5SGAE

Structures of product and inhibitor complexes of streptomyces griseus protease a at 1.8 angstroms resolution. a model for serine protease catalysis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
181
structure length
181
Chain Sequence
IAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAQPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE A (SGPA)
publication title Structures of product and inhibitor complexes of Streptomyces griseus protease A at 1.8 A resolution. A model for serine protease catalysis.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 181
sequence length 181
ec nomenclature ec 3.4.21.80: Streptogrisin A.
pdb deposition date 1990-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5sgaE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5sgaE01
1BRAA 4YOGA 3URDA 1WU1A 2WPMS 2B7DH 2H9EH 3K2UA 4TWYA 2F9VA 3VXEH 4X1PU 1QR3E 3ZZ6A 2PUXB 1KIGH 4CRDA 2WPJS 4IBLH 4X8SH 5JDUB 1FY4A 1HXFH 2WUCA 4YLUA 2RG3A 1YC0A 1AHTH 1FIZA 2QY0B 4BXSA 3SU3A 2A2XH 4QT8C 1LO6A 3SNEA 1HAVB 1Z7KA 2FOBA 4WVPE 1BTHH 4AFQA 1G2LA 1FY3A 2BDHA 3SJ8A 1TX8A 1EAWA 1CVWH 4IN1A 2AERH 1XKBC 1V2TT 2SNWA 1O2HA 1BRBE 2P93A 1GHXH 2XC0A 3DUXH 3SGQE 1B0EA 3TGIE 2ZZUH 1BZXE 1P8VC 1GHAF 1ZPZA 3BTTE 1AFQC 3IITA 1T8NA 2A4QA 2WUBA 2A2QH 3V3MA 1EZSC 1NTPA 2ZO3H 2JETC 2ZDLA 1CU1A 1Z1JA 4OS7A 4LZ1H 2STAE 3L6PA 1GMCF 1EXFA 5HMAA 3D23A 3HGNA 1AMHA 2VGCC 1HDTH 3A8BA 4AB9A 1DDJA 1ELTA 1LVOA 2ZP0H 1TRYA 1F5RA 2CJIA 4AYVB 2A4OA 1C1NA 1C9TA 3BTEE 1HAPH 1VGCB 2GCHF 4J1YA 4AN7A 1XKAC 3KCGH 5IDKA 1ZRKA 1BHXB 2ZHDA 1GI3A 5PTPA 4NZQA 2G5NA 2FO9A 2BY7X 1FXYA 1ETRH 1O3BA 2A7HA 1C1WH 3LDXH 2Z94A 2RA3A 3BEIB 5I46H 2XYAA 1Z8JB 5H4IB 1S85A 1V2MT 3F9EA 7ESTE 4NWKA 1H4WA 1NO9H 1J9CH 3A85A 5GIBA 3T62A 5C2ZA 1SGIB 1QB1A 1UVOA 2ZNKH 2W3IA 4CH8B 2C93B 1DS2E 1C5MD 3RXTA 1OX1A 1UMAH 1WOFA 1O2TA 1DICA 3SU2A 1SGEE 2BMGB 3P8GA 2C90B 2ZFTA 4B2CA 1KTSB 2AYWA 1GMDF 1YPHC 2J4IA 4AFSA 1IHSH 1TNGA 4NZLA 2ZDKA 3UNQA 1G30B 1A5GH 1UCYK 3UUZA 4D9QA 1ZPBA 1EX3A 3NK8A 1AN1E 1G36A 1O2OA 3KNXA 4A6LA 4ZKOU 1W3CA 1MUEB 3BG4C 5TCCA 1C2JA 2AFQB 5GCHG 1BT7A 1TX7A 4AZ2B 3RXDA 4OGYA 4XFQA 1GG6B 2Y5HA 3ZZBA 2A5AA 3PO1B 3K9XB 2Z3DA 1UTLM 4ZXYH 1S82A 4Q2KA 2FDAA 2BDGA 4Y79A 5FPSA 1QTFA 1BQYA 1AWHB 3AW1A 3ZYEA 2HNTE 1C1TA 1KXCA 2D2DA 3NZIA 4YT6H 3KL6A 1ZRBA 3UR9A 1W11U 1RTFB 5AF9H 5JBBS 1NZQH 2ZCLP 3T5FH 2QF3A 1TNHA 4YT7H 1HAHH 3FANA 6GCHF 1HAOH 4INHA 3TJOA 1PPEE 2ZFFH 4AG2A 4I32A 3C27B 4X2WA 2FS8A 1YBWA 3E8LA 3GOVB 2HGTH 3MU0A 1O2IA 4ZHLU 2VH6A 5EXLA 1NPMA 3UR6A 3SV9A 3Q00A 6ESTA 1ETTH 2ZIQH 3QK1A 1TNIA 1SGQE 1ANEA 1C5VA 2VIWA 3EA9A 2HPPH 1GBMA 4HTCH 3OSYA 3TNTA 1CA0B 4JZFH 4K60A 1V3XA 2XBXA 3T27A 1MKXK 2ZGBH 3TH4H 3ITIA 4X1QU 2IPHA 1W12U 1C5PA 3I29A 3Q76A 1QY6A 3SO3A 3ATLA 2ZU2A 3ZVBA 2VVVA 1LQDB 2TPIZ 5J4SA 2BDYA 4DGJA 3PTBA 3VXFH 3S0NA 5LGOA 2PTNA 1BBRK 3RXOA 4U32A 1C1PA 1Q3XA 5HM9A 4WWYA 1PFXC 1RJXB 1KXBA 3D65E 1O3GA 1P05A 2CMYA 1OXGA 3GYMA 1XUJA 2ZGCA 2THFB 5FPYA 5JYIA 2Q1JA 1SHYA 1BB0B 1HV7A 5FX5A 1FN6A 1QB9A 1O3AA 1P2IA 1QL9A 1LVMA 1QURH 1O2ZA 2QXHA 1ABJH 2UWLA 7GCHG 1GCTB 3UOUA 1MTNB 3A84A 3RXBA 1C2GA 1P2MA 1NFXA 2H9TH 1BUIA 3KN2A 3MMGA 4R8TB 4VGCC 9LPRA 4F4OC 1MBMA 1TMBH 3SUGA 2ZF0H 5F8ZA 3QGJA 3A87A 2O8LA 5K0HA 4Y76A 1A61H 2A5KA 2VJ1A 3W94A 4FU8A 1TE0A 1GJDB 2AIPA 1SGNE 1KLJH 4AORA 2BZ6H 4BTIB 2FOAA 1P03A 1QA0A 1MKXH 1DITH 1VITF 4MQAA 4IN2A 3MO6A 1KDQA 1YCPM 1SQOA 4BTTB 1OP0A 1A0LA 1ZGVA 1ETSH 1QHRB 2PGBB 2R0LA 4TWWA 2QIQA 3CP7A 3EA7A 1GCDA 2NU3E 2ZFPH 1HJ8A 2AS9A 2XCFA 5EXNA 2ZDMA 1ARBA 3U9AH 2ZTZA 3M36A 1LCYA 1TALA 2F91A 8KME2 3RXJA 2ZPRA 1VCQA 2XXLA 2A0QB 4I7YH 5K7RA 4O3UA 1ELDE 1C1VH 2Y80A 1L4DA 2ANKH 4ABGA 1KY9A 1WSSH 4K3JA 5EQRA 1GJ8B 3BTFE 4MNXA 1J8AA 1VR1H 1P2JA 3SU0A 1O2NA 3LJOA 3TGJE 2BD9A 3RLYH 1TWXB 1A4WH 1ZJKA 5FAHA 4B73A 1AE5A 2OTVA 3GY3A 1TABE 5EG4A 3FAOA 3PMBB 1O5BB 1UVUH 2HNTF 5C5OA 3GCHC 1C2IA 4LK4A 2FOMB 1C5TA 3QZRA 2PLXA 4IW4E 1A46H 4KTUA 1HB0B 1TLDA 1TGSZ 2PTCE 5E0GA 5C3NA 1AD8H 3M3SA 2XBVA 1ELCA 4AX9H 3HATH 1O38A 1TOMH 2WYGA 5EGMA 1A5IA 1GI0A 2BD7A 1GBKA 4D9RA 3L3TA 4MLFB 1FPCH 3BTHE 5BRRE 1ESAA 2GX4A 2KAIA 2Z9GA 4X0WU 1EZUC 2QC2A 2EI7A 4ABHA 2FTMA 1Q2WA 1NFWA 1E37B 3ZV9A 1UHBA 4HZHA 1C1UH 1IQNA 1XUHA 4ZHAA 1Y3UA 2OCVB 1YPLH 1GDNA 3ATKA 3VPKA 2FOFA 1YGCH 1W0YH 1UK2A 1GJ6A 1GBFA 3ZYDA 2Y6TA 1O3IA 4CHAB 1U6QA 2BLOA 1K2I1 1Y3YA 1V6DA 3M5LA 1ZHRA 2VIVA 1XX9A 1N6YA 1HPGA 2B5TB 1T8LA 2J38A 4FUBA 1HAZB 2WPIS 1HAGE 4GCHF 1CHGA 3ZZ3A 4BXWA 3CENA 5DP6A 1K1PA 1NRSH 1MKWK 2QYIA 2SNVA 3MO3A 1NS3A 1LDTT 2W7SA 1A2CH 4JZEH 2J9NA 4XBDA 4OS2A 3A7ZA 5DP3A 1A0HB 2FI5E 1EPTB 1XVOA 2PR3A 4RKJB 3A7YA 1KLTA 1O3DA 4UFGH 2FX6A 3P8NA 1K28D 1GBHA 4X1RU 2XBWA 3EAJA 2GKVE 3TPIZ 2Y7ZA 3O8RA 1HAXB 1DLEA 5F8XA 1PPHE 2Z9IA 4IGDA 1CGJE 2ZU5A 1EJMA 1MCVA 3SUEA 3PM3A 2OC1A 3T28A 1D3QB 2BY9X 1JMOH 4MTBA 1MZDA 2GCTB 1CA8B 2QGRA 2ZHFH 1P57B 4UFEH 2EI6A 3RXQA 4Y0YE 3TLOA 1C5RA 3M5NA 4B1TA 2OC0A 2VWOA 2GDDA 1QL8A 5HM2A 1IQJA 1Y3VA 3SNAA 2C4FH 1N8OC 5DP5A 1GHBF 4DG4A 4JZIA 5T3HA 3P92A 1OWHA 1JWTA 1NESE 2P8OC 1C5XB 2UUKB 5DK1A 1DWDH 1AVGH 2IJOB 1ELAA 1D4PB 3ESTA 4CR5A 1CBWC 1ANDA 3VGCC 1ELFA 2GMTC 1V2OT 4X6NA 1GHZA 5HXFA 2C8XB 2OBQA 1L4ZA 4O97A 4K5ZA 2WINI 1FLEE 2RDLA 1SG8B 2HWLB 1TPOA 3AAVA 3SGAE 3RU4T 1FDPA 4FUHA 1C4Y2 5HYOA 2BD3A 3NXPA 1TYNA 2VWMA 1NM6A 2BLQA 2C8YB 2G81E 1P02A 4YLQH 5HGGA 2UWPA 3DD2H 3IWMA 4WMDA 2FI4E 5A8ZA 3UFAA 3B8JA 2VINA 2VU8E 1TPAE 1L0ZA 3O8CA 1C1MA 1C9PA 1GI2A 1YYY1 3B9FH 3KQBA 1B0FA 3U8OH 3G01A 2HVXA 1EJAA 1UTMA 2BM2A 1GHYH 1UK4A 3ZZ5A 4JK5A 1JRSA 2ZCKP 1DANH 1ELBA 1YPKH 3V7TA 6CHAB 2G55A 3HPTB 5ESTE 1GL1A 5T6FA 1DY9A 2OXSA 3SGBE 4UFFH 3E91A 4ASHA 3EGKH 2PSXA 5C5NA 2OC7A 5AHGH 1TAWA 3ZVDA 2I6SA 1TMTH 3V13A 1GBDA 5L2ZH 4HGCA 1ZTKA 1EZXC 4AFZA 1WTGH 1NFUA 3MH7A 2F9OA 3H7OA 2ZDAH 2SGFE 3JZ1B 3TU7H 1EP5A 4ZKRU 4J2YB 1FPHH 1V2VT 3ATIA 4FU9A 1EP6A 3UQOA 1XMNB 3T26A 1ZR0A 1EB1H 1C5NH 1FY1A 3E6PH 4I8HA 4Y6DA 3H7TA 2G51A 2LNCA 2AIQA 1K1NA 2A1DB 4LOYH 2UUYA 1Y5UT 1AY6H 1AI8H 2A7JA 2F3CE 1O2UA 1J15A 1DSTA 4D7FA 3ZVAA 4DY7B 1GPZA 1W14U 3QX5H 1P3EA 5CHAC 1WBGB 3P8OA 4UFDH 1QRWA 1FJSA 1LKBA 3RMNH 2WV5A 1C1QA 2CHAC 1PPZA 3M7TA 1AKSB 1CHOF 1UJ1A 1IQMA 1O3KA 1ORFA 3QGNB 8LPRA 4Y7BA 2FS9A 2Z9KA 2Q6FA 4NWLA 1AGJA 4MPUA 1G37A 2ZKSA 2TGAA 4FUGA 4K8YA 3A7TA 2H5CA 3ATWA 3U69H 4TYDA 2ESTE 2ANWA 1RGQA 3FFGA 2OQUA 1GJ7B 2VWNA 3RP2A 1FZZA 1ZPCA 1A1RA 1IQKA 2PKSB 1V2QT 4I8KA 3P6ZB 5ESBA 3ZZCA 2J34A 5TCAA 1PQAA 3RC6A 4ABIA 8GCHF 1LPGB 5CMXH 1DUEA 1MCTA 2FXRA 1HIAB 1HAYB 3RUOA 5GPIB 4ISNA 4Z6AH 1DSUA 2FWWA 3LT3A 1AUTC 1K1IA 1LTOA 1FY5A 1PPFE 3RXFA 1PPCE 3SN8A 3STJA 3TJVA 2ALPA 2A32A 4NIXA 4B74A 2P95A 1GJAB 1SLXB 2ZGXH 1DVAH 1GBBA 3LOXA 1HJAC 2RA0A 1F5KU 3RXGA 3F9HA 4ISLA 3PMJA 2V3HH 5TJXA 5A0AE 1MMJN 3K6YA 3UREA 1P09A 3GDVA 1TNKA 3P8FA 4KTCA 3EQ0H 2O8TA 3CS0A 4MPVA 3TK5A 3S9BA 2Z7FE 1C5YB 1N6XA 3LKWA 7LPRA 4JZDH 4Y8ZA 2JH5D 4GPGA 1O3CA 2G00A 4KTSA 1SGRE 1ZZZA 3T25A 4ESTE 3MNXA 1Z1IA 1G3CA 2BY6X 1AQ7A 1IAUA 3A7WA 1SLWB 1GI6A 5F03A 1F0TA 4HI3A 5FBIA 4PROA 5C20A 1EJNA 1ZMNA 3SOSA 1OP2A 3VB3A 1SOZA 1MAXA 4U2WA 1QRZA 1FQ3A 2A4RA 3OYPA 3RDZA 1TONA 2P3FH 4JYTA 3VB5A 1NT1A 1TA2A 4UD9H 3ZVGA 3UIRA 2TGPZ 1AB9C 1O3JA 2NU0E 2Y82A 3QTVH 1DWCH 3F6UH 1Z8GA 2GD4B 4WJG2 4INKA 3MU1A 1ZMLA 4ZHMU 1K22H 1AFQB 2O8UA 2GZ9A 2IN2A 4I33A 4BAMB 1LHGH 2JETB 2Z3CA 1CT2E 4FVDA 1O2RA 4DJZB 3DFJA 3ZZ4A 2VGCB 4WXVA 1F0UA 1PQ8A 2WV4A 1RD3B 1WYKA 1GMHF 3KIDU 2OLGA 2ZCHP 2XBYA 3MNBA 2C8WB 3TITA 1JBUH 1O3PB 1BTYA 4CRBA 3EDXB 1WQVH 2ZFRH 2A5IA 3ELAH 1GHBG 1SFIA 1BDAA 1TMUH 3SNBA 3RXLA 4CREA 3VEQB 1C1RA 1O2YA 2ANMH 2PKAB 3O8DA 3ENSB 1UCYH 4E06H 1IQEA 5GXPA 1QRXA 4ABBA 2FI3E 1AE8H 3MH5A 1WAYB 2GT8A 2XC5A 4X2XA 2Y5GA 2ODPA 2O9QA 1TPSA 5JPMH 1CQQA 3GY4A 3QLPH 1YPHE 4DURA 3PTNA 1J17T 5LPRA 2H1UA 1UTJA 3SUFA 1RIWC 2XC4A 1LMWB 1OKXA 3SJ9A 1QJ1B 2XTTB 2BD4A 1OP8A 4AG1A 4GAWA 1JRTA 5A8YA 3BN9A 1O34A 3BEUA 4BAQB 1K1JA 3KHVA 5LPFA 1PPBH 1T4VH 3GISB 1XXDA 3RXKA 1RXPA 3SJKA 3SQEE 1DM4B 3UTUH 1FUJA 3FZZA 4NIVA 1P11E 1YPJH 2VWLA 3NWUA 1Z6EA 4IMQA 1C2MA 1HAVA 3RLWH 1T32A 1SGYE 1O3LA 5BPEA 1TBRH 4ISOA 1UK3A 1E34B 4WF8A 5DGJA 3UY9A 1Z8IB 4FUDA 4FXGH 4XOJA 5GJ4B 2P59A 1AVXA 1S6HA 4MPXA 4OGXA 1PQ5A 1XUKA 1BJUA 2FEQH 1DUAA 2BHGA 3BG4B 2O8WA 3V12A 2BX3A 1MQ6A 1BTZA 1O5AB 3BIVH 4ZXXH 3LGWA 1AWFH 4Y10E 1C4U2 3BSQA 2BYAX 1ANBA 1PYTC 5EQSA 1EKBB 2PFEA 5DO4H 4I8GA 4X2VA 1TNLA 3Q3XA 4WMEA 4CH2B 1PYTD 4NA8A 4KELA 4B71A 4NSVA 2ZTXA 1QB6A 3BTWE 2XWBI 1G9IE 3BF6H 1RS0A 2XRCA 4UEHH 5C1YA 3SU4A 5DP9A 1NROH 5EPYA 1D3DB 1K21H 1VJAU 3BV9B 1OYTH 1O33A 5DP4A 1BJVA 1EUFA 1O2SA 1GI1A 1O30A 3SU6A 5GWZA 3SHCH 1NN6A 1GGDC 3MFJA 3M5OA 3SU5A 1W8BH 1ZLRA 2FPZA 2VNTA 1BBRH 4E05H 2BY8X 1LHEH 2BD2A 1C4V2 1O2GH 1W7XH 2WPKS 3RMOH 1YCPK 4ABAA 1O5GH 2PGQB 3MOCA 1EOJA 4MDSA 1DE7H 2FLRH 4K69A 1MU6B 3RXEA 1GHAG 3MU8A 1GHWH 2ZC9H 1V2KT 3PLKA 1V2NT 4K1EA 2BQ6B 1ESBA 1GMCG 5EPNA 1QQ4A 3RXAA 3SW2B 2BX4A 3A7VA 2AGGX 2BZAA 3HK6B 3KGPA 3M35A 3LGUA 3RC4A 2GT7A 1LHFH 3GY2A 4YOIA 2GZ8A 4FUFA 2GCHG 1SLUB 3DT0H 2ZEBA 1OSSA 2W7UA 5EQQA 1S81A 1C2FA 1O36A 2P3UB 3F68H 1F92A 3H5CB 1BMLA 1SQAA 2VVCA 1SGFG 5JB8S 3URCA 1WV7H 2ANYA 4Q7XA 3U1IB 5DJ7A 5DKMA 1UCYE 2PSYA 1IQLA 3STIA 3R0FA 5I25A 3R3GB 1C1SA 1C5UA 4X8UH 1T8OA 2QXGA 1TPPA 1O2MA 2GVFA 1C5SA 2FZZA 1ELEE 1C1OA 5EOKA 3NUMA 1AVWA 1SGDE 2CF9H 3W95A 1LKAA 1E0FD 3QO6A 5FX6A 1ABIH 3GCNA 3V0XA 4D8NA 1BCUH 3TVJB 4H6SB 2TRMA 4OS5A 5EXMA 2ALVA 2FYQA 5CE1A 4M7GA 1GI5A 1O2JA 1YCPH 4TPIZ 1GMDG 2PHBA 1AZZA 4DCDA 2ZECA 4Y8YA 4INLA 4FUJA 1M9UA 2ZU3A 2D1JA 2ASUB 1GBAA 3KQDA 3AASA 4IC5A 3SJIA 3S7HB 1QIXB 4DIIH 1YLDA 2NWNA 2TGDA 1GHVH 1L1NA 3EYDA 1G3BA 3ZZDA 1CGIE 4YM9A 4NIWA 1P9SA 1GI9B 2BOKA 1F0RA 2PWXA 6CHAC 2QXJA 4DT7B 2QV1A 3A7XA 4FUIA 1KYNA 4ZROA 4GHTA 1UTKA 2PV9B 1BRUP 1SI5H 1LPKB 1O0DH 1DWBH 1CGHA 1YP9A 2G8TA 3DA9B 1GJCB 3TIUA 3GY6A 3ZZAA 2FOCA 1S5SA 1HUTH 1SVPA 3MYWA 4K1TA 3I77A 1PPGE 1C2HA 1P2NA 3VFEA 4E7RG 1FY8E 4DVAU 2HOBA 2H5DA 1TRNA 1ARCA 9ESTA 1O3MA 4Q7YA 2A4GA 1OWDA 3M61U 2CV3A 5T6DA 4AGJA 1L2EA 5JBTA 1PJPA 2F9PA 1UTQA 1C5QA 1T7CA 1B7XB 4ZH8A 1K1OA 1SGPE 6GCHG 4DW2U 3QN7A 1W2KH 1V2UT 2BDAA 1ANCA 2K1QA 3T29A 3BIUH 1K9OE 2DE9A 3MWIU 3GCHB 1HYLA 1TQ0B 2YNBA 2OQ5A 2FP7B 3QDZB 1GMHG 1DPOA 1ZTJA 2ZA5A 4AGKA 1SLVB 3LPRA 2AGIX 1BBRE 2QN5T 1Z6JH 4Y7AA 4K1SA 3HGPA 1GVZA 3SBKA 3M37A 4Z0KA 5A0CA 1YKTA 1FMGA 3SJOA 3TK9A 1MKWH 1ELVA 1BIOA 2ZU1A 4A7IB 2ZQ2A 3RXRA 3GY7A 1LVBA 1WQSA 3O8BA 1JXPA 1T31A 3Q3YA 3RXMA 1THSH 2GV7A 3LONA 2CN0H 1O2LA 3RM2H 3NPSA 3ATMA 4TY7A 1AU8A 1XUIA 1O2KA 2J95A 3HK3B 3ZVEA 3FP8E 1VGCC 3ZZ7A 2QAAA 8ESTE 3RXCA 1LQEA 1G3DA 2BLVA 3F9FA 4XDEA 3MTYA 1BITA 3BEFB 3A88A 4CR9A 1FAKH 1S84A 4FVBA 1EQ9A 2BD5A 3MU5A 2SGPE 1NC6A 1VJ9U 2BTCE 2GGVB 4B76A 3DFLA 3ZZ8A 1H8IH 4GUXA 1F5LA 1C5OH 1TRMA 3S69A 3SUDA 1TNJA 4O9VA 1IQHA 1OWJA 1ZOMA 2ZG0H 3RXVA 2NU2E 2ZPQA 4DOQA 4ZMAH 3FZDA 2TIOA 1C5WB 1TA6A 1BMAA 2RCEA 4NIYA 2R9PA 1TB6H 7GCHF 5LPEA 3U1JB 2BDIA 4IS5A 4SGBE 1D6WA 2D8WA 3VB4A 2STBE 1D3TB 2QCYA 3ODDA 4CRGA 4GHQA 3SORA 2YOLA 2TGTA 3LGVA 2Y81A 1H9IE 4OS1A 1BTUA 2BDBA 3GCTF 1RTLA 3PMAB 1FAXA 2AH4X 2ZHEH 4ZKNU 4X2YA 4Q7ZA 2G52A 1IQIA 1THRH 2FODA 1W0ZU 1UO6A 2EA3A 3GDSA 5AFYH 1OS8A 1VITG 1Z8RA 4BAHB 2BQWB 2VIOA 5DPAA 1DY8A 1HXEH 5AVDA 5A2MH 1FIWA 1NRNH 2ZDNA 1GG6C 2XW9A 3PO1C 1GDUA 1EAXA 1N8OB 5IYTA 2J2UA 3TGKE 1P2QA 1Q31A 1E36B 3GY8A 1YM0A 1TGBA 2VIPA 3QZQA 1SBWA 2P8OB 2AEIH 2W26A 2YNAA 4JCNA 2A45B 1E35B 1CSOE 2OINA 4GLYA 1YF4A 2Q6GA 1IQGA 3P17H 1L1JA 3UWJH 1O3HA 1O3OA 3M3VA 2FOGA 1CBWB 4LXBH 3VGCB 1O5DH 2GMTB 3KQEA 3RXIA 2ZHWH 1Y3WA 1YPEH 2PUQH 2AMDA 1GBCA 3P95A 2ZTYA 2F9BH 1V2LT 1KSNA 4OS6A 3PWBA 1OPHB 4UE7H 3UNSA 1UVTH 2EI8A 3GDUA 2OC8A 2H6MA 3A8CA 3IG6B 4GSOA 1P2KA 1A0JA 5ETXA 2AMPA 1GJBB 5L6NH 2HNTC 3E0NB 4SGAE 1OWKA 3TH3H 2ZDVH 1Y3XA 1HCGA 2V3OH 1RRKA 4I8LA 4ZAEA 1KDQB 3FP7E 2FX4A 1MQ5A 3UPEA 2OUAA 4XE4A 2WPLS 2F9NA 1MAYA 1EPTA 2ZFQH 4FU7A 1CA0C 4NGAH 2UWOA 1XUGA 1OWEA 3BG8A 3SHAH 4BANB 4NG9H 1GI4A 1P10A 1TX6A 2R3YA 1B5GH 3OTJE 2SFAA 4BNRA 4A5TS 2B9LA 3GICB 2BY5X 1EAIA 3SI4H 4IMZA 1MTWA 4Y0ZE 2R3UA 4A1XA 3ZVFA 3NCLA 1SOTA 1ZSJA 4WY3A 4AFUA 4RSPA 5FCRA 1SMFE 3A80A 1C2LA 4MNVA 2Z9JA 2FLBH 1X7AC 1QA7A 2QF0A 1GWAA 1QL7A 1VCPA 3M5MA 3P70B 4X6OA 1QBVH 1D3PB 1SGTA 1UVPA 1GVLA 1BMMH 4YO9A 2OP9A 3MO9A 4GCHG 4B2AA 4NFFA 2ZU4A 5B6OA 2BB4A 3E90B 1ESTA 1CT0E 1OOKB 4K2YA 4B75A 3SV6A 3RU4D 1QNJA 1KLIH 2Z3EA 2WYJA 4AYYB 4MNYA 2Z6BD 3ZVCA 4FUCA 4XBCA 4JK6A 4Q80A 1EZQA 1G2MA 3RMLH 5FHTA 1XUFA 4H6TA 1SGFA 1YLCA 1UTPA 4NFEA 1GCTC 1MTNC 1YPGH 2BVSH 1A7SA 1MH0A 1GVKB 1H9HE 3BTDE 1Y5BT 2XNIA 4WH8A 5JBAS 5CHAB 1HJ9A 2KAIB 1W10U 3AAUA 1AO5A 4D7GA 4XBBA 5DG6A 4HFPB 1EB2A 2G4TA 4BTUB 1UHBB 2W5EA 1ELGA 1WTHD 4ISIH 5F8TA 2CHAB 3C1KA 1F0SA 1MTVA 4CRAA 1QBNA 1O2XA 2BVXH 3S9CA 4UDWH 1KXFA 2BOHB 1O2VA 4ABJA 2F9UA 2FOEA 3A83A 3I78A 3NKKA 4AOQA 2R2MB 5AFZH 1A5HA 1HGTH 2BLWA 2WPHS 3TJUA 1AUJA 1QJ6B 3Q77A 5J4QA 1O31A 1XXFA 3S7KB 3LH3A 2NU1E 3RXSA 2W3KA 3LGIA 4DIHH 1NRQH 1UTNA 1F7ZA 1F2SE 1QGFA 5FCKA 1NRRH 3MH4A 3RC5A 1WCZA 3RXPA 1SFQB 2P3TB 5A0BA 5GDSH 1BA8B 4BAOB 1O2QA 3RMMH 1SL3A 1TBZH 2I6QA 3OY6U 1SR5C 3SV2H 1ZSKA 1TIOA 2FOHA 1OWIA 3UWIA 3AVZA 1NU9A 2BXTH 1AZ8A 1NRPH 3TNSA 1DOJA 4WH6A 1A3EH 1P3CA 5L2YH 3MNSA 5E2PA 3OY5U 1LVYA 1G3EA 1HJAB 1LPZB 2H2ZA 1O37A 1FNIA 3RU4E 2C8ZB 1SQTA 1V2RT 4X8TH 1BHXF 3HKJB 2Q6DA 1O3NA 3E0PB 3LGYA 3TH2H 5DP8A 3M7QA 3CS7A 5E0HA 1P04A 2BQ7B 1E38B 5JB9S 1Z71A 1TGCA 2ODYB 1GI7B 1L1GA 5A8XA 4ZKSU 2AMQA 7KMEH 3T2NA 2NU4E 1K1MA 2ZFSA 4I8JA 2GDEH 1O3EA 4Y71A 3LGTA 3KEEA 3LU9B 4ABDA 1DFPA 3MH6A 4BAKB 4FUEA 1P01A 2FMJA 1AKSA 2Z9LA 2ZWLH 2QXIA 3PMHB 4K8BA 1T8MA 1JIRA 4X1SU 1NU7B 1W13U 3SI3H 3EE0B 3OU0A 1BMNH 3PLBA 1BTWA 4MG3A 4A1TA 4CHAC 3DHKH 3Q3KA 1GBEA 1AB9B 1ZJDA 3KF2A 1K1LA 2BDCA 1SC8U 3F9GA 3GCTG 1MD8A 2Y7XA 3D49H 4NSYA 4Y11E 1EATA 1FN8A 1P9UA 2V35A 1Y59T 2P94A 2FESH 3PV4A 1TBQH 3M3TA 3VB7A 2SGEE 3FVFB 4WMFA 1QBOA 5F6MA 1HIAA 1CT4E 2HRVA 2SGDE 1S0RA 1GL0E 4MVNA 1P06A 1RTKA 1CE5A 1P2OA 1C2EA 3GYLB 1SB1H 3TJNA 5G4BA 5E8EH 1EPTC 1GJ5H 1OYQA 3RM0H 1TGNA 5C67A 1J14A 3SV7A 2C3SA 2ZHQH 2H9HA 1IHTH 5DP7A 5L30H 3LIWA 2FM2A 3KQCA 3BTKE 5SGAE 5FPTA 4YOJA 3SNCA 5C1XA 1DXPA 3SQHE 3SNDA 4YTAA 5FXLA 1CHOG 1YPMH 1GI8B 4OS4A 1INCA 4X6MA 1GJ4H 2GCTC 2AGEX 4A92A 1JIMA 2OD3B 1GBTA 3LC3A 4YESB 1GBIA 1MZAA 2VIQA 2IOTA 1O32A 3U8RH 3K65B 2SGAA 1CO7E 2VVUA 1RIWB 4MPWA 1V2ST 1H1BA 1MBQA 4X8VH 4TPYA 2JH0D 4YZUA 4ZUHA 2J92A 4I31A 8GCHG 1C2KA 2G4UA 1J16A 1GBJA 3GCOA 3U98H 1FI8A 1EOLA 1W7GH 3A86A 1TGTA 4D76A 2P16A 3ODFA 1FV9A 2ZPSA 2R0KA 1NY22 3A8AA 1ZMJA 1D6RA 1KTTB 4CRFA 2VH0A 3B23B 5EU8A 4BOHA 2TBSA 1RFNA 1O3FA 2EEKA 3A8DA 3BTGE 3M7UA 4NCYA 4CRCA 1BOQA 1KXEA 3UOPA 3SZNA 2EC9H 1AFEH 3LH1A 1IOEA 3LC5A 3S9AA 4KGAA 5T6GA 1HAIH 2UUFB 3VB6A 5A09A 2JH6D 4JYUH 4VGCB 4CBNA 4KKDA 4RN6A 2ODQA 4NA9H 1AIXH 4H42U 2DE8A 1TQ7B 1PQ7A 3SU1A 2ULLA 1O35A 2A31A 3JZ2B 4JZ1A 4ISHH 5EODA 4E7NA 2CGAA 1QFKH 3SV8A 5FBEA 1S6FA 1JOUB 4O3TA 3UQVA 1WUNH 1O5CB 3PYHA 4IC6A 3PLPA 1HNEE 1O2WA 3E3TA 1N1LA 3RXHA 4X6PA 4CBOA 2FYRA 5GCHF 2G5VA 2PKAA 1DWEH 4H4FA 2JKHA 3EA8A 3HKIB 1IQFA 2BD8A 1EASA 1GGDB 2DUCA 1O39A 1Y5AT 1H9LB 1S83A 2HALA 3D62A 2CF8H 2ZI2H 3BTQE 4RKOB 5E0JA 1BRCE 1LHDH 1ZHPA 4F49A 2FIRH 2PW8H 4X1NU 1EAUA 1GJ9B 1GBLA 3F1SB 2ZGJA 1DT2A 2B0FA 4NA7A 4UONA 3MI4A 4B2BA 4WXIA 1DX5M 1O5FH 1XM1A 2HPQH 1BTXA 2UUJB 3BTME 3WY8A 1QQUA 4XSKU 2VIDA 1P12E 3U8TH 4A1VA 1ZSLA 4TY6A 1NFYA 1O5EH 1MU8B 3UNRA 1KXDA 1QJ7B 4O03A 2A7CA 4GVUA 2V0BA 1ZYOA 2GZ7A 1XVMA 4U01A 1MTUA 1T4UH 2GTBA 1A3BH 2QA9E 1BTPA 1VZQH 2Y5FA 2ZQ1A 1UTOA 6LPRA 2XCNA 3TK6A 3AW0A 1V2WT 4AB8A 1H8DH 3QWCH 1ZTLA 1C5LH 2R2WU 1Y8TA 1MTSA 2ILNA 1DXWA 4THNH 1ZHMA 3RXUA 1KXAA 3GY5A 3ZV8A 2LPRA 1G32B 3MNCA 1C5ZB 3OX7U 4Y8XA 2D26C 1C2DA 2BVRH 2XWAA 1D9IA 1HBTH 2ZGHA 1QCPA 2V6NA 1O2PA 4ABFA 1HLTH 5EW2H 1GDQA 3QTOH 2CXVA 3PROA 3MHWU 3A82A 1LHCH 5C1UA 2PKSC 1MD7A 3MU4A 1HRTH 2SGQE 3QUMP 1SHHB 1ID5H 3E1XB 5EW1H 4LZ4B 2GP9B 1THPB 2O8MA 3A89A 1VITH 2GV6A 4ABEA 4MNWA 4R0IA 3E16B 2B8OH 1ACBE 1P0SH 4KP0A 2M5TA 1FONA 1S0QA 1V2JT 2J94A 1VCWA 5JBCS 3L33A 5ABWA 3A81A 1SSXA 1SPJA 1DLKB 3K6ZA 5E2OA 3FP6E 2VB0A 1HFDA 3LJJA 3N7OA 2HLCA 3ZZ9A 3PB1E 3PWCA 4U30A 2F83A 2FTLE 1V2PT 4JYVH 1TOCB 2BXUH 1SGCA 4JMYA 1ZGIA 2OBOA 1UVSH 5LH8A 1TFXA
chains in the Genus database with same CATH superfamily
1BRAA 4YOGA 3URDA 1WU1A 3DCLA 2WPMS 2B7DH 2H9EH 3K2UA 4TWYA 2F9VA 3VXEH 4X1PU 1QR3E 3ZZ6A 3W1EA 2PUXB 1KIGH 4CRDA 2WPJS 4IBLH 4X8SH 5JDUB 1FY4A 1HXFH 2WUCA 4YLUA 2RG3A 1YC0A 1AHTH 4XRNA 1FIZA 2QY0B 1FX0B 4BXSA 3SU3A 2A2XH 4QT8C 2K0QA 1LO6A 3SNEA 1HAVB 1W0KD 1Z7KA 2FOBA 4WVPE 1BTHH 4AFQA 1G2LA 1FY3A 2BDHA 3SJ8A 1TX8A 1EAWA 1CVWH 4IN1A 2AERH 1XKBC 1V2TT 2SNWA 1O2HA 1BRBE 2P93A 1GHXH 2XC0A 3DUXH 3SGQE 1B0EA 3TGIE 2ZZUH 1BZXE 1P8VC 1GHAF 1ZPZA 3BTTE 1AFQC 3IITA 1T8NA 2A4QA 2WUBA 2A2QH 3V3MA 1EZSC 1NTPA 2ZO3H 2JETC 2ZDLA 1CU1A 1Z1JA 4OS7A 4LZ1H 2STAE 3L6PA 1GMCF 1EXFA 5HMAA 3D23A 3HGNA 1AMHA 2VGCC 1HDTH 2W6JD 3A8BA 4AB9A 1DDJA 1ELTA 1LVOA 2ZP0H 1TRYA 1F5RA 2CJIA 4M9FA 2A4OA 1C1NA 1C9TA 3BTEE 4AYVB 1HAPH 1VGCB 2GCHF 4J1YA 4AN7A 1XKAC 3KCGH 5IDKA 1ZRKA 1BHXB 2ZHDA 1GI3A 5PTPA 4NZQA 2G5NA 2FO9A 2BY7X 1FXYA 1ETRH 2RDEA 1O3BA 2A7HA 1C1WH 3LDXH 2Z94A 2RA3A 3BEIB 5I46H 2XYAA 1Z8JB 5H4IB 1S85A 1V2MT 3F9EA 7ESTE 3DSGA 4NWKA 1H4WA 3PRDA 1NO9H 1J9CH 1S6LA 3A85A 5GIBA 3T62A 5C2ZA 1SGIB 1QB1A 1UVOA 2ZNKH 2W3IA 4CH8B 2C93B 1DS2E 1C5MD 4FETA 3RXTA 1OX1A 5EJZA 1UMAH 1WOFA 1O2TA 1WXRA 1DICA 3SU2A 1SGEE 2BMGB 3P8GA 2C90B 2ZFTA 4B2CA 1KTSB 2AYWA 1GMDF 1YPHC 2J4IA 4AFSA 1IHSH 1TNGA 4NZLA 3KYFA 2ZDKA 3UNQA 1G30B 1A5GH 1UCYK 3UUZA 4D9QA 1ZPBA 1EX3A 3NK8A 1AN1E 1G36A 1O2OA 3KNXA 4A6LA 4ZKOU 1W3CA 1MUEB 3BG4C 5TCCA 1C2JA 1COWD 2AFQB 3SZEA 5GCHG 5KGOA 1BT7A 1TX7A 4AZ2B 3RXDA 4OGYA 4XFQA 1SKYE 1GG6B 2Y5HA 3ZZBA 2A5AA 3F3BA 3PO1B 3K9XB 2Z3DA 1UTLM 4ZXYH 1S82A 4Q2KA 2FDAA 2J5UA 2BDGA 4Y79A 5FPSA 1QTFA 1BQYA 1AWHB 3AW1A 3ZYEA 2HNTE 1C1TA 1KXCA 2D2DA 3NZIA 4YT6H 3KL6A 1ZRBA 3UR9A 1W11U 1RTFB 4P00A 5AF9H 5JBBS 1NZQH 2ZCLP 3T5FH 2QF3A 1TNHA 4YT7H 1HAHH 3FANA 6GCHF 1HAOH 4INHA 3TJOA 1PPEE 2ZFFH 4AG2A 4I32A 3C27B 4X2WA 2FS8A 3GS9A 3F2HA 1YBWA 3E8LA 3GOVB 2HGTH 3MU0A 1O2IA 4ZHLU 2VH6A 5EXLA 1NPMA 3UR6A 3SV9A 3Q00A 6ESTA 1ETTH 2ZIQH 3QK1A 1TNIA 1SGQE 1ANEA 1C5VA 2VIWA 3EA9A 2HPPH 1GBMA 4HTCH 3OSYA 3TNTA 1CA0B 2PP6A 2JIZD 4JZFH 2WPDD 4K60A 1V3XA 2XBXA 3T27A 1MKXK 2ZGBH 3TH4H 3ITIA 4X1QU 2IPHA 1W12U 1C5PA 3I29A 3Q76A 1QY6A 3SO3A 3ATLA 2ZU2A 3ZVBA 5EJ1A 2VVVA 1LQDB 2TPIZ 5J4SA 1YY3A 2BDYA 4DGJA 3PTBA 3VXFH 3S0NA 5LGOA 2PTNA 1BBRK 3RXOA 2J97A 4U32A 1C1PA 1Q3XA 5HM9A 4WWYA 1PFXC 1RJXB 1KXBA 3D65E 1O3GA 1P05A 3OFND 2CMYA 1OXGA 3GYMA 1XUJA 2ZGCA 2THFB 5FPYA 5JYIA 2Q1JA 1SHYA 1BB0B 1YWUA 1HV7A 5FX5A 1FN6A 1QB9A 1O3AA 1P2IA 1QL9A 1LVMA 1QURH 1O2ZA 2QXHA 5B6LA 1ABJH 2UWLA 7GCHG 1GCTB 3UOUA 1MTNB 2KZ4A 3A84A 3RXBA 1C2GA 1H8HD 1P2MA 1NFXA 2H9TH 1BUIA 2WHXA 3KN2A 3MMGA 4R8TB 4VGCC 9LPRA 4F4OC 1MBMA 1TMBH 3SUGA 2ZF0H 5F8ZA 3QGJA 3A87A 2O8LA 5K0HA 4Y76A 1A61H 2A5KA 2VJ1A 3W94A 4FU8A 1TE0A 1GJDB 2AIPA 1SGNE 1KLJH 4AORA 4Q4LA 2BZ6H 4BTIB 2FOAA 1P03A 1QA0A 1MKXH 1DITH 1VITF 4MQAA 4IN2A 3MO6A 1KDQA 1YCPM 1SQOA 4BTTB 1OP0A 1A0LA 1ZGVA 1ETSH 1QHRB 2PGBB 2R0LA 4P02A 4TWWA 2QIQA 1QZ8A 3CP7A 3EA7A 1GCDA 2NU3E 2ZFPH 1HJ8A 2AS9A 2XCFA 5EXNA 2ZDMA 1ARBA 3U9AH 2ZTZA 3M36A 1LCYA 1TALA 2F91A 8KME2 3RXJA 2ZPRA 1VCQA 2XXLA 2A0QB 4I7YH 5K7RA 4O3UA 1ELDE 1C1VH 2Y80A 1L4DA 2ANKH 4ABGA 1KY9A 1WSSH 4K3JA 5EQRA 1GJ8B 3BTFE 4MNXA 1J8AA 1VR1H 1P2JA 3SU0A 1O2NA 3LJOA 3TGJE 2BD9A 3RLYH 1TWXB 1A4WH 1ZJKA 5FAHA 4B73A 1AE5A 2OTVA 3GY3A 1TABE 5EG4A 3FAOA 3PMBB 1O5BB 1UVUH 2HNTF 5C5OA 5C0UA 3GCHC 1C2IA 4LK4A 4OM9A 3ZIAD 2FOMB 1C5TA 3QZRA 2PLXA 4IW4E 1A46H 4KTUA 1HB0B 1TLDA 1TGSZ 2PTCE 5E0GA 4XD7D 3F2GA 5C3NA 1AD8H 3M3SA 2XBVA 1ELCA 4AX9H 3HATH 1O38A 1TOMH 2WYGA 2KCAA 5EGMA 1A5IA 1GI0A 2BD7A 1GBKA 4D9RA 3L3TA 4MLFB 1FPCH 3BTHE 5BRRE 1ESAA 2GX4A 2KAIA 2Z9GA 4X0WU 1EZUC 2QC2A 2EI7A 4ABHA 2FTMA 1Q2WA 2YMSC 1NFWA 1E37B 3ZV9A 1UHBA 2YMSD 4HZHA 1C1UH 1IQNA 1XUHA 4ZHAA 1Y3UA 1YPLH 2OCVB 1GDNA 3ATKA 3OAAD 3VPKA 2FOFA 1YGCH 1W0YH 1UK2A 1GJ6A 1GBFA 3ZYDA 2Y6TA 1O3IA 4CHAB 1U6QA 2BLOA 2J98A 3F0PA 1K2I1 1Y3YA 1V6DA 3M5LA 1ZHRA 2VIVA 1XX9A 1N6YA 1HPGA 2B5TB 1T8LA 2J38A 4FUBA 1HAZB 2WPIS 1HAGE 4GCHF 1CHGA 2AHME 3ZZ3A 4BXWA 3CENA 5DP6A 1K1PA 1NRSH 1MKWK 2QYIA 2SNVA 3MO3A 1NS3A 1LDTT 2W7SA 1A2CH 4JZEH 2J9NA 4XBDA 4OS2A 3A7ZA 5DP3A 1A0HB 2FI5E 1EPTB 1XVOA 2PR3A 4RKJB 5HKKD 3A7YA 1KLTA 1O3DA 4UFGH 2FX6A 3P8NA 1K28D 1GBHA 4X1RU 2XBWA 3EAJA 2GKVE 3TPIZ 2Y7ZA 5EJLA 3O8RA 1HAXB 1DLEA 5F8XA 1PPHE 2Z9IA 4IGDA 1CGJE 2ZU5A 1EJMA 1MCVA 3SUEA 3PM3A 2OC1A 3T28A 1D3QB 2BY9X 3N99A 1JMOH 4MTBA 1MZDA 2GCTB 1CA8B 4ACAA 2QGRA 2RFKC 2ZHFH 1P57B 4UFEH 2EI6A 3RXQA 4Y0YE 3TLOA 1C5RA 3M5NA 4B1TA 2OC0A 2VWOA 5C94A 2GDDA 1QL8A 5HM2A 1IQJA 1Y3VA 3SNAA 2C4FH 1N8OC 5DSFA 5DP5A 1GHBF 4DG4A 4JZIA 5T3HA 3P92A 1OWHA 1JWTA 1NESE 2P8OC 1C5XB 2UUKB 5DK1A 1DWDH 1AVGH 2IJOB 1ELAA 1D4PB 3ESTA 4CR5A 1CBWC 1ANDA 3VGCC 1ELFA 2GMTC 1V2OT 4X6NA 1GHZA 5HXFA 2C8XB 2OBQA 1L4ZA 4O97A 4K5ZA 2WINI 1FLEE 2RDLA 1SG8B 2HWLB 1TPOA 3AAVA 3SGAE 3RU4T 1FDPA 4FUHA 1C4Y2 5HYOA 2BD3A 3NXPA 1TYNA 3UAIC 2VWMA 1NM6A 2BLQA 2C8YB 2G81E 1P02A 4YLQH 5HGGA 2UWPA 3DD2H 3IWMA 3KQ5A 4WMDA 2FI4E 5A8ZA 3UFAA 3B8JA 4YXWD 2VINA 2VU8E 1TPAE 1L0ZA 3O8CA 1C1MA 1C9PA 1GI2A 1YYY1 3B9FH 3KQBA 1B0FA 3U8OH 3G01A 2HVXA 1EJAA 1UTMA 2BM2A 1GHYH 4RT0A 5C0TA 1UK4A 3ZZ5A 1E1QD 4JK5A 1JRSA 2ZCKP 1DANH 2GJGA 1ELBA 1YPKH 3V7TA 6CHAB 2G55A 3HPTB 5ESTE 1GL1A 5T6FA 1DY9A 2OXSA 3SGBE 4UFFH 3E91A 4ASHA 3EGKH 2PSXA 2F43B 5C5NA 2OC7A 5AHGH 1TAWA 3ZVDA 2I6SA 1TMTH 3V13A 1GBDA 5L2ZH 2HLDD 4HGCA 1ZTKA 1EZXC 4AFZA 1WTGH 1NFUA 3MH7A 2F9OA 3H7OA 2ZDAH 2SGFE 3JZ1B 3TU7H 1EP5A 4ZKRU 3EE7A 3N7EA 4J2YB 1FPHH 1V2VT 3ATIA 4FU9A 1EP6A 3UQOA 1XMNB 3T26A 1ZR0A 1EB1H 1C5NH 1FY1A 3E6PH 4I8HA 4Y6DA 3H7TA 2G51A 2LNCA 2AIQA 1K1NA 2A1DB 3MQKC 4LOYH 2UUYA 1Y5UT 1AY6H 1AI8H 2A7JA 2F3CE 1O2UA 1J15A 1DSTA 4D7FA 3ZVAA 4DY7B 1GPZA 1W14U 3QX5H 1P3EA 5CHAC 1WBGB 1K0HA 3P8OA 4UFDH 1QRWA 1FJSA 1LKBA 3RMNH 2WV5A 1C1QA 2CHAC 1PPZA 3M7TA 1AKSB 1CHOF 1UJ1A 1IQMA 1O3KA 1ORFA 3QGNB 8LPRA 4Y7BA 2FS9A 2Z9KA 2Q6FA 4NWLA 1AGJA 4MPUA 1G37A 2ZKSA 2TGAA 4FUGA 4K8YA 3A7TA 2H5CA 3ATWA 3U69H 4TYDA 2ESTE 2ANWA 3OEHD 1RGQA 3FFGA 2OQUA 1GJ7B 2VWNA 3RP2A 1FZZA 1ZPCA 1A1RA 1UW7A 1BMFD 1IQKA 2PKSB 1V2QT 4I8KA 3P6ZB 5ESBA 3ZZCA 2J34A 5TCAA 1PQAA 3RC6A 4ABIA 8GCHF 1LPGB 5CMXH 1DUEA 1MCTA 2FXRA 3SYJA 1HIAB 1HAYB 2KCPA 3RUOA 5GPIB 4ISNA 4Z6AH 1DSUA 2FWWA 3LT3A 1AUTC 5CHBA 1K1IA 1LTOA 1FY5A 1PPFE 3RXFA 1PPCE 3SN8A 3STJA 3TJVA 2ALPA 2A32A 4NIXA 4B74A 2P95A 1GJAB 1SLXB 2ZGXH 1DVAH 1GBBA 3LOXA 1HJAC 2RA0A 1F5KU 3RXGA 3F9HA 4ISLA 3PMJA 2V3HH 5TJXA 5A0AE 1MMJN 3K6YA 3UREA 1P09A 3GDVA 1TNKA 3P8FA 4KTCA 3EQ0H 2O8TA 3CS0A 4MPVA 3TK5A 3S9BA 2Z7FE 1C5YB 1N6XA 3LKWA 7LPRA 4JZDH 4Y8ZA 2JH5D 4GPGA 1O3CA 2G00A 4KTSA 1SGRE 1ZZZA 3T25A 4ESTE 3MNXA 1Z1IA 1G3CA 2BY6X 1AQ7A 1IAUA 3A7WA 1SLWB 5HIYA 1GI6A 5F03A 1F0TA 4HI3A 5FBIA 4PROA 5C20A 1EJNA 1ZMNA 3SOSA 1OP2A 3VB3A 1SOZA 1MAXA 4U2WA 1QRZA 1FQ3A 2A4RA 3OYPA 3RDZA 1TONA 2P3FH 4JYTA 3VB5A 1NT1A 1NBMD 1TA2A 4UD9H 3ZVGA 3UIRA 2TGPZ 1AB9C 1O3JA 2NU0E 2Y82A 3QTVH 1DWCH 3F6UH 1Z8GA 2GD4B 4WJG2 4INKA 3MU1A 1ZMLA 4ZHMU 1K22H 1AFQB 2O8UA 2GZ9A 2IN2A 1SQRA 4I33A 4BAMB 3KYGA 1LHGH 2JETB 2Z3CA 1CT2E 4FVDA 1O2RA 4DJZB 3DFJA 3ZZ4A 2VGCB 4WXVA 1F0UA 2JDID 1PQ8A 2WV4A 5IK2D 1RD3B 1WYKA 1GMHF 3KIDU 2OLGA 2ZCHP 2XBYA 3MNBA 2C8WB 3TITA 1JBUH 1O3PB 1BTYA 4CRBA 3EDXB 1WQVH 2ZFRH 2A5IA 3ELAH 1GHBG 1SFIA 1BDAA 1TMUH 3SNBA 3RXLA 4CREA 3VEQB 1C1RA 1O2YA 2ANMH 2PKAB 3O8DA 3ENSB 1UCYH 4E06H 1IQEA 5GXPA 1QRXA 4ABBA 2FI3E 1AE8H 3MH5A 1WAYB 2KX4A 2GT8A 2XC5A 4X2XA 3DSPA 2Y5GA 2ODPA 2O9QA 1TPSA 5JPMH 1CQQA 3GY4A 3QLPH 1YPHE 4DURA 3PTNA 1J17T 5LPRA 2H1UA 1UTJA 3SUFA 3OTPA 1RIWC 2XC4A 1LMWB 3VG8A 1OKXA 3SJ9A 1QJ1B 2XTTB 2BD4A 1OP8A 4AG1A 4GAWA 1JRTA 5A8YA 3BN9A 1O34A 3BEUA 4BAQB 1K1JA 3KHVA 5LPFA 1PPBH 1T4VH 3GISB 1XXDA 3RXKA 1RXPA 3SJKA 3SQEE 1DM4B 3UTUH 1FUJA 3FZZA 4NIVA 1P11E 1YPJH 2VWLA 3NWUA 1Z6EA 4IMQA 1C2MA 1HAVA 2KCYA 3RLWH 1T32A 1SGYE 1O3LA 5BPEA 1TBRH 4ISOA 1UK3A 1E34B 4WF8A 5DGJA 3UY9A 1Z8IB 4FUDA 4FXGH 4XOJA 5GJ4B 2P59A 1AVXA 1S6HA 4MPXA 4OGXA 1PQ5A 1XUKA 1BJUA 2FEQH 1DUAA 2BHGA 3BG4B 2O8WA 3V12A 2BX3A 1MQ6A 1BTZA 1O5AB 3BIVH 4ZXXH 3LGWA 1AWFH 4Y10E 2JJ1D 1C4U2 1OHHD 3BSQA 2BYAX 1ANBA 1PYTC 5EQSA 1EKBB 1W0JD 2PFEA 5DO4H 4I8GA 4X2VA 1TNLA 3Q3XA 4WMEA 4CH2B 1PYTD 4NA8A 2OK5A 4KELA 4B71A 4NSVA 2ZTXA 1QB6A 3BTWE 2XWBI 1G9IE 3BF6H 1RS0A 2XRCA 4UEHH 5C1YA 3SU4A 5DP9A 1NROH 5EPYA 1D3DB 1K21H 1VJAU 3BV9B 1OYTH 1O33A 5DP4A 1BJVA 1EUFA 1O2SA 1GI1A 1O30A 2IPQX 3SU6A 3U28C 5GWZA 3SHCH 1NN6A 1GGDC 3PRBA 3MFJA 3M5OA 3SU5A 1W8BH 1ZLRA 2FPZA 2VNTA 1BBRH 2XNDD 4E05H 2BY8X 1LHEH 2BD2A 1C4V2 1O2GH 1W7XH 2WPKS 3RMOH 1YCPK 4ABAA 1O5GH 2PGQB 3MOCA 1EOJA 4MDSA 1DE7H 2FLRH 4K69A 1MU6B 3RXEA 1GHAG 2VBCA 3MU8A 1GHWH 3PV2A 2ZC9H 1V2KT 3PLKA 1V2NT 3H09A 4K1EA 2BQ6B 1ESBA 1GMCG 3F0OA 5EPNA 1QQ4A 3RXAA 3SW2B 2BX4A 3A7VA 2AGGX 2BZAA 3HK6B 3KGPA 3M35A 3LGUA 3RC4A 2GT7A 1LHFH 3GY2A 4YOIA 2GZ8A 5CDFE 4FUFA 2GCHG 1SLUB 3DT0H 2ZEBA 1OSSA 2W7UA 5EQQA 1S81A 3DSOA 1C2FA 5T1VA 1O36A 2P3UB 3F68H 1F92A 3H5CB 1BMLA 1SQAA 2VVCA 1SGFG 5JB8S 3URCA 1WV7H 2ANYA 4Q7XA 3U1IB 5DJ7A 3FN8A 5DKMA 1UCYE 2PSYA 1IQLA 3STIA 3R0FA 5I25A 3R3GB 1C1SA 1C5UA 4X8UH 1T8OA 2QXGA 1TPPA 1O2MA 2GVFA 1C5SA 2FZZA 1ELEE 1C1OA 5EOKA 3NUMA 1AVWA 1SGDE 2CF9H 3W95A 1LKAA 1E0FD 3QO6A 5FX6A 1ABIH 3GCNA 3V0XA 4D8NA 1BCUH 3TVJB 4H6SB 2TRMA 4OS5A 5EXMA 2ALVA 2FYQA 5CE1A 4M7GA 1GI5A 1O2JA 1YCPH 4TPIZ 1GMDG 2PHBA 1AZZA 4DCDA 2ZECA 4DT4A 4Y8YA 4INLA 4FUJA 1M9UA 2ZU3A 2D1JA 2ASUB 1GBAA 3KQDA 3AASA 4IC5A 3SJIA 3S7HB 1QIXB 4DIIH 1YLDA 2NWNA 2TGDA 2QE7D 1GHVH 1L1NA 3EYDA 1G3BA 3ZZDA 1CGIE 4YM9A 4NIWA 1P9SA 1GI9B 2BOKA 1F0RA 2PWXA 6CHAC 2QXJA 4DT7B 1WDIA 2QV1A 3A7XA 4FUIA 1KYNA 4ZROA 3PV5A 4GHTA 1UTKA 2PV9B 1BRUP 1SI5H 1LPKB 1O0DH 1DWBH 1CGHA 2XOKD 1YP9A 2G8TA 3DA9B 1GJCB 3FO8D 3TIUA 3GY6A 3ZZAA 2FOCA 1S5SA 4ACBA 1HUTH 1SVPA 3MYWA 4K1TA 4I86A 3I77A 1PPGE 1C2HA 1P2NA 3VFEA 4E7RG 1FY8E 4DVAU 2HOBA 2H5DA 1TRNA 1ARCA 9ESTA 2K8IA 1O3MA 4Q7YA 2A4GA 1OWDA 3M61U 2CV3A 5T6DA 4AGJA 1L2EA 5JBTA 1PJPA 2F9PA 1UTQA 1C5QA 1T7CA 1B7XB 4ZH8A 1K1OA 1SGPE 6GCHG 4DW2U 3QN7A 1W2KH 1V2UT 2BDAA 1ANCA 2K1QA 3T29A 3BIUH 1K9OE 2DE9A 3MWIU 3GCHB 1HYLA 1TQ0B 2YNBA 2OQ5A 2FP7B 3QDZB 1GMHG 1DPOA 1ZTJA 2ZA5A 4AGKA 1SLVB 3LPRA 2AGIX 1BBRE 2QN5T 1Z6JH 2CK3D 4Y7AA 4K1SA 3HGPA 1GVZA 2KR7A 3SBKA 3M37A 4Z0KA 5A0CA 1YKTA 1FMGA 3SJOA 4B6FA 3TK9A 1MKWH 1ELVA 1BIOA 2ZU1A 4A7IB 2ZQ2A 3RXRA 3GY7A 1LVBA 2YMSB 1WQSA 3O8BA 1JXPA 1T31A 3Q3YA 3RXMA 1THSH 2GV7A 3LONA 2CN0H 1O2LA 3RM2H 3NPSA 3ATMA 4TY7A 1AU8A 1XUIA 1O2KA 2J95A 3HK3B 3ZVEA 3FP8E 1VGCC 3ZZ7A 2QAAA 8ESTE 3RXCA 1LQEA 1G3DA 2BLVA 3F9FA 2WV9A 4XDEA 4F55A 3MTYA 1BITA 3BEFB 3A88A 4CR9A 1FAKH 1S84A 1KMHB 4FVBA 5EIYA 1EQ9A 2BD5A 3MU5A 2SGPE 1NC6A 1VJ9U 2BTCE 2GGVB 4B76A 3DFLA 3ZZ8A 1H8IH 4GUXA 5HIZA 1F5LA 1C5OH 1TRMA 3S69A 3SUDA 1TNJA 4O9VA 1IQHA 1OWJA 1ZOMA 2ZG0H 3RXVA 2NU2E 2ZPQA 4DOQA 4ZMAH 3FZDA 2TIOA 1C5WB 1TA6A 1BMAA 2RCEA 4NIYA 2R9PA 1TB6H 7GCHF 5LPEA 3U1JB 2BDIA 4IS5A 4SGBE 1D6WA 2D8WA 3VB4A 2STBE 1D3TB 2QCYA 3ODDA 4CRGA 4GHQA 3SORA 2YOLA 2TGTA 3LGVA 2Y81A 1H9IE 5FL7D 4OS1A 1BTUA 2BDBA 3GCTF 1RTLA 3PMAB 1FAXA 2AH4X 2ZHEH 4ZKNU 4X2YA 4Q7ZA 2G52A 1IQIA 1THRH 4TSFD 2FODA 1W0ZU 1UO6A 2EA3A 3GDSA 5AFYH 1OS8A 1VITG 1Z8RA 4BAHB 2BQWB 2VIOA 5DPAA 1DY8A 1HXEH 5AVDA 5A2MH 1FIWA 1NRNH 2ZDNA 1GG6C 2XW9A 3PO1C 1GDUA 1EAXA 1N8OB 5IYTA 2J2UA 3TGKE 1P2QA 1Q31A 1E36B 3GY8A 2QF5A 4ASUD 1YM0A 1TGBA 2VIPA 3QZQA 1SBWA 2P8OB 2AEIH 2W26A 2YNAA 4JCNA 2A45B 1E35B 1CSOE 2OINA 4GLYA 1YF4A 2Q6GA 1IQGA 3P17H 1L1JA 3UWJH 1O3HA 1O3OA 3M3VA 2FOGA 1CBWB 4LXBH 3VGCB 1O5DH 2GMTB 3KQEA 3RXIA 2ZHWH 1Y3WA 3FOAA 1YPEH 2PUQH 2AMDA 1GBCA 3P95A 2ZTYA 2EQNA 2F9BH 1V2LT 1KSNA 4OS6A 3PWBA 1OPHB 4UE7H 5DN6D 3UNSA 1UVTH 2EI8A 3GDUA 2OC8A 2H6MA 3A8CA 3IG6B 4GSOA 1P2KA 1A0JA 5ETXA 2AMPA 1GJBB 5L6NH 2HNTC 3E0NB 2M2AA 4SGAE 1OWKA 3TH3H 2ZDVH 1Y3XA 1HCGA 2V3OH 1RRKA 4I8LA 4ZAEA 1KDQB 3FP7E 2FX4A 1MQ5A 3UPEA 2OUAA 4XE4A 2WPLS 2F9NA 1MAYA 1EPTA 2ZFQH 4FU7A 1CA0C 2V7QD 4NGAH 2UWOA 1XUGA 1OWEA 3BG8A 3SHAH 4BANB 4NG9H 3WWBA 1GI4A 1P10A 1TX6A 2R3YA 1B5GH 3OTJE 2SFAA 4BNRA 3FKSD 4A5TS 2B9LA 3GICB 2BY5X 1EAIA 3SI4H 4IMZA 1MTWA 4Y0ZE 2R3UA 4A1XA 3ZVFA 3NCLA 1SOTA 1ZSJA 4WY3A 4AFUA 4RSPA 5FCRA 1SMFE 3A80A 1C2LA 4MNVA 2Z9JA 4HG6A 2FLBH 1X7AC 5GNDA 1QA7A 2QF0A 1GWAA 1QL7A 1VCPA 3M5MA 3P70B 4X6OA 1QBVH 1D3PB 5C17A 1SGTA 3OE7D 1UVPA 1GVLA 1BMMH 4YO9A 2OP9A 3MO9A 4GCHG 4B2AA 4NFFA 2ZU4A 5B6OA 2BB4A 3E90B 1ESTA 1CT0E 1OOKB 2KFWA 4K2YA 4B75A 3RU4D 3SV6A 1QNJA 1KLIH 5KECA 4F48B 2Z3EA 2WYJA 1E79D 4AYYB 4MNYA 2Z6BD 3ZVCA 4FUCA 4XBCA 4JK6A 4Q80A 1EZQA 1G2MA 3RMLH 5FHTA 4RT1A 1XUFA 4H6TA 1SGFA 1YLCA 1UTPA 4NFEA 1GCTC 1MTNC 1YPGH 2BVSH 1A7SA 1MH0A 1GVKB 1H9HE 1VKYA 2JJ2D 3BTDE 1Y5BT 2XNIA 4WH8A 5JBAS 5CHAB 1HJ9A 2KAIB 1W10U 3AAUA 1AO5A 4D7GA 4XBBA 5DG6A 4HFPB 1EB2A 2G4TA 4BTUB 1UHBB 2W5EA 1ELGA 1WTHD 4ISIH 5F8TA 2CHAB 3C1KA 1F0SA 1MTVA 2W6ID 1QBNA 4CRAA 1O2XA 2BVXH 4Z1MD 4UDWH 3S9CA 1KXFA 2BOHB 1O2VA 4ABJA 2F9UA 2FOEA 3A83A 3I78A 3NKKA 4AOQA 2R2MB 5AFZH 1A5HA 2J98B 1HGTH 2BLWA 2WPHS 3TJUA 1AUJA 1QJ6B 3Q77A 5J4QA 1O31A 1XXFA 3S7KB 3LH3A 2NU1E 3RXSA 2W3KA 3LGIA 4DIHH 1NRQH 1UTNA 1F7ZA 1F2SE 1QGFA 5FCKA 1NRRH 3MH4A 3RC5A 1WCZA 3RXPA 1SFQB 2P3TB 5A0BA 5GDSH 1BA8B 4BAOB 1O2QA 3RMMH 1SL3A 1TBZH 2I6QA 3OY6U 1SR5C 3SV2H 1ZSKA 3CNRA 1TIOA 2FOHA 1OWIA 3UWIA 3AVZA 1NU9A 2BXTH 1AZ8A 1NRPH 3TNSA 1DOJA 4WH6A 1A3EH 1P3CA 5L2YH 3MNSA 5E2PA 1MABB 3OY5U 2HVYB 1LVYA 1G3EA 1HJAB 1LPZB 2H2ZA 1O37A 1FNIA 3RU4E 2C8ZB 1SQTA 1V2RT 4X8TH 1BHXF 2WSSD 2Q6DA 3HKJB 1O3NA 3E0PB 3LGYA 3TH2H 5DP8A 3M7QA 3CS7A 5E0HA 1P04A 2BQ7B 1E38B 5JB9S 1NBME 1Z71A 1TGCA 2ODYB 1GI7B 1L1GA 5A8XA 4ZKSU 2AMQA 7KMEH 3T2NA 2NU4E 1K1MA 2ZFSA 4I8JA 2GDEH 1O3EA 4Y71A 3LGTA 3KEEA 3LU9B 4ABDA 1DFPA 3MH6A 3OEED 4BAKB 2EY4C 1E1RD 4FUEA 1P01A 2FMJA 1AKSA 2Z9LA 2ZWLH 2QXIA 3PMHB 4K8BA 1T8MA 1JIRA 4X1SU 1NU7B 1W13U 3SI3H 3EE0B 3OU0A 1BMNH 5KEDA 2LELA 1BTWA 3PLBA 4MG3A 4A1TA 4CHAC 3DHKH 3Q3KA 1GBEA 1AB9B 1ZJDA 3KF2A 1K1LA 2BDCA 3F2FA 1SC8U 3F9GA 3GCTG 1MD8A 2Y7XA 3D49H 4NSYA 4Y11E 1EATA 1FN8A 1P9UA 2V35A 1Y59T 2P94A 2FESH 3PV4A 1TBQH 3M3TA 3VB7A 3WWFA 2SGEE 3FVFB 4WMFA 1QBOA 5F6MA 1HIAA 1CT4E 2HRVA 2SGDE 1S0RA 1GL0E 4MVNA 1P06A 1RTKA 1CE5A 1P2OA 1C2EA 3GYLB 1SB1H 3TJNA 5G4BA 2V3MA 5E8EH 1EPTC 1GJ5H 1OYQA 3RM0H 1TGNA 5C67A 1J14A 3SV7A 2C3SA 2ZHQH 2H9HA 1IHTH 5DP7A 5L30H 3LIWA 2FM2A 4B6EA 3KQCA 3BTKE 5SGAE 5FPTA 4YOJA 3SNCA 5C1XA 1DXPA 3SQHE 3SNDA 4YTAA 5FXLA 1CHOG 1YPMH 1GI8B 4OS4A 1INCA 4X6MA 1GJ4H 2GCTC 2AGEX 4A92A 1JIMA 2OD3B 3AK5A 1GBTA 3LC3A 4YESB 1GBIA 1MZAA 2VIQA 2IOTA 1O32A 3U8RH 3K65B 2SGAA 1CO7E 2VVUA 1RIWB 4MPWA 1V2ST 1H1BA 1MBQA 4X8VH 4TPYA 2JH0D 4YZUA 4ZUHA 2J92A 4I31A 8GCHG 1C2KA 2G4UA 1J16A 1GBJA 3GCOA 3U98H 1FI8A 1EOLA 1W7GH 2L6OA 3A86A 1TGTA 4D76A 2P16A 3ODFA 1FV9A 2ZPSA 2R0KA 2IJD1 2KCOA 1NY22 3A8AA 1ZMJA 1D6RA 1KTTB 4CRFA 2VH0A 3B23B 5EU8A 4BOHA 2TBSA 1RFNA 1O3FA 2EEKA 3A8DA 3BTGE 3M7UA 4NCYA 4CRCA 1BOQA 1KXEA 3UOPA 3SZNA 2EC9H 3WW7A 1AFEH 3LH1A 1IOEA 2QF4A 3LC5A 3S9AA 4KGAA 5T6GA 1HAIH 2UUFB 3VB6A 5A09A 2JH6D 4JYUH 4VGCB 4CBNA 4KKDA 4RN6A 2ODQA 4NA9H 1AIXH 4H42U 2DE8A 1TQ7B 1PQ7A 3SU1A 2ULLA 1O35A 2A31A 3JZ2B 4JZ1A 4ISHH 5EODA 4E7NA 2CGAA 1QFKH 3SV8A 1H8ED 5FBEA 1S6FA 1JOUB 4Q63A 4O3TA 3UQVA 1WUNH 1O5CB 3PYHA 4IC6A 3PLPA 1HNEE 1O2WA 3E3TA 1N1LA 3RXHA 4X6PA 4CBOA 2FYRA 5GCHF 2G5VA 2PKAA 1DWEH 4H4FA 2JKHA 3EA8A 3HKIB 1IQFA 2BD8A 1EASA 1GGDB 2DUCA 1O39A 1Y5AT 1H9LB 1S83A 2HALA 3D62A 2CF8H 2ZI2H 3BTQE 4RKOB 4FOUC 5E0JA 1BRCE 1LHDH 1ZHPA 4F49A 2FIRH 2PW8H 4X1NU 1EAUA 1EFRD 1GJ9B 1GBLA 3F1SB 2ZGJA 1DT2A 2B0FA 4NA7A 4UONA 3MI4A 4B2BA 4WXIA 1DX5M 1O5FH 1XM1A 2HPQH 1BTXA 2UUJB 3BTME 3WY8A 1QQUA 4XSKU 2VIDA 1P12E 3U8TH 4A1VA 5F53A 1ZSLA 4TY6A 1NFYA 1O5EH 1MU8B 3UNRA 1YLNA 1KXDA 1QJ7B 4O03A 2A7CA 4GVUA 2V0BA 4ZCNA 1ZYOA 2GZ7A 1XVMA 4U01A 1MTUA 1T4UH 2GTBA 1A3BH 2QA9E 1BTPA 1VZQH 2Y5FA 2ZQ1A 1UTOA 4RI0A 6LPRA 2XCNA 3TK6A 3AW0A 1V2WT 4AB8A 1H8DH 3QWCH 1ZTLA 1C5LH 2R2WU 1Y8TA 1MTSA 2ILNA 1DXWA 4THNH 1ZHMA 3RXUA 1KXAA 3GY5A 3ZV8A 2LPRA 1G32B 3MNCA 1C5ZB 3OX7U 4Y8XA 2L74A 2D26C 1C2DA 2BVRH 2XWAA 1D9IA 1HBTH 3NRLA 2ZGHA 1QCPA 2V6NA 1O2PA 4ABFA 1HLTH 5EW2H 1GDQA 3QTOH 2CXVA 3PROA 3MHWU 3A82A 1LHCH 5C1UA 2PKSC 1MD7A 3MU4A 1HRTH 2SGQE 3QUMP 4TT3D 1SHHB 1ID5H 3E1XB 5EW1H 4LZ4B 2GP9B 1THPB 2O8MA 3A89A 1VITH 2GV6A 4AC9A 4ABEA 4MNWA 4R0IA 3E16B 3UB0A 2B8OH 1ACBE 1P0SH 4KP0A 1FONA 1S0QA 1V2JT 2J94A 2M5TA 2LP6A 1VCWA 5JBCS 3L33A 5ABWA 3A81A 1SSXA 1SPJA 1DLKB 3K6ZA 5E2OA 3FP6E 2VB0A 1HFDA 3LJJA 2KM0A 3N7OA 2HLCA 3ZZ9A 3PB1E 2F4LA 3PWCA 4U30A 2F83A 2FTLE 1V2PT 4JYVH 1TOCB 2BXUH 1SGCA 4JMYA 3N7DA 1ZGIA 2OBOA 2WZQA 1UVSH 5LH8A 1TFXA
chains in the Genus database with same CATH topology
1BRAA 4YOGA 3URDA 1WU1A 2WPMS 2B7DH 2H9EH 3K2UA 4TWYA 2F9VA 3VXEH 4X1PU 1QR3E 3ZZ6A 2PUXB 1KIGH 4CRDA 2WPJS 4IBLH 4X8SH 5JDUB 1FY4A 1HXFH 2WUCA 4YLUA 2RG3A 1YC0A 1AHTH 1FIZA 2QY0B 4BXSA 3SU3A 2A2XH 4QT8C 1LO6A 3SNEA 1HAVB 1Z7KA 2FOBA 4WVPE 1BTHH 4AFQA 1G2LA 1FY3A 2BDHA 3SJ8A 1TX8A 1EAWA 1CVWH 4IN1A 2AERH 1XKBC 1V2TT 2SNWA 1O2HA 1BRBE 2P93A 1GHXH 2XC0A 3DUXH 3SGQE 1B0EA 3TGIE 2ZZUH 1BZXE 1P8VC 1GHAF 1ZPZA 3BTTE 1AFQC 3IITA 1T8NA 2A4QA 2WUBA 2A2QH 3V3MA 1EZSC 1NTPA 2ZO3H 2JETC 2ZDLA 1CU1A 1Z1JA 4OS7A 4LZ1H 2STAE 3L6PA 1GMCF 1EXFA 5HMAA 3D23A 3HGNA 1AMHA 2VGCC 1HDTH 3A8BA 4AB9A 1DDJA 1ELTA 1LVOA 2ZP0H 1TRYA 1F5RA 2CJIA 4AYVB 2A4OA 1C1NA 1C9TA 3BTEE 1HAPH 1VGCB 2GCHF 4J1YA 4AN7A 1XKAC 3KCGH 5IDKA 1ZRKA 1BHXB 2ZHDA 1GI3A 5PTPA 4NZQA 2G5NA 2FO9A 2BY7X 1FXYA 1ETRH 1O3BA 2A7HA 1C1WH 3LDXH 2Z94A 2RA3A 3BEIB 5I46H 2XYAA 1Z8JB 5H4IB 1S85A 1V2MT 3F9EA 7ESTE 4NWKA 1H4WA 1NO9H 1J9CH 3A85A 5GIBA 3T62A 5C2ZA 1SGIB 1QB1A 1UVOA 2ZNKH 2W3IA 4CH8B 2C93B 1DS2E 1C5MD 3RXTA 1OX1A 1UMAH 1WOFA 1O2TA 1DICA 3SU2A 1SGEE 2BMGB 3P8GA 2C90B 2ZFTA 4B2CA 1KTSB 2AYWA 1GMDF 1YPHC 2J4IA 4AFSA 1IHSH 1TNGA 4NZLA 2ZDKA 3UNQA 1G30B 1A5GH 1UCYK 3UUZA 4D9QA 1ZPBA 1EX3A 3NK8A 1AN1E 1G36A 1O2OA 3KNXA 4A6LA 4ZKOU 1W3CA 1MUEB 3BG4C 5TCCA 1C2JA 2AFQB 5GCHG 1BT7A 1TX7A 4AZ2B 3RXDA 4OGYA 4XFQA 1GG6B 2Y5HA 3ZZBA 2A5AA 3PO1B 3K9XB 2Z3DA 1UTLM 4ZXYH 1S82A 4Q2KA 2FDAA 2BDGA 4Y79A 5FPSA 1QTFA 1BQYA 1AWHB 3AW1A 3ZYEA 2HNTE 1C1TA 1KXCA 2D2DA 3NZIA 4YT6H 3KL6A 1ZRBA 3UR9A 1W11U 1RTFB 5AF9H 5JBBS 1NZQH 2ZCLP 3T5FH 2QF3A 1TNHA 4YT7H 1HAHH 3FANA 6GCHF 1HAOH 4INHA 3TJOA 1PPEE 2ZFFH 4AG2A 4I32A 3C27B 4X2WA 2FS8A 1YBWA 3E8LA 3GOVB 2HGTH 3MU0A 1O2IA 4ZHLU 2VH6A 5EXLA 1NPMA 3UR6A 3SV9A 3Q00A 6ESTA 1ETTH 2ZIQH 3QK1A 1TNIA 1SGQE 1ANEA 1C5VA 2VIWA 3EA9A 2HPPH 1GBMA 4HTCH 3OSYA 3TNTA 1CA0B 4JZFH 4K60A 1V3XA 2XBXA 3T27A 1MKXK 2ZGBH 3TH4H 3ITIA 4X1QU 2IPHA 1W12U 1C5PA 3I29A 3Q76A 1QY6A 3SO3A 3ATLA 2ZU2A 3ZVBA 2VVVA 1LQDB 2TPIZ 5J4SA 2BDYA 4DGJA 3PTBA 3VXFH 3S0NA 5LGOA 2PTNA 1BBRK 3RXOA 4U32A 1C1PA 1Q3XA 5HM9A 4WWYA 1PFXC 1RJXB 1KXBA 3D65E 1O3GA 1P05A 2CMYA 1OXGA 3GYMA 1XUJA 2ZGCA 2THFB 5FPYA 5JYIA 2Q1JA 1SHYA 1BB0B 1HV7A 5FX5A 1FN6A 1QB9A 1O3AA 1P2IA 1QL9A 1LVMA 1QURH 1O2ZA 2QXHA 1ABJH 2UWLA 7GCHG 1GCTB 3UOUA 1MTNB 3A84A 3RXBA 1C2GA 1P2MA 1NFXA 2H9TH 1BUIA 3KN2A 3MMGA 4R8TB 4VGCC 9LPRA 4F4OC 1MBMA 1TMBH 3SUGA 2ZF0H 5F8ZA 3QGJA 3A87A 2O8LA 5K0HA 4Y76A 1A61H 2A5KA 2VJ1A 3W94A 4FU8A 1TE0A 1GJDB 2AIPA 1SGNE 1KLJH 4AORA 2BZ6H 4BTIB 2FOAA 1P03A 1QA0A 1MKXH 1DITH 1VITF 4MQAA 4IN2A 3MO6A 1KDQA 1YCPM 1SQOA 4BTTB 1OP0A 1A0LA 1ZGVA 1ETSH 1QHRB 2PGBB 2R0LA 4TWWA 2QIQA 3CP7A 3EA7A 1GCDA 2NU3E 2ZFPH 1HJ8A 2AS9A 2XCFA 5EXNA 2ZDMA 1ARBA 3U9AH 2ZTZA 3M36A 1LCYA 1TALA 2F91A 8KME2 3RXJA 2ZPRA 1VCQA 2XXLA 2A0QB 4I7YH 5K7RA 4O3UA 1ELDE 1C1VH 2Y80A 1L4DA 2ANKH 4ABGA 1KY9A 1WSSH 4K3JA 5EQRA 1GJ8B 3BTFE 4MNXA 1J8AA 1VR1H 1P2JA 3SU0A 1O2NA 3LJOA 3TGJE 2BD9A 3RLYH 1TWXB 1A4WH 1ZJKA 5FAHA 4B73A 1AE5A 2OTVA 3GY3A 1TABE 5EG4A 3FAOA 3PMBB 1O5BB 1UVUH 2HNTF 5C5OA 3GCHC 1C2IA 4LK4A 2FOMB 1C5TA 3QZRA 2PLXA 4IW4E 1A46H 4KTUA 1HB0B 1TLDA 1TGSZ 2PTCE 5E0GA 5C3NA 1AD8H 3M3SA 2XBVA 1ELCA 4AX9H 3HATH 1O38A 1TOMH 2WYGA 5EGMA 1A5IA 1GI0A 2BD7A 1GBKA 4D9RA 3L3TA 4MLFB 1FPCH 3BTHE 5BRRE 1ESAA 2GX4A 2KAIA 2Z9GA 4X0WU 1EZUC 2QC2A 2EI7A 4ABHA 2FTMA 1Q2WA 1NFWA 1E37B 3ZV9A 1UHBA 4HZHA 1C1UH 1IQNA 1XUHA 4ZHAA 1Y3UA 2OCVB 1YPLH 1GDNA 3ATKA 3VPKA 2FOFA 1YGCH 1W0YH 1UK2A 1GJ6A 1GBFA 3ZYDA 2Y6TA 1O3IA 4CHAB 1U6QA 2BLOA 1K2I1 1Y3YA 1V6DA 3M5LA 1ZHRA 2VIVA 1XX9A 1N6YA 1HPGA 2B5TB 1T8LA 2J38A 4FUBA 1HAZB 2WPIS 1HAGE 4GCHF 1CHGA 3ZZ3A 4BXWA 3CENA 5DP6A 1K1PA 1NRSH 1MKWK 2QYIA 2SNVA 3MO3A 1NS3A 1LDTT 2W7SA 1A2CH 4JZEH 2J9NA 4XBDA 4OS2A 3A7ZA 5DP3A 1A0HB 2FI5E 1EPTB 1XVOA 2PR3A 4RKJB 3A7YA 1KLTA 1O3DA 4UFGH 2FX6A 3P8NA 1K28D 1GBHA 4X1RU 2XBWA 3EAJA 2GKVE 3TPIZ 2Y7ZA 3O8RA 1HAXB 1DLEA 5F8XA 1PPHE 2Z9IA 4IGDA 1CGJE 2ZU5A 1EJMA 1MCVA 3SUEA 3PM3A 2OC1A 3T28A 1D3QB 2BY9X 1JMOH 4MTBA 1MZDA 2GCTB 1CA8B 2QGRA 2ZHFH 1P57B 4UFEH 2EI6A 3RXQA 4Y0YE 3TLOA 1C5RA 3M5NA 4B1TA 2OC0A 2VWOA 2GDDA 1QL8A 5HM2A 1IQJA 1Y3VA 3SNAA 2C4FH 1N8OC 5DP5A 1GHBF 4DG4A 4JZIA 5T3HA 3P92A 1OWHA 1JWTA 1NESE 2P8OC 1C5XB 2UUKB 5DK1A 1DWDH 1AVGH 2IJOB 1ELAA 1D4PB 3ESTA 4CR5A 1CBWC 1ANDA 3VGCC 1ELFA 2GMTC 1V2OT 4X6NA 1GHZA 5HXFA 2C8XB 2OBQA 1L4ZA 4O97A 4K5ZA 2WINI 1FLEE 2RDLA 1SG8B 2HWLB 1TPOA 3AAVA 3SGAE 3RU4T 1FDPA 4FUHA 1C4Y2 5HYOA 2BD3A 3NXPA 1TYNA 2VWMA 1NM6A 2BLQA 2C8YB 2G81E 1P02A 4YLQH 5HGGA 2UWPA 3DD2H 3IWMA 4WMDA 2FI4E 5A8ZA 3UFAA 3B8JA 2VINA 2VU8E 1TPAE 1L0ZA 3O8CA 1C1MA 1C9PA 1GI2A 1YYY1 3B9FH 3KQBA 1B0FA 3U8OH 3G01A 2HVXA 1EJAA 1UTMA 2BM2A 1GHYH 1UK4A 3ZZ5A 4JK5A 1JRSA 2ZCKP 1DANH 1ELBA 1YPKH 3V7TA 6CHAB 2G55A 3HPTB 5ESTE 1GL1A 5T6FA 1DY9A 2OXSA 3SGBE 4UFFH 3E91A 4ASHA 3EGKH 2PSXA 5C5NA 2OC7A 5AHGH 1TAWA 3ZVDA 2I6SA 1TMTH 3V13A 1GBDA 5L2ZH 4HGCA 1ZTKA 1EZXC 4AFZA 1WTGH 1NFUA 3MH7A 2F9OA 3H7OA 2ZDAH 2SGFE 3JZ1B 3TU7H 1EP5A 4ZKRU 4J2YB 1FPHH 1V2VT 3ATIA 4FU9A 1EP6A 3UQOA 1XMNB 3T26A 1ZR0A 1EB1H 1C5NH 1FY1A 3E6PH 4I8HA 4Y6DA 3H7TA 2G51A 2LNCA 2AIQA 1K1NA 2A1DB 4LOYH 2UUYA 1Y5UT 1AY6H 1AI8H 2A7JA 2F3CE 1O2UA 1J15A 1DSTA 4D7FA 3ZVAA 4DY7B 1GPZA 1W14U 3QX5H 1P3EA 5CHAC 1WBGB 3P8OA 4UFDH 1QRWA 1FJSA 1LKBA 3RMNH 2WV5A 1C1QA 2CHAC 1PPZA 3M7TA 1AKSB 1CHOF 1UJ1A 1IQMA 1O3KA 1ORFA 3QGNB 8LPRA 4Y7BA 2FS9A 2Z9KA 2Q6FA 4NWLA 1AGJA 4MPUA 1G37A 2ZKSA 2TGAA 4FUGA 4K8YA 3A7TA 2H5CA 3ATWA 3U69H 4TYDA 2ESTE 2ANWA 1RGQA 3FFGA 2OQUA 1GJ7B 2VWNA 3RP2A 1FZZA 1ZPCA 1A1RA 1IQKA 2PKSB 1V2QT 4I8KA 3P6ZB 5ESBA 3ZZCA 2J34A 5TCAA 1PQAA 3RC6A 4ABIA 8GCHF 1LPGB 5CMXH 1DUEA 1MCTA 2FXRA 1HIAB 1HAYB 3RUOA 5GPIB 4ISNA 4Z6AH 1DSUA 2FWWA 3LT3A 1AUTC 1K1IA 1LTOA 1FY5A 1PPFE 3RXFA 1PPCE 3SN8A 3STJA 3TJVA 2ALPA 2A32A 4NIXA 4B74A 2P95A 1GJAB 1SLXB 2ZGXH 1DVAH 1GBBA 3LOXA 1HJAC 2RA0A 1F5KU 3RXGA 3F9HA 4ISLA 3PMJA 2V3HH 5TJXA 5A0AE 1MMJN 3K6YA 3UREA 1P09A 3GDVA 1TNKA 3P8FA 4KTCA 3EQ0H 2O8TA 3CS0A 4MPVA 3TK5A 3S9BA 2Z7FE 1C5YB 1N6XA 3LKWA 7LPRA 4JZDH 4Y8ZA 2JH5D 4GPGA 1O3CA 2G00A 4KTSA 1SGRE 1ZZZA 3T25A 4ESTE 3MNXA 1Z1IA 1G3CA 2BY6X 1AQ7A 1IAUA 3A7WA 1SLWB 1GI6A 5F03A 1F0TA 4HI3A 5FBIA 4PROA 5C20A 1EJNA 1ZMNA 3SOSA 1OP2A 3VB3A 1SOZA 1MAXA 4U2WA 1QRZA 1FQ3A 2A4RA 3OYPA 3RDZA 1TONA 2P3FH 4JYTA 3VB5A 1NT1A 1TA2A 4UD9H 3ZVGA 3UIRA 2TGPZ 1AB9C 1O3JA 2NU0E 2Y82A 3QTVH 1DWCH 3F6UH 1Z8GA 2GD4B 4WJG2 4INKA 3MU1A 1ZMLA 4ZHMU 1K22H 1AFQB 2O8UA 2GZ9A 2IN2A 4I33A 4BAMB 1LHGH 2JETB 2Z3CA 1CT2E 4FVDA 1O2RA 4DJZB 3DFJA 3ZZ4A 2VGCB 4WXVA 1F0UA 1PQ8A 2WV4A 1RD3B 1WYKA 1GMHF 3KIDU 2OLGA 2ZCHP 2XBYA 3MNBA 2C8WB 3TITA 1JBUH 1O3PB 1BTYA 4CRBA 3EDXB 1WQVH 2ZFRH 2A5IA 3ELAH 1GHBG 1SFIA 1BDAA 1TMUH 3SNBA 3RXLA 4CREA 3VEQB 1C1RA 1O2YA 2ANMH 2PKAB 3O8DA 3ENSB 1UCYH 4E06H 1IQEA 5GXPA 1QRXA 4ABBA 2FI3E 1AE8H 3MH5A 1WAYB 2GT8A 2XC5A 4X2XA 2Y5GA 2ODPA 2O9QA 1TPSA 5JPMH 1CQQA 3GY4A 3QLPH 1YPHE 4DURA 3PTNA 1J17T 5LPRA 2H1UA 1UTJA 3SUFA 1RIWC 2XC4A 1LMWB 1OKXA 3SJ9A 1QJ1B 2XTTB 2BD4A 1OP8A 4AG1A 4GAWA 1JRTA 5A8YA 3BN9A 1O34A 3BEUA 4BAQB 1K1JA 3KHVA 5LPFA 1PPBH 1T4VH 3GISB 1XXDA 3RXKA 1RXPA 3SJKA 3SQEE 1DM4B 3UTUH 1FUJA 3FZZA 4NIVA 1P11E 1YPJH 2VWLA 3NWUA 1Z6EA 4IMQA 1C2MA 1HAVA 3RLWH 1T32A 1SGYE 1O3LA 5BPEA 1TBRH 4ISOA 1UK3A 1E34B 4WF8A 5DGJA 3UY9A 1Z8IB 4FUDA 4FXGH 4XOJA 5GJ4B 2P59A 1AVXA 1S6HA 4MPXA 4OGXA 1PQ5A 1XUKA 1BJUA 2FEQH 1DUAA 2BHGA 3BG4B 2O8WA 3V12A 2BX3A 1MQ6A 1BTZA 1O5AB 3BIVH 4ZXXH 3LGWA 1AWFH 4Y10E 1C4U2 3BSQA 2BYAX 1ANBA 1PYTC 5EQSA 1EKBB 2PFEA 5DO4H 4I8GA 4X2VA 1TNLA 3Q3XA 4WMEA 4CH2B 1PYTD 4NA8A 4KELA 4B71A 4NSVA 2ZTXA 1QB6A 3BTWE 2XWBI 1G9IE 3BF6H 1RS0A 2XRCA 4UEHH 5C1YA 3SU4A 5DP9A 1NROH 5EPYA 1D3DB 1K21H 1VJAU 3BV9B 1OYTH 1O33A 5DP4A 1BJVA 1EUFA 1O2SA 1GI1A 1O30A 3SU6A 5GWZA 3SHCH 1NN6A 1GGDC 3MFJA 3M5OA 3SU5A 1W8BH 1ZLRA 2FPZA 2VNTA 1BBRH 4E05H 2BY8X 1LHEH