5SV5A

1.0 angstrom crystal structure of pre-peptidase c-terminal domain of collagenase from bacillus anthracis.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
NNRPEEANRIGLNTTIKGSLIGGDHTDVYTFNVASAKNIDISVLNEYGIGMTWVLHHESDMQNYAAYGQANGNHIEANFNAKPGKYYLYVYKYDNGDGTYELSVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Microbial collagenase
publication title 1.0 Angstrom Crystal Structure of pre-Peptidase C-terminal Domain of Collagenase from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
total genus 23
structure length 105
sequence length 105
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2016-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5sv5A00
1WMDA 2O8OA 4HPKB 1NQDA 1QXPA 4HPKA 2XVGA 1WMEA 4DY5A 1KFUL 5FAXA 1KFXL 4DXZA 1WMFA 5FBZA 1U5IA 4I3GA 1DF0A 2XVLA 2XVKA 3JQXA 5SV5A 3AFGA 2QFEA 2LUWA 3JQWA 3DF0A 1NQJA 4G9SB 4DZGA 4DY3A 3BOWA
chains in the Genus database with same CATH superfamily
1PVC1 1RVF3 2W0XA 2XJVA 5J7MA 3W5MA 2WRAA 3RDIA 1L7LA 1O3QA 1DGLA 4CE8A 1HJFA 1VBB2 5I0UA 1YRZA 3NNGA 5DXDA 4RN5A 4K1YA 1UMIA 1GR3A 1K5MB 2J42A 5FZEA 1AYM3 3I54A 5A33A 3ZYRA 4CEYB 4ZHNA 4RFRB 2WS92 5GZCA 4URAA 2FMDA 3HBKA 1D7PM 3VDCA 3U10A 2BP6A 2W1UA 3I2KA 3A0NA 3VD4A 3NV3A 1GWMA 5FK7A 4Q1PA 3CBNA 5DUUA 2X5IA 4QKDA 1J83A 4HVOA 4YW2A 3ZYFA 1V6JA 4DEVA 2R042 4XVHA 2QBXA 2BVBA 1IG3A 1CX4A 4YW3A 4JVAA 4N43A 2AENA 5BNPA 1WCKA 4XUTA 4LNVA 5IW0A 4OVEA 4YW7A 5CISA 2PHWA 2IXCA 1DLCA 2C5DA 3VHOA 2DCZA 4AW7A 4CCDA 3OGJA 2BGCA 3U78A 4QXKA 4D8MA 1ZBA3 5CG9A 1WUVA 3ZFFA 1ND3B 3B00A 3KHBA 4JZRA 3AZVA 3T1MA 4D69A 5K0UB 3C2UA 3H3ZA 1VPHA 2ARBA 3KB5A 2RS51 1O4YA 4YW1A 1K5MC 1YO8A 4CEYC 5ABJC 1XNAA 1DYOA 1VBC2 2OPWA 4FQ4A 5BYNA 2QQWA 4IV1A 4Y1VA 1WBLA 1PK6A 1YFWA 2YUEA 5IYYA 5F3IA 5HCHA 4XJ9A 4LULA 1PO12 1X9PA 2V4VA 2ZEWA 4QX0A 3UKTA 1S0BA 2AZ5A 2MNGA 4WVZA 5FZ1A 4ZU7A 1H30A 1HDKA 2XJPA 1JZ3A 1KS4A 4NHYA 3HN1A 4XACA 2BPA2 1QH6A 1UX7A 3WQBA 3W9AA 5M0TA 5IFTA 2ZCWA 1VR3A 1VRH2 2ARXA 4IV3B 1VBA1 1X8MA 1ZA7A 4Z2WA 1VMJA 3GYDA 5FP8A 1QJY3 2OPKA 4ARXA 3POYA 4GJYA 3PVEA 1ACCA 2NQYA 3S7IA 1GOHA 5FMBA 2F4PA 2VE1A 4HPKB 3CO2A 4NE9A 5K0UC 1V9U2 2ZEXA 2MEV3 3MEPA 5A7WA 2QQOA 1ULEA 5LY2A 1AR72 4MHUA 4GMP3 1DGRN 5BNNA 1UMHA 3WQ0A 5LBEA 3RPQA 5A70A 5CEHA 5DQ0A 5FP4A 4RGGA 3ZFEA 4Q0VA 3W59A 4F83A 1CAXA 1U5IA 4LKFA 4PF5A 1DP0A 2XLAA 3AL6A 4QWNA 5C9AA 5FPUA 4QQOA 4YSFA 3URFA 1S4CA 2A3XA 5I91A 3I2OA 4DQAA 4I01A 4K40A 1V00A 1WCSA 1V6OA 3SKVA 5AVAA 4DS0A 2BFUL 5C5TA 4MXVA 4AHWA 1MS8A 3AMMA 1S0DA 2PMWB 4CDXB 3ZYHA 1K45A 4XF9A 5FFOC 3TRSB 1MS3A 4JGZA 4IV3C 1HIXA 4TWTA 2GP5A 1US3A 3D3AA 3OSDA 4Y4RA 4QXCA 1MZEA 5FZKA 1KRIA 1I9RA 3TOJA 5FP3A 5C4WA 1OKQA 3H8XA 1LOGA 4UI9L 1APNA 1QJU1 2ZGUA 2Y26A 4QDRA 3AVRA 2WDBA 3I2IA 3KCYA 1MVQA 1ZBE2 3SC7X 4E8DA 2HWD1 5FYIA 5L7OA 5JPNB 1PO23 1R082 1UIKA 3V56A 3JQWA 1EAH3 4BA6A 1BEV3 1IOAA 4H7MA 2VOWA 1RGSA 4LMFA 1HB3A 1RITA 2SLIA 1AYN1 3AL5A 4FFHA 4PLOA 4L99A 4R52A 4BIFA 4BK4A 5J3UA 3KVBA 5BY5A 2NMOA 2CWSA 1VIWB 2GALA 3POFA 3WG2A 1UPSA 4O9EA 4CDXC 2DWRA 1GFF2 1AZDA 2D5HA 1MS5A 3S7EA 2YROA 2UURA 5A33B 1FPN3 5A3OA 2HH9A 5FYMA 3E5UA 3S5AA 1AXYA 1NLRA 1SPPB 4RQPA 1GP6A 5EP9A 4ZU4A 3I49A 2UWCA 3ATGA 5FJKA 1W9WA 2Y6FA 4K20A 1RMU1 4NRQA 4K8RB 2VTXJ 4L8QA 2X5IB 1YYNA 1NZIA 2UYBA 2JKXA 5LA0A 4BQXA 4YARA 3ZXJA 2C1FA 1TME1 4GKYA 1VBB1 3AMNA 4N43B 4YRDA 4KU7A 3AYCA 5BNPB 1LGNA 5IK8A 3BTYA 1N1TA 5DMYA 3TNQA 4FI9A 5FAXA 3N9QA 2WS91 2RM21 5C33A 2VTFA 2JDPA 2JDAA 1SLTA 1ODMA 1EP0A 3ZFFB 1GOFA 2UU8A 3CL1A 2EF6A 3RJ2X 1VP6A 3KV9A 1EV11 2VMHA 5JMOA 2FHRA 2RS53 2G1MA 4FOQA 4OYUA 1FX5A 3GGLA 4XFHA 5E8AA 3SXWA 3VZLA 3GXUA 1DGWA 1JUHA 1ZRDA 1RINA 4YWAA 5LK5A 4PJYA 1PK6B 2AR6A 5A7OA 3TN91 4L9BA 1Y9QA 4O61A 4BWOA 1S1AA 4XABA 5H9RA 5FZOA 2DUQA 4OFGA 4Z92B 3M3QA 2CY6A 2BYVE 3HN3A 3ECQA 2X5IC 3M3IA 3CIHA 5JXHA 2WN3A 4PLNA 4JGYB 4EV0A 2FDFA 4NIGA 1W8NA 3APBA 3VB9A 4N43C 2DUOA 3LWCA 5BNPC 1FXZA 3Q8AA 1VBA3 1DGRA 5J48A 3I3BA 1DFQA 1DQ4A 1NKGA 4RGAA 3CZJA 2VMFA 2ZEZA 1VBC1 5JI9A 2A75A 4XIKA 1MEC1 1IPJA 4MGIE 1BMV2 5FZ3A 2XB6C 1R1ZA 3O0VA 4LR4A 4FAHA 1PO11 3AKRA 4NWWA 4MUVA 1YQ2A 3AZZA 5FZHA 3ZR6A 3ZIXA 2W3JA 1U0AA 3CJXA 2VU9A 1GP4A 1WGPA 2XUMA 3I59A 4AQTA 2XXZA 2VD7A 4X8NA 2VZRA 3BU0A 4IV1C 5BXXA 1ZZBA 4JRAA 1TEIA 3FBMA 1CAXB 5FREA 1PK6C 5JAXA 1SBEA 1YQ5A 1YIPA 1VRH1 5JSRA 1RJ7A 4BQ1A 4OZXA 1FT9A 5CADA 2VBPA 3J4UH 4GULA 3V64A 2ZMNA 4DRRA 1S0FA 2D93A 1IS4A 5T52A 2HEYF 2WZ8A 3KWVA 4JTNA 2Q5TA 5AC92 2LALA 4MX3A 3UV9A 3P3PA 3B9CA 4JGZB 3UESA 2XGXA 4BB3A 4E8CA 5BNOB 5FLHA 3KGLA 1OQEA 4U2AA 1RUE3 2E32A 2YMZA 3GBFA 5C4WB 2VXRA 2A70A 1DQ0A 4XF3A 1H2KA 4A2UA 1H1IA 2QDNA 5FZAA 4CSWA 1R1A1 1K12A 1UYYA 2JG8A 4CCKA 2WAAA 3LOIA 5L7OB 2RMU2 3SCFA 2PELA 5BNNC 1A8DA 1G6NA 2XJRA 1FNYA 1RB8G 1QHDA 2O0OA 4ATEA 5GZDA 4YFWA 4XF0A 5T5OA 3ZFEC 1F9KA 4QPIA 1VE0A 4EZ4A 5C9AC 4HONA 1RUI2 3ELNA 3HNBM 1S0EA 1H1AA 3IPVA 4LKSA 1UMZA 1AYN3 5I8YA 3IDCB 3AJZA 1D4M2 3PUQA 2YBSA 2DDUA 3A21A 4IETA 5FYCA 3T2QA 2E63A 1XE8A 2Z4FA 2VW1A 4OHZA 5A6QA 5B4XA 1ZZCA 1LOEA 5IVVA 2YG0A 3O1OA 3MZHA 1DG6A 4HG6B 5A3PA 4NRPA 4JGZC 1F15A 2FZ2A 3OD4A 4NO4A 1R081 1TE1B 5DG2A 2IVIB 3WNMA 3ZXLA 1KGYA 2Y6GA 4J6GA 4XMAA 3B01A 1RUC2 4WZCA 5FYHA 5C4WC 3B69A 2A7AA 5FYUA 4XURA 5FDBA 5A7PA 1WLTA 1AR61 2XOMA 4HLTA 4MADA 5LBCA 3BOWA 1UY3A 3QCWA 2Q8CA 1TME3 1VBB3 4UYBA 5CKNA 5HBAA 2TNFA 4CDUA 3IB3A 4YGBA 2WLQA 1WMEA 5A3TA 4KL1A 1ZREA 2XJQA 3MLJA 1CONA 2YPJA 4YFZA 4KNCA 2WS93 1POV1 4QQPA 2XQXA 4JDOA 4RR3B 1D4VB 2JKBA 3MFAA 3RYRA 5DUVA 4DUVA 4BQ4A 3I97A 2WABA 1H4HA 4H3WA 1CAVA 1EV13 4CU8A 2JDMA 4QKFA 1JTZX 2NYYA 1LOBA 1IS5A 3KQRA 3UGGA 1JYXA 2XDVA 4PBOA 2R043 3FZ3A 1NXD1 1NUKA 2XKOA 4RQPC 3ILRA 2E33A 3POGA 5FZOB 2Q1MA 2YC2A 3WNLA 1NQDA 3WDVA 3ES4A 4Q29A 3J26N 2VMEA 1Y3TA 1YQ6A 4K7JA 2PHXA 2D6LX 3ETQA 4PDWA 4BPZA 1UQXA 4COZA 4E4ZA 2VQTA 1LHNA 2HKXA 2WLPA 3OUHA 5C3SA 4MG2A 3S6PA 3WHUA 3MFCA 1DZRA 2WQ8A 2UWAA 4A3XA 1Y4WA 5EYXA 1QWRA 4MGZE 4YM1A 4LT5A 5FLJA 3ZXFA 4Q0QA 1VBC3 4Q4Y1 2WZPP 2GAUA 1MEC3 2QCSB 1N1VA 1EPWA 1PIV1 2VC9A 2VQUA 3LFMA 2VMGA 1NA1A 3PMSA 4Q2FA 4AFBA 1UPIA 1JYIA 1PO13 4AFDA 4Z1VA 1DQ5A 1DZTA 2Y6HA 2QQVA 2YY1A 2XHKA 5D8AA 1CAUA 2P37A 3I59B 1JBCA 4CEWA 1JZ6A 1K42A 3N7MA 4XFCA 3HR9A 2VNGA 4CDWA 5A1AA 2E9QA 3ASIA 5EXOA 2RHPA 3N7LA 1DQ1A 3HEIA 1UNBA 3ZYPA 3AMPA 5LEKA 3ME2A 3T0AA 1VRH3 1WMFA 1OA3A 2TBVA 3CHXA 4QPWA 3WF1A 3WUDA 2VZ1A 5L9BA 4AEKA 2RS31 1Z0HA 4Q4V2 2CGNA 5DDJ2 4NIHA 3MHZA 4NVPA 2PHDA 4HSLA 1O59A 3A7QA 2QDRA 2R7EB 3WV6A 2AYHA 2VUAA 4CXYA 2R0HA 2VW0A 4ZY9A 1V9U3 1J3PA 2UY8A 1MS1A 1AR73 1XSRA 2J1RA 1EY2A 5FXZA 1PZ9A 4ET7A 1XE7A 5EYYA 4BQ5A 3HQUA 3ACIA 1R1A3 2ZX2A 1SCRA 1UAIA 2P17A 1UXXX 5IVJA 3NJXA 3AKTA 3AP4A 2E51A 4O7XA 4AG4A 4ASLA 3SLIA 2VBBA 2W1WA 3MIGA 3SITA 4UFLA 2LUWA 4XUPA 1ZYBA 2X29A 3VBOA 5KHJA 5FMOS 3E5XA 4S2DA 2GSYA 5FZBA 2HEVF 2GU9A 2ILMA 3J8F2 3BYWA 2Q1ZB 2RR12 1SQ4A 3A4UA 2SBAA 2PLV2 1XJAA 2VMCA 4P08A 1HRV1 2MPFA 2GH2A 4RD7A 3ZVXA 2OS2A 4GWNA 4EQVA 3T09A 2J7MA 4NRMA 1JOJA 4AVVA 1ZBE3 1W8ZA 2XQRA 3IAPA 3K51A 4YW5A 2RMU1 2OQ7A 4EN9B 5LZ6A 1R083 3GHNA 2EIBA 4H2AA 5E6HA 5FPXA 5IHRA 4CEWC 4XJZA 1VALA 3NL1A 5L9RA 5C3OA 2DV9A 1C8M1 4XUNA 4HN0A 5J09A 1RUI1 5DG1A 2DU0A 1FATA 2VOKA 2DBNA 1CAWA 3PIJA 2JG8C 3M7AA 5L73A 3DF0A 1S0JA 3U14A 3ZFGB 5JCTA 1REEA 1AR63 1F2NA 4ISQA 4K8FA 1X9TA 2PYTA 2PHFA 3LIGA 3U11A 3QD6A 1LGBA 4XE9A 1KFXL 4J25A 4QPIC 4DXSA 4UW4A 3UKVA 4MGTA 2MHFA 1NX9A 1I5ZA 5A32B 3ZXKA 5GZGA 4UXAA 3IKWA 1LEMA 4V2VA 2ZHNA 3AB0A 4W6XA 4AK3A 1C3HA 1GICA 2W47A 2OX0A 1POV3 2WT2A 2WZR2 4C1WA 1O4TA 2WJSA 1HX6A 1RUC1 2Y8KA 2ZMKA 1UXZA 3BVCA 4YYOA 4XMIA 1CAVB 3PUHA 4MZUA 5F3GA 2ZMLA 3DYOA 1E5SA 5LK7B 3X29B 4R8HA 1AYM1 1CN1A 1YNAA 4Y24A 3UL2A 4OLLA 4QU1A 4AGVA 3P1IA 4GJZA 4LXLA 1Z7S2 1UOBA 1RHI2 3Q8BA 1YHFA 3B7MA 2XJSA 4BIOA 4D6QA 1BVVA 2FDJA 5A7SA 1W9TA 4LBNA 1PZ7A 3J7HA 4R9BA 3SEEA 2ZGNA 1YC61 3VL8A 3M3EA 3C8XA 3VKLA 2VUCA 1LOCA 3DGTA 2ZGSA 4ZU5A 5LEJA 3RG0A 4FPGA 4B8EA 1U5ZA 1S2KA 4LLFA 2VM9A 1A34A 1RUG2 2G4IA 4I3PA 4CDUC 1HXS2 5BNQA 3DV8A 2VQAA 1N1YA 4FSJA 1ZRIA 4IEYA 4JV4A 2YV8A 2QFEA 2B9VA 1XYOA 3BUCA 4HXCA 5FMCA 4UOJA 1JZ4A 1UD1A 1NA1B 1PIV3 2P3IA 1OC1A 3O1UA 1DCSA 1HV0A 1L3JA 1H9WA 1X50A 2ZABA 3PU3A 3ZX7A 4YW4A 3I7DA 1NY72 2EXIA 4OHXA 5D8AB 2AGSA 5LB6A 4CEWB 1D0GA 1CX1A 1UX6A 1SFPA 4CDWB 2DVFA 3A0KA 4AGRA 1UZYA 4XFIA 5FZDA 3WF4A 3KVAA 1E5RA 4CPBA 4D7SA 1OVPA 2YC0A 4EN6B 1OFSA 2YXSA 2Y6JA 4ASKA 5FUNA 1W0NA 4WM7A 3KV5A 5FO7B 2C26A 1LENA 1G9BA 4KWLA 2XLGA 4OUMA 4DMIA 1X82A 1LJ7A 1VAVA 5FXXA 2ID4A 1OKOA 2WBKA 4PDWC 4COWA 4WM8A 1H8VA 3VHNA 3UNPA 2HBTA 1AR82 1ST8A 1W6QA 5FQ0B 3AP9A 1I6XA 4LPLA 2VG9A 3JD72 3JCIA 2CAVA 2RS12 5C70A 3I3EA 1W99A 1XQNA 3FJSA 1DYKA 5F37A 3U37A 3OGVA 1OBNA 3VDDA 2R0FA 3N36A 3O1MA 2ENRA 2G9ZA 1KXGA 3DL3A 3MI8A 2VAUA 2EAKA 4MGQA 5CBLA 4ARYA 2GDFA 1NA1C 1ZZ7A 1PM4A 3AK0A 1PGW2 4QB2A 4WZFA 3U0ZA 4Z2AA 2TEPA 4QT6A 2XBO2 4W4ZA 3BTZA 1VB4A 2WUHA 3PIGA 4XAEA 5D8AC 1Q8VA 2QQMA 3LZZA 4IEXA 1QF3A 4GMP1 4Q4V1 5F5QA 1ND2A 2XG3A 2J1AA 2PQQA 3ES1A 2VZQA 4AI8A 2Z69A 4CDWC 3VBOB 1NLSA 3R05A 5J36A 5AC93 3T0BA 2QQNA 4ZZ8A 3PNAA 3AMQA 4QB1A 2BWCA 3JXSA 4S2HA 1RUOA 1W2TA 5FKCA 3THPA 3MIFA 4M01A 4EN0A 1G9DA 3WCRA 4MGSA 1S55A 1TQ5A 4DIQA 1WLDA 3ACLA 2G19A 3DPRA 4HN1A 1GMMA 1HRV3 1Q8PA 2ZHMA 1N3OA 5FY9A 3O1TA 3H8OA 2ET1A 2B45X 2W68A 4GWJA 4W50A 4XBLA 1H2LA 1XNCA 4YVSA 1QOTA 3LFIA 1DLLA 4IUGA 5G04L 1NXMA 2VOXA 2RMU3 3C7OA 3K48A 3NNMA 3Q8FA 4UF0A 1CESA 4LBQD 2G9FA 1XC6A 4HT1T 2RDSA 4MOAA 4IL7A 1RUI3 5GALA 1CAWB 4Y26A 5F6KA 3GZUC 3C7FA 2WSUA 2PLV1 4LE4A 1D4M3 2OW4A 1YLLA 3GM8A 3O12A 4Q4X2 3ZYGA 5C3RA 1BEV1 3ORJA 3PURA 3VBOC 4FOYA 3WW3A 5DZEA 3WP4A 1A6CA 3WG1A 4DB5A 5E1RA 2YU1A 5GLWA 3ZR5A 4QQHA 2ZZJA 4CYDA 5LA2A 2X10A 3QH6A 4DOUA 2CNAA 5J1XA 4LHNA 1RUC3 5A6XA 2YFUA 2B42B 1HLCA 2OXBA 2XJUA 5FKBA 4XXAA 4ITCA 3SH5A 3AJYA 3ZSMA 1FPN1 5ABJB 3EQEA 3HWJA 2CV6A 3DYMA 1JOPA 4A7ZA 1C57A 4AEDA 4QKNA 4LJHA 2K2SA 3KV6A 3DEMA 1W06A 3WNNA 4AYUA 2JX9A 5A6ZA 2YC4A 3QBQA 2BJSA 4B4RA 4CXWA 2FQPA 1OQ1A 5J37A 3EHKA 2VVEA 4NMIA 4LHLA 1TG7A 2LRPA 2WZR1 1FMD2 5C8CA 1UCXA 3ZSLA 1GZTA 4Y1XA 3UETA 2VVFA 2CU5A 2KA3A 3VKNA 1REDA 1YI9A 1XE0A 4LBQA 4CVUA 3TAYA 2HWE2 4I09A 1BHGA 5BUVA 3MPPG 2CGPA 2HWC1 1Z7S1 2OYZA 5LRSA 2FCTA 2ZEYA 2JE7A 2ZXQA 3QOPA 2YBPA 3GCXA 2QJVA 1W2NA 4A41A 1XOYA 1NCRA 1CQ9A 3KCXA 1S2BA 3M3OA 4B1LA 3K2OA 4JX0A 1WWYA 4M3CF 4M00A 1XPWA 2V4AA 3AKSA 1QXRA 4Q4W1 3ZMNA 4BISA 3O1SA 2RJ2A 1RUG1 4LO6B 4WM7B 1BBT1 3RNSA 1ENXA 3OEBA 3PVNA 1JYNA 1FNZA 3VZMA 3ILNA 2IZWA 1GQPA 1QQP1 4Y20A 2Z79A 4GALA 1W6QB 4BXFA 2RJLA 2KXLA 2WA4A 5DAPA 1RYYA 4HKOA 1C4RA 1LEDA 5HPOA 1NY71 1QNYA 4QDQA 3T08A 1WKYA 3LEIA 4JHTA 3VN4A 2QVSB 4J1XA 4A6SA 1RUJ1 1OURA 5EQUA 3N3HA 4LBOA 2WT0A 5EWSA 1AR92 2F6BA 4QMAA 5C8WA 2RDNA 4ZPIA 4B7KA 1ND2B 4Q4V3 4Q27A 4AFAA 3POSA 1JYTA 2GMEA 5DDJ3 3J7MA 2R49A 2ZAHA 1X36A 1OLRA 2VPVA 4HKWA 3RWKX 2CTVA 2NM1A 2C9KA 4BOWA 4XCBA 5LATA 4WM7C 2CGOA 3WXPA 4CRQA 4CXXA 2RDQA 1DGWX 3ZKUA 4YM3A 4FPJA 5DPNA 4P9LA 3BIWE 2ZGQA 1W6OA 4WM8C 3D0JA 4C90A 3GNEA 1BVP1 1MZ5A 1GQHA 2QQPA 4IEZA 4AEJA 2XBO1 4YVSB 4XJ8A 3OPZA 2O8OA 4I02A 1UKGA 3L2HA 2VGDA 4YG0A 5D21A 5FZGA 4AWDA 3VDDC 1UW8A 4A3ZA 5A3UA 1LB2A 2WL1A 5LASA 4UF0B 5FZ0A 3T1LA 5LA1A 4JDMA 1RUE1 5LY1A 3ZIWA 5KC6A 3RYKA 3WOGA 4QGMA 5KHGA 1ULOA 1UWWA 2EAAA 3LIHA 4NPRA 2BOJA 1W8UA 2W46A 4KG8A 4A7KA 2RR13 4YZ1A 5D2AA 4P5HA 2WQZC 3M4FA 1VBE2 2PLV3 3POIA 2X53S 1UF2C 1NG0A 4GH4A 1J3RA 1ND2C 1E5HA 3MBWA 5FZ7A 1PGL1 2IXJA 3NKGA 4E4HA 3G6JB 3K75B 3R6SA 1LU2A 1O91A 4WV8A 2VY0A 3AZXA 4FTBA 1BCXA 4YG3A 4OI1A 2VQ0A 4LQRA 3WQ7A 1FOD1 1JHNA 2AREA 2UWBA 3KCCA 3VKFC 2ORXA 3DPRC 1LULA 3LPGA 1BJQA 2B8MA 2PHLA 1X7NA 1OUSA 5CIRA 2EIGA 3AXEA 4IQPA 3NQHA 3TYJA 1W9YA 5EZWA 4YVSC 1AXKA 4GKXA 3PTRB 3RZJA 4QGLA 4AEDB 2H0VA 2R32A 1QJEA 3NV4A 5FY4A 2E53A 4Z07A 2XMLA 5FZFA 5HXMA 1UZZA 3IN9A 4YG6A 3WDXA 1V6IA 2WZR3 4NHMA 5C8CB 1HQLA 2WWUA 1CZTA 1KITA 2BGOA 2K0GA 4AI1A 2OVUA 5JOYA 1HB2A 1O5LA 1CJDA 1JMUB 3VHRA 2DF7A 4TZDA 1OH3A 4LBQB 1NAEA 5HI0A 3A23A 2GMPA 3OOXA 3O5SA 5FXVA 3WD5A 3WLUA 1VLNA 2HWC3 1FV3A 1Z7S3 3MIBA 5JSOA 1YFUA 4AI9A 5DAQA 1V6KA 4AAPA 4LORA 1OPMA 3AVSA 3IDBB 1LKNA 3FE5A 1ZA4A 4PI0A 2I74A 3MIDA 1JZ7A 1HB1A 4E4DX 1DQ6A 2R041 4IV1B 4AEDC 3O0WA 4P9GA 4Q4W3 5E16A 1N3PA 1PX3A 1C5IA 4XJWA 1CPNA 1RUG3 3I3QA 3L2YA 1BBT3 3I2DA 3LD8A 1POQA 4M0NA 4QQLA 4JCKA 4PIXA 2HWE1 4Y20B 4UFIA 2XH6A 1QQP3 4Y5Z0 1LOAA 3AP6A 4DXZA 4ZXKA 2EA7A 5C8CC 3LA7A 4UFMA 5EJZB 3SNMA 2X8KA 2XL7A 3VBUA 3AX4A 1UOJA 1QDCA 2GC3A 3LDKA 2GNDA 4MGKE 4RHV2 3VBRA 1ODNA 2VZPA 2DVAA 2GP3A 4M3CA 4NJ4A 4F8AA 5F6LB 3AYEA 1RUJ3 2WZEA 2W92A 2ZBJA 1OFNA 2Q0AA 1WMDA 2LW8A 3B3QE 2XR4A 3VBSA 4DO0A 1ULDA 1VB2A 1NCRC 2IUWA 4C0HA 5A7WB 4D7YA 4OI0A 5BNNB 3N9NA 4ES8A 3W5NA 1AR83 3T3YA 4IE6A 3M70A 2RS13 3ZFEB 2JIGA 4ZS3A 5C9AB 1AX0A 1JUIA 3GZAA 4PLMA 3JB4C 2KR2A 3F95A 2CAUA 3LAGA 1W6OB 2D6NA 4HFSA 1RJ8A 2VUJA 1WW5A 1YQCA 2VOTA 3POJA 5FMOL 3PDQA 4L97A 1FV2A 3WDWA 4A7YA 5A1FA 5JIUA 1UL9A 3HOBA 3IMNA 5H9PA 3NW4A 2JEMA 2D3SA 2XBO3 1ULPA 4PT6A 2PN5A 2P1BA 2WWSA 2FZ1A 1V9U1 2PHTA 3HD8B 3MF6A 1UY0A 4XQWA 1PGL2 2EVXA 3OTFA 3TBDA 1AR71 4WVWA 4Q0UA 4KWJA 3ST7A 2VNVA 4AHZA 4PIYA 1O6UA 4LEJA 4FFGA 5ACA2 3CDZB 4YGDA 2UY9A 4DUXA 1VAKA 1Y9MA 2Y6LA 3FX3A 4AL9A 2BBAA 4FOVA 4GH4B 3AKPA 5FUIA 1RUF2 4NHXA 5CFCA 3D4KA 3DXTA 3RJRA 2BUKA 3OYWA 4DPNA 3ZYIB 2ERFA 3K46A 2Y0IA 4LK6A 3THCA 4LA3A 3O1PA 2XWBB 2A6VA 1DQ2A 5KXDA 5GJ6A 1FOD3 3WF3A 4HK8A 1V6NA 2DUPA 1VAMA 2W87A 2WFF2 2YHJA 4FO9A 4ISRA 5ANNA 2ZGPA 4HL0A 5C5UA 4B3NA 1ZBE1 4QX3A 3JUUA 5GLTA 4LO7A 4TN7A 3JBG2 3MW4A 4XF1A 3WNOA 2XKPA 4BQYA 1VBE1 4XHBA 2BWAA 5T55A 5JDBA 3H8RA 4FTEA 4HVQA 2JENA 1MPXA 5AFBA 1JODA 4RL7A 1LODA 2IFWA 2WAOA 1W3XA 4RQPB 4A42A 3CZUA 3KZ4C 4CCMA 4CP9A 2DFCA 1W6MA 2ADDA 3I3DA 4GAZA 4G4FA 1E5IA 4GA9A 1C5HA 2OUJA 1O3SA 3OGRA 1KS5A 3NV1A 4XFGA 3CMGA 3LEGA 3WDUA 3O0XA 4GH4C 3HJRA 3ZPYA 2VCBA 2D6PA 3N9OA 4KH9A 5AVPA 4AR2A 3J7LA 3N35A 1W3VA 3OY8A 2BV4A 4COUA 5KHKA 1N47A 4C8DA 1G7YA 4AFMA 2EIEA 2ATFA 4RFT0 5FXWA 2W08A 4LO4B 5KR7A 4KMQA 4H7LA 4XPVA 5CG8A 2K46A 2W2IA 1O5UA 3CLPA 5I8SA 1OXCA 3JZVA 3EO6A 4IGPA 1DHKB 2XHNA 2ZGRA 2GZWA 3N7KA 5KHHA 4Y4YA 1FMD3 5JSPA 5I8TA 3H50A 2ZKNA 4XZPA 1BYHA 2AEYA 4NIAA 3WINE 2O8QA 4IW3A 4MV2A 1WLWA 1PMJX 2IC1A 3SQOA 3LSDA 5F3CA 3POEA 2ZGKA 1H2NA 2OQ6A 2HWE3 1ZZ9A 2IXKA 2IXIA 3RZLA 5GLZA 2JJ6A 5K7PA 1SCSA 1WLCA 2B7YA 4PBPA 2EICA 2DYCA 1JW6A 3VBUB 1YWKA 5FPZA 4I3GA 3AP5A 1JZ2A 2IXHA 1GV9A 2H0BA 4FPCA 4FPKA 3LEKA 1QJFA 1W39A 1OPOA 2VL4A 3ITQA 5JVVA 5IVBA 2E31A 4IEQA 3KD4A 2HYXA 4N7IA 5FV3A 3U1XA 4FT8A 2LS6A 4L92A 4COYA 4QKBA 2PAEA 5C3QA 3TEWA 4DXTA 1R092 1AJKA 2ADEA 3ZYBA 1COV2 1MVEA 3NJVA 4P14A 1DU3D 4QDSA 3H7JA 1JYCA 5HCAA 4X6RB 1WD4A 2V72A 1NE6A 5HV4A 3ZXEA 4YZ3A 5FK8A 3THDA 4E4SA 5FY5A 4TXWA 4HZFA 4QHOA 2A6XA 2I07B 2VULA 3I2HA 5GZFA 4Y33A 3TEZA 1O8PA 2YB7A 3EBRA 4OUSA 4XDOA 1MQTA 4CU7A 2GC1A 1ZZ6A 1HN0A 2Y64A 2VMIA 1J3QA 1BMV1 3KQ4B 3MGUA 4JHZA 3VBUC 4O65A 4XW3A 3RYPA 1AR93 2BW8A 1IS6A 4BE3A 1UN1A 3KT4A 1LAJA 3VBRC 4IEPA 3DUIA 1XYPA 2C24A 4FPHA 2ZS6B 5ANQA 1U12A 4F7ZA 3B9IA 1GZWA 1QJY2 1DIWA 2DTYA 4MXWA 5LWBA 2BBVA 1C1LA 3OG2A 1VJ2A 4XF4A 2VECA 3DECA 5EPAA 4DRVA 1Q3EA 2GC0A 3OBRA 3VBSC 4R9AA 2ZJCA 2JG8B 3WHTA 1AXZA 1GWLA 4UW3A 1E57A 2AACA 5IAVA 1NCQA 1SBFA 3FHAA 4GB32 2D40A 3H3LA 5IAXA 3MLLA 1XNKA 3BCWA 3INAA 1X33A 3S5QA 5AC91 2W1SA 3OYWB 4QPIB 1ENRA 4PIZA 1PHMA 3IPVB 5DUWA 1JZ5A 3SMHA 2D6KA 3F2ZA 2GNTA 4UW6A 5F39A 4AI0A 1XU2A 4B7EA 1Z78A 2JB8A 4XAAA 2JB4A 4LE3A 1QIQA 3VBHA 4LA2A 2R1DA 1OLMA 5ACA1 2QNKA 4GQ7A 4H14A 3HQXA 2B4KA 3OUIA 4NPLA 3TB0A 1KJLA 5HCFA 3IMMA 2JD4A 4ORFA 1VBE3 2GNBA 3HAGA 1IPKA 3I8TA 3H0OA 2QQIA 3QLQA 1DYPA 1Q5OA 3MV01 4HBNA 2V5YA 1IQDC 1W6MB 3E6CC 4IE7A 1HJGA 5JI7A 1EUUA 2R072 3SHRA 1G86A 2VW2A 4JKLA 1D4M1 1PO22 1SLIA 5A7QA 3WG3A 4AVSA 4P00B 4XBNA 4EROA 4JQTA 2VCAA 5FYTA 5CFCC 3FL7A 1TVGA 4CCLA 3OY8B 3PMEA 1HKDA 4CDUB 4KWUA 3T4VA 1KDMA 3JBG1 3THTA 4AQSA 1PVC2 4BU2A 3H42B 4UAPA 1WCQA 4CPBD 2PA7A 3WUCA 3CEWA 2RE9A 2ZOEB 3WSOA 1XSQA 3Q9OA 5FBZA 3VL9A 3WF0A 3ZDSA 4KGQA 2RJKA 2W9XA 2ZPXA 4A44A 1D2SA 2VZUA 4W6YA 4EN7B 3IIAA 4Y5SA 3LDBA 1UY2A 4FOWA 5JUVA 3UGHA 3ZN5A 4P5YA 3HPNA 1PM7A 2KM2A 4CTEA 2HJIA 1K5JA 3SKJE 3BKZA 1VBD2 1W04A 1JYVA 4AGGA 4F3JA 3FHQA 2W39A 5BPXA 3FWEA 2FD8A 4YVWA 4CUBA 4CUAA 4PDWB 3ROUA 1F4AA 5FP9A 4P9WA 3AYDA 2FMYA 1OA4A 2D7FA 5F1RA 1EPZA 4YM0A 3T30A 2LROA 3HIFA 1K3IA 2J22A 3VZKA 4D0QA 3BTXA 2QKDA 5F5AA 1UU4A 3JQXA 4I0BA 4Q26A 2DFBA 3AFKA 4QX7A 2CDOA 3FMGA 3H1YA 3MLKA 5HCBA 5I0TA 3ZPOA 4DXRA 3LOBA 4BM8A 1ALYA 4NROA 5FZ8A 3U4XA 2BNNA 4FAGA 5IATA 3OBZA 1W6PA 4EWAA 1QY4A 2WA3A 5K9YA 1CAUB 5F2SA 4YZ4A 5KHIA 2D44A 1OA2A 3RS6A 1N1SA 4BHPA 3GBWA 3UKNA 1LHOA 1R64A 2Q8DA 5JOZA 3IZOA 4DEQA 1SG3A 3WNXA 4BYYA 3PTYA 1BZWA 1MQTB 4C91A 4Y1UA 4AAXA 1G9CA 1C1FA 3RZGA 3NNLA 4OMDA 3NNJA 2OZ6A 3TEYA 3O1VA 1H4GA 2ARCA 1ND3A 3PUIA 3E6DA 4J1WA 1SLCA 3K4AA 1COV1 1WW6A 1RL3A 5ERLA 5LCWL 1MACA 1VBA2 2HLEA 2BEOA 3NJYA 4UFKA 5F9TA 5GLUA 4BMEA 1GZWB 2WQ4A 4XUQA 3UGFA 4D94A 2Y0OA 4Q8KA 1LESA 4LITA 4AE2A 1TZOA 4TLFA 5A3LA 1H1MA 2E7QA 1LOFA 3LF7A 4YGEA 1LNSA 4IE4A 2QQJA 3HT1A 3ZXAC 5FOBB 5T50A 1LHVA 1QJX2 3M3CA 3V0AA 1W8FA 1LTEA 3HQRA 1QH7A 1W0PA 5DDJ1 1IG0A 1PMIA 3K77A 4XHXA 1GNHA 4JRLA 4K6BA 3WEZA 1DDLA 1W2UA 3BI3A 1J59A 1OD3A 3SEPA 1JU3A 3DYPA 5F7UA 3OCPA 5KC5A 5KWRA 1MQTC 2VO5A 4NWVA 4U36A 3W21A 3RRDA 3S0MA 4YM2A 2IXLA 4AZZA 4AOCA 3M8LA 2ES3A 5FO8B 4GMP0 3OBTA 5ACA3 2ZTNA 3K4DA 4SLIA 5JPMB 4HPKA 1UU6A 4WVVA 3LPFA 1UKRA 3DCQA 2JE8A 4LO5B 1LU1A 1LRHA 3OGGA 1WW7A 1IKPA 1H6XA 4YGCA 1LECA 4ASMB 1A3KA 3E6BA 2QQKA 4A6OA 1M4WA 1G9AA 3FBYA 3MDPA 4LOSA 4Y22A 5A3NA 1ULFA 4XZUG 5JXIA 3ZN6A 1F35A 3VD9A 1QJU2 3MIHA 4LBJA 2V73A 3J8F1 3R4DB 3MPBA 2RR11 4IEUA 4QB6A 2HWD2 1U5XA 1NCQC 2QTWB 3PJQA 5LA9A 4M4RA 4KGGA 1UZWA 1XU1A 2VUDA 2VXJA 4GIQA 4GZ9A 4CP1A 3D6EA 1XNDA 2WFF3 3FUQA 3VD3A 4E2GA 4IDZA 3HMYA 5F2WA 1GZCA 4AEMA 5IJRA 2ZGLA 4QPYA 1ENQA 3JBG3 4W6WA 5E89A 1YUDA 3BALA 4M3CE 1AX1A 1WZXA 1OD5A 4LOTA 3GCWA 1YI7A 3LQCA 4N90A 1JI6A 1Q8SA 2P3YA 4JQRA 3VBHC 4EWEA 1F8VA 2DURA 2ZX0A 4PCRA 1RTVA 3BB6A 2R071 5GLVA 2ZX1A 1NT0A 3E1F1 2XUEA 2ZX4A 3PLQA 5H9SA 2DBIA 4FPOB 4BZ4A 2JG9C 4OQ9A 3VKOA 3CF6E 3IWZA 3RZMA 4XJUA 3WCSA 1UIJA 2GMMA 2ZA9A 3FN9A 1RMU2 4BCUA 1W28A 3ZYJB 1ZZ8A 4EZHA 4IESA 4GWIA 4YVWB 2R30A 4XCAA 1CVNA 1B35A 2W52A 5FZ9A 1VMHA 3JB8A 1TME2 1GKBA 3Q8CA 5F5CA 1H2MA 4BH9A 2W95A 3PUAA 3ZLIA 1OOPA 5CVRA 2R6QA 4QPGA 1SFNA 3J9SA 1AF9A 3BPZA 1JH5A 2NPIA 2QE3A 5AFEA 2RVAA 4FPEA 3VLBB 2RM22 3S30A 4FP2A 4LIUA 5JOWA 5SV8A 1RHI1 1SHWB 1P8JA 1SPPA 2CWMA 2RV9A 1IS3A 4JKMA 1L7RA 1OH4A 1VBD1 4XTPA 1W6PB 2RG4A 1EV12 3N9LA 1AL22 1O4ZA 5CKQA 5F5IA 2PQSA 4NPMA 4A45A 4CCJA 2VH9A 4HETA 3WNPA 4CZSA 4DUWA 3TN92 1HRI2 4ATFA 3PHMA 2D6MA 4HK9A 1HXS1 3VD5A 1WA4A 2NP0A 5DZFA 3WX5A 4BDVB 3NV2A 4YVWC 3RFRA 4WM8B 1NE4A 4D7TA 4BXSV 2VZOA 3LSEA 4CCCA 3IDAA 1YEWA 1R093 2QZ3A 3ACFA 3NJZA 3KMHA 2ZGOA 1COV3 2HYKA 1BKZA 4M0HA 4OUEA 3VDDB 5E88A 1HB4A 5EJ1B 4XQDA 5FYSA 4NAMA 5FZIA 2D43A 3ETPA 4K21A 5LW9A 1TMF2 1MEC2 1J1LA 1ULGA 1UO9A 3KHCA 4P9IA 4YZ5A 3GZTB 4AVTA 4FBFA 3RZKA 5G05L 1OF3A 4MLOA 2JXAA 2ZHKA 3B93A 3ZN4A 4AVAA 3FHIB 4LBKA 4OMCA 1YJKA 3V0AB 3GDBA 1LHUA 4IEWA 4K3UA 4QX1A 3WG4A 1AR81 4IXLA 4QXHA 3JD71 2VTXA 2A1XA 2RS11 3MF9A 3E5QA 3NNFA 4JGYA 4OQ8A 5FCCA 4AQ2A 1XNTA 3MUY1 5CA6A 4K1ZA 1UZ0A 4HVRA 4TLGA 1W9FA 2FCUA 4NAOA 2HWF2 1RUH2 1W90A 1JS9A 4A4AA 1T6BX 2PAMA 2DVGA 3DPRB 4B4PA 1UY1A 1ONAA 3P5BA 2YFZA 3WVJA 4IGOA 1PGW1 1ND3C 2DVBA 2PFWA 3HVDA 2JDZA 3J7NA 5FY0A 4RGKA 4EN8B 1I1EA 1XB9A 4LIVA 1QJX1 2DVDA 4LKDA 4NUBA 1AHSA 1RUNA 4GB33 1B09A 5I0RA 5CKMA 4CCNA 1XYNA 3SCHA 4Y22B 5A6YA 1PNFA 1OVSA 4MGYE 1YIFA 3ACHA 3ZN6B 1W03A 4AVBA 1LOFC 1ZX5A 4EYUA 1XNBA 2E7TA 1R1A2 1LR5A 1URXA 5F8PA 4MH0E 4C1XA 3J8F3 3B02A 3KV4A 4UT5A 2WNUA 2DU1A 2XL9A 4H55A 3OBAA 2OIIA 2FDHA 3WY6A 1SEFA 5FY7A 1US2A 3VZOA 2Q8EA 4BQ2A 3MO4A 5IFPA 3VBFA 5JXJA 5IK7A 2GN7A 1IZ3A 1WW4A 3POBA 1IGOA 4XILA 3D0SA 4CUGA 5BNOA 1O3RA 5FO9B 1JXNA 4Q5OA 3RWNA 4BLJA 3ZDVA 3SCGA 2ZAAA 2AUYA 4UBGA 4MVTA 4XOGA 2WNOA 2VCCA 2CYFA 1KD7A 3UT0A 2PXJA 1S2EA 1MZ6A 4KG0A 5IVFA 2F17A 2R073 1F4HA 4CU6A 2XVLA 3FLTA 3R0RA 1ASJ2 2C6SA 4MSVA 4IE5A 4YLZA 3U75A 3WNKA 1ZRRA 4NR1A 4Q4X1 5GKAC 4FQZA 4EE2A 1AVBA 1MS0A 2WINB 3ZXDA 3KF5A 2W94A 4RS5A 5FBJA 3OGSA 1ZRFA 2E7AA 3GJAA 3U07A 3LGRA 3LB9A 3OJBA 2GN3A 2JD9A 3GHMA 2BNOA 1PVC3 1GQGA 1B35B 4OI2A 2O14A 1SFYA 5FPLA 3B94A 2JICA 1AR62 3ZOIA 2OA2A 2WNVA 3MV11 5T5LA 3ZMOA 4DY5A 1AUYA 4CU9A 4XQ4A 1OOPB 4QPGB 4L0PA 4FPFA 4LBLA 3AC0A 5ISLA 3KM5A 2EXKA 3G7DA 3H1WA 3CKHA 2A3YA 3SH3A 1OT5A 3BU7A 2A71A 1RHI3 1JOBA 1WD3A 1LHWA 5DUXA 2WR9A 1VBD3 3Q8EA 1JU4A 1KDKA 5DN2A 4V2WA 1MR5A 3O14A 4P9JA 1Y9GA 2HWB2 1NCRB 1W0OA 4BQWA 1SMVA 3FFZA 3LKJA 3ABZA 5KXEA 3LA2A 5FZ4A 1CIYA 1JHJA 1FMD1 3EJKA 1CR7A 1G9FA 1S0IA 3TWIA 1EYBA 1UYXA 2VMDA 3ENRA 5F32A 3K3OA 1QDOA 4BJ0A 3BOPA 2XJTA 4K9SA 5DZGA 1HXS3 4PQQA 3NSTA 2DTWA 5A80A 1GYKA 2BRTA 3NAPA 1VRBA 3PVBB 1B35C 2V09A 2B46X 1OLME 5FRAA 1PX4A 4AHXA 2D97A 1GUIA 4RR3A 3A22A 1WCUA 3RZZA 4IGQA 3OB8A 4UFHA 3AZYA 2FBEA 4CCOA 1AL21 1OOPC 5FYVA 4QPGC 1XXNA 4NHKA 3VGIA 1PMHX 1OF4A 1WMXA 3ZSEA 1IPSA 1CPMA 4E9KA 4IERA 2FDGA 4Q4Y2 3N9PA 3AZWA 3IBMA 3FUOA 2P2KA 1PIV2 1D0HA 1HRI1 2IWGB 2WNEA 3MIEA 4FFFA 2BZDA 4JDNA 4N53A 4XC9A 2VJXA 2VZ3A 2E6VA 1H9PA 2PTMA 5FPAA 2JDNA 5EFUA 3QH7A 2OT7A 4AVCA 2D6OX 2Y33A 3KT7A 5CNAA 1SLAA 3JD73 1UOGA 3W58A 1BQPA 5HV0A 3V65A 1C8NA 2YPDA 2WC2A 5CAZA 2ORZA 3ON7A 3BIEA 1X8EA 2JDKA 4N7UA 1NLQA 3ZM8A 2WO7A 3HT2A 1QXJA 1TMF1 2RS32 2WO1A 3EB7A 4FVVA 2WKKA 3CJIA 1JZ8A 3GZEA 2W5FA 3MUZ1 4FXGB 4G3YC 2VR4A 4KQ7A 4XETA 5GM0A 3DKQA 5HXVA 3VHPA 3ZFFC 2I2SA 2BU9A 1AR91 4I2OA 1O8SA 4URTA 5DAVA 1FYUA 2R062 2ETEA 1QJX3 2H6BA 3C7GA 2WYFA 4ZS2A 3KLSA 4CUCA 1MS4A 3WR0A 2Y6KA 1RUD2 4JAAA 3W20A 1REFA 2A6WA 3OD0A 3RI8A 1IHMA 1UYZA 2HWF1 1RUH1 5IVYA 2ARAA 5J98B 4MO3M 5JOXA 5L9VA 2WNUB 4AXOA 4TSVA 1EUTA 3KSCA 2Y60A 4N9IA 4QU2A 5FPVA 1Y7BA 2WIIB 4JGYC 1Q43A 5I0SA 3VBFB 3GF6A 5C3PA 5JMCA 4Z8BA 4V1PA 1UYPA 4CDQA 4XYXA 1W6NA 1H8TA 1GWKA 2C9AA 4XIOA 2A6YA 4BMBA 4AF9A 5JXGA 2J1UA 2G9GA 5CFDA 5CU1A 1HRV2 1W05A 3RSJA 4BK5A 4CP0A 4TYSA 2RDRA 2BVVA 4PF1A 4IEOA 4B4QA 1QJU3 2ZZQA 5IK5A 2WN2A 1DZQA 4I0AA 1BLZA 4LLOA 1SDDB 1HV1A 2Y38A 4IEVA 2HWD3 3KS7A 2QUOA 4XJAA 4YW6A 1Q8QA 4KWKA 5JR7B 4XXPA 4UW5A 4E2SA 4HOOA 4Q4X3 3TNPB 1GU3A 1SBDA 2P3JA 1OHFA 4RS5B 1C8M2 4AFCA 1RXGA 2BFUS 2WWJA 4Q0PA 1T6GC 3MYXA 1ZVFA 5C6CA 1V6MA 2AEZA 2DCTA 1N3QA 1WCDJ 4EWDA 1AL0G 1SLLA 4W65A 2WNUC 4QQ2A 3T2OA 5JZGA 1ZM1A 1WBFA 2WNVB 1W2AX 3HBZA 4FXKB 4QGNA 3NVCA 4AQ6A 1J1TA 4L11A 3HNYM 1BK0A 1OUXA 2DCYA 4BQ3A 3VBFC 1A8MA 2ZHLA 3LCPA 3MW2A 3VZNA 2XPJA 1ASJ1 4O9GA 1IQAA 1RVF2 5BNOC 2XWJB 2HEWF 2JWPA 2VCMA 4N8MA 2JDYA 5JIAA 1QU0A 2W91A 4LO8A 1SACA 1Q56A 2P6CA 2F4LA 2I45A 1RMU3 2BQPA 5B4NA 3VD7A 1O3TA 5L7OC 3VDBA 1AYM2 2YGMA 4NIDA 3ZFGA 4NIIA 1ULCA 4HKLA 4DY3A 5JLVA 1RC6A 3R4UA 2AH2A 2B5HA 5APAA 5T3NA 5JWPA 3FLPA 1POV0 3NKTA 4RS5C 4LKEA 1QOSA 3AMHA 1PNGA 3NAPB 5A32A 5KXBA 2OKXA 1J58A 1V70A 2RM23 3BPSA 2VZTA 2JECA 4FTSA 1W8WA 2W1QA 2WNVC 3I2FA 1MZFA 1DBNA 5EV7A 2PAKA 4XUOA 3UJQA 2BTVC 1FAYA 1SZBA 2A5ZA 2HWB1 3K3NA 3AFGA 3MICA 4QM9A 5EJ3A 1AL23 3VBRB 1BXHA 4BLIA 1T2XA 1CD3G 1LCLA 4M3CB 4YZ2A 2P4EA 1OQDA 3VV1A 5FTTC 4XFBA 2A6ZA 3NRUA 2VZSA 4N53B 1ZBA2 2BNMA 3JU9A 5T54A 3TN93 1HRI3 5FIXA 3VBSB 4R9CA 5T5PA 5J96B 2IFRA 5FYBA 5FZLA 4HMZA 4QX2A 4UFJA 1TNRA 4ZONA 4ONUA 2GC2A 3OUJA 3UJOA 4PHZA 4DNYA 4Y5TA 2NLRA 2EXHA 3L9JT 4S2GA 2K9ZA 1GNZA 1KFUL 2X09A 2IVJA 3USUA 2NMNA 2YDEA 4ES9A 1XRUA 1D2QA 2CHHA 4UBHA 3WDTA 4RHV1 1QKQA 4WVMA 5CZKA 5C7GA 3NAPC 4OHWA 2NN8A 3OF1A 4JC1A 1UU5A 3H7YA 4CP2A 1C28A 2GNMA 3N7JA 1YQ8A 3N9MA 3CJIB 1TMF3 2Q1FA 2CL2A 2WT1A 4I0WB 5IT6A 4RR3C 2D3PA 1ZNPA 3RQ0A 3FC0A 4DZGA 1GZ9A 1FI2A 1W2OA 4E27A 5A3MA 2ZGMA 1PZ8A 1I5PA 4OCTA 3LEMA 4AI3A 5IVEA 3D5OA 4RA0A 3PL0A 3T0DA 5FZCA 1V0AA 1F5FA 2EIDA 2XONA 4N53C 4AHYA 3LE0A 4SBVA 3O1RA 4CCEA 2HWF3 1RUH3 1SLBA 2BDRA 4ZKTB 2J1TA 2MEV2 2WO2A 3E97A 3V0BA 3OPWA 2X05A 3USSA 5CFCB 1HN1A 4R4ZA 3OPTA 4FPYA 3VKMA 5FQ0A 5FP7A 2FDIA 2D98A 2Q8OA 2H6CA 2J1SA 4ZXEA 3ZXGA 3ZSJA 2R061 1H6YA 1W8HA 2BOIA 1G8WA 1W6NB 1H8TB 4L2NA 4R9DA 3LDRA 4CDQB 3EYPA 4D6RA 4IE0A 4WBBA 1RXFA 5CFDB 5IUQA 2P34A 3DKWA 3CJIC 3O7OA 2TUNA 4QD2A 1QXPA 3RMYA 1RUD1 2ZX3A 4DINB 1S0CA 3BN6A 5FMDA 2Q30A 2BERA 1Y43B 1HQWA 4FP3A 4P9YA 1IKQA 1WA6X 2WYSA 3SH4A 4NN0A 1QEXA 5B2GB 4RSUA 2J1VA 2J1EA 1RUF1 5LBBA 5EHDA 2JDHA 3C7HA 2A73B 2JG9A 1I3HA 3C7EA 3T2PA 4CP9B 2B39A 4LUKA 1GOGA 3KT1A 5IK4A 4D3WA 4FPLA 1KQRA 4GXLA 2OZJA 5JZGB 2LM3A 4KBZA 1EAH2 2WFF1 2YU2A 3AXDA 3IM0A 3M2MA 1BEV2 5K4LA 3WT3A 3QACA 4COVA 1F31A 2LTNA 3AM2A 3WP5A 5IVCA 2P3KA 1OLQA 4CDQC 1M06G 1H8TC 1ASJ3 4EJRA 3ACGA 3R4SA 4XFAA 1CJPA 2YGLA 1W9SA 5CFDC 2A3WA 1LGCA 2Z5WA 3DN7A 5FLIA 4QX8A 2R16A 3IDEA 1S0GA 4LUMA 4X8PA 5I0DA 2EXJA 3ZSKA 2QQLA 2UYAA 4GWMA 1FPN2 4Y1YA 1UY4A 4G9SB 1F5JA 3BTAA 5L19A 4LK7A 4XFFA 5C71A 3WP3A 3B5LB 4HANA 1GBGA 3HNMA 2DCJA 2KD7A 1J84A 2Z42A 3FLRA 2Y34A 3C3VA 4PI2A 4XDPA 4MYEA 4D6SA 4ZZ5A 5DABA 1L7QA 3D8CA 2FDKA 2WO3A 3P3NA 3RGBA 1RVF1 1YFXA 2Q4SA 3IT8A 5GZEA 5I93A 3WW1A 1AJOA 2ZACA 5DAWA 5JZGC 2GH8A 3LA3A 1GSLA 4LTAA 4OI4A 3T4HB 3PU8A 4OZOA 4QX5A 5FZMA 3U4SA 2HWB3 1DF0A 3I2GA 3POWA 5A3WA 3WF2A 4XEZA 4NHLA 3RMXA 5FOJB 1K5MA 4S2FA 2VZVA 4CEYA 5ABJA 4P9XA 3MW3A 3IAQA 3OEAA 1W8TA 5FY1A 2HWC2 4MHRA 2VNRA 1HW5A 3GJBA 4I30A 1QOOA 3VUOA 3T2TA 3S57A 4LHSA 1KJRA 3I4IA 3ZKYA 5FY8A 5FUPA 4RYDA 4FCAA 3NO8A 5F3EA 2RS52 4Q1RA 3I3MA 5FYZA 5FJHA 3WDYA 3ZFGC 2VOVA 2XLFA 1O7FA 3CNAA 4W8JA 4PQ9A 3USUB 3AYAA 2R1BA 3P6BA 1NZCA 3KF3A 4Q4W2 4TTGA 2C0ZA 2O1QA 4N9HA 4X6QB 4DFSA 1BBT2 2EALA 1RIRA 4WVMB 4JKKA 4RHV3 1UZVA 4AI2A 2BGPA 1QQP2 2XVKA 2YYOA 4KI5M 2WFPA 4Q4Y3 3RVHA 1GNYA 1ZBA1 1Q8OA 2D5FA 3CU7A 4M4PA 1AX2A 1QGLA 2DCKA 1QNWA 5CB7A 1R091 2N7GA 3GALA 3NWKA 1OI6A 5K0UA 4CA9A 5A7NA 2C4XA 2QZ2A 5FPBA 3WQ1A 4Y1ZA 4E2QA 4MXWB 5CYYA 5L36A 4QAWA 2PHUA 3RZHA 4QHBA 5K8SA 3WP6A 4Q0SA 1RUJ2 5D1IA 2P5BA 4NOTA 3BGAA 1HQNA 2ET7A 2OUHA 3CQOA 5A1LA 4R4XA 1PVXA 4YNIA 1NCQB 3IIIA 3VDAA 5IWFA 3V0BB 3N4MA 1GLHA 2JDUA 5KXCA 4HSJA 3ZO0B 2RS33 4JTOA 5H9QA 1CZSA 4QXBA 2E26A 2VNOA 2ZKLA 4B1MA 5SV5A 3DXUA 2ZGTA 3WW4A 1NQJA 5FZ6A 2JE9A 2R063 4OHYA 3H1MA 4IV3A 3WW2A 5T5JA 1QJY1 3EMRA 5JR2A 2V5DA 4LBMA 3VBHB 4XTMA 1MS9A 4KU8A 1V6LA 3BODA 1RUD3 3D82A 1CIWA 2CDPA 4XDQA 4UWDA 2L9LA 2MEV1 1BK1A 1W8OA 4FFIA 5DAXA 5FYYA 2AC1A 4GB31 5FWJA 1STMA 3AP7A 3NMBA 5FR3A 1RUF3 1RUE2 2JG9B 2Z2SB 5KBFA 3K4ZA 2NZ9A 5EIYB 1NYWA 1CWPA 2FCVA 2VVDA 1PGSA 3H3UA 1YJLA 3H9AA 4Y3OA 2CSGA 3KGZA 3WZ1A 2YZ4A 4B29A 1H0BA 1NOVA 4YPJA 2B9UA 2P6HA 4Q8LA 3AKQA 1SDWA 3FFQA 2HBUA 3H8UA 1U5YA 5TSWA 4CDXA 1QJZA 1YCIA 3ALQA 3UYJA 2XVGA 4OHVA 1ZRCA 4Z82A 3PJYA 1AYN2 3RI9A 3I2JA 4META 4INDA 3UK9A 1YXWA 1ENSA 1CZVA 1FOD2 2D3RA 2WSVA 4P02B 3GBGA 1GP5A 2JIJA 1C8M3 5FWEA 4QHZA 1JYWA 1GANA 1QMJA 1JN2P 3SISA 1UOFA 3PUSA 1KEXA 1YFYA 3PVOA 4KBBA 2VBDA 4OULA 1OSGA 1TNFA 5LBFA 1VMFA 1PO21 3EXUA 4GD4A 1CGPA 1OMIA 3VZJA 4QM8A 1EAH1 1XBFA 2QQUA 4XBQA 3TEXA 5LRRA 2YBKA 4LHKA 4C0BA 5BV6A 1A78A 2PHRA 3ILFA 3M1HA
chains in the Genus database with same CATH topology
1PVC1 1RVF3 2W0XA 2XJVA 5J7MA 3RDIA 1O3QA 1DGLA 1VBB2 5I0UA 1YRZA 5DXDA 4K1YA 1GR3A 1K5MB 5A33A 1AYM3 3I54A 3ZYRA 4CEYB 2WS92 5GZCA 2FMDA 3U10A 3A0NA 3NV3A 4Q1PA 5DUUA 2X5IA 4HVOA 4YW2A 1V6JA 2R042 2BVBA 1CX4A 4YW3A 4JVAA 4N43A 2AENA 5BNPA 1WCKA 4LNVA 4OVEA 2PHWA 2IXCA 2C5DA 3VHOA 2DCZA 4AW7A 3OGJA 2BGCA 4QXKA 1ZBA3 5CG9A 1WUVA 3ZFFA 1ND3B 3B00A 3AZVA 3T1MA 4D69A 5K0UB 3C2UA 3H3ZA 3KB5A 2ARBA 2RS51 1O4YA 4YW1A 1K5MC 1YO8A 4CEYC 5ABJC 1VBC2 4FQ4A 5BYNA 4IV1A 4Y1VA 1WBLA 1PK6A 1YFWA 2YUEA 4XJ9A 4LULA 1PO12 3UKTA 1S0BA 2AZ5A 2MNGA 4WVZA 4ZU7A 1H30A 1HDKA 2XJPA 1KS4A 3HN1A 2BPA2 1QH6A 3W9AA 2ZCWA 1VR3A 1VRH2 2ARXA 4IV3B 1VBA1 1X8MA 4Z2WA 3GYDA 1QJY3 2OPKA 3POYA 3PVEA 2NQYA 3S7IA 2F4PA 4HPKB 3CO2A 5K0UC 1V9U2 2MEV3 3MEPA 1ULEA 5BNNA 1AR72 4GMP3 1DGRN 3WQ0A 3RPQA 4RGGA 3ZFEA 4Q0VA 3W59A 4F83A 1CAXA 1U5IA 4PF5A 5C9AA 3N4MA 2XLAA 4QQOA 4YSFA 3URFA 2A3XA 5I91A 4DQAA 4I01A 4K40A 1V00A 1WCSA 1V6OA 4DS0A 5AVAA 2BFUL 4MXVA 4AHWA 1MS8A 3AMMA 1S0DA 4CDXB 4XF9A 5FFOC 3TRSB 1MS3A 4JGZA 4IV3C 1HIXA 4TWTA 1MZEA 1KRIA 1I9RA 3TOJA 5C4WA 1OKQA 1LOGA 1APNA 1QJU1 2ZGUA 2Y26A 3KCYA 1MVQA 1ZBE2 2HWD1 5L7OA 5JPNB 1PO23 1R082 1UIKA 3V56A 3JQWA 1EAH3 4BA6A 1BEV3 1IOAA 4H7MA 2VOWA 1RGSA 1RITA 2SLIA 1AYN1 4PLOA 4L99A 4R52A 4BIFA 5J3UA 5BY5A 2NMOA 2CWSA 1VIWB 2GALA 3WG2A 1UPSA 4O9EA 4CDXC 2DWRA 1GFF2 1AZDA 2D5HA 1MS5A 3S7EA 2YROA 2UURA 5A33B 1FPN3 3E5UA 1AXYA 1NLRA 4RQPA 4ZU4A 2UWCA 3ATGA 4K20A 1RMU1 4L8QA 2X5IB 1YYNA 2UYBA 4YARA 3ZXJA 2C1FA 1TME1 4GKYA 1VBB1 3AMNA 4N43B 4YRDA 4KU7A 3AYCA 5BNPB 1LGNA 5IK8A 1N1TA 3TNQA 5FAXA 2WS91 2RM21 5C33A 1SLTA 1EP0A 3ZFFB 2UU8A 3CL1A 2EF6A 3RJ2X 1VP6A 1EV11 2VMHA 2FHRA 2RS53 4FOQA 4XFHA 1FX5A 5E8AA 3SXWA 3VZLA 1DGWA 1JUHA 1ZRDA 1RINA 5LK5A 4PJYA 1PK6B 2AR6A 3TN91 4L9BA 1Y9QA 4BWOA 1S1AA 5H9RA 2DUQA 4OFGA 4Z92B 3M3QA 2CY6A 2BYVE 3ECQA 3M3IA 2X5IC 4PLNA 4JGYB 4EV0A 3APBA 4N43C 2DUOA 3LWCA 5BNPC 1FXZA 1VBA3 1DGRA 5J48A 1DFQA 1DQ4A 4RGAA 1VBC1 5JI9A 2A75A 4XIKA 1MEC1 1IPJA 4MGIE 1BMV2 2XB6C 1R1ZA 3O0VA 4LR4A 4FAHA 1PO11 3AKRA 4NWWA 4MUVA 3AZZA 3ZIXA 3CJXA 1U0AA 2VU9A 1WGPA 2XUMA 3I59A 4AQTA 4X8NA 4IV1C 5BXXA 1ZZBA 4JRAA 1TEIA 3FBMA 1CAXB 5FREA 1PK6C 5JAXA 1SBEA 1YIPA 1VRH1 5JSRA 1RJ7A 4BQ1A 4OZXA 1FT9A 5CADA 3J4UH 4GULA 3V64A 2ZMNA 4DRRA 1S0FA 2D93A 1IS4A 5T52A 2HEYF 4JTNA 5AC92 2Q5TA 2LALA 4MX3A 3UV9A 3P3PA 3B9CA 4JGZB 2XGXA 5BNOB 5FLHA 3KGLA 1OQEA 4U2AA 1RUE3 2YMZA 3GBFA 5C4WB 2VXRA 2A70A 1DQ0A 4XF3A 1H2KA 4A2UA 1H1IA 2QDNA 1R1A1 2JG8A 5L7OB 3LOIA 2RMU2 3SCFA 2PELA 5BNNC 1A8DA 1G6NA 2XJRA 1FNYA 1RB8G 1QHDA 2O0OA 4ATEA 5GZDA 4YFWA 4XF0A 5T5OA 3ZFEC 1F9KA 4QPIA 5C9AC 1RUI2 3ELNA 3IPVA 1S0EA 1H1AA 1UMZA 1AYN3 5I8YA 3IDCB 3AJZA 1D4M2 4IETA 2E63A 1XE8A 4OHZA 2VW1A 1ZZCA 1LOEA 3MZHA 1DG6A 4JGZC 2FZ2A 3OD4A 4NO4A 1R081 1TE1B 5DG2A 3ZXLA 4J6GA 4XMAA 3B01A 1RUC2 4WZCA 5C4WC 3B69A 2A7AA 5FDBA 1WLTA 1AR61 4HLTA 3BOWA 3QCWA 1TME3 1VBB3 5HBAA 2TNFA 4CDUA 4YGBA 2WLQA 1WMEA 4KL1A 1ZREA 2XJQA 3MLJA 1CONA 2YPJA 4YFZA 4KNCA 2WS93 1POV1 4QQPA 4JDOA 4RR3B 1D4VB 2JKBA 3MFAA 3RYRA 5DUVA 1H4HA 4H3WA 1CAVA 1EV13 1JTZX 2NYYA 1LOBA 1IS5A 3KQRA 4PBOA 2R043 3FZ3A 1NXD1 2XKOA 4RQPC 3ILRA 2Q1MA 1NQDA 3WDVA 3ES4A 4Q29A 3J26N 4K7JA 1Y3TA 2PHXA 2D6LX 3ETQA 4PDWA 4BPZA 4COZA 4E4ZA 1LHNA 2HKXA 2WLPA 3S6PA 3WHUA 3MFCA 1DZRA 2UWAA 4A3XA 5EYXA 1QWRA 4MGZE 4YM1A 4LT5A 5FLJA 3ZXFA 4Q0QA 1VBC3 4Q4Y1 2WZPP 2GAUA 1MEC3 2QCSB 1N1VA 1EPWA 1PIV1 4Q2FA 3PMSA 4AFBA 2VMGA 1NA1A 1JYIA 1UPIA 1PO13 4AFDA 4Z1VA 1DQ5A 1DZTA 2YY1A 2XHKA 5D8AA 1CAUA 2P37A 3I59B 1JBCA 4CEWA 3N7MA 4XFCA 3HR9A 2VNGA 4CDWA 2E9QA 3ASIA 5EXOA 2RHPA 3N7LA 1DQ1A 3ZYPA 5LEKA 3AMPA 3ME2A 1VRH3 1WMFA 1OA3A 2TBVA 3WUDA 4AEKA 2RS31 1Z0HA 4Q4V2 2CGNA 5DDJ2 4NVPA 2PHDA 4HSLA 2QDRA 3WV6A 2AYHA 2VUAA 2R0HA 2VW0A 1V9U3 1J3PA 2UY8A 1MS1A 1AR73 1EY2A 1PZ9A 1XE7A 5EYYA 1R1A3 2ZX2A 1SCRA 1UAIA 2P17A 3AKTA 3AP4A 2E51A 4AG4A 4ASLA 3SLIA 3MIGA 3SITA 3VBOA 2LUWA 5KHJA 1ZYBA 2X29A 5FMOS 3E5XA 4S2DA 2GSYA 2HEVF 2GU9A 2ILMA 3J8F2 2Q1ZB 2RR12 1SQ4A 3A4UA 2SBAA 2PLV2 1HRV1 2MPFA 2GH2A 4RD7A 3ZVXA 4GWNA 4AVVA 1JOJA 1ZBE3 3K51A 4YW5A 2RMU1 4EN9B 1R083 3GHNA 5FPXA 4CEWC 4XJZA 1VALA 3NL1A 1C8M1 2DV9A 5J09A 4HN0A 1RUI1 5DG1A 1FATA 2DU0A 2VOKA 1CAWA 2JG8C 3M7AA 5L73A 3DF0A 1S0JA 3ZFGB 5JCTA 1REEA 1AR63 1F2NA 4ISQA 4K8FA 2PYTA 2PHFA 3U11A 3QD6A 1LGBA 4XE9A 1KFXL 4QPIC 4UW4A 3UKVA 2MHFA 1I5ZA 5A32B 3ZXKA 5GZGA 4UXAA 3IKWA 1LEMA 4W6XA 2ZHNA 3AB0A 4AK3A 1C3HA 1GICA 2WZR2 1POV3 2WT2A 4C1WA 1O4TA 2WJSA 1HX6A 1RUC1 2ZMKA 4YYOA 4XMIA 1CAVB 5LK7B 4MZUA 2ZMLA 3X29B 4R8HA 1AYM1 1CN1A 1YNAA 4Y24A 3UL2A 4OLLA 4AGVA 1Z7S2 1RHI2 1YHFA 3B7MA 2XJSA 4BIOA 1BVVA 4LBNA 1PZ7A 4R9BA 2ZGNA 3VL8A 3M3EA 3VKLA 1LOCA 3DGTA 2ZGSA 4ZU5A 5LEJA 4FPGA 4B8EA 1U5ZA 1S2KA 4LLFA 1RUG2 2G4IA 4I3PA 4CDUC 1HXS2 3DV8A 2VQAA 1N1YA 4FSJA 4IEYA 4JV4A 2YV8A 2QFEA 1XYOA 1UD1A 1NA1B 1PIV3 2P3IA 1HV0A 1L3JA 1H9WA 1X50A 2ZABA 3ZX7A 4YW4A 3I7DA 1NY72 2EXIA 4OHXA 5D8AB 2AGSA 4CEWB 1D0GA 1UX6A 4CDWB 2DVFA 3A0KA 4AGRA 1UZYA 4XFIA 4D7SA 2YC0A 4EN6B 1OFSA 2YXSA 4WM7A 5FO7B 1LENA 1G9BA 4KWLA 2XLGA 4OUMA 4DMIA 1X82A 1LJ7A 1VAVA 4PDWC 4COWA 4WM8A 1H8VA 3VHNA 1AR82 1W6QA 5FQ0B 3WOGA 3AP9A 1I6XA 2VG9A 3JD72 3JCIA 2CAVA 2RS12 1XQNA 3FJSA 1DYKA 3VDDA 2R0FA 3N36A 2ENRA 1KXGA 3DL3A 3MI8A 2EAKA 5CBLA 2GDFA 1NA1C 1ZZ7A 3AK0A 4WZFA 1PGW2 3U0ZA 2TEPA 4QT6A 2XBO2 1VB4A 5D8AC 1Q8VA 4IEXA 3LZZA 4Q4V1 1QF3A 4GMP1 5F5QA 3RG0A 1ND2A 2XG3A 4AI8A 2PQQA 3ES1A 4CDWC 2Z69A 3VBOB 1NLSA 3R05A 5J36A 5AC93 3PNAA 3AMQA 2BWCA 4S2HA 1RUOA 3THPA 3MIFA 4M01A 4EN0A 1G9DA 3WCRA 1S55A 1TQ5A 1WLDA 3ACLA 3DPRA 4HN1A 1PGL2 1HRV3 1Q8PA 2ZHMA 1N3OA 2ET1A 2B45X 2W68A 4XBLA 1H2LA 1XNCA 4YVSA 1QOTA 1DLLA 1NXMA 2VOXA 2RMU3 3K48A 1CESA 4LBQD 2G9FA 4HT1T 4IL7A 1RUI3 5GALA 1CAWB 4Y26A 5F6KA 3GZUC 2WSUA 2PLV1 4LE4A 1D4M3 2OW4A 1YLLA 3O12A 3ZYGA 4Q4X2 1BEV1 3VBOC 4FOYA 3WW3A 5DZEA 3WP4A 1A6CA 3WG1A 4DB5A 5E1RA 5GLWA 4QQHA 2ZZJA 4CYDA 3QH6A 4DOUA 2CNAA 4LHNA 1RUC3 2B42B 1HLCA 2XJUA 4XXAA 4ITCA 3SH5A 3AJYA 3ZSMA 1FPN1 5ABJB 3EQEA 3HWJA 2CV6A 4A7ZA 1C57A 4AEDA 2K2SA 4AYUA 2JX9A 3QBQA 4B4RA 2FQPA 1OQ1A 5J37A 3EHKA 2VVEA 4LHLA 2WZR1 1FMD2 5C8CA 1UCXA 3ZSLA 4Y1XA 2VVFA 2KA3A 3VKNA 1REDA 1YI9A 4LBQA 3TAYA 2HWE2 4I09A 5BUVA 3MPPG 2CGPA 2HWC1 1Z7S1 2OYZA 5LRSA 2JE7A 3QOPA 2QJVA 1NCRA 1CQ9A 3KCXA 1S2BA 3M3OA 4M3CF 4M00A 3AKSA 4Q4W1 1QXRA 3ZMNA 1RUG1 4LO6B 4WM7B 1BBT1 3RNSA 1ENXA 3PVNA 1FNZA 3VZMA 3ILNA 2IZWA 1QQP1 4Y20A 2Z79A 4GALA 1W6QB 2RJLA 2KXLA 2WA4A 4HKOA 1C4RA 1LEDA 1NY71 1QNYA 3VN4A 2QVSB 4J1XA 1RUJ1 3N3HA 4LBOA 2WT0A 5EWSA 1AR92 2F6BA 4QMAA 5C8WA 4B7KA 1ND2B 4Q4V3 4Q27A 4AFAA 3POSA 2GMEA 5DDJ3 2R49A 2ZAHA 1X36A 1OLRA 2VPVA 4HKWA 2CTVA 2NM1A 4BOWA 4WM7C 2CGOA 3WXPA 4CRQA 4YM3A 1DGWX 4FPJA 4P9LA 3BIWE 2ZGQA 1W6OA 4WM8C 3D0JA 4C90A 3GNEA 1BVP1 1MZ5A 1GQHA 2QQPA 4IEZA 4AEJA 2XBO1 4YVSB 4XJ8A 3OPZA 2O8OA 4I02A 1UKGA 3L2HA 2VGDA 4YG0A 4AWDA 3VDDC 1UW8A 1LB2A 2WL1A 3T1LA 4JDMA 1RUE1 3ZIWA 5KC6A 3RYKA 4QGMA 5KHGA 2EAAA 4NPRA 4KG8A 4A7KA 2RR13 4YZ1A 4P5HA 2WQZC 3M4FA 1VBE2 2PLV3 2X53S 1UF2C 1NG0A 4GH4A 1J3RA 1ND2C 1PGL1 2IXJA 3NKGA 3G6JB 3R6SA 1LU2A 1O91A 4WV8A 2VY0A 3AZXA 4FTBA 1BCXA 4YG3A 4OI1A 2VQ0A 3WQ7A 1FOD1 1JHNA 2AREA 2UWBA 3KCCA 3VKFC 3DPRC 1LULA 1BJQA 2B8MA 2PHLA 1X7NA 5CIRA 2EIGA 3AXEA 4IQPA 3TYJA 5EZWA 4YVSC 1AXKA 4GKXA 4QGLA 4AEDB 2H0VA 2R32A 3NV4A 2E53A 4Z07A 1UZZA 3IN9A 4YG6A 3WDXA 1V6IA 2WZR3 4NHMA 5C8CB 1HQLA 1KITA 2K0GA 4AI1A 2OVUA 5JOYA 1O5LA 1CJDA 3VHRA 2DF7A 4TZDA 4LBQB 5HI0A 2GMPA 3O5SA 3WLUA 3WD5A 1VLNA 2HWC3 1FV3A 1Z7S3 3MIBA 5JSOA 1YFUA 1V6KA 1OPMA 3IDBB 1LKNA 3FE5A 1ZA4A 2I74A 3MIDA 4E4DX 1DQ6A 2R041 4IV1B 4AEDC 3O0WA 4P9GA 4Q4W3 5E16A 1N3PA 4XJWA 1C5IA 1CPNA 1RUG3 3L2YA 1BBT3 3I2DA 4M0NA 4QQLA 4JCKA 4PIXA 2HWE1 4Y20B 2XH6A 1QQP3 4Y5Z0 1LOAA 3AP6A 4DXZA 4ZXKA 2EA7A 5C8CC 3LA7A 3SNMA 2X8KA 2XL7A 3VBUA 3AX4A 1QDCA 2GC3A 2GNDA 4MGKE 4RHV2 3VBRA 2DVAA 4M3CA 4F8AA 5F6LB 3AYEA 1RUJ3 2ZBJA 1OFNA 2Q0AA 1WMDA 3B3QE 3VBSA 1ULDA 1VB2A 1NCRC 4OI0A 4C0HA 4D7YA 5BNNB 4ES8A 1AR83 3M70A 2RS13 3ZFEB 5C9AB 1AX0A 1JUIA 3GZAA 4PLMA 3JB4C 3LAGA 2CAUA 1W6OB 2D6NA 4HFSA 1RJ8A 2VUJA 1WW5A 5FMOL 3WDWA 4L97A 1FV2A 4A7YA 5JIUA 1UL9A 5H9PA 3IMNA 3NW4A 2JEMA 2D3SA 2XBO3 2PN5A 2WWSA 1V9U1 2FZ1A 2PHTA 3HD8B 3MF6A 4XQWA 2EVXA 3OTFA 3TBDA 1AR71 4WVWA 4Q0UA 4KWJA 3ST7A 4AHZA 4PIYA 4LEJA 5ACA2 4YGDA 2UY9A 1VAKA 3FX3A 4FOVA 4GH4B 3AKPA 1RUF2 5CFCA 3D4KA 3RJRA 2BUKA 3OYWA 4DPNA 3ZYIB 2ERFA 2Y0IA 4LA3A 2XWBB 2A6VA 1DQ2A 5KXDA 5GJ6A 1FOD3 4HK8A 1V6NA 2DUPA 1VAMA 2WFF2 2YHJA 4FO9A 4ISRA 2ZGPA 4HL0A 4B3NA 1ZBE1 3JUUA 5GLTA 4LO7A 4XF1A 3JBG2 3MW4A 2XKPA 1VBE1 4XHBA 2BWAA 5T55A 5JDBA 4FTEA 4HVQA 2JENA 5AFBA 4RL7A 1LODA 2IFWA 4RQPB 3KZ4C 2DFCA 1W6MA 4G4FA 4GA9A 1C5HA 2OUJA 1O3SA 1KS5A 3NV1A 4XFGA 3WDUA 3O0XA 4GH4C 3ZPYA 2D6PA 4KH9A 5AVPA 3N35A 3OY8A 4COUA 5KHKA 1N47A 1G7YA 4AFMA 2ATFA 4RFT0 2W08A 4LO4B 5CG8A 4H7LA 4XPVA 1O5UA 3CLPA 5I8SA 3JZVA 3EO6A 1DHKB 2ZGRA 2GZWA 3N7KA 5KHHA 4Y4YA 1FMD3 5JSPA 5I8TA 3H50A 2ZKNA 4XZPA 1BYHA 3WINE 2O8QA 4MV2A 1WLWA 2IC1A 3LSDA 2ZGKA 1H2NA 2HWE3 1ZZ9A 2IXKA 2IXIA 5GLZA 2JJ6A 5K7PA 1SCSA 1WLCA 2B7YA 4PBPA 2DYCA 1JW6A 3VBUB 1YWKA 5FPZA 4I3GA 3AP5A 2IXHA 1GV9A 2H0BA 4FPCA 4FPKA 1W39A 1OPOA 5JVVA 4IEQA 3KD4A 4N7IA 4FT8A 4L92A 4COYA 2PAEA 1R092 1AJKA 1COV2 1MVEA 4P14A 1DU3D 3H7JA 1JYCA 5HCAA 4X6RB 1WD4A 1NE6A 3ZXEA 4YZ3A 4E4SA 4HZFA 2A6XA 2I07B 2VULA 5GZFA 3EBRA 4OUSA 1MQTA 2GC1A 1ZZ6A 2VMIA 1J3QA 1BMV1 3MGUA 3VBUC 4XW3A 3RYPA 1AR93 2BW8A 1IS6A 4BE3A 1UN1A 3KT4A 3VBRC 4IEPA 3DUIA 1XYPA 4FPHA 2ZS6B 1U12A 4F7ZA 3B9IA 1GZWA 1QJY2 1DIWA 2DTYA 4MXWA 2BBVA 1C1LA 4XF4A 1VJ2A 2VECA 4DRVA 1Q3EA 2GC0A 3OBRA 3VBSC 4R9AA 2ZJCA 2JG8B 3WHTA 1AXZA 4UW3A 1E57A 1NCQA 1SBFA 4GB32 2D40A 3MLLA 1XNKA 3BCWA 3INAA 1X33A 5AC91 3OYWB 4QPIB 1ENRA 4PIZA 1PHMA 3IPVB 5DUWA 3SMHA 2D6KA 2GNTA 4UW6A 4AI0A 1XU2A 4B7EA 1Z78A 4LE3A 3VBHA 4LA2A 2R1DA 5ACA1 2QNKA 4GQ7A 4H14A 3HQXA 3TB0A 1KJLA 5HCFA 2JD4A 4ORFA 1VBE3 2GNBA 3HAGA 1IPKA 3I8TA 3H0OA 3QLQA 1DYPA 1Q5OA 4HBNA 2V5YA 1W6MB 3E6CC 5JI7A 2R072 3SHRA 1G86A 2VW2A 1D4M1 1PO22 1SLIA 3WG3A 4AVSA 4EROA 4XBNA 5CFCC 3OY8B 3PMEA 1HKDA 4CDUB 1KDMA 3JBG1 3THTA 4AQSA 1PVC2 2PA7A 3WUCA 3CEWA 2RE9A 2ZOEB 3Q9OA 5FBZA 3VL9A 3ZDSA 4KGQA 2RJKA 2ZPXA 1D2SA 4W6YA 4EN7B 3IIAA 4FOWA 3ZN5A 1PM7A 2KM2A 4CTEA 2HJIA 1VBD2 4AGGA 4F3JA 2W39A 5BPXA 3FWEA 4YVWA 4PDWB 3ROUA 4P9WA 3AYDA 2FMYA 1OA4A 2D7FA 5F1RA 1EPZA 4YM0A 3HIFA 3VZKA 2QKDA 1UU4A 3JQXA 4I0BA 4Q26A 2DFBA 3AFKA 3H1YA 3FMGA 3MLKA 5HCBA 5I0TA 3LOBA 4BM8A 1ALYA 3U4XA 2BNNA 4FAGA 1W6PA 4EWAA 1QY4A 2WA3A 5K9YA 1CAUB 4YZ4A 5KHIA 2D44A 1OA2A 3RS6A 1N1SA 4BHPA 3GBWA 3UKNA 1LHOA 5JOZA 4C91A 3WNXA 4BYYA 3PTYA 1BZWA 1MQTB 1G9CA 4Y1UA 1C1FA 2OZ6A 1H4GA 1ND3A 3E6DA 4J1WA 1SLCA 1COV1 1WW6A 1RL3A 1MACA 1VBA2 2BEOA 5F9TA 5GLUA 4BMEA 1GZWB 2WQ4A 4D94A 2Y0OA 4Q8KA 1LESA 4AE2A 4TLFA 5A3LA 1H1MA 2E7QA 1LOFA 4YGEA 3HT1A 3ZXAC 5FOBB 5T50A 1LHVA 1QJX2 3M3CA 3V0AA 1LTEA 1QH7A 1W0PA 5DDJ1 1PMIA 4XHXA 1DDLA 1GNHA 4JRLA 4K6BA 1W2UA 1J59A 3OCPA 5KC5A 5KWRA 1MQTC 4NWVA 4U36A 3S0MA 3RRDA 4YM2A 2IXLA 3M8LA 2ES3A 5FO8B 4GMP0 3OBTA 5ACA3 2ZTNA 4SLIA 5JPMB 4HPKA 1UU6A 4WVVA 1UKRA 4LO5B 1LU1A 1LRHA 3OGGA 1WW7A 1IKPA 4YGCA 4ASMB 1LECA 1A3KA 3E6BA 1M4WA 1G9AA 3FBYA 3MDPA 4Y22A 1ULFA 3ZN6A 1QJU2 3MIHA 4LBJA 2V73A 3J8F1 3R4DB 3MPBA 2RR11 4IEUA 2HWD2 1U5XA 1NCQC 3PJQA 4KGGA 1XU1A 4GIQA 4CP1A 3D6EA 1XNDA 2WFF3 3FUQA 4E2GA 3HMYA 1GZCA 4AEMA 2ZGLA 4QPYA 1ENQA 3JBG3 4W6WA 5E89A 1YUDA 3BALA 4M3CE 1AX1A 1OD5A 1YI7A 4N90A 4JQRA 1Q8SA 3VBHC 4EWEA 1F8VA 2DURA 2ZX0A 4PCRA 1RTVA 3BB6A 2R071 5GLVA 2ZX1A 2ZX4A 3PLQA 5H9SA 4FPOB 4BZ4A 2JG9C 3VKOA 3CF6E 3IWZA 4XJUA 3WCSA 1UIJA 2GMMA 2ZA9A 4BCUA 1RMU2 3ZYJB 1ZZ8A 4IESA 4YVWB 2R30A 1CVNA 1B35A 2W52A 3JB8A 1TME2 1GKBA 1H2MA 4BH9A 1OOPA 5CVRA 2R6QA 4QPGA 1SFNA 3J9SA 1AF9A 3BPZA 1JH5A 2NPIA 2QE3A 5AFEA 4FPEA 3VLBB 2RM22 3S30A 4FP2A 5JOWA 5SV8A 1RHI1 2CWMA 1IS3A 1VBD1 4XTPA 1W6PB 1EV12 1AL22 1O4ZA 2VH9A 4HETA 4CZSA 3TN92 1HRI2 4ATFA 3PHMA 2D6MA 4HK9A 1HXS1 2NP0A 1WA4A 5DZFA 3WX5A 3NV2A 4YVWC 4WM8B 1NE4A 4D7TA 3LSEA 1R093 2QZ3A 3NJZA 3KMHA 2ZGOA 1COV3 2HYKA 1BKZA 4M0HA 3VDDB 5E88A 4XQDA 2D43A 4K21A 1TMF2 1MEC2 1J1LA 1ULGA 4P9IA 4YZ5A 3GZTB 4AVTA 4FBFA 4MLOA 2JXAA 2ZHKA 3B93A 3ZN4A 4AVAA 3FHIB 4LBKA 1YJKA 3V0AB 4K3UA 1LHUA 4IEWA 3WG4A 1AR81 4IXLA 3JD71 2RS11 3MF9A 3E5QA 4JGYA 5FCCA 4AQ2A 5CA6A 4K1ZA 4HVRA 2HWF2 1RUH2 2PAMA 2DVGA 3DPRB 4B4PA 1ONAA 3WVJA 1PGW1 1ND3C 2DVBA 2PFWA 2JDZA 4EN8B 1I1EA 1QJX1 2DVDA 1RUNA 1AHSA 4GB33 1B09A 5I0RA 1XYNA 3SCHA 4Y22B 1PNFA 4MGYE 1YIFA 3ZN6B 4AVBA 1LOFC 1ZX5A 1XNBA 2E7TA 1R1A2 1LR5A 1URXA 4MH0E 4C1XA 3J8F3 3B02A 2WNUA 2DU1A 2XL9A 4H55A 2OIIA 3WY6A 1SEFA 3VZOA 3VBFA 5IK7A 2GN7A 1IZ3A 1WW4A 1IGOA 4XILA 3D0SA 5BNOA 1O3RA 5FO9B 1JXNA 3RWNA 4BLJA 3SCGA 2ZAAA 2AUYA 4UBGA 4MVTA 4XOGA 2CYFA 1KD7A 4KG0A 1MZ6A 2R073 2XVLA 3FLTA 3R0RA 1ASJ2 4MSVA 4YLZA 1ZRRA 4NR1A 4Q4X1 5GKAC 4FQZA 1AVBA 1MS0A 2WINB 3ZXDA 4RS5A 1ZRFA 2E7AA 3U07A 3LGRA 3LB9A 3OJBA 2GN3A 3GHMA 2BNOA 1PVC3 1GQGA 1B35B 4OI2A 1SFYA 3B94A 2JICA 1AR62 2OA2A 2WNVA 5T5LA 3ZMOA 4DY5A 1AUYA 4XQ4A 1OOPB 4QPGB 4FPFA 4LBLA 3KM5A 2EXKA 3G7DA 3H1WA 2A3YA 3SH3A 3BU7A 2A71A 1RHI3 1WD3A 1LHWA 5DUXA 1VBD3 1KDKA 1MR5A 3O14A 4P9JA 2HWB2 1NCRB 1W0OA 1SMVA 3FFZA 3LKJA 5KXEA 3LA2A 1FMD1 3EJKA 1CR7A 1G9FA 1S0IA 3TWIA 1EYBA 3ENRA 1QDOA 3BOPA 2XJTA 4K9SA 5DZGA 1HXS3 3NSTA 2DTWA 1GYKA 3NAPA 3PVBB 1B35C 2V09A 2B46X 5FRAA 4AHXA 2D97A 4RR3A 3RZZA 3AZYA 2FBEA 1AL21 1OOPC 4QPGC 1XXNA 4NHKA 3VGIA 3ZSEA 1CPMA 4E9KA 4IERA 4Q4Y2 3AZWA 3IBMA 3FUOA 2P2KA 1PIV2 1D0HA 1HRI1 2IWGB 2WNEA 3MIEA 4JDNA 4N53A 2E6VA 1H9PA 2PTMA 5EFUA 3QH7A 4AVCA 2D6OX 3KT7A 5CNAA 1SLAA 3JD73 3W58A 1BQPA 3V65A 1C8NA 2WC2A 5CAZA