5SGAE

Structures of product and inhibitor complexes of streptomyces griseus protease a at 1.8 angstroms resolution. a model for serine protease catalysis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
181
structure length
181
Chain Sequence
IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of product and inhibitor complexes of Streptomyces griseus protease A at 1.8 A resolution. A model for serine protease catalysis.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEINASE A (SGPA)
total genus 53
structure length 181
sequence length 181
ec nomenclature ec 3.4.21.80: Streptogrisin A.
pdb deposition date 1990-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5sgaE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5sgaE01
3TK6A 1MUEB 1THSH 2J92A 3HK3B 5DGJA 6GCHF 2BXTH 3ZVBA 1P2KA 2BMGB 1TBQH 5FAHA 1GDQA 1H9HE 1K21H 1LPZB 2FI4E 4Y6DA 3E1XB 3A81A 2ZO3H 3RXMA 3HKIB 4JYTA 3NKKA 4Q2KA 1GG6B 3V13A 1PPFE 1O3FA 1ZTLA 2VIDA 2BLWA 1DFPA 1RJXB 1UTMA 2OC8A 3M5LA 5DG6A 1BJVA 2A4GA 1C2FA 5L6NH 3NWUA 1ANEA 3U1IB 4LZ4B 1ARBA 3GCHB 2Z94A 1FY1A 4X1PU 1FAXA 2OC0A 3RU4D 3SI4H 2B0FA 4GCHF 2HPQH 1DX5M 1P9SA 1UJ1A 3U1JB 4Y76A 4E7NA 1C5LH 1OYTH 2ZDKA 4AGJA 1OPHB 4CR9A 3O8RA 8ESTE 2FOBA 1ANBA 3OX7U 1SGYE 3M7QA 1SLXB 1B0EA 5CHAC 1TPSA 1P10A 3S0NA 3MNBA 3UOUA 4IGDA 1NS3A 1B0FA 2Z9GA 1FY3A 3PYHA 1Z8JB 1FAKH 1V2TT 3PB1E 4I8HA 1WSSH 4FUEA 1MBMA 1V2RT 4YTAA 1Y3UA 4BOHA 1PQ8A 2FP7B 3LC3A 2JH5D 2EI6A 2VNTA 3Q76A 4OS5A 4AORA 1GJ5H 1UK4A 4OS2A 3DFJA 1DITH 1KTSB 4NA7A 1ZGIA 2TGAA 1GJ4H 1K28D 3A87A 2FWWA 5K7RA 5EOKA 5GJ4B 1MTVA 2ZGXH 4I31A 4X8UH 3MH7A 1UVUH 3TJNA 4K3JA 4MNXA 7ESTE 3SU6A 4H42U 4IW4E 2V6NA 3UUZA 2CMYA 3C27B 1D6WA 2BD9A 2ZHDA 1BA8B 3AASA 1BMNH 3H7TA 3LOXA 4K1SA 2G51A 1ZTJA 4CRCA 1AY6H 1A61H 1ZSLA 2NU1E 2EEKA 1Y3WA 2BY6X 2BLQA 1ELTA 1MMJN 1UMAH 1JRSA 1QB1A 4K5ZA 4UEHH 1EJNA 3UTUH 1LVMA 4ISIH 3LKWA 1C5NH 3D23A 2VH6A 3M37A 1VGCC 4K8BA 5DP8A 3VEQB 3SJKA 1Z6EA 1SLUB 3TJVA 1BTYA 1BJUA 4B76A 2AERH 3MHWU 1P11E 2AEIH 1TPPA 2HOBA 1ZPCA 2ALPA 1RTLA 1C2JA 1YLDA 3RXPA 1GBEA 3GDVA 2ZP0H 1P9UA 4WH8A 1GJ6A 1YPLH 2Y81A 5EXLA 4MPVA 3DD2H 4DIIH 1THPB 2BD4A 1Y5UT 4WH6A 2ZEBA 2P94A 3EGKH 4R0IA 3RXCA 1PJPA 1T31A 1AHTH 1YPMH 4ZHAA 4ESTE 2GZ8A 2ZFFH 8GCHF 1P3EA 4ABJA 3SGQE 1OX1A 4JYVH 1W10U 3ZZ5A 4ABGA 1GMHG 2UUYA 4E06H 2J94A 2ZDAH 4FUCA 3BTME 3A8CA 5ETXA 3A8DA 3W95A 1SGTA 2XC5A 3A7WA 1CHOF 4K1TA 5GPIB 5K0HA 5BRRE 1CT0E 1O2YA 3GY2A 1TPOA 1VJAU 5C20A 3ATKA 1PPCE 1TGCA 4GUXA 1V2JT 2XCFA 2NU4E 1O0DH 3K6YA 5HM2A 2WPIS 1JOUB 2ANMH 1YC0A 3MH5A 4X6OA 4X1SU 1OWIA 1NESE 5HMAA 1EJMA 2W7SA 1A2CH 1GHAG 1TLDA 3MNCA 2F9PA 1DM4B 2BQWB 2SGQE 3QWCH 4FU8A 2R2WU 1FIZA 3SV9A 3ELAH 4AOQA 1ARCA 1BMMH 1HJ8A 2GP9B 3BEUA 4PROA 1C2MA 3TVJB 3PTNA 2CGAA 3V0XA 2VWLA 1GMHF 1NRSH 4K69A 2FI5E 4B2BA 1W0ZU 1V2VT 3K2UA 4Y79A 2GV7A 3SGBE 1G36A 4Q7XA 1VITG 5C3NA 3UR6A 1GBAA 1P2JA 4TWYA 3RXJA 4R8TB 1O5EH 3BG4C 4JCNA 2RA3A 1FXYA 2EI7A 4A7IB 4NSYA 5GXPA 1RFNA 2F3CE 3RLWH 3ZZ3A 1AU8A 4ZHLU 5G4BA 2UWPA 1ZTKA 4XBCA 2FOFA 4AB8A 2D8WA 1O39A 1SR5C 4BAOB 1ACBE 2FOAA 1IQEA 1ZYOA 4NZQA 1O5AB 4YM9A 1GHAF 1P2OA 1GWAA 4WXVA 2C93B 1C5SA 1BQYA 1Z1JA 4CBNA 2W3KA 2C8YB 1DXWA 1AWHB 1UVOA 2WPJS 4YLQH 2Z6BD 4X0WU 4FU9A 1ID5H 4NG9H 1A0HB 4IBLH 4X8TH 1PPZA 2SNVA 1E38B 1MCVA 2P95A 1NC6A 1XKBC 1O3KA 3BSQA 3SV6A 1L4DA 3QO6A 3P8FA 1O3MA 2Z3EA 2VWMA 4XDEA 3F9HA 1FY5A 1RIWC 3IWMA 1UVTH 1A5GH 4BANB 1OWEA 2ZDVH 2GX4A 3A7ZA 3MH4A 1ANDA 3O8CA 1O2OA 2G8TA 1TBZH 4ISNA 2GMTC 1HAIH 2FO9A 4DOQA 3A83A 2A4OA 2QIQA 4FU7A 3ODFA 3SORA 2STBE 3ESTA 1SGNE 5HXFA 1B7XB 2ZIQH 1Y59T 3KCGH 1O3LA 2VU8E 1DICA 4JMYA 3SJIA 5BPEA 3U98H 4Y10E 2OBQA 2CJIA 5DP4A 2EC9H 3MTYA 2FX6A 3UR9A 3CS7A 2FLBH 2UUKB 4I8LA 4WVPE 4Y71A 4H4FA 1K22H 4U30A 1E0FD 3V12A 1SOZA 1O33A 2ZG0H 1GGDC 2YNBA 2FOEA 1TALA 1S5SA 4NFEA 1BRUP 1NT1A 1DXPA 3UIRA 1AZ8A 1MZAA 1SGIB 2AH4X 3V7TA 1BTHH 1CO7E 1Y3YA 1GCTB 1RS0A 1PQAA 3LONA 2P3UB 3RM0H 1IQLA 2SGPE 3BG4B 3UFAA 4XSKU 1Y8TA 1GI0A 4INHA 1OWHA 4SGBE 3A82A 3A84A 3EE0B 1GJ8B 1W8BH 5FPSA 1GI3A 1S83A 1EP5A 5FBIA 1P02A 2ZC9H 4HGCA 1GBTA 3SHCH 1BBRK 3SQHE 4ISLA 4WMEA 4Y7BA 1XVMA 3M3VA 1O3NA 1UTPA 4DVAU 2PLXA 1BTWA 1JIMA 1ZHPA 3NUMA 4TYDA 1TGBA 1YGCH 2HALA 2ODQA 1PPEE 2W7UA 5L2ZH 1ELEE 5EW1H 2FESH 2P59A 4Q80A 1V3XA 5C5NA 5EODA 2SGDE 1D3QB 1L0ZA 1BITA 4B74A 3P95A 3FZDA 1T8NA 1PPGE 3E90B 4J2YB 2A0QB 5GDSH 1G2LA 1HAVB 1KXBA 4NCYA 3UNRA 3MI4A 3MOCA 2FM2A 3U8TH 3ATMA 1QIXB 3EA7A 3RXOA 2VWOA 1NU9A 4Q7YA 3SUGA 1V2OT 1O2VA 1G3BA 1ELFA 5EGMA 2ZQ1A 1ZSJA 3B23B 3BN9A 3ZVDA 1Q2WA 1KLJH 4U01A 1OKXA 1TGSZ 2PSXA 1GBHA 6GCHG 1ELCA 3OU0A 1PYTD 2SNWA 2FTMA 1FPHH 3A86A 3F1SB 2TGTA 1F92A 1P12E 4ISOA 3KF2A 4BTTB 2FEQH 3K9XB 1O3PB 3BF6H 2B5TB 4UFDH 2HNTF 4DURA 2I6SA 3TLOA 1EASA 3GDUA 1CT4E 3STIA 4D76A 1SQOA 3RXTA 2TRMA 4BAKB 5E0GA 4XBBA 4MNYA 1QB6A 2OBOA 3KQCA 1EAWA 1TX6A 2FPZA 4GHTA 1L2EA 4AN7A 2IOTA 1KXFA 3EA8A 5EW2H 6LPRA 2XNIA 1HAGE 1KY9A 3RXIA 2IN2A 1EUFA 2PUQH 5DP5A 1ELBA 1IAUA 3PMHB 4X8SH 4BAMB 1YPJH 4I32A 1QHRB 4MDSA 2ZFQH 4X1RU 2VB0A 7LPRA 3T2NA 1W7GH 1O5BB 1D3DB 1A3BH 2A5AA 2UWLA 2XBVA 4XFQA 2QF3A 3LPRA 5FXLA 2GGVB 3LDXH 4RKOB 2TBSA 3RMNH 1QCPA 4CREA 1AFQB 5EQSA 4Y8YA 2FOCA 3QN7A 1QBNA 1JWTA 1ABIH 2BOHB 1Y5AT 1MKXH 5I25A 2HVXA 3OSYA 1PPHE 3ATIA 3QK1A 1FONA 1ZJKA 4DG4A 2CV3A 2TGPZ 1O3IA 5CHAB 1P04A 1TNJA 2WPLS 1H4WA 5DO4H 4UFEH 2RG3A 1GBKA 4MPXA 4XE4A 2PFEA 1EATA 1T7CA 1C5WB 2J4IA 1MU8B 1GDUA 2AMDA 3RXDA 1YCPH 3MU0A 1L1JA 2G4UA 1ESAA 3U8OH 2OC1A 1CE5A 1FUJA 2BD8A 3MWIU 2BY9X 1TBRH 1C4V2 2HPPH 1L1GA 3SNEA 4Y8ZA 4AYYB 1ELDE 3RXHA 1HJAC 1S6HA 3SUEA 3RXFA 1C1UH 1L4ZA 2WPMS 2VIVA 1CA0C 4IN1A 2THFB 1FY4A 2AMQA 1DOJA 2IPHA 1NU7B 4OGXA 1GG6C 5TCCA 2OCVB 2Z3DA 3VB6A 2VIOA 1BZXE 1S0QA 3ZYDA 3E6PH 2GZ9A 3OY6U 1UTOA 4I8JA 2EI8A 3KQDA 5J4QA 1GJ7B 5A8ZA 4DGJA 3BTQE 1TNKA 1C5RA 3A7VA 1F0RA 1JIRA 1RGQA 1OWJA 1MH0A 1QTFA 1TAWA 3MH6A 1ZGVA 3GCOA 3RXAA 4JZ1A 4IMZA 4K1EA 5AF9H 1TFXA 2BD5A 2P3FH 1P03A 1T4UH 1G37A 3ZV9A 1W3CA 1NFWA 1ZPZA 1QNJA 2FX4A 3RXLA 3KEEA 3NZIA 4D9RA 1N8OC 1F2SE 3K65B 2ZTXA 1GHZA 2PKAA 2GCTB 1O3OA 3SJ9A 1CU1A 1XVOA 5C67A 3LGIA 1O2XA 1CGJE 1UCYK 3QGNB 3RXBA 3T5FH 5LPEA 1TIOA 2BZ6H 1CQQA 3ZVCA 2TGDA 1F5RA 1V2UT 4CBOA 2EA3A 2O8MA 1AB9C 1TB6H 1DUEA 1ZHMA 2D26C 1SLWB 1KLTA 4ZMAH 1MU6B 3ODDA 3E8LA 1O2HA 2C8ZB 1SQTA 1GI5A 1XUKA 2W5EA 3TGIE 2ZGJA 1SSXA 3OY5U 1S0RA 3SU0A 3LGVA 3AW1A 1TOMH 2Z9KA 1O3JA 1GHBG 1ZHRA 4KELA 3DA9B 4Y0ZE 2WV4A 2BY5X 3T28A 4FUJA 1G30B 4UONA 2WUBA 1GJAB 1H8DH 4U2WA 2WPKS 4KP0A 1HIAB 1FJSA 1QRWA 5EPYA 1D3TB 1LHGH 3RM2H 2H1UA 2ZDNA 3RXUA 2W26A 1T8OA 2ZU1A 1QFKH 3PM3A 1AFEH 1TGTA 1EPTA 1XUFA 7GCHG 3MNXA 2VINA 1DWCH 1QA7A 3GOVB 1GI7B 5LGOA 2QGRA 2ZHEH 3ZZ4A 1XKAC 3L33A 4J1YA 1C5MD 3KN2A 1WYKA 1GMDG 4NA9H 5DK1A 2Z9LA 2GT7A 2Y7XA 5GWZA 1SVPA 4WXIA 4AG1A 1UHBA 3T62A 3RMLH 3LJJA 1EB1H 4JZDH 3PV4A 3KHVA 1C5OH 1AMHA 3K6ZA 1Y3VA 1RXPA 3RXKA 3FANA 2F9UA 3A80A 4CHAB 2STAE 1P2NA 5E0HA 3LIWA 3TPIZ 3ENSB 2ZU4A 2DE9A 1A1RA 3GICB 2FXRA 1YLCA 2A4QA 2ZZUH 1GHBF 2BHGA 4XBDA 4FVDA 1UVSH 2PTCE 4KTCA 1D3PB 1O32A 2VGCC 2C8XB 2J38A 2A45B 1N6YA 3URCA 2A31A 1QGFA 3P70B 2G00A 1LHDH 1MD8A 1F5KU 8LPRA 3QZQA 4IC6A 3E0PB 2FTLE 4CH8B 4DIHH 2ZNKH 3UOPA 4X1QU 4ABHA 1TRYA 4D7GA 5L30H 1YCPK 2XRCA 3VGCC 2A2XH 4ASHA 2PKSB 3BTKE 5TCAA 1HPGA 1HXEH 3GY5A 1HAVA 2B7DH 3ZZ6A 2GMTB 4MQAA 1TNLA 1WV7H 1B5GH 3S7KB 1FIWA 3ZYEA 1C1WH 1YBWA 1HDTH 1J8AA 5C1YA 3GY7A 3QTVH 1LCYA 4GVUA 4FUDA 4A1XA 2BDBA 1GBJA 1UK3A 1HYLA 1CA8B 3T26A 2C4FH 2ZCHP 1YCPM 4VGCB 3SU2A 1X7AC 4JK5A 4IMQA 1O35A 1QJ7B 2VIQA 1TYNA 1KDQB 2PWXA 2FDAA 1O2IA 1EP6A 1BTZA 4Z6AH 1AO5A 5EQQA 1Q31A 1AE8H 4ZH8A 2QAAA 4BAHB 1ZLRA 3SU5A 1TABE 5ESBA 4ZROA 3V3MA 2Q6DA 3WY8A 2FI3E 3FVFB 1Z8RA 4HZHA 1GVLA 5JBBS 1BHXB 2GDDA 3RMOH 3SNDA 2FODA 1C1OA 1KIGH 1VJ9U 2XWAA 4K60A 1ZRBA 1OP2A 5JPMH 4UE7H 1TWXB 2K1QA 1WQVH 3VB5A 4FUFA 1XXDA 1GCTC 4ZUHA 5C1UA 1W14U 1EAUA 1XUGA 4JZIA 4U32A 4ABFA 5F8TA 2WUCA 1SL3A 1IQHA 3RDZA 1WTGH 3RXRA 1YKTA 3SU3A 2ODYB 4B73A 3M36A 2A4RA 5IDKA 1XXFA 3DFLA 4ZKNU 1LHEH 2B9LA 2WYGA 3F9FA 2OINA 3ATLA 1AIXH 3QGJA 3VB3A 2BM2A 4AB9A 1BB0B 5E2OA 1O2WA 1A5HA 3GCTG 4FXGH 1SGRE 4LXBH 1TQ0B 3P8NA 5FCRA 2VWNA 1C1MA 4A1TA 3GY6A 3UNSA 1HNEE 2ALVA 3TGJE 1O2GH 1Z8IB 1C9PA 2BY8X 4BTUB 5C2ZA 1V2PT 1U6QA 4CH2B 2ZDMA 1FDPA 2PR3A 1SGFA 2OD3B 2QN5T 1N1LA 1XM1A 4IN2A 1SHHB 2ULLA 1C2KA 1UVPA 1KDQA 1G32B 2V0BA 2BXUH 3HATH 3P92A 3QX5H 5EXMA 3RP2A 2HNTE 2FYQA 1TA2A 4FUGA 3ITIA 5A0AE 1C2DA 1A46H 2GT8A 3O8BA 3SV7A 3PWCA 1LMWB 2GCHG 3A89A 1C1SA 1J17T 3VXEH 1BMLA 4HFPB 1V2QT 2F9OA 5AVDA 2ZU5A 4RKJB 1TRMA 5A0BA 3MO3A 4X8VH 2ASUB 3TGKE 4AYVB 2LPRA 1C5QA 1YPKH 1A0JA 1P0SH 2NU2E 3DHKH 2G52A 1WUNH 4K8YA 2AIQA 2QY0B 1EX3A 2G81E 2KAIA 3VB7A 1J15A 1TQ7B 3BTWE 3FFGA 1OSSA 2UUJB 2DE8A 2TPIZ 1BBRE 1H9LB 5T6FA 4HI3A 2XC0A 1QJ6B 1YM0A 3HPTB 2VGCB 3Q3KA 1SMFE 1BMAA 3BEFB 1IQKA 1GHWH 1AWFH 3B9FH 1ELAA 3L6PA 3LC5A 4NWLA 2GCHF 3PO1C 1RRKA 1LQEA 1AI8H 1H8IH 3EYDA 2SFAA 3F9GA 4NSVA 1GHVH 3RXVA 2GVFA 3TIUA 4ZKRU 2XWBI 4SGAE 3UPEA 1QB9A 1M9UA 4YESB 3B8JA 2B8OH 1NM6A 2PSYA 2C90B 3A85A 3VPKA 4E7RG 4ZXYH 2OLGA 4K2YA 1K1MA 5FPTA 4INLA 2Z9IA 1CBWB 3F6UH 1S82A 3RC5A 2VH0A 2O8TA 4B2CA 1C4U2 3U8RH 1IHTH 2C8WB 1GBIA 2JETB 4X2YA 1QBVH 1EOJA 3LGTA 1NN6A 1SFIA 1UTNA 4X1NU 1O2MA 1QQ4A 9LPRA 1MQ5A 3SV2H 2WV5A 1MTNB 2J9NA 5DP3A 1T4VH 1HAZB 2ZKSA 3IITA 2A7JA 2AMPA 1O2RA 3BG8A 3TITA 2BVRH 1G9IE 1EQ9A 1H1BA 1MD7A 1QA0A 1GCDA 2BDAA 2XXLA 5FX6A 1BOQA 2AGIX 4AGKA 4JYUH 5TJXA 4CRBA 1A7SA 1HBTH 3EAJA 4WWYA 1KXEA 2BTCE 2XW9A 4INKA 1MTWA 2BDYA 2XBYA 4ZHMU 1DSTA 1O38A 1TGNA 1O5DH 1XMNB 2Z7FE 1D4PB 5A8XA 1UK2A 3LGUA 2FMJA 4QT8C 5LPFA 2WINI 4X2XA 3PLPA 1ZMLA 2F91A 2HLCA 1O2NA 4OS1A 4MTBA 2I6QA 2ZFTA 3M7TA 1HAHH 2QYIA 3I78A 1HAOH 4MVNA 3RUOA 2ZFPH 1IHSH 1O2PA 4O3TA 4YT6H 1J9CH 1GBCA 1HFDA 2ZTYA 3ZZDA 2AS9A 3FP8E 3U69H 2F9VA 4I8GA 1N6XA 1ZSKA 1DLEA 5T6GA 2ZPQA 1DT2A 1AB9B 4O9VA 2M5TA 1GBBA 4ABAA 3GY3A 3G01A 1WBGB 3SW2B 3M3TA 3TK5A 4BAQB 2QA9E 1P09A 3EQ0H 1BIOA 2V3OH 5AHGH 1AE5A 1CGHA 2NU3E 2NU0E 1OP0A 2Y5GA 3AW0A 3CS0A 2Q6GA 1W12U 1IQJA 1K1PA 2GCTC 1F0UA 2GD4B 1MCTA 1UTKA 1GBFA 3NXPA 3S9BA 4Z0KA 1KYNA 1DSUA 1ZPBA 4MNVA 1AVXA 1HAYB 2NWNA 1Q3XA 1V2MT 1GDNA 2SGAA 1O2JA 2R3UA 3HGPA 4ABIA 1A4WH 3BTGE 3A7YA 4E05H 1QL9A 5C1XA 2A32A 2BD2A 2VIWA 2ESTE 2OQUA 5F8ZA 2AYWA 5EQRA 1O37A 3RXEA 5CE1A 2ZDLA 1IQMA 3GISB 4Q7ZA 2AGEX 2F9NA 2ZHFH 1AZZA 1NFXA 2A5KA 1IQFA 1O2UA 1C1VH 3FAOA 1Y5BT 1DUAA 1LKAA 5DPAA 3L3TA 3SQEE 1SGDE 1NRNH 4D8NA 1BRAA 2AIPA 1S85A 2A5IA 3AVZA 1WTHD 1KSNA 1FNIA 2UWOA 5DP6A 2R0KA 3T27A 1MKWH 2O8WA 1DWBH 4NWKA 2BVSH 2P8OB 1ZZZA 4GSOA 2Y80A 1AKSA 1VZQH 2H9TH 5IYTA 1UTLM 3SUFA 1SFQB 4OS4A 4CR5A 1E34B 4YO9A 1ELVA 1NPMA 2P16A 6CHAB 3SU4A 1EJAA 2PTNA 2WYJA 3GY4A 4M7GA 1O36A 3GCTF 1GMDF 4F4OC 3M5NA 1GI1A 1W2KH 1EZQA 1SLVB 1BRBE 1F0TA 1DWEH 2AFQB 4YLUA 1CHOG 1EOLA 1NRQH 1TMUH 1XUIA 1V2WT 3GCNA 2BLOA 2O8LA 2OUAA 1TONA 3SOSA 2XBWA 4F49A 4LOYH 3EDXB 5E0JA 5FCKA 3NK8A 5E2PA 1J14A 4HTCH 5DJ7A 1GHYH 1UCYE 4Y11E 4BNRA 3C1KA 2BB4A 2BQ7B 3PLBA 4NA8A 1YF4A 1EXFA 1GI6A 1MKXK 3ZV8A 1YPEH 1MTSA 1ZRKA 2PHBA 3AAVA 2GTBA 3SGAE 3LH3A 5ESTE 2R0LA 1SBWA 1GL1A 4TWWA 3KL6A 1BRCE 2G5VA 3UQVA 1V2KT 4OGYA 1FN8A 5A0CA 1AQ7A 5JBTA 1K9OE 1YYY1 3S9CA 3SNAA 1AVGH 2ZCLP 1MTNC 2P3TB 3LH1A 2BOKA 4TPIZ 3BTFE 4AFUA 1WOFA 3TH4H 5T6DA 2Y6TA 2CXVA 3I77A 1FMGA 3TU7H 2RCEA 1JRTA 4A1VA 2ZFRH 1HGTH 1WAYB 1SGEE 3T25A 1O3HA 1OWDA 1TNGA 4AFZA 1C5ZB 3M35A 3FZZA 4MLFB 1BTXA 1KXDA 2FOGA 3AAUA 1D9IA 2HGTH 2KAIB 4UFFH 1G3DA 4NIWA 3SHAH 4VGCC 5C5OA 1TX8A 4B71A 5LH8A 3DT0H 3GYLB 3W94A 1LTOA 4KTSA 4CHAC 5JBCS 1NRRH 4O03A 1GJDB 3Q3YA 1GMCF 1ESBA 3ZVFA 1E35B 4THNH 2JH6D 3MU1A 1HAPH 1C1QA 4YOGA 1J16A 4MPWA 2P8OC 1ZR0A 3QUMP 9ESTA 5JB9S 5AFYH 1FPCH 1UTJA 5A2MH 1G3CA 1T32A 3D62A 3TNSA 1RTKA 1THRH 1GI2A 2D1JA 3ZZCA 1O5GH 2QXJA 4KKDA 1NTPA 2CN0H 4B75A 3RU4E 3NPSA 1LHCH 4WMDA 5DKMA 3BTHE 3STJA 5CMXH 3SV8A 1OP8A 2O8UA 1O3CA 4XOJA 2QXHA 1O2SA 1DDJA 1JMOH 3SI3H 2RA0A 1DS2E 1QL8A 1K1JA 1P2MA 2PV9B 3RC6A 1N8OB 1O2KA 1OXGA 3M5MA 2ZHWH 1IQIA 1RD3B 2ZECA 4NGAH 2BDIA 1CGIE 3VB4A 3U9AH 2Q6FA 1HUTH 4Y8XA 1P2QA 1QRXA 2O9QA 3ZVAA 2ZQ2A 3SZNA 3SN8A 1O30A 2V35A 4KTUA 1CT2E 2PUXB 5HGGA 2XYAA 1WU1A 2GV6A 1C5PA 1L1NA 2LNCA 4AFSA 2FIRH 1CA0B 3M7UA 1SB1H 4JK6A 1VCQA 4H6TA 4CRFA 3TH2H 1S84A 1Z7KA 1LPKB 3D65E 3E0NB 2OQ5A 4BTIB 3OYPA 4OS6A 1SG8B 1DANH 1YPHC 4RN6A 3TH3H 1W0YH 4GHQA 2BY7X 2CHAC 2JKHA 2QV1A 3ZZ8A 1AN1E 5HM9A 4ABBA 3JZ1B 1EPTC 2ZFSA 3R3GB 1QJ1B 1S6FA 2OXSA 2JH0D 3S7HB 1OYQA 4X6NA 1PYTC 1W13U 2IJOB 3RXSA 4NIYA 4RSPA 4GCHG 4TPYA 1C5XB 1GGDB 3SO3A 2ILNA 1ZMNA 1SI5H 1VITH 1VGCB 1GL0E 4YZUA 1SGQE 2FZZA 8KME2 5B6OA 4A6LA 1SGPE 3A8BA 1O2TA 1F7ZA 4IS5A 2ZGBH 3KGPA 1BTPA 1ZOMA 2VVUA 1P3CA 1RIWB 1LQDB 1A0LA 1C5VA 1OOKB 3BEIB 3E3TA 1GBLA 2SGEE 1MZDA 3T29A 2XBXA 5A8YA 1UO6A 4BXSA 4I8KA 2W3IA 3A7TA 1C2GA 1NFYA 1Z71A 1O2ZA 3E16B 2FLRH 1MQ6A 3IG6B 4A5TS 3QZRA 1VCPA 6ESTA 3UREA 1C5UA 3JZ2B 4X2VA 3BTEE 3UWIA 3MO6A 4AX9H 3SUDA 1WQSA 1QY6A 1FN6A 2V3HH 3PWBA 1V2LT 4MNWA 3TNTA 1LVYA 1TA6A 1D6RA 2QCYA 4AFQA 5F8XA 1HCGA 1HB0B 1EKBB 3LJOA 5T3HA 1AD8H 1IQGA 3QDZB 3MO9A 1DPOA 2XTTB 1V2NT 2ZHQH 3A8AA 5I46H 4GAWA 1HXFH 1UHBB 1QRZA 3VGCB 3QLPH 4MG3A 1FZZA 7KMEH 4B2AA 1VCWA 3N7OA 2ZPSA 4B1TA 2FS9A 3ZVEA 2H5DA 5EG4A 1O3BA 1G2MA 3S69A 1SQAA 1O3AA 1SGCA 3ZZ9A 3O8DA 3M3SA 5FHTA 1ZJDA 1AUTC 4FUIA 2H2ZA 5JB8S 3Q77A 4DW2U 1QURH 4JZEH 1O3EA 2Y5HA 3KQEA 1E36B 2CHAB 1AUJA 5FBEA 1IQNA 3GCHC 3PMJA 3MU4A 2F9BH 2PGBB 1RTFB 1ETTH 2BYAX 4ZKOU 3SNBA 4UDWH 5SGAE 3RU4T 1AKSB 1DY8A 3SBKA 1O2QA 2H6MA 3BTDE 5JBAS 1C5YB 2G4TA 4NIXA 1P01A 4TY7A 2BDHA 2SGFE 3I29A 1O3GA 1HJ9A 5E8EH 3PTBA 1O31A 1C2EA 3DUXH 1W11U 4JZFH 4CRGA 3PMAB 1V6DA 2BX4A 2Z9JA 3F68H 1O5CB 3HKJB 1XUHA 1LO6A 1O2LA 2G55A 1C2IA 1XUJA 2YNAA 2A7HA 2ZPRA 1FQ3A 5PTPA 4YT7H 2ODPA 1QL7A 1C2LA 1QQUA 2BX3A 3MMGA 1VR1H 5A09A 1CBWC 1SGFG 1KTTB 1GI4A 5JYIA 1K1IA 3EA9A 1OWKA 1PQ5A 3H5CB 2XC4A 3MFJA 2Y7ZA 2YOLA 3P6ZB 3TJOA 2BD7A 4NFFA 1MTUA 1TX7A 1O5FH 3UNQA 1LVOA 4X2WA 1XX9A 3MU8A 2R3YA 1BT7A 1ANCA 5F6MA 2PKAB 2FOHA 4I33A 1S81A 4GLYA 1WCZA 4DCDA 2P93A 1O34A 1FI8A 2VVVA 1IOEA 2Z3CA 1HV7A 4WJG2 2ZTZA 1KXCA 3BIUH 4ZKSU 1DE7H 1C1RA 1A5IA 3SU1A 2OTVA 2AGGX 1VITF 2BLVA 2ANYA 1LHFH 2BVXH 3P8GA 2H9HA 3PROA 1EPTB 2BD3A 3ZZBA 5HYOA 3BTTE 1T8MA 1UCYH 1SOTA 1ETSH 2CF8H 5EPNA 2ZGCA 1KLIH 3NCLA 2VVCA 2OC7A 4UFGH 2VJ1A 2ZWLH 4O97A 1LPGB 2D2DA 1EZXC 1F5LA 1CSOE 1QR3E 1SC8U 1BBRH 1FV9A 1DLKB 2Q1JA 4ISHH 5DP9A 1Z8GA 4FUHA 2C3SA 4IC5A 5FX5A 2XCNA 4MPUA 1CHGA 4O3UA 3S9AA 1GPZA 2R2MB 1HRTH 4KGAA 5DP7A 1FY8E 2F83A 3P8OA 2WPHS 1K2I1 1EZUC 3P17H 4AZ2B 1GBMA 3PLKA 2G5NA 3F9EA 6CHAC 1P8VC 3A7XA 1GJCB 1JXPA 4TY6A 1BTUA 1GI8B 1C1PA 1EZSC 2FOMB 3CENA 3RLYH 2GDEH 2HRVA 1H9IE 3FP7E 3CP7A 5GCHG 1DY9A 4D7FA 3UY9A 2VIPA 7GCHF 1K1OA 1GVZA 3HGNA 1C1NA 5F03A 2UUFB 4A92A 2QC2A 2PW8H 1TMBH 3KQBA 4ABEA 2BZAA 2GZ7A 3D49H 3ZZAA 1ORFA 1Z6JH 1T8LA 4Y7AA 1PFXC 1HLTH 5ABWA 1CVWH 1SHYA 5L2YH 1C2HA 3RC4A 2J95A 2TIOA 1FLEE 2A2QH 4YOJA 3MU5A 3KIDU 4LK4A 1TRNA 4CRAA 2ZU2A 3ZVGA 1C9TA 3GDSA 3ZZ7A 1Z1IA 1EAIA 2CF9H 1HJAB 1F0SA 3GYMA 1QBOA 2PGQB 2ZGHA 1ETRH 1UTQA 3A88A 3RMMH 3FP6E 1KXAA 1YPHE 2J34A 8GCHG 2ZI2H 3BV9B 4Y0YE 2BDGA 2GKVE 2ZF0H 2BDCA 2A1DB 4GPGA 3VFEA 4DJZB 1K1LA 2QF0A 4DY7B 2RDLA 1MBQA 3GY8A 4UD9H 1MKWK 1YP9A 1JBUH 1EAXA 5EU8A 1A3EH 1P2IA 3R0FA 1BHXF 2ZCKP 2H9EH 1PQ7A 2ZA5A 1BUIA 2Y82A 1GHXH 1GMCG 3TK9A 2HWLB 3E91A 5J4SA 1MAXA 3LGYA 4ABDA 4NIVA 1LDTT 1TNHA 1C1TA 1INCA 3VXFH 1YPGH 1NROH 5JDUB 3QTOH 1NY22 3HK6B 1W7XH 5GCHF 1SPJA 1G3EA 2R9PA 4AG2A 5FPYA 1NO9H 1ESTA 1TMTH 4WF8A 4NZLA 3UQOA 3M5OA 4D9QA 1C5TA 1P06A 1DWDH 1LVBA 1OS8A 4X6PA 4DT7B 1C4Y2 1LKBA 2FYRA 1TNIA 1AGJA 1P57B 3URDA 1HIAA 2A7CA 1BCUH 1ABJH 2QXIA 3PO1B 3SJ8A 3SJOA 2ANKH 1MAYA 1GBDA 3SNCA 3RXQA 1PPBH 2FS8A 1E37B 2J2UA 2ANWA 4WY3A 1GJ9B 5LPRA 1HAXB 4YOIA 1BDAA 1AFQC 4I7YH 3PMBB 3Q00A 4ZAEA 3MNSA 3LGWA 1NRPH 1EB2A 1ZMJA 4FVBA 2DUCA 3KNXA 5H4IB 2BQ6B 4FUBA 4BXWA 1NFUA 3UWJH 4X6MA 2OP9A 3LT3A 1DVAH 1ELGA 1GJBB 1Y3XA 2JETC 1GI9B 2QXGA 3H7OA 3OTJE 3RXGA 3LU9B 3MYWA 1GVKB 2ZU3A 2HNTC 5GIBA 1TOCB 3BIVH 1NZQH 1K1NA 5EXNA 5AFZH 2H5CA 3Q3XA 1O3DA 1V2ST 1AVWA 3ATWA 4LZ1H 4H6SB 4WMFA 1P05A 4CRDA 1TPAE 2PKSC 3M61U 1TE0A 2Y5FA 3TJUA 4OS7A 4ZXXH
chains in the Genus database with same CATH superfamily
3TK6A 1MUEB 1THSH 4Z1MD 2J92A 3HK3B 5DGJA 6GCHF 2BXTH 3ZVBA 1P2KA 2BMGB 1TBQH 5FAHA 1GDQA 1H9HE 1K21H 1LPZB 2FI4E 4Y6DA 3E1XB 3A81A 2ZO3H 3RXMA 3HKIB 4JYTA 3NKKA 4Q2KA 1GG6B 3V13A 1PPFE 1O3FA 1ZTLA 2VIDA 1FX0B 2BLWA 1DFPA 1RJXB 1UTMA 2OC8A 3M5LA 5DG6A 1BJVA 2A4GA 1C2FA 5L6NH 3NWUA 1ANEA 3U1IB 4LZ4B 1ARBA 3GCHB 2Z94A 1FY1A 5CHBA 4X1PU 1FAXA 2OC0A 3RU4D 5EJLA 3SI4H 2B0FA 4GCHF 2HPQH 1DX5M 1P9SA 3PRBA 1UJ1A 3U1JB 3F0PA 4Y76A 4E7NA 3WWBA 1C5LH 1OYTH 2ZDKA 4AGJA 1OPHB 4CR9A 3O8RA 8ESTE 2FOBA 1ANBA 3OX7U 5B6LA 1SGYE 3M7QA 1SLXB 1B0EA 5CHAC 1TPSA 1P10A 3S0NA 3MNBA 3UOUA 4IGDA 1NS3A 1B0FA 2Z9GA 1E1QD 1FY3A 3PYHA 1Z8JB 1FAKH 1V2TT 3PB1E 4I8HA 3FO8D 1WSSH 4FUEA 1WXRA 1MBMA 1V2RT 4YTAA 1Y3UA 4BOHA 1PQ8A 2FP7B 3LC3A 2JH5D 2EI6A 2VNTA 3Q76A 4OS5A 4AORA 1GJ5H 1UK4A 4OS2A 3DFJA 1DITH 1KTSB 4NA7A 1ZGIA 2TGAA 1GJ4H 5C0UA 1K28D 3A87A 2FWWA 5K7RA 5EOKA 5DSFA 5GJ4B 1MTVA 2ZGXH 4I31A 4X8UH 3MH7A 1UVUH 3TJNA 4K3JA 4MNXA 7ESTE 3SU6A 4H42U 4IW4E 2V6NA 3UUZA 4AC9A 2CMYA 3C27B 1D6WA 2BD9A 2ZHDA 1BA8B 3AASA 1BMNH 3H7TA 3LOXA 4K1SA 2G51A 1ZTJA 4CRCA 1AY6H 3N7DA 1A61H 1ZSLA 2NU1E 2EEKA 1Y3WA 2BY6X 2BLQA 1ELTA 1MMJN 1UMAH 1JRSA 1QB1A 4K5ZA 4UEHH 1EJNA 3UTUH 1LVMA 4ISIH 3LKWA 1C5NH 3D23A 2VH6A 3OEHD 3M37A 1VGCC 4K8BA 5DP8A 3VEQB 3SJKA 1Z6EA 1SLUB 3TJVA 1BTYA 1BJUA 4B76A 2AERH 3MHWU 3FOAA 1P11E 2AEIH 1TPPA 2HOBA 1ZPCA 2ALPA 4ASUD 1RTLA 1C2JA 1YLDA 3RXPA 1GBEA 3GDVA 2ZP0H 1P9UA 4WH8A 2RDEA 1GJ6A 1YPLH 2Y81A 5EXLA 4MPVA 3DD2H 4DIIH 1THPB 2BD4A 1Y5UT 4WH6A 2ZEBA 2P94A 3EGKH 4R0IA 3RXCA 2KFWA 1PJPA 1T31A 1AHTH 1YPMH 4ZHAA 4ESTE 2GZ8A 2ZFFH 8GCHF 1P3EA 4ABJA 3SGQE 1OX1A 4JYVH 1W10U 3ZZ5A 4ABGA 1GMHG 2UUYA 4E06H 2J94A 2ZDAH 4FUCA 3BTME 3A8CA 5ETXA 3A8DA 3W95A 1SGTA 2XC5A 3A7WA 1CHOF 4K1TA 5GPIB 5K0HA 5BRRE 1CT0E 1O2YA 3GY2A 1TPOA 1VJAU 5C20A 3ATKA 1PPCE 1TGCA 4GUXA 1V2JT 1NBMD 2XCFA 2NU4E 1O0DH 3K6YA 5HM2A 2WPIS 1JOUB 2ANMH 1YC0A 3MH5A 4X6OA 4X1SU 1OWIA 1NESE 5HMAA 1EJMA 2W7SA 1A2CH 1GHAG 1TLDA 3MNCA 2F9PA 1DM4B 2BQWB 2SGQE 3QWCH 4FU8A 3WW7A 2R2WU 1FIZA 3SV9A 3ELAH 4AOQA 1ARCA 1BMMH 1HJ8A 2GP9B 3BEUA 4PROA 4Q63A 1C2MA 3TVJB 3PTNA 2CGAA 3OEED 3V0XA 1NRSH 1GMHF 2VWLA 4K69A 2FI5E 4B2BA 2K8IA 1W0ZU 1V2VT 3K2UA 4Y79A 2GV7A 3SGBE 1G36A 4Q7XA 1VITG 5C3NA 3UR6A 1GBAA 1P2JA 4TWYA 3RXJA 4R8TB 1O5EH 3BG4C 4JCNA 2RA3A 1FXYA 2EI7A 4A7IB 4NSYA 5GXPA 1RFNA 2F3CE 3RLWH 3ZZ3A 1AU8A 4ZHLU 4ACBA 5G4BA 2UWPA 1ZTKA 4XBCA 2FOFA 3H09A 4AB8A 2D8WA 1O39A 1SR5C 4BAOB 1ACBE 2FOAA 1IQEA 1ZYOA 4NZQA 1O5AB 4YM9A 1GHAF 1P2OA 1GWAA 4WXVA 5DN6D 2C93B 1C5SA 1BQYA 1Z1JA 4CBNA 2W3KA 2C8YB 1DXWA 1AWHB 1UVOA 2WPJS 4YLQH 2Z6BD 4X0WU 4FU9A 1ID5H 4NG9H 1A0HB 4IBLH 4X8TH 1PPZA 2SNVA 1E38B 3F0OA 1MCVA 2P95A 4YXWD 1NC6A 1XKBC 1O3KA 3BSQA 3SV6A 1L4DA 3QO6A 3P8FA 1O3MA 2Z3EA 2VWMA 4XDEA 3F9HA 1FY5A 1RIWC 3IWMA 1UVTH 1A5GH 1WDIA 4BANB 1OWEA 2ZDVH 2GX4A 3A7ZA 3MH4A 1ANDA 3O8CA 1O2OA 2G8TA 1TBZH 4ISNA 2GMTC 3AK5A 1HAIH 2FO9A 4DOQA 3A83A 2A4OA 2QIQA 4FU7A 3ODFA 3SORA 2STBE 3ESTA 1SGNE 1BMFD 5HXFA 1B7XB 2ZIQH 1Y59T 3KCGH 1O3LA 2VU8E 1DICA 4JMYA 3SJIA 5BPEA 2RFKC 3U98H 4Y10E 2OBQA 2CJIA 4FETA 3CNRA 4P02A 5DP4A 2EC9H 3MTYA 2FX6A 3UR9A 3CS7A 2K0QA 2FLBH 2UUKB 4I8LA 4WVPE 4Y71A 4H4FA 2OK5A 1K22H 4U30A 1E0FD 3V12A 1SOZA 1O33A 2ZG0H 1GGDC 2YNBA 2FOEA 1TALA 1S5SA 4NFEA 1BRUP 1NT1A 1DXPA 3UIRA 1AZ8A 1MZAA 1SGIB 2AH4X 3V7TA 1BTHH 1CO7E 1Y3YA 1GCTB 1RS0A 1PQAA 3LONA 2P3UB 3RM0H 1IQLA 2SGPE 3BG4B 3UFAA 4XSKU 1Y8TA 1W0JD 2F43B 1GI0A 4INHA 1OWHA 4SGBE 3A82A 3A84A 3EE0B 1GJ8B 1W8BH 5FPSA 1GI3A 1S83A 1EP5A 5FBIA 1P02A 2ZC9H 4HGCA 1GBTA 3SHCH 1BBRK 3SQHE 4ISLA 4WMEA 4Y7BA 1XVMA 3M3VA 1O3NA 1UTPA 4DVAU 2PLXA 1BTWA 1JIMA 1ZHPA 3NUMA 4TYDA 1TGBA 1YGCH 2HALA 2ODQA 1PPEE 2W7UA 5L2ZH 1S6LA 1ELEE 5EW1H 2FESH 2P59A 4Q80A 1V3XA 5C5NA 5EODA 2SGDE 1D3QB 1L0ZA 3OTPA 1BITA 4B74A 3P95A 3FZDA 1T8NA 2WZQA 1K0HA 1PPGE 3E90B 4J2YB 2A0QB 3UB0A 5GDSH 1G2LA 1HAVB 1KXBA 4NCYA 3UNRA 3MI4A 3MOCA 2FM2A 3U8TH 3ATMA 4HG6A 1QIXB 3EA7A 3RXOA 2VWOA 1NU9A 4Q7YA 3SUGA 1V2OT 1O2VA 1G3BA 1ELFA 5EGMA 2ZQ1A 1ZSJA 3B23B 3BN9A 3ZVDA 1Q2WA 1KLJH 4U01A 1OKXA 1TGSZ 2PSXA 1GBHA 6GCHG 1ELCA 3OU0A 1PYTD 2SNWA 2FTMA 1FPHH 3A86A 3F1SB 2TGTA 1F92A 1P12E 4ISOA 3KF2A 4BTTB 2FEQH 3K9XB 1O3PB 3BF6H 2B5TB 4UFDH 2HNTF 4DURA 2I6SA 3TLOA 1EASA 3GDUA 1CT4E 3STIA 4D76A 1SQOA 3RXTA 2TRMA 4BAKB 5E0GA 4XBBA 4MNYA 1QB6A 2OBOA 3KQCA 1EAWA 1TX6A 2FPZA 4GHTA 1L2EA 4AN7A 2IOTA 1KXFA 3EA8A 5EW2H 6LPRA 2XNIA 1HAGE 1KY9A 3RXIA 2IN2A 1EUFA 2PUQH 5DP5A 1ELBA 1IAUA 3PMHB 4X8SH 3PRDA 1YPJH 4BAMB 4I32A 1QHRB 4MDSA 2ZFQH 4X1RU 4FOUC 2VB0A 7LPRA 3T2NA 1W7GH 1O5BB 1D3DB 1A3BH 1UW7A 2J98B 2A5AA 5T1VA 2UWLA 2XBVA 2JDID 4XFQA 2QF3A 3LPRA 5FXLA 2GGVB 3LDXH 4RKOB 2TBSA 3RMNH 1QCPA 4CREA 1AFQB 5EQSA 4Y8YA 2FOCA 3QN7A 1QBNA 1JWTA 1ABIH 2BOHB 1Y5AT 1MKXH 5I25A 2HVXA 1W0KD 3OSYA 3U28C 5C0TA 1PPHE 3ATIA 3QK1A 1FONA 1ZJKA 4DG4A 2CV3A 2TGPZ 1O3IA 5CHAB 1P04A 1E1RD 1TNJA 2WPLS 1H4WA 5DO4H 4UFEH 2RG3A 1GBKA 4MPXA 4XE4A 2PFEA 1EATA 1T7CA 1C5WB 2J4IA 1MU8B 1GDUA 2AMDA 3RXDA 1YCPH 3MU0A 1L1JA 5F53A 2G4UA 1ESAA 3U8OH 2OC1A 1CE5A 1FUJA 2BD8A 3MWIU 4OM9A 2BY9X 1TBRH 1C4V2 2HPPH 1L1GA 3SNEA 4Y8ZA 4AYYB 1ELDE 3RXHA 1HJAC 1S6HA 2LP6A 3SUEA 3RXFA 1C1UH 1L4ZA 2WPMS 2VIVA 1CA0C 4IN1A 2THFB 1FY4A 2AMQA 1DOJA 2IPHA 1NU7B 4OGXA 1GG6C 5TCCA 2OCVB 2Z3DA 3VB6A 3DSGA 2VIOA 1BZXE 1S0QA 3ZYDA 3E6PH 2WPDD 2GZ9A 3OY6U 1UTOA 4I8JA 2EI8A 3KQDA 5J4QA 1GJ7B 5A8ZA 4DGJA 3BTQE 1TNKA 1C5RA 3A7VA 1F0RA 1JIRA 1RGQA 1OWJA 1MH0A 1QTFA 1TAWA 3MH6A 1ZGVA 3GCOA 3RXAA 4JZ1A 5KECA 4IMZA 5EJZA 4K1EA 5AF9H 1TFXA 2BD5A 2P3FH 2QE7D 2WHXA 1P03A 1T4UH 1G37A 3ZV9A 1W3CA 1NFWA 1ZPZA 1QNJA 2FX4A 3RXLA 3KEEA 3NZIA 4D9RA 1N8OC 1F2SE 3K65B 2ZTXA 1GHZA 2PKAA 3MQKC 4RI0A 2GCTB 1O3OA 3SJ9A 1CU1A 1XVOA 5C67A 3LGIA 1O2XA 1CGJE 1UCYK 3QGNB 3RXBA 3T5FH 5LPEA 1TIOA 2BZ6H 1CQQA 3ZVCA 2TGDA 1F5RA 1V2UT 4CBOA 2J98A 2EA3A 2O8MA 1AB9C 1TB6H 1DUEA 1ZHMA 4XD7D 2D26C 1SLWB 1KLTA 4ZMAH 1E79D 1MU6B 3ODDA 3E8LA 1O2HA 2C8ZB 1SQTA 1GI5A 1XUKA 2W5EA 3TGIE 2ZGJA 1SSXA 3OY5U 1S0RA 3SU0A 3LGVA 3AW1A 1TOMH 2Z9KA 1O3JA 1GHBG 1ZHRA 4KELA 3DA9B 4Y0ZE 2WV4A 2BY5X 3T28A 4FUJA 1G30B 4UONA 2WUBA 1GJAB 1H8DH 4U2WA 2WPKS 3EE7A 4KP0A 1HIAB 1FJSA 1QRWA 5EPYA 1D3TB 1LHGH 3RM2H 2H1UA 2ZDNA 3RXUA 2W26A 1T8OA 2ZU1A 1QFKH 3PM3A 1AFEH 1TGTA 1EPTA 1XUFA 7GCHG 3MNXA 2VINA 1DWCH 1QA7A 3GOVB 1GI7B 5LGOA 2QGRA 2ZHEH 3ZZ4A 1XKAC 3L33A 4J1YA 1C5MD 3KN2A 1WYKA 1GMDG 4NA9H 5DK1A 2Z9LA 2GT7A 2Y7XA 5GWZA 1SVPA 4WXIA 4AG1A 1UHBA 3T62A 3RMLH 3LJJA 1EB1H 4JZDH 2EQNA 4ACAA 3PV4A 3KHVA 1C5OH 1AMHA 3K6ZA 1Y3VA 1RXPA 3RXKA 3FANA 2F9UA 3A80A 4CHAB 2STAE 1P2NA 5E0HA 3LIWA 3TPIZ 3ENSB 2GJGA 2DE9A 2ZU4A 1A1RA 3GICB 2FXRA 3FKSD 1YLCA 2L6OA 2A4QA 2ZZUH 1GHBF 2BHGA 4XBDA 4FVDA 1UVSH 2PTCE 4KTCA 1D3PB 1O32A 2VGCC 2C8XB 2J38A 2A45B 1N6YA 3URCA 1NBME 2A31A 1QGFA 3P70B 2G00A 1LHDH 1MD8A 1F5KU 8LPRA 3QZQA 4IC6A 3E0PB 2FTLE 4CH8B 4DIHH 2ZNKH 3UOPA 4X1QU 4ABHA 1TRYA 4D7GA 1MABB 2M2AA 1YCPK 5L30H 2XRCA 3VGCC 2A2XH 4ASHA 2PKSB 3BTKE 5TCAA 1HPGA 1HXEH 3GY5A 1HAVA 2B7DH 3ZZ6A 2GMTB 4MQAA 1TNLA 1WV7H 1B5GH 2KM0A 3S7KB 1FIWA 3ZYEA 1C1WH 1YBWA 1HDTH 1J8AA 5C1YA 3GY7A 3QTVH 1LCYA 4GVUA 1YLNA 4FUDA 4A1XA 2BDBA 1GBJA 1UK3A 1HYLA 1CA8B 3T26A 2C4FH 2ZCHP 1YCPM 4VGCB 3SU2A 1X7AC 4JK5A 4IMQA 1O35A 4TT3D 1QJ7B 2VIQA 1TYNA 1KDQB 2PWXA 2FDAA 1O2IA 1EP6A 1BTZA 4Z6AH 1AO5A 5EQQA 1Q31A 1AE8H 4ZH8A 2QAAA 4BAHB 1ZLRA 3SU5A 1TABE 5ESBA 4ZROA 3V3MA 2Q6DA 3WY8A 2FI3E 3FVFB 1Z8RA 4F55A 4HZHA 1GVLA 5JBBS 1BHXB 2GDDA 3RMOH 3FN8A 3SNDA 2FODA 1C1OA 1KIGH 1VJ9U 2XWAA 4K60A 1ZRBA 1OP2A 5JPMH 4UE7H 1TWXB 2K1QA 1WQVH 3VB5A 4FUFA 4TSFD 1XXDA 1GCTC 4ZUHA 5C1UA 1W14U 1EAUA 1XUGA 4JZIA 4U32A 4ABFA 4P00A 5F8TA 2WUCA 1SL3A 1IQHA 3RDZA 1WTGH 3RXRA 1YKTA 3SU3A 2ODYB 4B73A 2V7QD 3M36A 2A4RA 5IDKA 1XXFA 1SKYE 3DFLA 4ZKNU 1LHEH 2B9LA 2WYGA 3F9FA 2OINA 3ATLA 1AIXH 3QGJA 3VB3A 2BM2A 4AB9A 1BB0B 5E2OA 1O2WA 1A5HA 3GCTG 4FXGH 1SGRE 4LXBH 1TQ0B 3P8NA 3F3BA 5FCRA 2VWNA 1C1MA 4A1TA 3GY6A 3UNSA 1HNEE 2ALVA 3TGJE 1O2GH 1Z8IB 1C9PA 2BY8X 4BTUB 5C17A 5C2ZA 1V2PT 1U6QA 4CH2B 2ZDMA 1FDPA 2PR3A 1SGFA 2OD3B 2QN5T 1N1LA 1XM1A 4IN2A 1SHHB 2ULLA 1C2KA 1UVPA 1KDQA 1G32B 2V0BA 2BXUH 3HATH 3P92A 3QX5H 5EXMA 3RP2A 2HNTE 2FYQA 1TA2A 4FUGA 3ITIA 5A0AE 1C2DA 1A46H 2GT8A 3O8BA 3SV7A 3PWCA 3UAIC 1LMWB 2GCHG 3A89A 4DT4A 1C1SA 1J17T 3VXEH 1BMLA 4HFPB 1V2QT 2F9OA 5AVDA 2KCYA 2ZU5A 4RKJB 1TRMA 5A0BA 3MO3A 4X8VH 2ASUB 3TGKE 4AYVB 2LPRA 3DSOA 1C5QA 1YPKH 1A0JA 3SYJA 1P0SH 2NU2E 3DHKH 2G52A 1WUNH 4K8YA 2AIQA 2QY0B 3F2HA 1EX3A 2G81E 2KAIA 3VB7A 1J15A 1TQ7B 3BTWE 3FFGA 1OSSA 4B6EA 2UUJB 2DE8A 2TPIZ 1BBRE 1H9LB 5T6FA 4HI3A 2XC0A 1QJ6B 1YM0A 3HPTB 2VGCB 3Q3KA 1SMFE 1BMAA 3BEFB 1IQKA 1GHWH 1AWFH 1VKYA 2XNDD 3B9FH 2KR7A 1ELAA 3L6PA 3LC5A 4NWLA 2GCHF 3PO1C 1RRKA 3DSPA 1LQEA 1AI8H 1H8IH 2YMSD 3EYDA 2SFAA 3F9GA 4NSVA 1GHVH 3RXVA 2GVFA 3TIUA 4ZKRU 2XWBI 4Q4LA 4SGAE 3UPEA 1QB9A 1M9UA 4YESB 3B8JA 2B8OH 1NM6A 2PSYA 2C90B 3A85A 3VPKA 4E7RG 4ZXYH 2OLGA 4K2YA 1K1MA 5FPTA 4INLA 2Z9IA 1CBWB 3F6UH 1S82A 3RC5A 2VH0A 2O8TA 4B2CA 1C4U2 3U8RH 3SZEA 1IHTH 2C8WB 1GBIA 2JETB 4X2YA 1QBVH 1EOJA 3LGTA 1NN6A 1SFIA 1UTNA 4X1NU 1O2MA 1QQ4A 9LPRA 1MQ5A 3SV2H 2WV5A 1MTNB 2J9NA 5DP3A 1T4VH 1HAZB 2ZKSA 3IITA 2A7JA 2AMPA 1O2RA 3BG8A 3TITA 2BVRH 1G9IE 1EQ9A 1H1BA 1MD7A 1QA0A 1GCDA 2BDAA 2XXLA 5FX6A 1BOQA 2AGIX 4AGKA 4JYUH 5TJXA 4CRBA 1A7SA 4I86A 1HBTH 3EAJA 4WWYA 1KXEA 2BTCE 2XW9A 4INKA 1MTWA 2BDYA 2XBYA 4ZHMU 1DSTA 1O38A 1TGNA 1O5DH 1XMNB 2Z7FE 1D4PB 5A8XA 1UK2A 3LGUA 2FMJA 4QT8C 5LPFA 2WINI 4X2XA 3PLPA 1ZMLA 2PP6A 2F91A 2HLCA 1O2NA 4OS1A 4MTBA 2I6QA 2ZFTA 3M7TA 1HAHH 2QYIA 3I78A 1HAOH 4MVNA 3RUOA 2ZFPH 1IHSH 1O2PA 4O3TA 4YT6H 1J9CH 1GBCA 1HFDA 2ZTYA 3ZZDA 2AS9A 3FP8E 3U69H 2F9VA 4I8GA 1N6XA 1ZSKA 1DLEA 5T6GA 2ZPQA 1DT2A 1AB9B 4O9VA 2M5TA 1GBBA 4ABAA 3GY3A 3G01A 1WBGB 2L74A 3M3TA 3SW2B 3TK5A 4BAQB 2QA9E 1P09A 3EQ0H 1BIOA 2V3OH 5AHGH 1AE5A 1CGHA 2NU3E 4RT0A 2NU0E 1OP0A 2Y5GA 3AW0A 3CS0A 2Q6GA 1W12U 1IQJA 1K1PA 2GCTC 1F0UA 2GD4B 1MCTA 2VBCA 1UTKA 1GBFA 3NXPA 3KQ5A 4Z0KA 3S9BA 1KYNA 1DSUA 1ZPBA 4MNVA 1AVXA 1HAYB 2NWNA 1Q3XA 1V2MT 1GDNA 2SGAA 1O2JA 2R3UA 3HGPA 4ABIA 1A4WH 3BTGE 3A7YA 4E05H 1QL9A 5C1XA 2A32A 2BD2A 2VIWA 2ESTE 2OQUA 5F8ZA 2AYWA 5EQRA 1O37A 3RXEA 5CE1A 2ZDLA 1IQMA 3GISB 3PV2A 2AGEX 2F9NA 2ZHFH 4Q7ZA 1AZZA 1YWUA 1NFXA 2A5KA 1IQFA 1O2UA 1C1VH 3FAOA 1Y5BT 1DUAA 1LKAA 5DPAA 3L3TA 3SQEE 1SGDE 1NRNH 4D8NA 1BRAA 2AIPA 1S85A 2A5IA 3AVZA 1WTHD 1KSNA 1FNIA 2UWOA 5DP6A 4XRNA 2R0KA 3T27A 1MKWH 2O8WA 1DWBH 4NWKA 2BVSH 2P8OB 1ZZZA 4GSOA 2Y80A 1AKSA 1VZQH 2H9TH 5IYTA 1UTLM 3SUFA 1SFQB 4OS4A 4CR5A 1E34B 4YO9A 1ELVA 1QZ8A 2WV9A 1NPMA 2P16A 6CHAB 3SU4A 1EJAA 2PTNA 2WYJA 3GY4A 4M7GA 1O36A 3GCTF 1GMDF 4F4OC 2KZ4A 3M5NA 1GI1A 1W2KH 1EZQA 1SLVB 1BRBE 1F0TA 1DWEH 2AFQB 4YLUA 1CHOG 1EOLA 1NRQH 1TMUH 1XUIA 1V2WT 3GCNA 3W1EA 2BLOA 2O8LA 2OUAA 1TONA 3SOSA 2XBWA 4F49A 4LOYH 3EDXB 5E0JA 5FCKA 3KYFA 3NK8A 5E2PA 1J14A 4HTCH 5DJ7A 5HIZA 1GHYH 1UCYE 4Y11E 4BNRA 3C1KA 3N7EA 5C94A 2BB4A 2KX4A 2BQ7B 3PLBA 4NA8A 1YF4A 1EXFA 1GI6A 1MKXK 3ZV8A 1YPEH 1MTSA 1ZRKA 1COWD 2PHBA 3AAVA 2GTBA 3SGAE 3LH3A 5ESTE 2R0LA 1SBWA 1GL1A 4TWWA 3KL6A 1BRCE 2G5VA 3UQVA 1V2KT 4OGYA 1FN8A 5A0CA 1AQ7A 5JBTA 1K9OE 1YYY1 3S9CA 2HVYB 3SNAA 1AVGH 2ZCLP 2YMSB 1MTNC 2P3TB 2XOKD 3LH1A 2BOKA 4TPIZ 3BTFE 5KEDA 4AFUA 1WOFA 5HIYA 3TH4H 5T6DA 2Y6TA 5IK2D 2CXVA 3I77A 1FMGA 3TU7H 2RCEA 1JRTA 4A1VA 2ZFRH 1HGTH 1WAYB 1SGEE 3T25A 1O3HA 1OWDA 1TNGA 4AFZA 1C5ZB 3M35A 3FZZA 4MLFB 1BTXA 1KXDA 2FOGA 3AAUA 1D9IA 2HGTH 2KAIB 4UFFH 1G3DA 2JIZD 4NIWA 3SHAH 4VGCC 5C5OA 1TX8A 4B71A 5LH8A 3DT0H 3GYLB 3W94A 1LTOA 4KTSA 4CHAC 5JBCS 1NRRH 4O03A 1GJDB 3Q3YA 1GMCF 1ESBA 3ZVFA 1E35B 4THNH 2JH6D 3MU1A 1HAPH 1C1QA 4YOGA 1J16A 4MPWA 2P8OC 1ZR0A 3QUMP 9ESTA 5JB9S 5AFYH 1FPCH 1UTJA 5A2MH 1G3CA 1T32A 3D62A 3TNSA 1RTKA 1THRH 1GI2A 2D1JA 3ZZCA 1O5GH 2W6JD 2QXJA 4KKDA 5FL7D 1NTPA 2CN0H 2EY4C 4B75A 3RU4E 3NPSA 1LHCH 4WMDA 5DKMA 3BTHE 3STJA 5CMXH 3SV8A 1OP8A 2O8UA 1O3CA 4XOJA 2QXHA 1O2SA 1DDJA 1JMOH 3SI3H 2RA0A 1DS2E 1QL8A 1K1JA 1P2MA 2PV9B 3RC6A 1N8OB 1O2KA 1OXGA 3M5MA 2ZHWH 1IQIA 1RD3B 2ZECA 4NGAH 2BDIA 1CGIE 3VB4A 3U9AH 2Q6FA 1HUTH 4Y8XA 1P2QA 1QRXA 2O9QA 3F2FA 3ZVAA 2ZQ2A 2LELA 3SZNA 3SN8A 1O30A 2V35A 4KTUA 1CT2E 2PUXB 5HGGA 2XYAA 1WU1A 2GV6A 1C5PA 1OHHD 1L1NA 2LNCA 4AFSA 2FIRH 1CA0B 3M7UA 1SB1H 4JK6A 1VCQA 4H6TA 4CRFA 3TH2H 3WWFA 1S84A 1Z7KA 1LPKB 3D65E 3E0NB 3KYGA 2OQ5A 4BTIB 3OYPA 4OS6A 1SG8B 1DANH 1YPHC 4RN6A 3TH3H 1W0YH 4GHQA 2BY7X 2CHAC 2JKHA 2QV1A 4ZCNA 3ZZ8A 1AN1E 5HM9A 4ABBA 3JZ1B 1EPTC 2ZFSA 3R3GB 1QJ1B 1S6FA 2OXSA 2JH0D 3S7HB 1OYQA 4X6NA 1PYTC 1W13U 2IJOB 3RXSA 4NIYA 4RSPA 4GCHG 4TPYA 1C5XB 1GGDB 3PV5A 3SO3A 2ILNA 1ZMNA 2J5UA 1SI5H 1VITH 1VGCB 1GL0E 4YZUA 1SGQE 2FZZA 8KME2 5B6OA 2CK3D 4A6LA 1SGPE 3A8BA 1O2TA 1F7ZA 4IS5A 5EJ1A 2ZGBH 3KGPA 1BTPA 1ZOMA 2VVUA 1P3CA 1RIWB 1LQDB 1A0LA 1C5VA 1OOKB 3BEIB 5GNDA 3E3TA 1GBLA 2SGEE 1MZDA 3T29A 2XBXA 5A8YA 2IJD1 1UO6A 4BXSA 4I8KA 2W3IA 3A7TA 1C2GA 1NFYA 1Z71A 1O2ZA 3E16B 2FLRH 1MQ6A 3IG6B 4A5TS 3QZRA 1VCPA 6ESTA 3UREA 1C5UA 3JZ2B 4X2VA 3BTEE 3GS9A 3UWIA 3MO6A 4AX9H 3SUDA 1WQSA 1QY6A 1FN6A 2V3HH 3PWBA 5CDFE 1V2LT 4MNWA 3TNTA 1LVYA 1TA6A 1D6RA 2QCYA 4AFQA 5F8XA 1HCGA 1HB0B 1EKBB 3LJOA 5T3HA 1AD8H 1IQGA 3DCLA 3QDZB 3MO9A 1DPOA 2XTTB 1V2NT 2ZHQH 3A8AA 5I46H 4GAWA 1HXFH 1UHBB 1QRZA 3VGCB 3QLPH 4MG3A 1FZZA 2W6ID 7KMEH 4B2AA 1VCWA 3N7OA 2ZPSA 4B1TA 2FS9A 3ZVEA 2H5DA 5EG4A 1O3BA 1G2MA 3S69A 1SQAA 1O3AA 1SGCA 3ZZ9A 3O8DA 3M3SA 5FHTA 1ZJDA 1AUTC 4FUIA 2H2ZA 5JB8S 3Q77A 4DW2U 1QURH 4JZEH 1O3EA 2Y5HA 3KQEA 1E36B 2CHAB 1AUJA 5FBEA 1IQNA 3GCHC 3PMJA 3MU4A 2F9BH 2PGBB 1RTFB 1ETTH 2BYAX 4ZKOU 3SNBA 4UDWH 5SGAE 3RU4T 1AKSB 1DY8A 3OAAD 3SBKA 1O2QA 3ZIAD 2H6MA 3BTDE 5JBAS 1C5YB 2G4TA 4NIXA 1P01A 4TY7A 2BDHA 2SGFE 3I29A 1O3GA 1HJ9A 5E8EH 3PTBA 1O31A 1C2EA 3DUXH 1W11U 4JZFH 4CRGA 3PMAB 1V6DA 2BX4A 2Z9JA 3F68H 1O5CB 3HKJB 1XUHA 1LO6A 1O2LA 2G55A 1C2IA 1XUJA 2YNAA 2A7HA 2ZPRA 2WSSD 1FQ3A 5PTPA 4YT7H 2ODPA 1QL7A 1C2LA 1QQUA 2BX3A 3MMGA 2QF5A 1VR1H 5A09A 1CBWC 1SGFG 1KTTB 1GI4A 5JYIA 1K1IA 3EA9A 1OWKA 1PQ5A 3H5CB 2XC4A 3MFJA 2Y7ZA 2YOLA 3P6ZB 3TJOA 2BD7A 4NFFA 1MTUA 1TX7A 1O5FH 3UNQA 1LVOA 4X2WA 1XX9A 3MU8A 2R3YA 1BT7A 1ANCA 5F6MA 2PKAB 2FOHA 4I33A 1S81A 4GLYA 1WCZA 4DCDA 2P93A 1O34A 1FI8A 2VVVA 1IOEA 2Z3CA 1HV7A 4WJG2 2ZTZA 1KXCA 3BIUH 4ZKSU 1DE7H 1C1RA 1A5IA 3SU1A 2OTVA 2AGGX 1VITF 2BLVA 2ANYA 1LHFH 2BVXH 3P8GA 2H9HA 3PROA 1EPTB 2BD3A 3ZZBA 5HYOA 3BTTE 1T8MA 1UCYH 1SOTA 1ETSH 2CF8H 5EPNA 2ZGCA 1KLIH 3NCLA 2VVCA 2OC7A 4UFGH 2VJ1A 2ZWLH 4O97A 1LPGB 2D2DA 1EZXC 1F5LA 1CSOE 1QR3E 1SC8U 1BBRH 1FV9A 1DLKB 2Q1JA 4ISHH 2KCOA 5DP9A 1Z8GA 4FUHA 2C3SA 4IC5A 5FX5A 2XCNA 3F2GA 1YY3A 4MPUA 1CHGA 4O3UA 3S9AA 1GPZA 2R2MB 1HRTH 4KGAA 5DP7A 1FY8E 2F83A 3P8OA 2WPHS 2J97A 1K2I1 1EZUC 3P17H 4AZ2B 1GBMA 3PLKA 2G5NA 3OE7D 3F9EA 2F4LA 6CHAC 1P8VC 3A7XA 1GJCB 1JXPA 4M9FA 4TY6A 1BTUA 1GI8B 1C1PA 1EZSC 2FOMB 3CENA 3RLYH 2GDEH 2HRVA 1H9IE 3FP7E 3CP7A 5GCHG 1DY9A 4D7FA 3UY9A 5EIYA 2VIPA 7GCHF 1K1OA 1GVZA 3HGNA 1C1NA 5F03A 2UUFB 4A92A 2QC2A 2PW8H 1TMBH 3KQBA 4ABEA 2BZAA 2GZ7A 3D49H 3ZZAA 1ORFA 1Z6JH 1T8LA 4Y7AA 1PFXC 1HLTH 5ABWA 1CVWH 1EFRD 1SHYA 5L2YH 1C2HA 3RC4A 2J95A 2TIOA 1FLEE 2A2QH 4YOJA 3MU5A 3KIDU 4LK4A 1TRNA 4CRAA 2ZU2A 3ZVGA 1C9TA 3GDSA 3ZZ7A 1Z1IA 1EAIA 2CF9H 4F48B 1HJAB 1F0SA 3GYMA 1QBOA 2JJ1D 2PGQB 2ZGHA 1SQRA 1ETRH 1UTQA 3OFND 3A88A 3RMMH 3FP6E 1KXAA 1YPHE 2J34A 8GCHG 2ZI2H 3BV9B 4Y0YE 2BDGA 2GKVE 2ZF0H 2BDCA 2A1DB 4GPGA 3VFEA 4DJZB 2V3MA 1K1LA 2QF0A 4DY7B 2RDLA 1MBQA 3GY8A 4UD9H 1MKWK 1YP9A 1JBUH 1EAXA 5EU8A 1A3EH 1P2IA 3R0FA 1KMHB 1BHXF 2ZCKP 2H9EH 3NRLA 1PQ7A 2ZA5A 4RT1A 1BUIA 2IPQX 1GHXH 2Y82A 1GMCG 3TK9A 2HWLB 3E91A 5J4SA 1MAXA 3LGYA 4ABDA 4NIVA 1LDTT 1TNHA 1C1TA 1INCA 3VXFH 1YPGH 1NROH 5JDUB 3QTOH 2HLDD 1NY22 3HK6B 1W7XH 5GCHF 1SPJA 1G3EA 2R9PA 4AG2A 5FPYA 1NO9H 1ESTA 1TMTH 2AHME 4NZLA 4WF8A 3UQOA 3M5OA 4D9QA 3VG8A 1C5TA 1P06A 1DWDH 1LVBA 1OS8A 4X6PA 4DT7B 1H8HD 1C4Y2 1LKBA 2FYRA 1TNIA 1AGJA 1P57B 3URDA 1HIAA 2A7CA 1BCUH 1ABJH 2QXIA 3PO1B 3SJ8A 3SJOA 2ANKH 2QF4A 1MAYA 1GBDA 3SNCA 3RXQA 1PPBH 2FS8A 1E37B 2J2UA 2ANWA 4WY3A 1GJ9B 5LPRA 1HAXB 4YOIA 1BDAA 1AFQC 4I7YH 3PMBB 3Q00A 4ZAEA 3MNSA 3LGWA 2KCAA 1NRPH 1EB2A 1ZMJA 4FVBA 2DUCA 3KNXA 2YMSC 3N99A 2BQ6B 4FUBA 5H4IB 4BXWA 1NFUA 3UWJH 4X6MA 2KCPA 2OP9A 3LT3A 1DVAH 1ELGA 1GJBB 1Y3XA 2JETC 1GI9B 2QXGA 3H7OA 3OTJE 3RXGA 3LU9B 3MYWA 1GVKB 4B6FA 2JJ2D 2ZU3A 2HNTC 5GIBA 5HKKD 1TOCB 3BIVH 1NZQH 1K1NA 5EXNA 5AFZH 2H5CA 3Q3XA 1O3DA 1V2ST 1H8ED 1AVWA 5KGOA 3ATWA 4LZ1H 4H6SB 4WMFA 1P05A 4CRDA 1TPAE 2PKSC 3M61U 1TE0A 2Y5FA 3TJUA 4OS7A 4ZXXH
chains in the Genus database with same CATH topology
3TK6A 1MUEB 1THSH 2J92A 3HK3B 5DGJA 6GCHF 2BXTH 3ZVBA 1P2KA 2BMGB 1TBQH 5FAHA 1GDQA 1H9HE 1K21H 1LPZB 2FI4E 4Y6DA 3E1XB 3A81A 2ZO3H 3RXMA 3HKIB 4JYTA 3NKKA 4Q2KA 1GG6B 3V13A 1PPFE 1O3FA 1ZTLA 2VIDA 2BLWA 1DFPA 1RJXB 1UTMA 2OC8A 3M5LA 5DG6A 1BJVA 2A4GA 1C2FA 5L6NH 3NWUA 1ANEA 3U1IB 4LZ4B 1ARBA 3GCHB 2Z94A 1FY1A 4X1PU 1FAXA 2OC0A 3RU4D 3SI4H 2B0FA 4GCHF 2HPQH 1DX5M 1P9SA 1UJ1A 3U1JB 4Y76A 4E7NA 1C5LH 1OYTH 2ZDKA 4AGJA 1OPHB 4CR9A 3O8RA 8ESTE 2FOBA 1ANBA 3OX7U 1SGYE 3M7QA 1SLXB 1B0EA 5CHAC 1TPSA 1P10A 3S0NA 3MNBA 3UOUA 4IGDA 1NS3A 1B0FA 2Z9GA 1FY3A 3PYHA 1Z8JB 1FAKH 1V2TT 3PB1E 4I8HA 1WSSH 4FUEA 1MBMA 1V2RT 4YTAA 1Y3UA 4BOHA 1PQ8A 2FP7B 3LC3A 2JH5D 2EI6A 2VNTA 3Q76A 4OS5A 4AORA 1GJ5H 1UK4A 4OS2A 3DFJA 1DITH 1KTSB 4NA7A 1ZGIA 2TGAA 1GJ4H 1K28D 3A87A 2FWWA 5K7RA 5EOKA 5GJ4B 1MTVA 2ZGXH 4I31A 4X8UH 3MH7A 1UVUH 3TJNA 4K3JA 4MNXA 7ESTE 3SU6A 4H42U 4IW4E 2V6NA 3UUZA 2CMYA 3C27B 1D6WA 2BD9A 2ZHDA 1BA8B 3AASA 1BMNH 3H7TA 3LOXA 4K1SA 2G51A 1ZTJA 4CRCA 1AY6H 1A61H 1ZSLA 2NU1E 2EEKA 1Y3WA 2BY6X 2BLQA 1ELTA 1MMJN 1UMAH 1JRSA 1QB1A 4K5ZA 4UEHH 1EJNA 3UTUH 1LVMA 4ISIH 3LKWA 1C5NH 3D23A 2VH6A 3M37A 1VGCC 4K8BA 5DP8A 3VEQB 3SJKA 1Z6EA 1SLUB 3TJVA 1BTYA 1BJUA 4B76A 2AERH 3MHWU 1P11E 2AEIH 1TPPA 2HOBA 1ZPCA 2ALPA 1RTLA 1C2JA 1YLDA 3RXPA 1GBEA 3GDVA 2ZP0H 1P9UA 4WH8A 1GJ6A 1YPLH 2Y81A 5EXLA 4MPVA 3DD2H 4DIIH 1THPB 2BD4A 1Y5UT 4WH6A 2ZEBA 2P94A 3EGKH 4R0IA 3RXCA 1PJPA 1T31A 1AHTH 1YPMH 4ZHAA 4ESTE 2GZ8A 2ZFFH 8GCHF 1P3EA 4ABJA 3SGQE 1OX1A 4JYVH 1W10U 3ZZ5A 4ABGA 1GMHG 2UUYA 4E06H 2J94A 2ZDAH 4FUCA 3BTME 3A8CA 5ETXA 3A8DA 3W95A 1SGTA 2XC5A 3A7WA 1CHOF 4K1TA 5GPIB 5K0HA 5BRRE 1CT0E 1O2YA 3GY2A 1TPOA 1VJAU 5C20A 3ATKA 1PPCE 1TGCA 4GUXA 1V2JT 2XCFA 2NU4E 1O0DH 3K6YA 5HM2A 2WPIS 1JOUB 2ANMH 1YC0A 3MH5A 4X6OA 4X1SU 1OWIA 1NESE 5HMAA 1EJMA 2W7SA 1A2CH 1GHAG 1TLDA 3MNCA 2F9PA 1DM4B 2BQWB 2SGQE 3QWCH 4FU8A 2R2WU 1FIZA 3SV9A 3ELAH 4AOQA 1ARCA 1BMMH 1HJ8A 2GP9B 3BEUA 4PROA 1C2MA 3TVJB 3PTNA 2CGAA 3V0XA 2VWLA 1GMHF 1NRSH 4K69A 2FI5E 4B2BA 1W0ZU 1V2VT 3K2UA 4Y79A 2GV7A 3SGBE 1G36A 4Q7XA 1VITG 5C3NA 3UR6A 1GBAA 1P2JA 4TWYA 3RXJA 4R8TB 1O5EH 3BG4C 4JCNA 2RA3A 1FXYA 2EI7A 4A7IB 4NSYA 5GXPA 1RFNA 2F3CE 3RLWH 3ZZ3A 1AU8A 4ZHLU 5G4BA 2UWPA 1ZTKA 4XBCA 2FOFA 4AB8A 2D8WA 1O39A 1SR5C 4BAOB 1ACBE 2FOAA 1IQEA 1ZYOA 4NZQA 1O5AB 4YM9A 1GHAF 1P2OA 1GWAA 4WXVA 2C93B 1C5SA 1BQYA 1Z1JA 4CBNA 2W3KA 2C8YB 1DXWA 1AWHB 1UVOA 2WPJS 4YLQH 2Z6BD 4X0WU 4FU9A 1ID5H 4NG9H 1A0HB 4IBLH 4X8TH 1PPZA 2SNVA 1E38B 1MCVA 2P95A 1NC6A 1XKBC 1O3KA 3BSQA 3SV6A 1L4DA 3QO6A 3P8FA 1O3MA 2Z3EA 2VWMA 4XDEA 3F9HA 1FY5A 1RIWC 3IWMA 1UVTH 1A5GH 4BANB 1OWEA 2ZDVH 2GX4A 3A7ZA 3MH4A 1ANDA 3O8CA 1O2OA 2G8TA 1TBZH 4ISNA 2GMTC 1HAIH 2FO9A 4DOQA 3A83A 2A4OA 2QIQA 4FU7A 3ODFA 3SORA 2STBE 3ESTA 1SGNE 5HXFA 1B7XB 2ZIQH 1Y59T 3KCGH 1O3LA 2VU8E 1DICA 4JMYA 3SJIA 5BPEA 3U98H 4Y10E 2OBQA 2CJIA 5DP4A 2EC9H 3MTYA 2FX6A 3UR9A 3CS7A 2FLBH 2UUKB 4I8LA 4WVPE 4Y71A 4H4FA 1K22H 4U30A 1E0FD 3V12A 1SOZA 1O33A 2ZG0H 1GGDC 2YNBA 2FOEA 1TALA 1S5SA 4NFEA 1BRUP 1NT1A 1DXPA 3UIRA 1AZ8A 1MZAA 1SGIB 2AH4X 3V7TA 1BTHH 1CO7E 1Y3YA 1GCTB 1RS0A 1PQAA 3LONA 2P3UB 3RM0H 1IQLA 2SGPE 3BG4B 3UFAA 4XSKU 1Y8TA 1GI0A 4INHA 1OWHA 4SGBE 3A82A 3A84A 3EE0B 1GJ8B 1W8BH 5FPSA 1GI3A 1S83A 1EP5A 5FBIA 1P02A 2ZC9H 4HGCA 1GBTA 3SHCH 1BBRK 3SQHE 4ISLA 4WMEA 4Y7BA 1XVMA 3M3VA 1O3NA 1UTPA 4DVAU 2PLXA 1BTWA 1JIMA 1ZHPA 3NUMA 4TYDA 1TGBA 1YGCH 2HALA 2ODQA 1PPEE 2W7UA 5L2ZH 1ELEE 5EW1H 2FESH 2P59A 4Q80A 1V3XA 5C5NA 5EODA 2SGDE 1D3QB 1L0ZA 1BITA 4B74A 3P95A 3FZDA 1T8NA 1PPGE 3E90B 4J2YB 2A0QB 5GDSH 1G2LA 1HAVB 1KXBA 4NCYA 3UNRA 3MI4A 3MOCA 2FM2A 3U8TH 3ATMA 1QIXB 3EA7A 3RXOA 2VWOA 1NU9A 4Q7YA 3SUGA 1V2OT 1O2VA 1G3BA 1ELFA 5EGMA 2ZQ1A 1ZSJA 3B23B 3BN9A 3ZVDA 1Q2WA 1KLJH 4U01A 1OKXA 1TGSZ 2PSXA 1GBHA 6GCHG 1ELCA 3OU0A 1PYTD 2SNWA 2FTMA 1FPHH 3A86A 3F1SB 2TGTA 1F92A 1P12E 4ISOA 3KF2A 4BTTB 2FEQH 3K9XB 1O3PB 3BF6H 2B5TB 4UFDH 2HNTF 4DURA 2I6SA 3TLOA 1EASA 3GDUA 1CT4E 3STIA 4D76A 1SQOA 3RXTA 2TRMA 4BAKB 5E0GA 4XBBA 4MNYA 1QB6A 2OBOA 3KQCA 1EAWA 1TX6A 2FPZA 4GHTA 1L2EA 4AN7A 2IOTA 1KXFA 3EA8A 5EW2H 6LPRA 2XNIA 1HAGE 1KY9A 3RXIA 2IN2A 1EUFA 2PUQH 5DP5A 1ELBA 1IAUA 3PMHB 4X8SH 4BAMB 1YPJH 4I32A 1QHRB 4MDSA 2ZFQH 4X1RU 2VB0A 7LPRA 3T2NA 1W7GH 1O5BB 1D3DB 1A3BH 2A5AA 2UWLA 2XBVA 4XFQA 2QF3A 3LPRA 5FXLA 2GGVB 3LDXH 4RKOB 2TBSA 3RMNH 1QCPA 4CREA 1AFQB 5EQSA 4Y8YA 2FOCA 3QN7A 1QBNA 1JWTA 1ABIH 2BOHB 1Y5AT 1MKXH 5I25A 2HVXA 3OSYA 1PPHE 3ATIA 3QK1A 1FONA 1ZJKA 4DG4A 2CV3A 2TGPZ 1O3IA 5CHAB 1P04A 1TNJA 2WPLS 1H4WA 5DO4H 4UFEH 2RG3A 1GBKA 4MPXA 4XE4A 2PFEA 1EATA 1T7CA 1C5WB 2J4IA 1MU8B 1GDUA 2AMDA 3RXDA 1YCPH 3MU0A 1L1JA 2G4UA 1ESAA 3U8OH 2OC1A 1CE5A 1FUJA 2BD8A 3MWIU 2BY9X 1TBRH 1C4V2 2HPPH 1L1GA 3SNEA 4Y8ZA 4AYYB 1ELDE 3RXHA 1HJAC 1S6HA 3SUEA 3RXFA 1C1UH 1L4ZA 2WPMS 2VIVA 1CA0C 4IN1A 2THFB 1FY4A 2AMQA 1DOJA 2IPHA 1NU7B 4OGXA 1GG6C 5TCCA 2OCVB 2Z3DA 3VB6A 2VIOA 1BZXE 1S0QA 3ZYDA 3E6PH 2GZ9A 3OY6U 1UTOA 4I8JA 2EI8A 3KQDA 5J4QA 1GJ7B 5A8ZA 4DGJA 3BTQE 1TNKA 1C5RA 3A7VA 1F0RA 1JIRA 1RGQA 1OWJA 1MH0A 1QTFA 1TAWA 3MH6A 1ZGVA 3GCOA 3RXAA 4JZ1A 4IMZA 4K1EA 5AF9H 1TFXA 2BD5A 2P3FH 1P03A 1T4UH 1G37A 3ZV9A 1W3CA 1NFWA 1ZPZA 1QNJA 2FX4A 3RXLA 3KEEA 3NZIA 4D9RA 1N8OC 1F2SE 3K65B 2ZTXA 1GHZA 2PKAA 2GCTB 1O3OA 3SJ9A 1CU1A 1XVOA 5C67A 3LGIA 1O2XA 1CGJE 1UCYK 3QGNB 3RXBA 3T5FH 5LPEA 1TIOA 2BZ6H 1CQQA 3ZVCA 2TGDA 1F5RA 1V2UT 4CBOA 2EA3A 2O8MA 1AB9C 1TB6H 1DUEA 1ZHMA 2D26C 1SLWB 1KLTA 4ZMAH 1MU6B 3ODDA 3E8LA 1O2HA 2C8ZB 1SQTA 1GI5A 1XUKA 2W5EA 3TGIE 2ZGJA 1SSXA 3OY5U 1S0RA 3SU0A 3LGVA 3AW1A 1TOMH 2Z9KA 1O3JA 1GHBG 1ZHRA 4KELA 3DA9B 4Y0ZE 2WV4A 2BY5X 3T28A 4FUJA 1G30B 4UONA 2WUBA 1GJAB 1H8DH 4U2WA 2WPKS 4KP0A 1HIAB 1FJSA 1QRWA 5EPYA 1D3TB 1LHGH 3RM2H 2H1UA 2ZDNA 3RXUA 2W26A 1T8OA 2ZU1A 1QFKH 3PM3A 1AFEH 1TGTA 1EPTA 1XUFA 7GCHG 3MNXA 2VINA 1DWCH 1QA7A 3GOVB 1GI7B 5LGOA 2QGRA 2ZHEH 3ZZ4A 1XKAC 3L33A 4J1YA 1C5MD 3KN2A 1WYKA 1GMDG 4NA9H 5DK1A 2Z9LA 2GT7A 2Y7XA 5GWZA 1SVPA 4WXIA 4AG1A 1UHBA 3T62A 3RMLH 3LJJA 1EB1H 4JZDH 3PV4A 3KHVA 1C5OH 1AMHA 3K6ZA 1Y3VA 1RXPA 3RXKA 3FANA 2F9UA 3A80A 4CHAB 2STAE 1P2NA 5E0HA 3LIWA 3TPIZ 3ENSB 2ZU4A 2DE9A 1A1RA 3GICB 2FXRA 1YLCA 2A4QA 2ZZUH 1GHBF 2BHGA 4XBDA 4FVDA 1UVSH 2PTCE 4KTCA 1D3PB 1O32A 2VGCC 2C8XB 2J38A 2A45B 1N6YA 3URCA 2A31A 1QGFA 3P70B 2G00A 1LHDH 1MD8A 1F5KU 8LPRA 3QZQA 4IC6A 3E0PB 2FTLE 4CH8B 4DIHH 2ZNKH 3UOPA 4X1QU 4ABHA 1TRYA 4D7GA 5L30H 1YCPK 2XRCA 3VGCC 2A2XH 4ASHA 2PKSB 3BTKE 5TCAA 1HPGA 1HXEH 3GY5A 1HAVA 2B7DH 3ZZ6A 2GMTB 4MQAA 1TNLA 1WV7H 1B5GH 3S7KB 1FIWA 3ZYEA 1C1WH 1YBWA 1HDTH 1J8AA 5C1YA 3GY7A 3QTVH 1LCYA 4GVUA 4FUDA 4A1XA 2BDBA 1GBJA 1UK3A 1HYLA 1CA8B 3T26A 2C4FH 2ZCHP 1YCPM 4VGCB 3SU2A 1X7AC 4JK5A 4IMQA 1O35A 1QJ7B 2VIQA 1TYNA 1KDQB 2PWXA 2FDAA 1O2IA 1EP6A 1BTZA 4Z6AH 1AO5A 5EQQA 1Q31A 1AE8H 4ZH8A 2QAAA 4BAHB 1ZLRA 3SU5A 1TABE 5ESBA 4ZROA 3V3MA 2Q6DA 3WY8A 2FI3E 3FVFB 1Z8RA 4HZHA 1GVLA 5JBBS 1BHXB 2GDDA 3RMOH 3SNDA 2FODA 1C1OA 1KIGH 1VJ9U 2XWAA 4K60A 1ZRBA 1OP2A 5JPMH 4UE7H 1TWXB 2K1QA 1WQVH 3VB5A 4FUFA 1XXDA 1GCTC 4ZUHA 5C1UA 1W14U 1EAUA 1XUGA 4JZIA 4U32A 4ABFA 5F8TA 2WUCA 1SL3A 1IQHA 3RDZA 1WTGH 3RXRA 1YKTA 3SU3A 2ODYB 4B73A 3M36A 2A4RA 5IDKA 1XXFA 3DFLA 4ZKNU 1LHEH 2B9LA 2WYGA 3F9FA 2OINA 3ATLA 1AIXH 3QGJA 3VB3A 2BM2A 4AB9A 1BB0B 5E2OA 1O2WA 1A5HA 3GCTG 4FXGH 1SGRE 4LXBH 1TQ0B 3P8NA 5FCRA 2VWNA 1C1MA 4A1TA 3GY6A 3UNSA 1HNEE 2ALVA 3TGJE 1O2GH 1Z8IB 1C9PA 2BY8X 4BTUB 5C2ZA 1V2PT 1U6QA 4CH2B 2ZDMA 1FDPA 2PR3A 1SGFA 2OD3B 2QN5T 1N1LA 1XM1A 4IN2A 1SHHB 2ULLA 1C2KA 1UVPA 1KDQA 1G32B 2V0BA 2BXUH 3HATH 3P92A 3QX5H 5EXMA 3RP2A 2HNTE 2FYQA 1TA2A 4FUGA 3ITIA 5A0AE 1C2DA 1A46H 2GT8A 3O8BA 3SV7A 3PWCA 1LMWB 2GCHG 3A89A 1C1SA 1J17T 3VXEH 1BMLA 4HFPB 1V2QT 2F9OA 5AVDA 2ZU5A 4RKJB 1TRMA 5A0BA 3MO3A 4X8VH 2ASUB 3TGKE 4AYVB 2LPRA 1C5QA 1YPKH 1A0JA 1P0SH 2NU2E 3DHKH 2G52A 1WUNH 4K8YA