5SWSA

Crystal structure of np2-b17 tcr-h2db-np complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
277
structure length
273
Chain Sequence
b'GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGELTQDMELVETRPAGDGTFQKWASVVVPLQNYTCRVYHEGLPEPLTLRWEPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Reversed T Cell Receptor Docking on a Major Histocompatibility Class I Complex Limits Involvement in the Immune Response.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 55
structure length 273
sequence length 277
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swsA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5swsA01
4QRPA 2E7LC 5TE7L 1S3KL 1MIMH 4OLUL 1EHXA 3BQUA 1DVFD 1MFAH 4LBEB 3M1BB 3W2DH 4R4ND 4CW1B 5E2WH 2VXUL 3W9EB 2H2SC 4HS8H 5E8EA 3SEPA 1WC7A 2IQ9H 4QRPB 4R90H 4KZEH 1NGZA 4LIQH 5CKAA 3LH2L 3QFJE 5FA3A 4EIGB 3BQUB 1KACB 1FAIL 2M1KA 4PP1C 1OPGL 3LEVL 2IFGA 3OB0K 1NJ9A 2XICA 2AJYL 4DKFH 3IXAA 5E8EB 2DI9A 3QDHA 1WC7B 1NGZB 4M1CD 3RPIA 3EBAA 5FA3B 1B6DA 4JDZA 4MAUH 5I9QB 1ODAA 1C5BH 2MKWA 1NJ9B 2OP4H 3IAQA 3BE1H 5INCA 1FVDA 5CD5C 3DMMD 3ZYZA 3IXAB 4ZS6D 2ZUQB 2PR4L 4XP4L 3RPIB 4WI9A 5GRXG 4K07A 5EA0L 1KXVC 1KBGL 1UENA 4JDZB 2R0WH 5E4IA 3VWJC 3N06B 4I5BA 4RAHA 4KPHH 1FVDB 5INCB 5CGTA 1XGRA 4LEXL 1FLRL 4JG1H 4L4TB 2EH8H 3SE4A 3O2DL 4I18C 2AS5M 1IKFL 1FNGA 3O6LL 3GIZL 1FIEA 2IAMC 5AAMA 4PREA 4I5BB 3LEYH 4V1DA 35C8L 3LRGA 3HG1D 4IBLT 4S10A 1DQQA 1XGRB 5KW9L 1J1XL 2FGWH 5ADOH 1Y6NR 3C08L 1FNGB 3SCMD 3A6BH 4LAJH 4CVXA 4Z7VE 4NZRL 1PD6A 4J3XA 4TSAH 4PREB 1RJYA 2A77H 5D6CA 3OBAA 4GOSA 5E9DD 4V1DB 1DQQB 5C2UB 5JNYA 5C07A 1EPFA 1BPVA 3VFMA 3PQYE 5FYLE 4PYHA 1NPUA 1LEGA 5C0AA 4R2GC 4AMKL 4CVXB 1KJ2H 4U1MA 5C2BL 1RJYB 5D6CB 1ZGLM 2HFTA 5DK0A 3UYRL 3V7AG 1ZA6A 1GHFH 5JNYB 5C07B 4ZAKD 3VFMB 1U2HA 2UWEA 3MODH 1Z9LA 4OCWH 5DVKA 1JJUA 1LEGB 1OGAA 2ED8A 3RVUC 2DYPD 4BKLB 2VH5H 4C4KT 5C0AB 1T2JA 4YXHH 1JI2A 4DVRH 4U1MB 2AW2A 1BX2A 5DK0B 5HHVL 4V2CB 2MQ0A 1ZA6B 3SDXE 1WAAF 4PJ5A 1UA6H 1RZKC 4KRPB 2UWEB 4U1HA 1E28A 1OGAB 4NYLA 4LKCA 1UCTA 2IG2L 5D1ZD 4XP1H 4JFDE 4M61A 3LZFL 1BX2B 4PJ5B 2V5SA 1LO2H 1CDYA 5EO9B 4LVNB 4FFYL 4U1HB 1E4KA 1E28B 4KJQD 4NYLB 4XWOD 4LKCB 5LG1A 5IBTH 3TIEA 4M61B 1MIEH 2D7PA 2APVA 4C56D 1ORSA 2EXYD 1PKOA 2R8SL 5IJVA 2J8UF 5E99L 5GS3A 4RMUA 2VLJD 3H42H 4I77H 1NMAL 2WM0A 3TIEB 4JRYA 5LVEA 1FZKB 1ORSB 3RIAF 2C1OA 5IJVB 4MHHI 1CLCA 2VN4A 3GFUA 4I3SH 4C83A 2VAAA 2FECI 5C6TH 4YR6A 1L6XA 2V5MA 3BD5A 4L3EE 1X6LA 4F8TA 4JRYB 5D7LA 4FNLH 4NM8L 3ULUF 5I8KL 2C1OB 5LBSL 5JPNA 4PTUA 2CMRH 4X83A 4C83B 2JB5H 2VAAB 3CZJA 4GRWH 2NY6D 4YR6B 3M45A 3CVHH 1YNLH 3JZ7A 5D7LB 4Y5YA 3FZUC 2NY0B 4WUKL 5KSAC 3MJ7A 1MCNA 4XVUC 5JPNB 4PTUB 3BT2H 4RX4A 1IGCH 1KENL 3ZDYE 3GMQB 1UACH 2AK4D 4Q9RL 4Y5YB 3LN4A 5I16A 4J3VA 2I60L 4KVCL 4TOYH 3MJ7B 3AROA 5IEKA 1FFRA 3X11B 3LQAH 3BOVA 1I1AC 3QAZC 5LXGL 1DQLL 1PG7W 1WIOA 1P9MA 5HGHA 4FZEH 4NQEA 1QNZH 3LN4B 3T3MF 5I16B 1N2RA 3VGBA 1IAKA 2UYLA 3MRMA 4GXVH 5CWSB 4EN3C 1D5ZA 5IEKB 2BY1A 2XN9E 3GMNA 5EU7E 3SO3B 2KDGA 1QFWL 1XF2A 3ZMRA 5HGHB 5C0RL 4NQEB 3U7WL 3V9FA 1N2RB 2GY7B 5DMIH 3VFTA 1IAKB 2UYLB 3MRMB 3HNSH 1D5ZB 3GMNB 3T0EA 3MUZ1 2EE3A 4F57L 1XF2B 4MWFA 4M3JA 1YYLL 3G6JE 4QHMA 4JFEE 2ITDA 3VFTB 1W72A 3ZKMD 3LIZL 3T0EB 1NANI 4JM2D 4XNYH 3VD9A 1CL7H 1E27A 4MWFB 1QKZH 4QHMB 1S5IH 5GGTA 2XWJA 5F21B 2ITDB 1W72B 1HDMA 4KDWA 5I1HL 2IMNA 4W6XB 3QCVL 5KSBE 2JJWA 5JHLH 1E27B 1MJJA 3QUZD 3DX7A 3VXUA 4UDUA 1BVLA 4RMTA 4W4NA 5E94A 2XWJB 3HE7A 5F44A 5C08D 3IDNA 4LARL 2ZCKL 1HDMB 4G8GE 2FATL 4E0RA 2B39A 2H32H 5I1EL 4XCNA 4GAGL 2DS4A 1MJJB 3VXUB 3DX7B 1A7PL 3E2HC 4PJFE 1BVLB 4JQXA 5E94B 3MRFA 3FQNA 2NY5L 1HINH 3HE7B 3IDNB 3MLRH 1PKQA 2VKXA 3RY6A 4B53A 4E0RB 2YS4A 25C8H 3U0WL 4ZUUA 5CP3H 4XCNB 4Y7MA 1EMTL 5C0ND 3RBGA 1Z2KA 4TNWK 3QXAA 3MRFB 3FQNB 4LHUG 1PKQB 3M8OL 4Y19D 1JGLL 4ZUUB 1ZAGA 1KFAH 2IPTL 3NZ8A 1QLFA 4KKCC 4ONFL 3QXAB 5LCVH 4JRWA 1HNFA 4U33A 1MVUA 1S7SA 4P2RA 4CVWA 1QSFE 4P46A 3CDFA 2D31B 15C8L 3NZ8B 2DQUH 1KTDA 1YEGL 4WFEE 1QLFB 5E0QA 1N4XH 4ZUTA 5DZOA 4J1UA 1MVUB 5IM7A 5CJXC 2NY2B 4G7YH 1S7SB 4P2RB 3G5XA 4Z6AT 3PJSA 4GJTB 3IETA 4P46B 4Z7QE 2VLME 4N0RA 4JPKH 4LOUD 5CZVL 5E8DH 1KTDB 1NKRA 1INEL 3KHOA 4P9MH 4ZUTB 1FYTA 1G7HA 5IM7B 2DQJH 4LSQH 4ONOA 3G5XB 3PJSB 5GRUH 3IETB 3AY4C 5E03A 1DBAH 4K8RH 5L2KD 2FDBP 2PN5A 3MBEC 5FYKE 1QFOA 4UNUA 4Y4FC 1FYTB 1G7HB 4U7KA 1VGKA 2F53A 2Z8RA 4M6OL 5DHVH 4JHWH 3TFKA 2EC8A 1J0IA 5DO2C 4K3DL 2ZNXA 4OQTH 5DEGA 3DHJA 2R39A 4NC0B 4NQUA 1VGKB 2F53B 5F7UA 5DD0L 3JTCA 3ZKXC 4YDIL 3FT2A 1QYGH 4MCYA 4YE4L 2N7BA 3PL6D 5DEGB 5J57B 5CILL 3WUWG 3WHE0 3PGFL 3RDTA 3WS3A 1OD9A 1RZGA 1MI5A 3FT2B 4FQXD 1A1MA 1MLCA 4FFVD 4MCYB 3O81A 4RAVA 5T1DH 3O6ML 4AJ0A 3HUJE 3MOQA 4XCCH 3RDTB 2ATPA 4UIMA 3WS3B 5EO1A 1RZGB 2H9GB 1MI5B 5DR5L 2R0LL 5IT2H 4G6AC 3VRJB 4LSVL 1A1MB 1MLCB 3OXSA 3VD7A 4KMTL 1I9RL 5E6IC 4KKNA 1RIVH 4HUWA 1CDCA 1BP3B 2ATPB 4UIMB 4QRRD 3FB5A 5EU6E 5AZ2H 5EO1B 1GOFA 2EDRA 2B0SL 4KK5C 4U6XA 5KBNC 4P2QA 3OSKA 3OXSB 3UMTA 4OLVH 4HUWB 4Z7WF 3QNZA 3FCTB 4HUNB 4UT7H 3E8UL 4GBXA 3FB5B 5IQ7H 4O00A 4U6VH 1DSFH 3AAZA 4U6XB 2CXGA 1A0QL 3FQUA 3T8XA 1WBXA 5DMGD 4P2QB 2KZ1B 1CR9L 2UUDH 5FIEA 3GUTA 1T66D 3BGFB 5DMYA 1EHNA 3GRWL 4GBXB 4O58H 4NKIH 3ISWA 3JV6A 3O9WC 3AAZB 3FQUB 5F7MC 3T8XB 1Q9OB 4W70A 1WBXB 5FFLA 5EO0A 3EYQD 3D25A 1GGTA 2GT9A 1S78D 3GUTB 3IFLL 5HHXL 3HMWH 1PJ9A 4N0UE 4WCYL 5JW4M 1UH4A 5F6IB 3DECA 3JV6B 1RURH 2P5WD 3H6JA 3PWPE 1NAKL 3QSKB 4PY8J 5EO0B 3D25B 2GT9B 1SY6H 4EUPA 2LFGA 5FDYA 1XZ0A 3UTOA 4LCUA 2DQEL 3TO2A 1J87A 1IGJA 1QFHA 4JZNA 3O2VL 1U8KA 1IGFH 2FX8L 4HJ0C 4EUPB 2Y06H 1XZ0B 3KJ4C 4LCUB 4UTBH 1EA9C 3JWDL 3TO2B 4F8QA 1IGJB 3GJFK 4JZNB 5T33H 3GHBL 1U8KB 5FUCE 3S35X 4P2OA 1LO0L 3NFNA 1UG9A 1X5IA 3BRGC 1RUML 5EOQH 1DUZA 2Q7NA 1RZ7H 2YPVH 3ET9F 4DN4H 3B5HA 4YXKL 1YEHH 5F72S 4P2OB 3NFNB 4MNGA 3TJEL 1Y18A 3BKMH 3LRHA 4P59H 3X3FL 1DUZB 1AO7A 1U36A 3WDJA 1LK3L 3SDCD 5DXWA 5JOEA 4OD3H 3FQWA 2OR9H 2X4RB 4EXPX 4MNGB 1Y18B 1I1FA 5GRJL 3VDBA 2ZKHL 3C6LD 4Y4HD 2J6EL 1V8HA 3BZFA 1DN2A 4OZ4A 4TPRL 3MV8D 3V6BR 5DUBA 1ZGLP 5LGJA 3FQWB 3U9PH 3R4DA 1KCRL 1I1FB 1NL0H 1BFVL 3L5WA 3L5XL 3TWCL 3BZFB 4IM8A 4OZ4B 4OCNC 1L7TH 5I8OH 1HIML 1KOAA 5DUBB 1SMAA 2BJMH 3NZHL 3VI3E 5LGJB 3VW3H 3P30L 4NOBA 3WEXA 4JO3H 3IJYA 1GAFH 5T5FL 3L95A 3GI8H 3L5WB 1O7VA 3RKDC 3I9GL 3H9ZA 4EBQL 1PGRB 2W07A 5GGVL 4OTXH 2P1YA 5IBUG 3QULA 3WEXB 5C71A 3ZZ1A 1MY5A 3L95B 2K3TA 2XTJE 1GH7A 3VI4E 2Q20A 4OLYH 4JKKA 2CPCA 3FRUA 4FMKA 3MRLA 3QULB 4M00A 5ACZA 4RISH 4XAWL 1DUYA 3L7EA 2EXWC 5FEBA 5DRWA 3HAEH 1UKTA 4HKXA 4QCIA 5CJOL 4FQJH 4JN2B 1BBJA 2GJ6A 1KJMA 4WEMB 1JWUA 3MRLB 3UX9B 5ACZB 3SE8H 2FZ3A 4XPFH 5C9JA 3VG0H 5A1AA 5B38A 1DUYB 3L7EB 4BZYA 4OFYA 1MCSA 5D93C 5DRWB 4HKXB 4QCIB 3BH9A 1BBJB 2GJ6B 1KJMB 1P6FA 2MJWA 1JWUB 4GS7B 4PJDF 2CRYA 2FZ3B 4P4KD 5C9JB 1O0VA 5B38B 3GIVA 2F5BH 4NBXB 4W4OC 3O2DA 5D6DC 1AKJA 4LNRA 3K2UL 1R24A 3RZCA 3BH9B 5D9SA 4Z7UE 4APQA 2PXYC 5I2IA 3GSUA 3IJHA 2P5EE 5HYEA 2MKLC 3NH7L 1JPSL 3GIVB 2P4AB 5BS0E 1IAIH 4RZCA 1MRCL 2I25N 1AKJB 4XMKH 1CFBA 4LNRB 1RZFH 1R24B 3RZCB 4FTVE 3GBML 5D9SB 4HCRH 1AIFA 1CVSC 4LGRB 4APQB 4WW1A 5I2IB 4RQQA 2P42B 3IJHB 5TQ0L 2ENSA 1OTSD 5LQBL 1LDPH 4RZCB 1CXFA 5IVZA 3PHOA 1F5WA 2D0GA 4QYOB 4XC3H 5FYLL 1UM5H 1AIFB 4WW1B 5ICXA 4RQQB 5DVLA 4YXLH 5F6HI 2VIRB 5IVZB 3UAJD 3PHOB 4FQLL 2V5RA 4PJ8A 4P23A 1HZHL 5ICXB 3EYSL 2H2PD 4N5EA 1FSKB 1V05A 4DQOH 3CIQA 3FN9A 3CH8A 2AQ2A 1N0XH 3GMLA 1J1OH 4XXDA 3ARVA 1T7WA 5FGCE 4PJ8B 4P23B 1DEDA 1MPAL 1LEIA 2ZUSA 1JWMA 4G8EA 2X4UA 4XVTH 2RJMA 1A6PA 3CFIC 4N90D 3GMLB 3UZQA 4XXDB 2R15A 2Y7QA 3GBNH 3CDCA 2OJEA 5I1JL 2BNQA 1RUAL 3VGAC 3R1GH 2HKHH 1LEIB 1JWMB 4G8EB 4WI2A 2X4UB 3HCVA 4M7KL 4OGXL 5IVXA 4NHUE 1W0WA 4D94A 1AXSA 2Y7QB 4WO4C 4K3JL 4UT6L 4K23H 2BNQB 4JREC 4O2FA 1FDLH 4RMSA 4PJGE 5IVXB 4R8WL 3WFBL 2V5TA 5FXCH 1W0WB 1AXSB 1KB5L 5JXAH 3KPSA 5JLZA 2HKFL 4O51A 4CBPA 4JVUA 4O2FB 1ZLVH 2VDNL 2UVEA 3REVA 4TSCL 4XT1C 4BYHA 2YMXL 1FNHA 2R4RL 3KPSB 3QCTL 5JLZB 3CMGA 4X8JA 4FG6D 4FS0A 4MMXC 4O51B 2QQKL 2LVCA 5DD5L 3REVB 1A8JH 3NOIA 3P2TA 2VXSH 1DANU 4YX2H 4LHUD 2ZOKA 3RVTC 1CLOL 4X8JB 3O6FA 5ACLA 4QWWC 4TNVK 2VDPH 1WZKA 4ZPTA 5DA0B 1FG2A 1U95A 3VXPA 1OARH 5CJQH 5CMAA 2DJ4A 3S35L 4YC2B 1TJHH 3MMEA 4I8DA 1D9KC 3ARFA 3EJZD 5DGQA 2D7QA 2ZOKB 3QDMD 3S9DB 2VXTH 1OGTA 3O6FB 4AG4H 1BBDL 2ADFL 1WTLA 3IFNH 5F9AC 4ZDHA 4ZPTB 4CAGA 4Z7OE 1FG2B 1U95B 3VXPB 1BIIA 1IMHC 1VEMA 5CMAB 1B9ZA 2VR4A 3A6CL 3MMEB 3ARFB 3I84A 5E2UH 1NGQL 2ADJA 4KKLC 1IQDA 1OGTB 5T5NF 2FLBT 3KVQA 3BUTA 4ZDHB 5BW7C 4M7LL 4KTEH 1CD0A 4MAYD 4V2BA 3R06A 2AEQH 2DQTL 2EECA 4WVRA 2UWEF 1NCUA 2VDMH 3VCLA 3SQOL 2ADJB 3PV6A 4X0KA 1IQDB 4OIIH 4Z5RA 4L4VD 5HTSA 2BVQA 5FHBL 5C6PB 3EDFA 3R06B 3VCLB 4YUEH 5GS2H 3PV6B 4X0KB 5HHOE 2F19L 4Z5RB 3OPZH 3P4NA 5EBGA 5L7XH 1BF2A 2BVQB 1WBYA 2UV3A 2V7HA 2VZOA 8CGTA 2E7BA 4UQ2A 1A1NA 5IGXH 2P7TA 2FO1A 3PE9A 4QRSA 5D4QA 2R0KH 1K4CA 2GK0A 3P4NB 1WBYB 4MQ7A 2V7HB 2DJSA 1LWRA 1J11A 4UQ2B 1A1NB 1K8DA 2P7TB 1NUFA 3QG7H 1JPFA 1QLEH 3WN5A 4JFFB 4QRSB 3OAZK 1U8MA 1K4CB 2GK0B 2X1WL 5I74B 4AENA 3EOYG 4MQ7B 4XP9H 5JHDE 3HC3H 4OD2A 1K8DB 5IK3A 3T3PF 5F9WB 1JPFB 3WN5B 1Z6JT 3RFZC 2F8VA 3FFCD 5EUOA 1U8MB 3MRIA 1VSCA 5GRYA 4WUUB 4AENB 4CDHA 2GTZA 3MACL 2D7MA 4OD2B 5IK3B 4WRLA 2CGRL 3LB6C 2EZ0C 4QT5A 4Z9KB 5EUOB 3MRIB 2BZDA 4LVHB 4OCSH 1K6QL 2QSCL 1FV1A 3BX7C 4JDTL 5CINL 3ARXA 5TE7H 3SOBH 4F7EA 5C0CD 2Q87A 2GTZB 1S3KH 1JTOA 3I02A 3QIUD 4OLUH 12E8H 4OAWA 3TPUB 5LGHL 1X5AA 4QT5B 1EJOL 4RMQA 5HDLA 3EZ8A 1R3HA 4S1DC 2E8YA 1FV1B 3MC0A 3HI6H 4F7EB 2BP3A 4AEHL 4M43L 1I8LA 3I02B 3MXVL 3QDGD 4RFOL 1CS6A 4OAWB 1U58A 3I6LD 2XY1A 1R6VA 2VL4A 3F7RA 3VWKD 3VXSA 2FECL 5L8LB 1R3HB 2NY1C 3K8LA 4DVBA 4TRPL 1P4BL 1TTFA 1A7RL 4LASL 3ZE1F 1U58B 5BRZA 1WAAE 2CDEA 3DSNA 2OM5A 3NIDF 2X44D 3VXSB 3FMGL 4XNUL 1CXLA 2XFXA 4I13B 3SE9L 3OKDA 5F3BA 2Q8AH 4BQ6A 5C0DA 4DVBB 3L3KA 4JB9L 5EA0H 1KBGH 1D5MA 5DRZA 4DOHB 3H3PH 5BRZB 2CDEB 5JW3L 5FYKL 4L9LA 4ODWA 4BFGA 4YHML 3QISA 2XFXB 3OKDB 4LEXH 4P3CH 5F3BB 1T03L 2EE9A 5C0DB 2HN7A 3HMXA 3L3KB 1F4YL 3P9MA 4EQ2A 1X4XA 5J12C 4EI5D 1ZGLA 3O6LH 3GIZH 1D5MB 5DRZB 4L9LB 2J8UE 4NWUH 4ODWB 3ZDXF 3ZSSA 3BI9X 1VFMA 35C8H 1PBYA 4TSBL 1J1XH 2HN7B 3O45A 3P9MB 3C08H 3OMZA 1ZGLB 2R4SL 5DD3H 3QBTB 2GY5A 4NZRH 2PYEE 5FGBA 3TN0C 3V6FA 2XZCL 4I9WD 5SWZE 3O45B 2BNRD 8FABA 1I9JH 4JKWA 3ULUE 4AMKH 4GMSL 3U4AA 3SDDA 3SKUD 3BP6A 3V6FB 5C2BH 1ZVYA 5T3ZD 3UYRH 1HQ4A 3MFGB 2YA0A 1G0YR 1A6TA 3F7VA 1EO7A 8FABB 1ETZA 4U1SA 1CU4L 5AYUL 2K7QA 4KMQA 3SDDB 3FT3A 5AUMA 3BP6B 4G59A 3GGWA 1ADQL 3B8SA 5HHVH 4NQCA 3V6OE 1HQ4B 3QUML 4D9QE 4JR9L 4HXAH 3QI9D 1A6TB 3F7VB 3RP1A 2XYCA 1YMMA 1ETZB 4KUZH 4U1SB 5KVFL 3GHEH 3JWNC 5GHWL 2IG2H 1EBPA 1RULH 1SVZA 3FT3B 3LZFH 4QOKA 5AUMB 1BOYA 3GGWB 4NQCB 4OFVA 1P4IL 4XWGL 2MTPA 1R5IA 4KQ3L 3IDYC 4EKXA 2HLFD 4FFYH 3R0MA 1YMMB 5GZOC 3T3ME 3GRWA 4QOKB 3W82A 2EDJA 1R5IB 4GRLC 5E4EC 3NTCH 1J1PL 4XB7A 2YK1H 4X6EA 3SGJC 1N6QL 2NXYD 3GNML 1CE1L 2IJ0C 3CLEL 4RNRA 4S1QH 4IEFB 5EU3A 3WNKA 3H9SD 1CFNA 1X5FA 3VH8G 3QP3A 5D7IA 4X6EB 1D5XA 3RIAK 4M5ZH 1OAYL 4NM8H 3KXFE 1I1CA 5F88A 4DGIL 5I8KH 4NN7C 4RNRB 1UM6L 5EU3B 3NGBB 1YYMH 1FFPA 3UPRA 1CFNB 3SGDI 1I7UA 3OL2A 1UWGH 2D7OA 1CGTA 2EEAA 5D7IB 1D5XB 4IDJL 5E70A 1JTTA 1OM3H 5F88B 2DD8L 3V52L 1BQHG 4KI5C 1FFPB 3VRIA 1I7UB 4U3HA 4M6NL 5K33A 4Q9RH 4KAQH 1IM9A 1G9NL 4EIZC 2I60H 3DPBA 2W9EL 1A3RL 4IRZL 4KJWD 4F9LC 1QBLH 4JPWL 3VRIB 1FPTL 2O93L 4NM4H 4S0UC 1Q1JL 4M5YH 3DOSA 2B5IC 1IM9B 1T3FA 3O4OB 4HBCL 5T1LA 3QEQD 4I0CC 3QEGH 3W11C 1QFWH 5CEZE 5H94A 2YN3A 2GYSA 5F7YC 3B2UD 2H3NA 4FMFA 2YRLA 5C0RH 4L29A 1T3FB 2CIIA 2AERT 5T1LB 1E4WH 2XXCB 3GMOB 5KS9A 5C0FA 2NXZB 1DVFA 2NX5D 5I1LA 4MQXD 4BQ9A 1PG7L 1RIUL 2H3NB 4HPYL 1URLA 2QKIA 3CXHK 5I0DA 4WV1C 1KIPA 1Q0XL 4L29B 5JXEC 4PDCE 4HMCA 4K3EL 4LAQH 1WT5A 3LIZH 1AXTH 5C0FB 5KS9B 3WNNA 3BHBA 1F00I 1DVFB 2EIZA 2RGSA 5I1LB 3STBA 1Y6MR 4UDTA 2QKIB 3KLAA 1FIGH 4M6AA 2FIKA 2EDXA 2YD4A 2DQHH 3C5ZC 4MB4A 1QO3A 1JGUL 3FKUS 3BHBB 3QCVH 2EIZB 4QNPF 5FGRA 3DV6A 1YNTA 4UDTB 1JF1A 4AH2A 3KLAB 3I3BA 3LKRA 3DMMA 1ZXQA 2QQNL 3F7QA 4HZAA 4M7ZC 3MRGA 4PB0L 5HYFA 3UBXA 3B6SA 1GGBL 2ZSVA 3LKNA 1V3LA 2Y4SA 1MCIA 1MWAA 4W68A 1EVUA 3DV6B 3LQAC 1BF8A 1YNTB 2VZSA 1IARB 1JF1B 4AH2B 3LKRB 2V9TA 3DMMB 1HYSD 5IEHA 3T1WA 1HQRA 4I3RH 2D4DA 3MRGB 4ZFGL 9CGTA 2EDBA 3UBXB 1M7DA 3B6SB 4HAFA 5C8JA 2ZSVB 3LKNB 5LJYH 3U0WH 2R29L 5DA4A 1MWAB 4Y8DC 2Q3ZA 3I85A 4NFDA 2C5DC 3NPSB 3HG1A 4MZ3A 4ZODA 5H37H 4PBWD 3WLWD 5IEHB 1HQRB 1LP9A 4PRHE 3DETC 1M7DB 3SCMA 3M8OH 1ZEAH 4KJPC 1JGLH 5C8JB 1MHCA 2WQ8A 4K94C 1MCHA 5E9DA 5GGRA 1IJ9A 4PS4L 3HG1B 2ZNWA 2O5YH 1LP9B 3GSVA 4Y88A 3MV7D 3SCMB 5CHNA 5IHBA 5ISZE 1MHCB 2GEEA 4U1NA 1EV2E 4PJCA 4WFGE 2NY3D 4NQDD 5E9DB 2VQUA 5GGRB 2EIEA 2HH0L 1MCPH 3QPXL 3GSVB 2HTKC 2AJSL 2DYPA 4BQBA 5CHNB 2CR6A 4LCIL 2X4TA 4U1NB 3CPLA 5CZVH 5DFTA 4PJCB 4HH8A 5I75B 1INEH 4G6FD 1FFNA 3WUZA 3RVXC 2UZIH 3V0WH 1JPTL 2NY7H 2Z8SA 2DYPB 1OAQH 2R56L 4OLEA 5D1ZA 2DBJA 2X4TB 4NZUH 1VACA 3CPLB 4Z7WE 2FL5A 4KRNA 1JZ6A 1FFNB 3BSZL 2AAVA 5FKAA 4DGVH 1NC2A 1PY9A 4E41E 2VDQL 4HUVA 2ILLA 2DOCA 4OI7A 3K81A 5D1ZB 1VACB 2OMBA 1NMCB 4MJ5A 4C56A 2FL5B 3ES6A 2DF3A 5FKAB 2YPKA 1Q9LA 1NC2B 4U3CA 4HUVB 3QFDA 5DD0H 1NFDA 2E6QA 2A73A 2LAGB 3QR2A 1CZ8H 1T7VA 1J12A 5AWNH 1F13A 2O5XH 4HLJA 4MJ5B 4C56B 3ES6B 1T89C 5GGVY 2VL5A 2YPKB 1Q9LB 3PGFH 3RTQC 3A67L 3QFDB 3SN6N 4DKAA 1NFDB 2A73B 5CCKH 2BHZA 3HHRB 1P4LA 4PBVC 2VL5B 1T1XA 3WKML 3O6MH 1NCCL 3GSNL 1AE6L 4N0FA 2R1XA 3TO4C 4BZ1L 2X70A 5DR5H 1N5YL 2IC2A 1FQ9C 4XPBH 4LSVH 1P4LB 2G9HA 4KMTH 1T1XB 3GSXA 2ZUQC 4HK3N 1M6OA 4CADB 1AHWA 4M1GL 4ZOEA 2VXQH 4N0FB 4ALAL 2R1XB 3TBYA 2B0SH 2X70B 1RHHA 1SQ2N 1JK8A 3MLUL 2H2SD 4PLOB 1KNOA 2G9HB 3ARBC 1E4XI 4UNTA 4WI3A 4HS3A 5BV7H 4K8RC 3GSXB 5FM8A 2FBOJ 5TH2A 4F7TB 1M6OB 3I3DA 4J12A 1AHWB 4QEGA 4PP1D 3TBYB 2YUWA 1RHHB 1JK8B 1EHLH 1KNOB 1LO4L 4HS3B 5GGRY 4JVWA 5D5MA 3SE4C 5TH2B 2CKBA 1HKLL 4OF3A 5KJRL 4ZFZA 3EO9L 4H8WH 4G8IA 5CD5D 1G7LA 3K3QA 1DBBL 4RGNE 3O8XA 5D5MB 4JO2H 3CSBA 2CKBB 5FHAH 1FNSL 1HN1A 4WCYH 5TFSL 4ZFZB 3VWJD 1I9EA 1MHEA 4G8IB 4LLWA 2IAND 4HZLA 1G7LB 4NRYA 4OGAC 3U46A 3BDYH 3O8XB 2WQRA 2EDOA 4L1DA 5C3TA 5CGMA 4JM2A 1JYWA 2IAMD 3QPQC 4GSDL 4AQOA 1MHEB 4LDEB 4LLWB 4NC1C 4HZLB 2FX8H 4NRYB 1ZHBA 3U46B 1F90H 5DD1H 4TUOA 4OM0L 2VLKA 4RWYL 4JM2B 3JWDH 4TUKH 4OLWH 3O3BA 1LO0H 1ZHBB 1MRDL 5JW4N 4TUOB 1JYNA 4Z0BL 1HWHB 3VXTA 2VLKB 4R2GD 1VFUA 4PUBL 5IFJA 1YJDH 3O3BB 1BREA 1CBVL 3TF7C 2DWEA 2APBA 3TJEH 2DQFA 2VABA 3S3SA 1U8OA 2YN5A 1FLTX 2VLMD 1LK3H 3RVUD 3KJ6H 3VXTB 3S36X 1JHKL 5IFJB 3KPLA 4FP8H 1FZJA 5IVXF 3BJ91 4J3TA 3RUGA 2DWEB 2DQFB 2VABB 4N8CL 2VDKL 1U8OB 3HZMA 4J3SA 1V5JA 2J6EH 3NABL 3D39D 1PSKL 4TPRH 1AGEA 4PJDE 3KPLB 5DSCA 1FZJB 3RUGB 4KGJA 2HA1A 3HZMB 1BFVH 1VADA 3CJJA 1HIMH 1AGEB 1NBYA 3NZHH 1TQCB 2BXZA 4L3CA 2H26A 5DSCB 1JE6A 2C4FU 5M7QA 5J13B 1VADB 2OXHA 3K8KA 4KI1A 4WW2F 5IB4A 3I9GH 1U8NA 1NBYB 1HSBA 4L3CB 2H26B 2WIMA 4X9FA 3RJDA 1J9CT 2J12B 2YD9A 3S37L 2D4FA 2JB6A 1A3QA 3MGAA 4UIKH 5IB4B 2XWTA 1U8NB 5IOPA 3CVIL 4O02L 2MMXA 1G9ML 1CXHA 1HSBB 2HT4C 4IRJC 3JSSA 4IIQA 1C7SA 5L2KA 2JB6B 4XAWH 4S1SH 4K55A 3DVIA 2J7LA 2XWTB 4YAQA 5IOPB 2GITA 4PRDA 1J0YA 2APTA 4LFHG 1ZHNA 3FZUD 4DZ8A 4IIQB 5L2KB 4CN6A 2HFGL 2BOCA 5D2LF 5KSAD 1IBGL 5HVFB 4XVUD 4WIQA 4XP6L 5F70A 4UU9A 4YAQB 4FZ8L 4GG8A 2GITB 4PRDB 4Y5VC 4F37K 1OTTC 1ZHNB 4N8PA 4DZ8B 1JWSA 5MHSE 2HT2C 2BOCB 2IH3A 4KY1L 4UU9B 3ALWA 3T0EC 3I2CH 3GO1H 1I1AD 3C5SA 4GG8B 5ITBH 3K2UH 3TGXA 1OL0A 3D0VA 5GGSA 4FQXA 5KAQG 1JWSB 3F7PC 3LD8C 4HJJH 2VDOL 4EN3D 4YHZL 3VFWA 3IFPA 1JPSH 2IH3B 3C5SB 3U4BL 2X09A 2LVEA 1MY7A 2WIIA 3D0VB 4H88L 3EHBC 4HWZB 5GGSB 4FQXB 4X6FA 4LQ1A 1FVEA 2J88H 3IFPB 3VFWB 2NW3A 5LQBH 5I1CL 3FTGA 3G9AB 3WIIH 2DDQL 2F5AL 2Z9TA 2WIIB 4LHJB 5IJKA 5FYLH 4C57C 3NVQA 4X6FB 4PLKC 1O5DT 3ULUL 4W6WB 1FVEB 4L4TE 1U3HC 1T4KB 2NW3B 3AS0A 4QRRB 4XCFL 3FTGB 5DJ6A 3IT8D 3M07A 4FQLH 3HPJA 5C3LD 3AMKA 1HZHH 4R97C 2WINA 3JTTA 1T83C 5F7LB 3G5ZA 3QUMA 5B4MC 4B50A 5EUOF 3E6FA 4TTDC 3D85A 1WQVT 2EDHA 5DJ6B 4OZHA 3HPJB 2VXVL 1LO3L 3BZ4A 4V1DE 3JTTB 2WINB 1TVHB 1VFOA 1IC5L 2X7LA 3G5ZB 3QUMB 3SGKC 2WBKA 3DURA 5IB3A 3E6FB 4QF1A 1KCUL 1JL8A 3D85B 4M6ML 5C0GA 3TJHC 5BVJA 1E4JA 1MSPA 4FFEX 2JKXA 2ZP0T 4OZHB 2P5WA 1PVHA 4JN1L 1RUAH 3BZ4B 3TZVC 3GK8H 1AI1H 5C07E 4AEFA 5EORH 5IB3B 3JWOH 4M7KH 3DURB 2ZUTA 4K3GA 2LTQB 4QF1B 5C0GB 4P46C 5BVJB 1JZ2A 4IHOA 3FL7A 5C0AE 4EVNA 3DXAD 2P5WB 1BJ1J 3EYUH 4UT6H 3LQMA 4IOFC 2FX7L 1HNGA 4GRWF 4YDJA 2UWEE 1OGAE 4QXUH 4IHOB 4EVNB 1KB5H 3FN0L 3L3IA 4NKQB 3QXWA 4KKCD 5DWUL 5CSGA 3C60C 1XT5A 3DUUA 4HQQH 1E6JL 3BYTA 4PJ5E 3QWRD 5J3HC 4YDJB 1NLBL 3PP4L 3TNNA 4U0QB 2IMMA 4TSCH 3P4MA 3DV4A 2YMXH 4ORZC 3QHZH 5DQJA 2R4RH 3L3IB 1MJ7L 2MPAL 5I6XB 4K9EC 3ZE2F 1ZS8A 3L6FA 3DUUB 3OZ9H 3DLQR 3JXAA 3BKJL 5DD5H 3TNNB 3TFKC 3LKSA 3P4MB 1OLLA 2DM2A 3DV4B 2PTUA 3B2VL 4H1LH 5DQJB 3RI5K 3P3YA 1ZS8B 3L6FB 3C6LA 4Y4HA 4HC1A 3MCLL 3MOBL 3MV8A 4G6MH 5J1SC 3S35H 2VSDA 3O3AA 2CLRA 1L7IH 3LKSB 5B3JF 3HI5H 2X10A 3QG6A 2XRAL 1T1YA 4JRYE 4KVNL 3MBED 5DEFA 4AIOA 3T3PE 4Y4FD 3WCYA 4G8FA 2CLZA 3C6LB 4Y4HB 1IKNA 1KEML 5JQ6L 3DVFA 2I5YL 3RDTC 2QLVB 3QWOA 1MCFA 2J8HA 3MV8B 2OJZH 4CJ0A 2CLRB 3EJJX 5FDWA 5DO2D 3QG6B 4HJGA 1T1YB 5D7LE 4ZOCA 5DEFB 4UT9L 2DQCL 5CEZL 4G8FB 2CLZB 1UCBL 3QWOB 4M7LH 5FDWB 2DQTH 4Q0XL 4HJGB 3SQOH 1OCWL 3V5KA 3B9KC 1JFMA 3ZYIA 5FHBH 5IHZA 2OBGA 4KHXH 2B1AL 3ULVF 3T0VA 5L0QB 1WLHA 3IAGC 4HG4K 1HHHA 3LMJL 4YWGL 2F19H 2IBBA 2R1YA 3V5KB 2AJZA 4U05A 5IHZB 3RAJL 4Q2ZA 1PZ5A 4H0GA 4NZJA 1YA5A 3SPVA 3T2PA 3UJIH 4G6AD 4DUVA 4ZS7L 5TPWL 2AXJA 1HHHB 3SY0A 3SDYL 3ZE1E 2R1YB 1RQ5A 5E6ID 2AJZB 5BCAA 1VCAA 2QHRL 4ODTH 3NIDE 5DJZA 1ROWA 2AV1A 4Q2ZB 3EDEA 4WEBL 1PZ5B 2X40A 1UADC 5HJ3A 3SPVB 3HE6C 3QEHA 1IAOA 3PGCA 3RY5A 4KK5D 1MCOH 2UUDK 3GSOA 3SY0B 1UXWA 4QXGH 2PO6C 4F58H 2B1HL 5DJZB 1KJVB 2XQYK 2AV1B 4UUJA 1I8IA 5HJ3B 3UYPA 3QEHB 1IAOB 3PGCB 4XMPH 4ESKA 1A3LL 2CRZA 3GSOB 3VXMD 1H8NA 1UXWB 1EO5A 3QUYC 1WZMA 3VDCA 3MACH 5GJTH 3ZDXE 3N9GL 1TLKA 4UUJB 5KZCD 3RGHA 1FO0L 1I8IB 2CGRH 3EYVA 4D0BA 3O9WD 1IT9H 3MCKA 5E1HB 3ZKNC 4KWUA 2QSCH 5CINH 2JTDA 1UJTA 3B9EA 2F8XC 3K4ZA 4Z7UA 3EYVB 4D0BB 2GTWA 5HI3C 2ESVA 3VXUE 3MCKB 3UJTL 3ARSA 4M43H 2EEDA 3MXVH 1A47A 5DJCA 3F65A 4Z7UB 3P0GB 2GTWB 3DUHA 2ESVB 4YFLF 5EWIL 4JFOA 4HJ0D 1MCDA 4TRPH 3IU4L 1PKQE 1MLBA 1WFUA 5DJCB 5IKCA 4OZIA 5F1NA 1LQVA 4NN6C 1DQML 2AI0L 4JFOB 3RNQA 3RA7L 1XGUA 4KXZI 5IKCB 4OZIB 1OAUL 2AJXL 5F1NB 5FYKH 4UOJA 1XEDA 3KPOA 1A6ZA 4ODHH 2Z91A 3U36A 5KS9F 1LGVA 3IGAA 3E0GA 5JIKA 2YD2A 4CN1A 3RGVC 1T03H 1T2QL 3MLYL 5I8EA 2WSKA 3MRPA 2RFXA 3RNQB 1RD6A 4P2RE 1XGUB 3MX0A 5K9JL 2YD5A 4LPUA 4OLXL 5TF1L 1BJ1H 1OF2A 3KPOB 1A6ZB 2Z91B 2VRAA 3U36B 3T65A 3IGAB 5ESAA 4TSBH 5F89A 4GUPA 5I8EB 1N26A 3TA3C 3MRPB 3MJ9L 2VE6A 2RFXB 3BD4A 4MDIA 2JE8A 1F4WH 2XPGA 5D8JL 1RUPH 5GQBA 1NCAL 4GQ9H 3MR9A 1OF2B 4M02A 2IH1B 3LRSA 3T65B 5ESAB 5F89B 1CGXA 2X1QA 4GUPB 1F6AA 4NHUA 4P5KA 2NR6C 1I85C 1W8NA 1FYTE 2VE6B 4MDIB 4QTHB 4JY6A 4M48H 5MERA 4URTB 2XPGB 4LPWA 3BPNC 4GMSH 1KF9B 3MR9B 1J0ZA 4KJYA 5D1QA 3TYGH 2DLTA 3GJFH 3JV4A 3LRSB 1KCGC 4PJGA 1F6AB 4P5KB 3RKDD 4LHQB 4JY6B 5MERB 2F53E 1CU4H 1T1ZA 2XQBL 3LS4H 4KJYB 4LHUA 5D1QB 1ADQH 3JV4B 4C4KO 5JR1H 4PJGB 2Y6SC 1M4KA 3IKKA 2MQ3A 3P0YL 1MQKL 3WJLA 1C12A 5KVFH 1T1ZB 5GHWH 1I7TA 1LP9F 3GI9H 2CJUL 2XG4A 5CZXC 4LHUB 5F7FA 3QDMA 4MJ2A 3GSRA 3EZJB 1P4IH 4XWGH 3Q1SL 4YDKL 4KQ3H 4QY8A 4LRIA 1TZGH 2EXWD 4JZOA 4P2CG 1Q38A 1C12B 4LCWD 3VFUA 4KK9C 1I7TB 5EH1A 2HJKA 3W0WA 3OGOE 3QDMB 3GSRB 3QHFH 4R0LC 5ANME 4QY8B 4PJCF 4JZOB 1GPOL 3WIHL 3VMOA 3VFUB 3Q5TA 3L9RA 4S1RH 2HJKB 3W0WB 1KXTB 1N6QH 3CFJA 3GNMH 4BFIA 1CIDA 4MA1C 1A7QL 5EG6C 4OFDA 1UEYA 4WFHE 3ZYOA 2MSPA 3L9RB 4JM4L 2PXYD 1L6ZA 4M9OA 4P2QE 1KN2H 4Q6YA 4N1HB 3CFJB 4DGIH 2UY7A 2VWEC 5DUPL 4Y0GA 2OLDA 4BFIB 4LFHD 3EOAA 4NO0A 4QXWA 2B2XL 4V3DB 3D3VD 3G6DH 5A40E 4PJ8C 3MRNA 4KRMB 5EIIA 2QV2A 4JCLA 2DD8H 3V52H 4QNPE 4NKMA 3MLXL 4XTRC 4NO0B 3RNKA 3EOTL 4M6NH 3RQ3A 4R4FL 4NGHH 1AJ7H 3WUWA 4TQEL 1RIHL 3HNTL 3MRNB 2YWYA 2BVUA 5EIIB 3THML 1NFDF 2W9EH 4NKMB 2VLRD 1TNNA 4OQ1A 3RWFA 5KVGH 3RNKB 1BZ7A 1JGVH 3FFCA 1BM3L 3WUWB 5CP7A 1XF5A 1CLYH 3QUKA 4G42A 4OLZL 4UILL 2ERJB 1S7XA 1ED3A 4HBCH 5HY9A 5DVNA 3REWA 3CMOL 4AM0A 2PF6A 3RWFB 3E1F1 3JTSA 1BZ7B 3FFCB 2W9DH 3LHPH 5CP7B 1XF5B 4IDLA 4ZUVA 2DIJA 2AABH 3QUKB 4G42B 4YHOL 1S7XB 1ED3B 5C0CA 4S0TD 5HY9B 3NFSH 4M93C 3QIUA 3REWB 4AM0B 2XKSA 3JTSB 4QHLA 3UJJL 4HPYH 3R0NA 1QR1A 3WYRA 4OI9A 4W6YB 4HWEL 4ZUVB 1MEXL 4K3EH 1C8PA 5C0CB 3QIUB 4QHLB 5HGAA 4WO4D 2VC2H 1QR1B 1ZLVK 4YQXL 1RVFL 3UTTD 2W0LA 2J4WL 1OY3B 2D3VA 1MCRA 1S7VA 3K74B 5HGDB 3EUUA 4M7JH 5HGAB 5D5MF 4POYA 5DT1L 4XPTL 4K71C 3BPOB 3O6FC 1Z9SA 1EEQA 3HPLA 5DFWH 1W2KT 4CUCA 1J8HD 4K7PX 3SJVD 2A1WH 2BRQA 1BEYL 4JGJA 3GM0A 1QHPA 1KGCE 2QQLL 2WUCL 1ERNA 5EZJA 5J11B 5BVPH 3PP3K 5FYJD 3TIDA 3ZHLA 3HPLB 5BV7B 4EI5A 1E4XL 1P84K 3MJ6A 3VFNA 4PFEA 4WI8A 4XNQB 3RVTD 1KPVA 2OR8A 2ICCA 5EZJB 4JM2F 2F9BT 4QWWD 4D0DA 3TIDB 4POZC 4EI5B 4MNQD 4OIBA 4YPGA 2DWDB 3CX5K 3VFNB 5IHUL 1D9KD 4ZSOA 5HYSG 3K0WA 3H8NA 1KPVB 2YXFA 4PS4H 4ODSL 1IGIL 3GEWB 2BVTA 4D0DB 4JGMA 2ZJSL 1FGNL 4HF5H 4YPGB 5B22A 3WD5L 1RAMA 3L1OL 4PGJA 4ZSOB 3S4SG 4KKLD 1P5UA 1TVDA 3BKCL 1J5OL 3LS5L 2ZWLT 4U0RB 4L8CA 1R3KA 3QNXA 2CUMA 2W92A 3X17A 2GJ6E 2P8PA 2W65A 5BZWA 4BK4A 3SHSA 1JPTH 5D71L 4L8CB 1R3KB 4A2LA 2AJVH 4ZUSA 3QNXB 3RUGF 1WGOA 3WN5C 4FN0A 5IHLB 3EYOA 4XX1G 2P8PB 2W65B 4ZPVA 5BZWB 4ZTPL 1CGWA 1A6WL 2NY5C 3QWQB 4ZUSB 4FABL 1XF3B 4KK6C 4NUJA 3DX6A 3HA0A 5D2NA 3EYOB 5EOCL 4LVHC 4X5XA 5IVOA 5J8OA 4ZPVB 1SYSA 5TGBA 5GS0L 2HT3C 1UVQA 4D3CL 5E24E 3KYMA 4GKOA 2VR9A 3MJGX 3K4DA 3MV9D 4NUJB 2FJHA 1S7TA 3DX6B 3AM8A 5D2NB 5BJTA 4IMKA 4KMLB 4QXTA 1SYSB 5TGBB 1YY9C 3A67H 1UVQB 5IBUB 3KYMB 3T0WA 4HIHA 2YWZA 3U7AA 2FJHB 1S7TB 3IFOA 5BJTB 5JW4Q 1U8LA 5MEND 2NXYB 4QXTB 2BY3A 4YEEA 4M1DL 2DL2A 3EAKA 5DJXA 4J2XA 3GSNH 5DYOA 3UZEA 1AE6H 5J06A 3RIFF 4G6KL 3OKOA 1L8JA 4HIHB 3D0LA 3LB6D 2EZ0D 3IFOB 3MLZL 1N5YH 3NAAH 1U8LB 1FNAA 5FYJU 3FB8A 4U3XA 4WGWB 1T6VN 5AAWA 1BJMA 5DJXB 1T1WA 4K2UL 2WK2A 2BRRL 5DYOB 1XGYL 4HFUH 4M1GH 4ALAH 3OKOB 5ECJE 3D0LB 4P2YA 1FN4A 4DFIA 4ZNCD 3FB8B 4S1DD 3WS6C 1UM4L 2R2EA 1KPUA 1T1WB 4PRID 5HVWA 4DGYL 4BK5A 4PRPD 2F54D 4IJ3C 3WFHA 1WJ3A 1A6AA 3JV0A 4L9LC 2BVOA 2NY1D 3SBWC 1LDSA 2WP3O 1LO4H 5HYIA 2R2EB 2BNQE 3KR3H 3OAZH 1KPUB 2C4XA 2BSSA 3QEQA 1DBKH 4PV9A 4GH7B 1T5WA 1HKLH 3T2NH 4C59B 5IVXE 4LSUH 3EO9H 3WFHB 1A6AB 5A2IH 2BVOB 2A9NL 2IADA 1DBBH 4YHLL 1QFUL 5I1GL 1NLDL 1CK0L 1GYAA 3CFKA 5C6WH 2BSSB 3QEQB 1T5WB 3BD3A 2NX5A 3B9DA 4MZ2A 1DN0A 1O7SA 2IADB 3KPSE 3CFKB 3V4VL 1QUNA 4HWBH 1JPST 1KLFA 4MS8A 2Q7YA 5CEXA 4JY5L 1S9WA 2NX5B 4RFNB 1DN0B 3SDDC 2CK2A 4OCMC 1IAMA 4KDVA 2GI7A 2CUHA 2XQYG 4OM0H 5F9DC 2IWGA 5BOZG 1H5BA 2NQCA 2YPLD 2YHGA 2Q7YB 5CEXB 3WBDA 1S9WB 2FNBA 1T20A 3TN0D 3NCFB 4J8RA 4LL9A 1MRDH 4OZHF 1H5BB 4Z0BH 4YHNA 6FABL 1T20B 3MZGB 2PTVA 4R26L 3SE3C 2X2YA 4J8RB 2AGJL 5I15L 4YHNB 2VDRL 3N0PB 1JHKH 5D2LE 3OKNA 4H8WC 1CT8A 5DUML 1SEQL 3HZVA 4XCEA 3N85H 4LF3A 3BAEL 1YEIH 4LSSH 1MRFL 3OJDA 3OKNB 4XXCA 1HXYA 1CT8B 4OKDA 3UO1H 3HZVB 5D7SL 4K7PL 4XCEB 2H1PH 1WICA 2MWCA 1CL7I 4LF3B 3NGBC 1WCQA 2YKLL 3CU1A 3RHWK 5GZOD 1DR9A 3OJDB 1L9MA 4NQDA 1HXYB 4UB0H 1W72L 5B8CA 4L1HA 4GRLD 5FM5O 4YHKL 1NFIA 3OAYK 4BSVB 4MD0A 3KYAA 3QDJD 4ZD3L 4JO1L 5CIPA 2CDGA 3JWDC 5GGTL 4JFFE 2NY3B 1B90A 1JF5A 4NQDB 2OTUA 1ZA3A 2Y36H 5B8CB 5F1SA 5HDBF 3GM8A 4WNQA 1NFIB 4XC1L 4QTIL 3MZTA 4MD0B 4F15B 2AEPL 3PNWA 2WV3A 4O02H 4JQVC 5CIPB 2CDGB 3F5WA 1DLHA 1G9MH 4JGUA 1GSMA 4NCC1 2JELL 3O0RL 2OTUB 1HHKA 1ZA3B 2FJFA 1IVLA 2FHCA 4YPJA 4WUUE 4BH7A 4WNQB 4LLDA 3UZVB 1KULA 4FQ1L 4HS6A 5L9DL 3QUXA 1QRND 3PNWB 1BLNA 2W0KA 1XIWC 4MLIA 5FUZL 3F5WB 3V4UL 1DLHB 2OI9C 5DQ9A 5GIRA 5L8JB 3LKOA 5EUOE 4P3DB 1W0VA 1HHKB 2FJFB 4HV8A 2HFGH 4JKPH 4MGXA 1TPXB 1IBGH 4BH7B 4AL8L 4KI5D 4LLDB 2XXMB 4HS6B 4OF7A 4Y4KA 4FZ8H 3QUXB 1BLNB 3RU8L 4NCC2 4Z7WA 3RL2A 2DIBA 3QO0A 5DQ9B 3TPUE 1I3VA 5GIRB 1NGPH 1UJ3A 3U9UA 3LKOB 4MYWB 2VN7A 1W0VB 4KTDL 1A5FL 4HV8B 4UMGA 2J2ZA 1A14L 4Y4KB 3OX8A 5F71A 4GLRH 3ZO0A 4Z7WB 5JA9A 5F96L 3RL2B 3VGEA 2HWZL 1UJ3B 4P3WA 3HAEG 1IZJA 1G84A 5DQDH 2VDOH 4RGMC 2C9AA 4OM1L 1WT5C 2Y23A 3UDWA 2XNAA 3OX8B 4XVJH 2D7NA 3W11D 3MJ9A 4M7LT 3O2WH 1QACA 5TE4L 3F6LA 3VXSE 2AQ1A 5I1DA 1IRAY 5D72H 2E7LA 2W0FB 2DLHA 2NPLX 4OGZA 1N3NA 4ETQA 5GS1C 2YUZA 2HRLA 2XNAB 1KSRA 2I27N 4S2SA 5GISH 1YEEL 4DOHE 4YFLI 5BRZE 3UTZA 2CK0L 5I1DB 5JXED 5T3XE 3ULUH 3DRTA 1N3NB 5ABDE 4ETQB 2MCPH 4RMWA 2Z0BA 1H8OA 1B0RA 4XCFH 3ZE2E 4D9RD 3CLFL 4S2SB 3UTZB 3H2WA 3KWWA 4X6DA 1JV5A 4MXVF 2RCSH 2R2BA 3C5ZD 3DRTB 4O5LL 3OJVC 2DI7A 3CC5A 2CSPA 1OP3K 5IESL 4HKJA 3STLA 2AXGA 5ACMA 4KROC 2VXVH 3IS0X 4D0CA 3KWWB 4X6DB 1LO3H 5GSRA 1JV5B 3D48R 5KTEL 3QEUA 3WE6A 1MAML 3U6RA 2R2BB 2NW2A 1R0AH 3UC0L 4ORGA 5B3JE 5HSFA 2CO6B 5IFHL 3SKJL 3CC5B 3VWJA 4LGSB 4N0CA 4HKJB 3STLB 1J7VR 1FL6A 2AXGB 3QQ9C 5C0BD 4R7DA 3MLSH 5GSRB 2JCCF 3QEUB 3WE6B 3U6RB 1EEUA 2NW2B 5IW6A 1U6AL 3L5IA 4ORGB 1AD0A 3VWJB 2OX5A 1FL6B 3WIHA 4R7DB 4OFPA 3LQZB 1DLFL 2M8XA 4MA3A 5IW6B 5GPRA 3DETD 4KJPD 1AD0B 2E9IA 2OZ4A 3UBXI 3LKQA 1WVZA 1MJ8H 5KVEH 4OZIF 4NQCE 3ULSA 2V2XA 4M9PA 4MA3B 5FO8A 5HHPA 3ULVE 3KPRD 1JHLL 2XKUA 4U6TA 4KDTC 1OAZL 3LKQB 2MPAH 4QOKE 4HGMA 1CIUA 4OF0A 3ULSB 2V2XB 3ZE0F 3ELAT 2HTKD 5FO8B 2DLFH 2P43B 5HHPB 3QZWG 4R2GB 4Q9CA 2R0ZH 4MLSA 2WW8A 4H26A 4Q58C 3WDHA 5GZNC 3RVXD 3IDMA 4RRPG 3D39A 1YEKH 2P8MA 3MOBH 4OCRH 5HGBA 1S9YA 4H26B 4UI2A 1QPXA 4XNZC 4KVNH 3SDAC 1OSPH 3RZWA 1KEMH 3D39B 3PWUA 5KVDL 2P8MB 2I5YH 4J6RL 5C7XL 4XMLH 3S5LG 3JWOC 2C3XA 5I73C 4RDQG 5F7EL 5HGBB 1JNHA 3LEXA 3MNWA 1S9YB 3L3HA 5JUEH 3RBSA 1X5ZA 1AFVH 1GIGH 4UT9H 1A9BA 1TETL 5CEZH 1WEJL 1G6RA 1UCBH 1T04A 3PWUB 3S36H 3QCUH 4PJDA 4PJBA 1B4RA 1MCCA 1Q72L 4NDMB 4P5TC 1JNHB 3LEXB 4Q0XH 3MNWB 3L3HB 4QRPD 1PX3A 4JPVL 1A9BB 3FFDA 3WXVL 3RTQD 1G6RB 1T04B 2EYSA 4PJDB 1AHWC 4PJBB 1FORH 2IALA 1YQVL 1TZHA 2BSED 3C8HA 1DBML 3FFDB 5F1KC 3RAJH 1CLZH 4PB9L 2EYSB 4PGDA 3TO4D 1ZTXL 2IALB 1OQXA 2P49B 5TPWH 5FCUL 1TZHB 4LLVA 5HHMD 3SDYH 2R9HC 3S3PA 5KSAA 3S3JA 3GJFB 2QHRH 3M17A 1CXKA 1SM3L 4P9HL 5I1KH 4WEBH 4PJIA 4PGDB 5T1MA 3GMMA 5HYJE 1AY1H 2CRMA 4LLVB 1QG3A 5KANI 3ARBD 4R96A 3FT4A 5DZNA 4K8RD 3VH8A 5KSAB 3WJJC 3O8XC 3BUYA 3M17B 4WJ5B 5KS9E 4PJIB 3ZHDA 1EDQA 3BYYA 1X5LA 1A3LH 5T1MB 1HCVA 3W9DB 4A6YL 3GMMB 1Q8MA 1T7YA 4R96B 1Z0NA 4NQSA 3FT4B 3VH8B 5CS7A 5EU7C 4EN3A 2IBGA 4MA8L 4XZUA 3BUYB 1RY7B 4NP4L 4OD1L 4JZJC 5E95B 4KGLA 4OBRA 3BZDA 3R8BB 1RSFA 1BQHA 3RY4A 4F80A 3F12A 1UGNA 1ACYL 4NQSB 3PUCA 3UCRA 3O41A 4KUCD 4EN3B 4XZUB 4W81A 3F62A 2XI9A 2FJGA 1ZT7A 4XB8A 3WNOA 3MA7B 1BQHB 4UAOB 3F12B 4U1JA 5B3NA 4OGAD 3O41B 4G7VL 5HYQA 1FRGL 2Q8BH 5C0AD 5I19L 3QPQD 1TDQA 4JDVA 1P53A 4HHAA 32C2A 2FJGB 1ZT7B 3N1MC 2Q3AA 3BEVA 5GRZA 5EWIH 4U1JB 4IS6A 1KELL 1I9IL 5JOPD 3IU4H 5HYQB 4H20H 5MEOB 1EIBA 2G60H 4JDVB 4HHAB 32C2B 1BFTA 1TQBC 5DFVC 3BEVB 2VLLA 1OTUC 4L4TA 4IS6B 3HG1E 2YZ1A 1LP9E 1FBIH 1H3GA 4NUGL 3RA7H 4J3OC 4OT1L 5L6YL 2DLIA 1CDUA 3UPCA 5ELIA 2ZG1A 2W60A 5J6HA 1TITA 5E9DE 2VLLB 1IAII 4NKOA 3MLYH 4M62L 4NJ9L 1ONQA 4R9HA 3O6KL 3IXTA 4OLXH 2WBWB 2W60B 3VRLE 3DXAA 4J7RA 4PJCE 5J6HB 3CX2A 3MLVH 1S7QA 4NKOB 1E6OL 4MXWL 2GSIA 4WDIA 1ONQB 3KYKH 3Q6GL 3ARZA 5D8JH 3ERYA 3IXTB 2OL3H 1NCAH 1NCWH 2IFFH 3DXAB 4UV7L 3TESA 1S7QB 5I1IL 3BGAA 1ZLSL 3C2AH 3QWRA 4BKLA 5ALCL 2GSIB 4WDIB 3P11L 4LQFL 2FBJH 2A38A 4G3YL 3DTXA 3OTTA 3ARGC 1IC4L 1MFEH 5CJXA 3MOAL 2DB8A 3U1SL 1J8KA 3DTXB 1T80A 1EEZA 1DQTA 4GT7A 4C56E 5EO9A 3MTRA 1I3GL 1CGVA 1F8TH 5FB8A 4RX4D 3AY4A 4PY8I 3P0YH 2HT4D 2W1NA 2VLJE 4IRJD 1NFDE 2CJUH 1EEZB 5CJ8A 3Q1SH 3P0VL 4Y4FA 4UV4H 2RB8A 1ZSDA 1CFVL 5FB8B 1KN4H 1IILE 1FZKA 4KK8C 1M7IA 4NQED 3STZA 5EOCJ 2GW5A 4O9HL 1B2WL 4Y4FB 1S9KC 1ZSDB 2BFVH 1A7OH 2L7JA 1OTTD 3VG9C 5L88H 1M7IB 3STZB 4YGVA 2VB5A 2HT2D 5JW4R 2GJJA 1V7NH 4U1KA 1YNKH 1KIRA 4LCCC 1A7QH 4DFHA 3T0ED 5EB9A 1MFAL 3CXDH 3ZKXB 4LP5A 4HS8L 2AK4E 5FCSH 4YGVB 4KZEL 5DUPH 4KZDL 4D2NA 4U1KB 1KIRB 5DJAA 4NN5B 2P24A 4TN9A 1INDH 2B2XH 3GMQA 3EHBD 4DKFL 3C6SA 3UYOD 1JNNL 3PWVA 4XHJC 5E6IA 4HG4J 4MCZA 3X11A 5ADPH 4X4ZA 4HK0A 5D5ME 5DJAB 3CK0L 5F8QC 4GG6A 4MAUL 4PJ9C 4O2EA 2P24B 1C5BL 3UTPD 1S8DA 4G6JL 4MQTB 4YDLB 4R4FH 3BE1L 1IZKA 1RUKL 3HNTH 1MNUL 3C6SB 4PLKD 3THMH 5CWSA 3PWVB 5E6IB 4L5FL 4MCZB 1U3HD 5DF0A 2LTQC 4HK0B 4GG6B 4HLZG 4O2EB 1S8DB 2FGZA 3FQTA 3VXMA 4OLZH 4UILH 4BA8A 2GHWB 1T6WA 2NZIA 4JG1L 2EH8L 5B4MD 1X44A 4TTDD 3DI2B 3CMOH 4L8SA 3O9WA 3FQTB 2A2QT 1C5DA 3LEYL 3VXMB 3O4LD 4YHOH 1MFDL 2EE6A 3TJHD 3A6BL 4K94H 4L8SB 5KZCB 3QJFA 2AQ3A 2VLKE 2JJVA 3UJJH 4B7LA 4TSAL 3O9WB 2COQA 3T04D 4OF8A 1C5DB 3QRGH 4FQIL 3TZVD 4HWEH 1MEXH 3BIAX 3EOBA 5C08E 4P2RD 4P46D 1IM3A 4JHAL 3QJFB 4RMVA 1KJ2L 1PLGL 2GUOA 2JJSC 3KLDA 3WNMA 5EIQA 4YQXH 3BRFA 5KVMC 1ZE3C 5E5RB 3EOBB 4IOFD 4OCWL 4DJMA 2VH5L 1IM3B 5IF0A 1YZZA 2JJTA 5FUCC 2GUOB 3DX8A 3QH3A 5DT1H 4XPTH 3RX5A 3C60D 1F2XK 1FG9C 3RUGE 1Q9KA 1G9NC 3RVWC 5J3HD 1UZ8A 4FQ2H 3VE0A 3KJ4B 3ME0A 5IF0B 4Y19E 2FX9L 3DX8B 3QH3B 1ORQA 5A3IC 4EQ3A 2WUCH 2AEIT 1D5IL 1LO2L 5FF6A 1Q9KB 1UZ8B 3VE0B 3ARWA 3ROLA 1E4XH 5F9JA 3TFKD 2WY3A 5IBTL 4LP4A 3KS0J 1U42A 4FHBD 5EZOH 4LSTH 1ORQB 5JDJA 2CLVA 3MA9L 3BMVA 5FF6B 1Y6KR 4U6YA 1IGYA 4XHQA 3ROLB 5JZ7C 2D31A 5F9JB 2XZQH 3FO0L 4I77L 1CFQA 1AC6A 2CLVB 4ODSH 4Z7VF 4MJID 5DLMH 2W38A 1UWXH 1HE7A 1S9XA 3IDJA 3RDTD 4I3SL 1FGNH 4FXLA 1IGYB 4U6YB 5C6TL 3V7MA 3VMPA 1MI5D 1CFQB 4TYUA 4FNLL 1TJGL 5L2KE 2FH6A 4XI5C 4XPGH 1S9XB 3IDJB 1NBZA 2JB5L 3GBLA 3HNVH 3V4PL 5H37G 1RZJL 4YBQC 3T0BA 1YNLL 4DZBA 3Q6FA 4HKBA 2Z31C 1FP5A 3B9KD 4PJXA 2XTJC 2ZUVA 3MLTA 2MQCA 5D71H 2DM3A 4X5WA 1NBZB 1IGCL 4LVOB 5T3XL 4DZBB 2ZUYA 1UACL 4ZTOL 1CFSA 1R5WA 3Q6FB 4HKBB 4PJXB 3MLTB 1WV7T 1J10A 1A6WH 4X5WB 4FABH 4EDWH 2C3GA 1SBSL 4K7PY 1MJUH 2L0DA 4RFEA 1CFSB 1R5WB 3HMXL 5EOCH 5ID1A 3N1GC 2J5LC 4GXVL 4LMQI 5GS0H 5C09D 4RBPK 2YSSA 1A4KA 3HE6D 1CCZA 3ALPA 4RFEB 3W81A 2MNUA 2BY0A 1GL4B 4B7IA 1JRHH 5D7JC 5ID1B 3ARQA 1YECH 2PO6D 4UINL 5DMIL 3HNSL 1XFPA 5D93B 3U83A 5D6DA 2YSSB 4NZTL 2H9GA 1A4KB 2ARJA 4QRRE 3VRJA 2PXYA 1BD2D 4TUJA 3TBTA 5ANMA 3QUYD 4DK3A 4AEIH 2B4CL 4MA7L 3OGCA 2X4SA 4XNYL 3ALXA 3HB3C 2ARJB 2YEZA 1CL7L 2KKQA 4MMZC 5T1KD 3MLZH 3D3VA 1JFQH 2PXYB 3ZKND 1S5IL 4TUJB 3TBTB 5ANMB 2FHFA 4K2UH 3FCTA 3OGCB 1MHHA 1XGYH 2X4SB 1XCQA 2YEZB 5JHLL 2XT1B 4NHCL 5HI3D 5TE6H 3D3VB 3FB7A 4PGEA 3ULVL 4OZHE 2CXKA 5GS2D 1UM4H 5CZKA 3L7FA 2QTEA 1MHHB 2DQGL 4D9LL 2VLRA 5C0JA 4DGYH 1XCQB 3NACH 4R3SA 4Y2DA 1CF8H 1Q9OA 4PGEB 3FB7B 4Y1AD 4WI6A 2P5WE 5DURB 4TNWF 3L7FB 1HINL 3MLRL 5MEPA 1AO7D 1AGCA 1N7MH 2VLRB 5C0JB 4BELD 4R3SB 4Y2DB 2VNCA 2A9NH 5F8RC 1FH5H 4TVPD 1QFUH 4YHLH 1NLDH 1CK0H 2OQJA 5MEPB 3ILQC 3F7YA 1AGCB 5ICZA 3DGGA 1A6UH 2I07A 5K9QG 2CIKB 3RGVD 3AREC 2OQJB 1LE9A 3ARDC 3F7YB 2NY4C 4JG0L 4WTZA 1ZANL 5ICZB 5IWLC 3DGGB 5IFAH 1K9TA 2I07B 4UOW0 5D1QC 2JLLA 2VZTA 1EFXD 3UTTA 3VGAB 1N4XL 4AIZA 1LE9B 3TA3D 5GXBB 4NBZB 1UYWH 2FR4A 5J1AA 3HFML 1YN7A 4X6DF 5JIIA 4JPKL 1IEAA 5HDBE 1G7QB 1P69B 2ZCLL 5F9OL 4WO4B 5E8DL 3NBNA 2F58L 1GZQA 1IFHL 1QTYT 4XVSL 2OS7A 3UTTB 1Q9WA 4P9ML 3S97C 1MAKA 4AIZB 4JREB 1AR2A 2NR6D 4GKZA 2DQJL 5DC9B 5E6YA 1IEBA 2FR4B 5J1AB 1J8HA 3SJVA 1YN7B 3DRQA 3MCG1 3MV8E 5E56A 3WJLC 1ZWIA 1IEAB 2B20A 6FABH 5TQ2H 1EGJA 4WI5A 3BWAA 1OLZA 2X4RA 2ORBL 1GZQB 2X4OA 1Q9WB 4LPCA 1IAIM 5I15H 4GKZB 4LRIC 1IEBB 3KLHC 3U82B 1J8HB 3SJVB 1GOGA 3DRQB 4JHWL 2G75A 2CKNA 1ZWIB 3KS0H 3V7AE 3IDGA 2GJ6D 3BWAB 3G08A 1SEQH 2X4OB 2A6DA 3BPCA 2Y6SD 3KLSA 4MNQA 3MRDA 5E8OA 2G75B 1CGUA 3FOLA 1MRFH 2PYFA 2BMKA 3IDGB 1GGYA 4FQCH 5CZXD 1QYGL 1P84J 4GAYA 4A6YA 5JW5A 3G08B 5D7SH 2A6DB 4KKBC 4K7PH 3BPCB 1S7WA 2YKLH 4MNQB 3MRDB 5DMKA 5E8OB 3FOLB 3NA9L 4KK9D 2PYFB 2BMKB 2BOBA 4WFFE 4PY7B 4GAYB 3CX5J 1W72H 4A6YB 1YEFH 5JW5B 4OKVA 4P49A 1N64L 4DUXA 5BW7A 1S7WB 1EZVX 1VGEH 4XCCL 3CFEA 2F74A 1OP5K 5DMKB 1VHPA 4HAGA 2XZAH 3TPKA 4X6BA 2BOBB 5GGTH 4JRXD 4GKSA 4X7CC 1GGUA 1D6VL 4OKVB 3MRJA 1RIVL 2A6JA 4OJFL 3H9HA 4KTYA 3LDBC 2AEPH 2BSTA 2F74B 2EKSA 3CFEB 1FZOA 1I1YA 3FAXA 4JN2A 5SWSA 4DK6A 4X6BB 4NJAL 2JELH 4GKSB 2IF7A 5EPMA 5DDHA 3MRJB 2A6JB 5FAAA 1JF6A 1MWAL 5IROA 2EC9U 3H9HB 2BSTB 2EKSB 1FZOB 1I1YB 3NA4A 5SWSB 5FUZH 4MXVE 4U6VL 3V4UH 1DSFL 4Y5XA 1D5BA 2N7AA 4YBLC 4PJ8D 1P5VA 1QSED 5EPMB 1CD8A 2A83A 5DDHB 5C70A 4HUXA 4AL8H 1EAPA 4XTRD 2DMBA 4NKIL 1SMOA 3K1KC 3MV9A 3RU8H 4Y5XB 1D5BB 4NNXA 4X9GA 4Z7NF 2QR0A 4PJBF 1YC8A 3BP4A 2A83B 4P4RA 4HUXB 2WAHA 2XWBA 4U7SA 1EAPB 4N0YH 1OVZA 3F8UB 3MV9B 1RURL 4NNXB 3Q2CA 2QR0B 3QDAA 5MENA 1LVEA 2BNQD 1HEZA 2ESVE 4J4PA 3BP4B 1NAMA 4P4RB 2XWBB 3SO5A 4QHUA 1G6VK 3WNLA 5I1AA 3HUJF 1WISA 4QYOA 4G80A 3UTSD 3VFGL 5DRNA 1IGFL 5MENB 1HEZB 3F58H 1NAMB 2Y06L 4HT1H 2W0PA 1CICA 2VIRA 4QHUB 5I1AB 4OZIE 1YEEH 5T33L 4G80B 2EYRA 2R69H 1G9MC 5DRNB 4JVPA 5DJ0A 3CFCL 1OWRM 4PJIF 4N5UA 5J11C 4X6CF 4F9PC 5EOQL 4PRIA 3VXRA 1PYWA 1U3ZA 4DN4L 4N90E 1YEHL 1CICB 4PRPA 4K9EH 5DHXB 3ZE0E 2EYRB 5DJ0B 3B5TA 1Q0YH 2FSEA 3J8F7 4P59L 4PRIB 3VXRB 2JIXD 1PYWB 2CUIA 5JMRA 3HC0A 4U7MA 3RRQA 5H35A 3ZL4L 3EDJA 4OD3L 4PRPB 2DMCA 2F54B 3S96A 5C1MB 2NY1B 3O6FD 3D2UD 2A74A 2FSEB 3D69A 4JHZA 1MAMH 1UQSA 4LNVA 5K9KA 4OUUA 3UC0H 3TC9A 3HC0B 4ZNEE 5H35B 3FJTA 1QLRA 1FE8H 3S96B 2FD6L 3OAUL 4G9FD 3A6OA 4DKEH 4FFWC 1C5CL 1F4XL 1NL0L 2A74B 3D69B 4ELMF 1UQSB 1IQWL 5K9KB 3NCJL 1KCKA 4OUUB 5EIVA 1L7TL 4YJZL 5I8OL 4OCLC 3PWNA 3N1QC 2BJML 3PHSA 2DQIL 1QLRB 1FGVL 2WWKT 2DQDH 2APXA 1TTUA 3VW3L 3WFDL 3MRKA 4JO3L 1ES0A 2PKDA 4LK4A 3GI8L 4XAKD 5HVHC 5J12B 4POZD 2YPLA 2Y25A 3OHXA 3PWNB 5LAXA 2BDNH 2IGFH 3BESR 5B39G 5DD6A 5K9QI 3MRKB 1ES0B 1AQKH 1FAKT 1U0QA 2HP4A 3ULUC 2YPLB 4H25A 1JHLH 3OHXB 5LAXB 5DD6B 4OLYL 4WW2A 1WBZA 4OCXH 3QDME 5ILTL 1TMCA 1NDGB 2HRPL 4H25B 2A9MH 2WNGA 1YDPA 4WW2B 3V6OC 1WBZB 4XPFL 3W0WE 3VG0L 2CKBL 4NWTL 2HJFA 2WBJC 1TMCB 1R3LA 5C86A 3PP3H 2OK0H 2R23A 1YDPB 3AM8C 2A0LC 1UWEH 4LU5L 1CDIA 1B4JH 4UTAH 2HJFB 4PJEA 4BSWA 2F5BL 2BHYA 2CR3A 5KVDH 1R3LB 5C7XH 3JVGA 5D70H 5D2LA 4KK6D 5IMMA 2R23B 5F7EH 1HILA 4EUPH 4GMTL 1TETH 4PJEB 1WEJH 2HT3D 3IDYB 4BSWB 4H1LG 4OFIA 1IAIL 3QDJA 4XMKL 5D2LB 5BO1H 5IMMB 5E8NA 1VFAB 3SGJA 1Q72H 3CSGA 4HCRL 4X99A 1HILB 1HXMA 5IBLC 1NBQA 5FUOL 4LPXA 2Z35A 4JPVH 1H3TA 3WXVH 1YY9D 2C3HA 1RU9H 5E4EB 1LDPL 3QDJB 2ICWA 5E8NB 4I2XA 4XC3L 1KJ2A 1UM5L 4X99B 5D1XC 1AGDA 4KHTL 1HXMB 1BQLH 1MFNA 2Z35B 5E1AA 2QADC 1G1CA 4OGYH 3CGTA 1QRNA 1ZTXH 2G5BA 4JFFA 2ICWB 4I2XB 5FCUH 1KJ2B 1KV3A 4O4YH 3V5DA 1AGDB 3FFCE 1M71A 3BP7A 4MXQC 4DQOL 4NN7B 5E1AB 4GAJL 3QIWC 1SM3H 1N0XL 4LRNL 1QRNB 1F3RB 2ZUWA 4UZGA 2G5BB 3LPGA 1QHOA 1N6VA 4TVPH 3V5DB 4QO1A 4YGAB 2VZUA 1PG7X 2C3WA 3D5OF 1M71B 1RV6X 3BP7B 4WUUA 4EXKA 5JIHA 1IEHA 4XVTL 1CVRA 5C0CE 2QEJA 1WZLA 4RFNC 3GBNL 2VYRE 1X5JA 2BXYA 5HPOA 3BIKA 2HKHL 4F7MA 4I48A 4HUKB 2X4NA 4HDIA 1KJ3L 3RWJA 2IQAA 2FCBA 3QDGE 4MS8C 3TV3H 3TPUA 3I6LE 4U2ZA 1TENA 3Q48A 4WGVB 7CGTA 4R7NA 1UEMA 4X80L 1JI1A 2B5IB 4K23L 1EX0A 3BIKB 3QRFM 1MCJA 4F7MB 3CSPA 4I48B 1OAXL 2X4NB 2GAZA 1NCTA 1FDLL 4HDIB 3RWJB 2IQAB 1BWWA 2XZZA 1D6EA 2AXFA 2VXUH 3NCYP 3U30C 5JXAL 3HI1A 4R7NB 4GG6F 3SKOA 3CNKA 43C9B 4G7VH 3VD4A 2GAZB 3LH2H 2EH7L 4OF5A 5I19H 1FAIH 1OPGH 3LEVH 1D6EB 3SDDD 2AXFB 3T77A 3OV6A 3CVHA 3HI1B 2AJYH 5JORA 4I4WA 2AKRA 3SKOB 4DTGL 2UZXB 3BJLA 4Q6IA 4TNVF 1C16A 2VDLL 4OCYL 2JF1A 1U8PA 1A02N 2VXSL 5IB5A 4YX2L 4XPAL 4GRWB 3T77B 3CD4A 3CVHB 3NMEA 5JORB 4I4WB 2AKRB 4CL7A 2PR4H 4XP4H 4Q6IB 2VDPL 5D7KD 1QFPA 1C16B 1YMMD 1OARL 1U8PB 1L9NA 5CJQL 5IB5B 3CDGA 1UH3A 5GRVL 4XXCC 4ZSOE 5C0BA 4HWNA 3QO1A 4MD4A 2VXTL 3BIBX 4N8VG 4AG4L 1FLRH 1C7TA 1SEBA 3O2DH 4I9WE 4M62H 2OXGA 4P99A 1IKFH 5KOMC 3CDGB 5C0BB 3QO1B 4MD4B 5KW9H 3P4OA 2P46B 5T3ZE 1SEBB 4G5ZL 4MXWH 1WFTA 4ZOAA 3Q6GH 1PQZA 2RHEA 1T7XA 2AEQL 1X5XA 3P4OB 1EO8L 4HXBL 4KFZC 4ETYA 5I1IH 4XNMA 1KTLA 3ZT6A 1QZ1A 1ZLSH 3DSFL 2FHBA 1F02I 3KPRA 1PQZB 1SJXA 3VDAA 3OXRA 4G3YH 2OSLA 4YUEL 3TVMA 1NCBL 3OPZL 5L7XL 1TPXC 4XNMB 1KTLB 1QFWM 1WCBA 1OB1A 1K8IA 3KPRB 4JJ5A 5IGXL 3QUXC 1SJVA 5JIPA 3OXRB 3T1FA 2OSLB 5D2NE 2R0KL 1EUTA 3TVMB 4PLNC 1F2QA 3BPLC 1C1EL 2FEEI 1I3GH 1WCBB 3DGCR 4YZFF 1OB1B 1K8IB 2D9CA 4Y4KC 4JJ5B 4CMHB 5HYSA 3QG7L 1A22B 1NCDL 3T1FB 5IB1A 2H32A 4FFZL 5H2BA 2LQRA 2Z8WC 2KUTA 1T0NA 5HYSB 3HC3L 3S4SA 4X5LA 1XIWD 5IB1B 2H32B 1FNFA 4AQ1B 5CP3A 4YNYA 5DMJB 5H2BB 4HEME 2MCG1 2R8SH 4LLUA 3V8OA 5T1LD 5E99H 1X9QA 1T0NB 3L5HA 4GW5A 1MFBL 2YR3A 3QIBC 4HKZA 4HEPG 5I71C 5HXMA 3ARTA 3S4SB 1BFOA 1NMAH 4YNYB 4OCSL 1T89A 3MRHA 5BOPA 3SOBL 4LLUB 3RTQA 4QHNA 4GW5B 4HKZB 5DJ2A 4MVBC 12E8L 1BFOB 3OAYH 4PJXF 1JZ4A 1DTUA 4HLZH 3MRHB 3HI6L 5LBSH 4B5EA 4OZFG 2FLRT 3RTQB 4N9GA 4KZDH 4QHNB 5DJ2B 3TO4A 4YBHA 3ZTJH 3KDMA 1LHZA 3T09A 5HHMA 4PBXA 4WUKH 4JPIA 1QSVA 1JNNH 3BRDA 2YBRA 4NO5A 4N9GB 5FO9A 3QEQE 1EBAA 3CK0H 3VJ6A 1DFBL 3TO4B 1KENH 3TBWA 3KDMB 4G6JH 1RUKH 4GXUM 1XR8A 4HC1L 5HHMB 3ARBA 1MNUH 5CGYC 2Q8AL 4JPIB 1R5VA 3QFJD 4KVCH 4L5FH 2YBRB 4NO5B 4LSPL 2E7HA 3ZT5A 5FO9B 4YFDB 3VJ6B 3QHTC 5LXGH 3H3PL 1DQLH 3TBWB 4N0CC 5DHVA 2HVKA 4ERSL 2NX5E 3MLWL 4QRTA 5EUKA 4IRSC 4ZYKA 1XR8B 3ARBB 4P3CL 3SQBA 5IUSA 2WWMC 1R5VB 5F93C 3AB0B 4L8BA 4OQTA 3GMOA 2QJDA 5HYJA 1J0JA 5DHVB 2HVKB 4NWUL 4KROD 3N50A 3DO7A 4QRTB 5L2JA 5EUKB 4ZYKB 1FL3A 4RGNC 4OV6F 3U7WH 3AGVA 4WTXA 4L8BB 5IG7A 1MFDH 1MQ8A 5DD3L 4F57H 5HYJB 3DO7B 1U41A 1HI6A 1YYLH 3QQ9D 5L2JB 5GRWA 1FL3B 4FQIH 4FQPA 2NTFA 2O5ZL 3LKPA 4ZXBC 1J86A 1N0LA 5IG7B 4OV5A 1VPOL 1HH6A 1I9JL 2ICEA 1I8KA 3PWLA 2DN7A 4JHAH 5JTWA 1PLGH 2PW2A 3QXUA 1HI6B 1KCVL 2VO5A 1ZMYA 2NTFB 3LKPB 5KAQF 1NMBL 4I0PC 4OV5B 2G5RA 1HH6B 1V3JA 2ZPKL 6CGTA 5GJSL 5I1HH 2ICEB 1I8KB 1P7HL 4MJ6A 3PWLB 3W39A 4WI4A 3ZKQD 2PW2B 1JCKA 1M7XA 1OT1A 3PQYD 5FYLD 4LARH 3PF2A 4HXAL 2ZCKH 3HZYA 4WWKC 1UT9A 3MRCA 2FATH 5HBBA 4KUZL 4MJ6B 5IB2A 3GHEL 3W39B 5I1EH 3G5VA 1RULL 4GAGH 2FX9H 4IOIA 2IPKA 1A7PH 4OBSA 3TF7A 1OP3H 1ZT1A 1D5IH 2NY5H 1NC2D 3HZYB 1JZ7A 3MRCB 1FL5A 3TCLA 1DP0A 3MV7E 5IB2B 1RK1A 1I1RA 3G5VB 1EMTH 4PJ7A 4IOIB 2IPKB 1BIHA 5GZND 4NQDE 2AXHA 3MA9H 1ZT1B 3BMWA 5BXFA 3S37X 2GK2A 1FL5B 3TCLB 3NTCL 4JFDD 2YK1L 2IPTH 3V5HA 1RK1B 5ESVA 5JDSA 3FO0H 4PJ7B 2VR5A 4Z78A 3SDAD 4ONFH 1Z3GL 3CU7A 4S1QL 4Y16C 5BXFB 1YUHA 1SY6A 4XRCA 1A64A 4TULL 2X9XA 15C8H 3V5HB 5ESVB 5JDSB 3VD3A 4U1LA 3TT3L 2W91A 4QRQA 1DZBA 1YEGH 1SJHA 4PLJC 4M5ZL 4Z78B 4U1GC 1TJGH 2EDKA 1FHGA 4ZAKA 1YUHB 1YYML 4XRCB 2V17L 3V4PH 1RZJH 1UWGL 4P5TD 1OW0A 4U1LB 1JPGA 4QRQB 1SJHB 3KPMA 1OM3L 4ZAKB 3LN9A 4L3ED 1JHTA 1QQDA 2VZ1A 1I8MA 5SV4A 3DWTA 5T3XH 1JMXA 4IRJA 4ODVL 4ZTOH 1JPGB 4NZDA 5MI0B 3KPMB 4KAQL 4JFZL 1HYRC 3QQ3A 2ARJQ 2NLJA 3MROA 1K3IA 1QBLL 2D03L 4M6OH 1SBSH 4HD9A 5DRXA 1JHTB 1QQDB 4PG2C 4NM4L 1I8MB 3ZLQC 5ERWA 4IRJB 1N6UA 1A7BA 2FO4A 1I7RA 4M5YL 4K3DH 3HMXH 4JFQA 2R9HD 5E5UB 3QQ3B 2NLJB 3QQ4A 2YD7A 2NTSP 3QEGL 3MROB 4QHKI 2VLJA 5DRXB 4Y5VA 4YDIH 4Z95L 5ERWB 2FO4B 1I7RB 4YE4H 4UAOC 4QGYA 4JFQB 1XCTA 5M95B 2E6JA 3NFPA 2GFBA 4UINH 5CILH 3O8XD 3H7LA 2E7LE 1E4WL 5E5MA 4ONGL 3QQ4B 3BQUC 5EULV 3C09B 2VLJB 4FRWA 4NZTH 1H9VA 4Y5VB 2JJUA 3WFCL 4UBDC 2F8OA 4BUHA 1XCTB 4XPHL 3NFPB 2GFBB 2XN9D 4LAQL 2B4CH 2XTLA 4MA7H 2NCMA 5E5MB 4CADA 1AXTL 5I9QC 1GGIL 1PFCA 1N59A 2R0LH 3S6CA 2Y1VA 4MB3A 4PG9A 1FIGL 4ENEC 3LD8B 4E9LA 4X6DE 1I9RH 2DQHL 4DN3L 4F7TA 4AY0A 1RJZA 3EFDL 2VLKD 2NY6B 1N59B 4NHCH 4JFED 1ITBB 2AK4A 3ULVH 4PG9B 1UB5A 3TM6A 4HK3J 2Q1EA 1U3HA 5EC1A 1RJZB 2DQGH 3U2SA 4D9LH 3E8UH 1M05A 3HAEA 1A0QH 2AK4B 5BQ7A 1UB5B 5DS8A 4UDUB 1IGTA 1GRWA 1CR9H 2IANE 1BHGA 1X5YA 1T83A 2YOCA 4I3RL 1U3HB 5EC1B 3U2SB 5GS0C 3GRWH 4PRNA 2E6PA 1M05B 3AU1A 3NPZB 2AEWA 3HAEB 5HDQL 5DFVD 5BQ7B 5DS8B 3O4LA 4R97B 1OTUD 1IGTB 3BN9C 3RWEA 4G8GD 2EKJA 3IFLH 3SGKA 5HHXH 1OOAA 5IQ9A 4C54A 3TJHA 3MQIA 4PRNB 1ZEAL 5CLWA 3DBXA 3AU1B 1NAKH 5JOFA 4YO0A 3O4LB 3TZVA 1JP5A 3RWEB 2O5YL 5EBLA 5IQ9B 2DQEH 2ZZUT 4JG0H 1ZANH 3DBXB 1V7ML 3ECBA 3O2VH 5JOFB 2P44B 4YO0B 4HCRA 2XKNA 3TZVB 1MCPL 4M4PA 3GMPA 3ZKSD 4KRPC 5EBLB 3HFMH 1A21A 5F1IA 5F9OH 2ZCLH 3ECBB 3QUZA 3GHBH 4OFKA 4F2MA 2F58H 1T0PB 5A2LH 1IFHH 4XVSH 3TYFA 5CEYA 2XKNB 3C60A 2UZIL 3WHE1 3V0WL 5C08A 3GMPB 5KOVC 1RUMH 2NY7L 1QSFD 4J1UB 4LVNC 1F11A 3D39E 1OAQL 4YXKH 1P7QD 4L8DA 2XY2A 4WFED 4NZUL 4WI7A 4YLQT 5F1IB 5A2FA 3QUZB 4F2MB 2ORBH 3RWDA 3TYFB 5CEYB 3ARGD 5E2VL 3C60B 4DGVL 5C08B 5IMLA 1CTNA 3X3FH 3DI3B 1F11B 1E4KC 1KB9K 2ICES 2KZWA 2QSVA 4L8DB 3DYPA 1FC1A 1EEYA 1ND0A 3RWDB 3N1PC 1JMZA 5GRJH 3TH3T 2ZKHH 5IMLB 2DJUA 1RMFL 4Z7NE 4Y19A 4Z0XA 4PJBE 2FYYA 5ENWA 1QD0A 1EEYB 1CZ8L 1ND0B 2YD6A 2O5XL 5AWNL 5FYKD 5TJWK 1KCRH 4MJIA 1JGEA 1WZ1L 1CGSL 3RVVC 3L5XH 3TWCH 2SEBA 4ONHA 3ARRA 4NN5C 4Y19B 4Z0XB 1R3IL 4UQ3A 2FYYB 2XV6B 4BFBD 4X4YA 3NA9H 5ENWB 2EIDA 4KK8D 5HHQA 5FM4A 5CCKL 3IRPX 3P30H 1I3RA 4LSRL 3QZWA 2NY0C 4MJIB 1JGEB 5T5FH 1N64H 4HUMB 2SEBB