5RLAA

Altering the binuclear manganese cluster of arginase diminishes thermostability and catalytic function
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
314
Chain Sequence
KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDNSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARGINASE
publication title Altering the binuclear manganese cluster of arginase diminishes thermostability and catalytic function.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 107
structure length 314
sequence length 314
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 1997-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 5rlaA00
3SJTA 1T5FA 2A0MA 4DZ4A 3LP7A 4RHQA 2EIVA 5HJAA 4ITYA 2EF4A 1P8QA 3SL0A 4Q41A 4MYNA 3E6VA 1T5GA 3MFWA 4FCKA 1WOGA 4Q3VA 1T4PA 3THJA 3GMZA 1ZPEA 1P8NA 4IE1A 4RHIA 3NIOA 3THHA 1WOHA 1CEVA 3NIPA 1P8RA 2CEVA 4Q3TA 4Q40A 3TH7A 1PQ3A 1GQ7A 3M1RA 1HQGA 1T4RA 2PHAA 4HXQA 4IXVA 4Q3UA 4MYFA 3DJ8A 4GSVA 3THEA 3NIQA 4RHLA 4GSZA 3SL1A 1GQ6A 4Q3RA 3E6KA 1P8SA 2RLAA 1P8OA 4MXRA 4Q42A 1R1OA 1D3VA 3TF3A 4G3HA 4Q3SA 2EF5A 2PHOA 3MJLA 1P8MA 4CEVA 1P8PA 1T4SA 3PZLA 4GSMA 3F80A 1TBJA 1HQXA 5HJ9A 4RHMA 2AEBA 4RHKA 4MYKA 3E8QA 3GN0A 3E9BA 1HQHA 4Q3QA 3CEVA 1HQ5A 4MYLA 3MFVA 1TA1A 3LHLA 2ZAVA 1WVBA 4IE3A 1RLAA 4Q3PA 4IXUA 4GWDA 4IE2A 1WOIA 4IU1A 5CEVA 1WVAA 3E8ZA 4IU0A 1ZPGA 4IU5A 3KV2A 4RHJA 2PLLA 1HQFA 1XFKA 4HWWA 4HZEA 4I06A 4Q3RC 3RLAA 1T4TA 5RLAA 4RLAA 4GWCA 3MMRA 3SKKA 1TBLA 3LP4A 4FCIA 4IU4A 1TBHA
chains in the Genus database with same CATH superfamily
3ZNSA 3SJTA 1T5FA 3MAXA 2A0MA 4CBYA 5G12A 4QA0A 4QA2A 4A69A 4DZ4A 3LP7A 4RHQA 2EIVA 4ZUQA 5HJAA 4ITYA 3F07A 2EF4A 5ICNB 1P8QA 3SL0A 3F0RA 5EF7A 4Q41A 4MYNA 2VQVA 3Q9BA 3E6VA 1T5GA 1C3SA 3MFWA 4FCKA 3SFHA 1WOGA 4Q3VA 1T4PA 5THVA 4BKXB 5EFNA 2V5XA 1C3PA 5G13A 5FCWA 3THJA 3EZPA 5DC5A 5EEFA 1T67A 3GMZA 3C10A 4QA6A 1ZPEA 1P8NA 4IE1A 4RHIA 3NIOA 5EFHA 3THHA 5JI5A 1WOHA 1CEVA 1ZZ0A 2VQWG 3NIPA 1P8RA 2CEVA 4Q3TA 4Q40A 5EFKB 3TH7A 3MZ7A 3EW8A 4CQFA 1PQ3A 3MZ6A 1GQ7A 3M1RA 1HQGA 3MZ4A 5D1CA 4ZUOA 5IX0A 1T4RA 1T64A 5EF8A 5THSA 5EEKA 2PHAA 4HXQA 5A2SA 5G0HA 1T69A 4ZURA 4IXVA 3Q9EA 4Q3UA 4CBTA 2VQQA 4MYFA 5EFJD 5LI3A 3DJ8A 4GSVA 3THEA 3NIQA 4RHLA 3C0ZA 4GSZA 5EEMA 1GQ6A 3SL1A 4Q3RA 3E6KA 5G17A 1VKGA 5G0XA 1P8SA 2RLAA 4RN1A 5EFBD 3C0YA 5G0YA 3SFFA 1P8OA 4MXRA 4Q42A 1R1OA 5EFGA 4BZ5A 1D3VA 4RN2A 4G3HA 3TF3A 4Q3SA 2EF5A 2PHOA 3MJLA 5THUA 1P8MA 4CEVA 1C3RA 1P8PA 4BZ9A 4ZUNA 1T4SA 3MENA 3PZLA 4GSMA 3F80A 5FUEA 1TBJA 1HQXA 5G11A 5HJ9A 5D1DA 4RHMA 5G0IA 2AEBA 2VQJA 4MYKA 3E8QA 4RHKA 5D1BA 3ZNRA 3GN0A 1W22A 5BWZA 3E9BA 1ZZ1A 4RN0A 1HQHA 2VQOA 4LY1A 5DC8A 4Q3QA 5EENA 3CEVA 1HQ5A 4MYLA 5DC7A 1TA1A 3MFVA 4LXZA 5G1BA 5G3WA 3LHLA 4QA4A 4QA3A 2ZAVA 3Q9FA 1WVBA 5THTA 3MZ3A 4IE3A 4BZ7A 1RLAA 4QA7A 4Q3PA 4IXUA 4GWDA 2VQMA 1WOIA 3Q9CA 4IE2A 4IU1A 4BZ6A 1WVAA 5CEVA 3E8ZA 5G0GA 4QA5A 2V5WA 4IU0A 5IWGA 2GH6A 1ZPGA 4IU5A 3EWFA 3KV2A 4RHJA 5G1CA 4QA1A 2PLLA 1HQFA 1XFKA 4HWWA 4HZEA 4I06A 5DC6A 4ZUPA 4Q3RC 3RLAA 5G1AA 1T4TA 3EZTA 5RLAA 5G0JA 3F06A 5G10A 4BZ8A 4RLAA 4GWCA 5EEIA 3MMRA 3SKKA 1TBLA 3LP4A 4FCIA 2VCGA 4IU4A 4ZUMA 3RQDA 1ZZ3A 1TBHA
chains in the Genus database with same CATH topology
3SJTA 1T5FA 2A0MA 4DZ4A 3LP7A 4RHQA 2EIVA 5HJAA 4ITYA 2EF4A 1P8QA 3SL0A 4Q41A 4MYNA 3E6VA 1T5GA 3MFWA 4FCKA 1WOGA 4Q3VA 1T4PA 3THJA 3GMZA 1ZPEA 1P8NA 4IE1A 4RHIA 3NIOA 3THHA 1WOHA 1CEVA 3NIPA 1P8RA 2CEVA 4Q3TA 4Q40A 3TH7A 1PQ3A 1GQ7A 3M1RA 1HQGA 1T4RA 2PHAA 4HXQA 4IXVA 4Q3UA 4MYFA 3DJ8A 4GSVA 3THEA 3NIQA 4RHLA 4GSZA 3SL1A 1GQ6A 4Q3RA 3E6KA 1P8SA 2RLAA 1P8OA 4MXRA 4Q42A 1R1OA 1D3VA 3TF3A 4G3HA 4Q3SA 2EF5A 2PHOA 3MJLA 1P8MA 4CEVA 1P8PA 1T4SA 3PZLA 4GSMA 3F80A 1TBJA 1HQXA 5HJ9A 4RHMA 2AEBA 4RHKA 4MYKA 3E8QA 3GN0A 3E9BA 1HQHA 4Q3QA 3CEVA 1HQ5A 4MYLA 3MFVA 1TA1A 3LHLA 2ZAVA 1WVBA 4IE3A 1RLAA 4Q3PA 4IXUA 4GWDA 4IE2A 1WOIA 4IU1A 5CEVA 1WVAA 3E8ZA 4IU0A 1ZPGA 4IU5A 3KV2A 4RHJA 2PLLA 1HQFA 1XFKA 4HWWA 4HZEA 4I06A 4Q3RC 3RLAA 1T4TA 5RLAA 4RLAA 4GWCA 3MMRA 3SKKA 1TBLA 3LP4A 4FCIA 4IU4A 1TBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJT A;  1T5F A;  2A0M A;  4DZ4 A;  3LP7 A;  4RHQ A;  2EIV A;  5HJA A;  4ITY A;  2EF4 A;  1P8Q A;  3SL0 A;  4Q41 A;  4MYN A;  3E6V A;  1T5G A;  3MFW A;  4FCK A;  1WOG A;  4Q3V A;  1T4P A;  3THJ A;  3GMZ A;  1ZPE A;  1P8N A;  4IE1 A;  4RHI A;  3NIO A;  3THH A;  1WOH A;  1CEV A;  3NIP A;  1P8R A;  2CEV A;  4Q3T A;  4Q40 A;  3TH7 A;  1PQ3 A;  1GQ7 A;  3M1R A;  1HQG A;  1T4R A;  2PHA A;  4HXQ A;  4IXV A;  4Q3U A;  4MYF A;  3DJ8 A;  4GSV A;  3THE A;  3NIQ A;  4RHL A;  4GSZ A;  3SL1 A;  1GQ6 A;  4Q3R A;  3E6K A;  1P8S A;  2RLA A;  1P8O A;  4MXR A;  4Q42 A;  1R1O A;  1D3V A;  3TF3 A;  4G3H A;  4Q3S A;  2EF5 A;  2PHO A;  3MJL A;  1P8M A;  4CEV A;  1P8P A;  1T4S A;  3PZL A;  4GSM A;  3F80 A;  1TBJ A;  1HQX A;  5HJ9 A;  4RHM A;  2AEB A;  4RHK A;  4MYK A;  3E8Q A;  3GN0 A;  3E9B A;  1HQH A;  4Q3Q A;  3CEV A;  1HQ5 A;  4MYL A;  3MFV A;  1TA1 A;  3LHL A;  2ZAV A;  1WVB A;  4IE3 A;  1RLA A;  4Q3P A;  4IXU A;  4GWD A;  4IE2 A;  1WOI A;  4IU1 A;  5CEV A;  1WVA A;  3E8Z A;  4IU0 A;  1ZPG A;  4IU5 A;  3KV2 A;  4RHJ A;  2PLL A;  1HQF A;  1XFK A;  4HWW A;  4HZE A;  4I06 A;  4Q3R C;  3RLA A;  1T4T A;  5RLA A;  4RLA A;  4GWC A;  3MMR A;  3SKK A;  1TBL A;  3LP4 A;  4FCI A;  4IU4 A;  1TBH A; 
#chains in the Genus database with same CATH topology
 3ZNS A;  3SJT A;  1T5F A;  3MAX A;  2A0M A;  4CBY A;  5G12 A;  4QA0 A;  4QA2 A;  4A69 A;  4DZ4 A;  3LP7 A;  4RHQ A;  2EIV A;  4ZUQ A;  5HJA A;  4ITY A;  3F07 A;  2EF4 A;  5ICN B;  1P8Q A;  3SL0 A;  3F0R A;  5EF7 A;  4Q41 A;  4MYN A;  2VQV A;  3Q9B A;  3E6V A;  1T5G A;  1C3S A;  3MFW A;  4FCK A;  3SFH A;  1WOG A;  4Q3V A;  1T4P A;  5THV A;  4BKX B;  5EFN A;  2V5X A;  1C3P A;  5G13 A;  5FCW A;  3THJ A;  3EZP A;  5DC5 A;  5EEF A;  1T67 A;  3GMZ A;  3C10 A;  4QA6 A;  1ZPE A;  1P8N A;  4IE1 A;  4RHI A;  3NIO A;  5EFH A;  3THH A;  5JI5 A;  1WOH A;  1CEV A;  1ZZ0 A;  2VQW G;  3NIP A;  1P8R A;  2CEV A;  4Q3T A;  4Q40 A;  5EFK B;  3TH7 A;  3MZ7 A;  3EW8 A;  4CQF A;  1PQ3 A;  3MZ6 A;  1GQ7 A;  3M1R A;  1HQG A;  3MZ4 A;  5D1C A;  4ZUO A;  5IX0 A;  1T4R A;  1T64 A;  5EF8 A;  5THS A;  5EEK A;  2PHA A;  4HXQ A;  5A2S A;  5G0H A;  1T69 A;  4ZUR A;  4IXV A;  3Q9E A;  4Q3U A;  4CBT A;  2VQQ A;  4MYF A;  5EFJ D;  5LI3 A;  3DJ8 A;  4GSV A;  3THE A;  3NIQ A;  4RHL A;  3C0Z A;  4GSZ A;  5EEM A;  1GQ6 A;  3SL1 A;  4Q3R A;  3E6K A;  5G17 A;  1VKG A;  5G0X A;  1P8S A;  2RLA A;  4RN1 A;  5EFB D;  3C0Y A;  5G0Y A;  3SFF A;  1P8O A;  4MXR A;  4Q42 A;  1R1O A;  5EFG A;  4BZ5 A;  1D3V A;  4RN2 A;  4G3H A;  3TF3 A;  4Q3S A;  2EF5 A;  2PHO A;  3MJL A;  5THU A;  1P8M A;  4CEV A;  1C3R A;  1P8P A;  4BZ9 A;  4ZUN A;  1T4S A;  3MEN A;  3PZL A;  4GSM A;  3F80 A;  5FUE A;  1TBJ A;  1HQX A;  5G11 A;  5HJ9 A;  5D1D A;  4RHM A;  5G0I A;  2AEB A;  2VQJ A;  4MYK A;  3E8Q A;  4RHK A;  5D1B A;  3ZNR A;  3GN0 A;  1W22 A;  5BWZ A;  3E9B A;  1ZZ1 A;  4RN0 A;  1HQH A;  2VQO A;  4LY1 A;  5DC8 A;  4Q3Q A;  5EEN A;  3CEV A;  1HQ5 A;  4MYL A;  5DC7 A;  1TA1 A;  3MFV A;  4LXZ A;  5G1B A;  5G3W A;  3LHL A;  4QA4 A;  4QA3 A;  2ZAV A;  3Q9F A;  1WVB A;  5THT A;  3MZ3 A;  4IE3 A;  4BZ7 A;  1RLA A;  4QA7 A;  4Q3P A;  4IXU A;  4GWD A;  2VQM A;  1WOI A;  3Q9C A;  4IE2 A;  4IU1 A;  4BZ6 A;  1WVA A;  5CEV A;  3E8Z A;  5G0G A;  4QA5 A;  2V5W A;  4IU0 A;  5IWG A;  2GH6 A;  1ZPG A;  4IU5 A;  3EWF A;  3KV2 A;  4RHJ A;  5G1C A;  4QA1 A;  2PLL A;  1HQF A;  1XFK A;  4HWW A;  4HZE A;  4I06 A;  5DC6 A;  4ZUP A;  4Q3R C;  3RLA A;  5G1A A;  1T4T A;  3EZT A;  5RLA A;  5G0J A;  3F06 A;  5G10 A;  4BZ8 A;  4RLA A;  4GWC A;  5EEI A;  3MMR A;  3SKK A;  1TBL A;  3LP4 A;  4FCI A;  2VCG A;  4IU4 A;  4ZUM A;  3RQD A;  1ZZ3 A;  1TBH A; 
#chains in the Genus database with same CATH homology
 3SJT A;  1T5F A;  2A0M A;  4DZ4 A;  3LP7 A;  4RHQ A;  2EIV A;  5HJA A;  4ITY A;  2EF4 A;  1P8Q A;  3SL0 A;  4Q41 A;  4MYN A;  3E6V A;  1T5G A;  3MFW A;  4FCK A;  1WOG A;  4Q3V A;  1T4P A;  3THJ A;  3GMZ A;  1ZPE A;  1P8N A;  4IE1 A;  4RHI A;  3NIO A;  3THH A;  1WOH A;  1CEV A;  3NIP A;  1P8R A;  2CEV A;  4Q3T A;  4Q40 A;  3TH7 A;  1PQ3 A;  1GQ7 A;  3M1R A;  1HQG A;  1T4R A;  2PHA A;  4HXQ A;  4IXV A;  4Q3U A;  4MYF A;  3DJ8 A;  4GSV A;  3THE A;  3NIQ A;  4RHL A;  4GSZ A;  3SL1 A;  1GQ6 A;  4Q3R A;  3E6K A;  1P8S A;  2RLA A;  1P8O A;  4MXR A;  4Q42 A;  1R1O A;  1D3V A;  3TF3 A;  4G3H A;  4Q3S A;  2EF5 A;  2PHO A;  3MJL A;  1P8M A;  4CEV A;  1P8P A;  1T4S A;  3PZL A;  4GSM A;  3F80 A;  1TBJ A;  1HQX A;  5HJ9 A;  4RHM A;  2AEB A;  4RHK A;  4MYK A;  3E8Q A;  3GN0 A;  3E9B A;  1HQH A;  4Q3Q A;  3CEV A;  1HQ5 A;  4MYL A;  3MFV A;  1TA1 A;  3LHL A;  2ZAV A;  1WVB A;  4IE3 A;  1RLA A;  4Q3P A;  4IXU A;  4GWD A;  4IE2 A;  1WOI A;  4IU1 A;  5CEV A;  1WVA A;  3E8Z A;  4IU0 A;  1ZPG A;  4IU5 A;  3KV2 A;  4RHJ A;  2PLL A;  1HQF A;  1XFK A;  4HWW A;  4HZE A;  4I06 A;  4Q3R C;  3RLA A;  1T4T A;  5RLA A;  4RLA A;  4GWC A;  3MMR A;  3SKK A;  1TBL A;  3LP4 A;  4FCI A;  4IU4 A;  1TBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...