5SWSA

Crystal structure of np2-b17 tcr-h2db-np complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
277
structure length
273
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGELTQDMELVETRPAGDGTFQKWASVVVPLQNYTCRVYHEGLPEPLTLRWEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Reversed T Cell Receptor Docking on a Major Histocompatibility Class I Complex Limits Involvement in the Immune Response.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 55
structure length 273
sequence length 277
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swsA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5swsA01
1CFSA 1HXMB 2MPAH 1KIPA 3CLEL 4QT5A 2DQFB 4YHZL 3TWCL 2VDRL 3WD5L 4IIQA 4P2RD 1N7ML 3CFCL 4MAYA 3L3GB 1CICD 1P9MC 4OF5A 4F7TB 2DQJH 4FQXD 4NNPH 4NBYB 2V6HA 1KNOA 3UYPA 4IDJH 5C9JB 2F54D 5A2LH 2CDFA 2VH5L 1VFAA 3PGDB 3U1SH 4B53A 2X4UA 3P9MB 3MBEA 4KJWD 2V7HA 1DUZB 4O2EB 4KMQA 4NJAL 1MELA 3SJVB 5HDQL 2DKSA 3FONB 3W0WE 2ZNXA 1LGVA 2HLFD 1NC4D 4Z0BH 1QD0A 2VDOH 5KSAA 1G0DA 4TTDC 5DJCB 3BT2L 1YEJH 2EEAA 4PJXE 4UAOC 32C2A 2UV3A 5D2NB 1EO7A 1KPUA 4GS7C 1OAZH 4KK8D 2B0SL 4HIEB 3QDJA 3I3EA 5H2BA 3IGAB 3GM0A 4AG4L 1A6AB 3B9VA 4DW2L 1R5IA 5I8EB 4Q9QH 4LVOC 1T21B 2IQAB 2PO6C 1WQVT 1FC1A 2XICA 3NVQA 4E5XA 4YXLH 3BP6A 1RJLA 4YDIH 2DIAA 3NTCL 5DMIL 3QWRA 5IVZA 1WEJH 1UB6B 5HTSA 3MJ7B 1JWUA 1GH7A 1MIML 5GJSH 2JE8A 5I66A 1BWMA 5HHPB 2D9CA 1U8JB 4PJCF 1XIWA 1HHIB 3ARZA 4RNRB 4GW1A 2DQGH 3QFDA 4FQIH 2VOTA 4HEPG 1JNLL 5KANI 4DJMA 5EOCL 4IRZL 1J0KA 4PGBA 4EVNA 3KG5A 2HKHL 2E9BA 4YFDB 3HI5L 1FYTA 1QR1B 1ZHLA 1MIEH 4R4FH 4RFOL 2VITB 4OF7A 3T3ME 1INEL 1WBXA 3P0YL 3EGSA 4M1DL 4FXGB 1FL6A 2G2RB 4KQ4H 5T5NF 4C56B 2FHCA 3MRJB 1FNSH 2BNRA 5F97E 2DJ4A 1FH5H 4K3JH 4BSWB 5MHSE 3V6OA 2FH8A 2OMNA 2C7UB 3FT2B 3LEYL 5JW5A 2D31A 3MC0A 2FGWH 3W2DH 1UZ6F 4BH7A 5LJYH 3KNBA 5HHNA 1U2CA 1CDJA 4YGVB 2RFXA 1QBLL 2D03L 4QWWD 5DJ0A 2VDML 1JP5A 2AAVA 4MB3A 1IAOA 5TGBA 4NUGL 2XACC 2CKNA 5DR5L 1CXLA 1ACZA 1RJZA 2Z31D 3ZSSA 3O41A 3B6SB 4Z7UA 5K9JL 2VN7A 3D85B 1NCUA 4XP4H 1DBJH 1C7TA 1YPZB 4FTVE 4KHTL 4HT1L 4HMEA 2YA2A 3VDCA 4PJHE 1MCIA 4RDQF 3M1BB 2EDRA 3OKYA 4OI9A 5C2UB 4UUJA 3IKCA 2DYPB 2VQTA 1AGBA 1U93A 5GZNC 5SWSA 5JZ7C 1ZSDA 1MWAA 1MCLA 3I9GH 1OLZA 1FFQA 1YMMB 3ZO0A 5JORB 3HNTH 1H0DB 1OLLA 4I77L 1I1RA 1YEHL 5TE7H 1FO0H 3MRIB 2D7OA 2J88H 4YHIB 3SE4C 1MOEA 2P5EA 3MACH 4P59L 5E99H 4BUHA 2R2BA 4U7MA 4OLVH 1EFQA 2OTPA 5LGJB 4PR5A 1PVHA 2J1KA 5DYOB 4M6MH 2L0DA 4OCRL 4KTYA 4X7SH 5TJWK 4MQXD 1A0QH 2X4SA 3GSXB 3OKMA 5D1XA 4H25B 5CP7A 1QRND 1NFKA 5DHVB 1NBVL 3ARQA 4PTTA 2V5TA 5F6HI 3W0WA 4LCIL 4Q9BA 1HYSD 4E41E 2C3XA 1OAXL 4YXKL 4QY8B 2Q3AA 1GCFA 2JCCF 5HI3C 1T7VA 3ZE2E 4OD3H 4YFLI 4PJXA 3TO4D 5KSBF 3SDAA 4K8RD 1K4DB 4Y8DC 1VENA 2XKNB 3CSYA 3OPZH 2AP2A 5HYQA 2X89A 1QFOA 1FRGH 1R3KB 5AWNL 1E6OH 3CD4A 4ZTPH 5BCAA 4UOW0 1N0LA 2ZG1A 2WP3O 3QIWC 2P47B 3U0TB 2OCFD 4YZFF 1H3TA 4QOKD 3BPLC 1P4LA 1WTLA 2Q20A 2AJXH 4JJ5B 5F9JB 3E6FA 3VFMA 4PJEB 1MCBA 3C9NB 3P4LA 1P9MA 3QISA 5KG9B 4UAOB 4KJQD 5HPMA 3U46A 5EUOF 3TN0B 1R3HB 3RL1A 3BGMB 3EDJA 3T8XA 4CJ1A 1LO5B 4BELD 4LVOB 1TZIB 4X5XA 4ZAKA 3BOVA 5HI5C 5FDWB 1K8IA 5BOZG 2VSDA 7FABH 5ELIA 3CH1A 1VFMA 2R2CA 2W0FA 3SDCC 1UA6H 2E7CA 3KJ4C 3EO0B 4PGJA 1DN0A 5D2LF 1NFDF 3T0XA 3HI6H 5DD3H 1AY1H 1MLCA 3IFPB 2APXA 5KVMC 1ZHKB 2WLYA 4F57H 1JMXA 2XZCH 4OFVA 3WFZA 2CK0L 2IAMA 5CP3H 5EZOH 5I1LB 1TJHH 4HCRL 5CGMA 1E4XL 1X4XA 3S88L 2RB8A 3LQZB 5F1NA 3MV7B 1B2WH 2Y7QA 1OW0C 1L9NA 3D2UD 2DM2A 1J1OH 4UINL 4JQXA 4GOSA 1MVUA 3VWJC 1JGDA 3K2MC 1FNLA 3MRCA 3MZTA 5DGQA 5ICXB 2B7DT 4WFGD 3RDTD 1NAKL 3NIFE 4OF6A 3RKDD 3X3FL 2FO4B 4M1CC 4OKDA 3FFCE 4FTVA 4S0SD 1RZGB 3TV3L 1HHHA 5EO9A 1UVQA 5DD1L 1P6FA 5GJTL 1JGLL 2IBZY 1P7QD 2P46B 4PJHA 2H26B 1JGVL 3CUPB 2Q8AL 4Y16D 3QA3B 2WUCH 4LGSB 1UQSB 3EYFA 1RVFL 2IALB 3BZFB 3OAUL 1A7QL 4OAWA 4X6EA 4ZUTA 3WHXA 5HYJE 4J4PC 5C0BD 2J8UF 4CDHA 4GAJH 5IVNA 4JY6B 2CDEB 1UM6L 2EDXA 2NY5L 2C3GA 2ZCLH 4YX2H 1N6QH 4PG2C 1GAFH 1ZEAL 3NCFB 3VXOA 4FFZH 1DQDH 4I0KA 3K7UA 1TMCB 3X3GH 3LOWA 3F7PC 1NC2A 4CW1B 3CFJA 1CD8A 4F7EA 4RZCB 4YPGB 4JFHE 1JRHH 4WWKC 2XG5A 3BZEB 1AGDB 2GJ6B 2IMMA 4TVPL 4E41A 3BP4B 2VXQH 4RMVA 2VQ1A 1XF5A 1QSED 5IHUL 5FKAA 3FL7A 2ICES 4G9DB 4U1IA 5E9DB 4LDEB 4MDJA 2R4SH 3HE6C 4Z5RB 5E8EA 1I3RA 3BXNA 4GW5A 4LLDB 3D39B 4UIMB 1K6QL 1MAJA 2APVA 3PXHA 3WEXB 3FQUA 5J1SC 4RIRA 3WUWA 1WWAX 5C0NC 5IMMA 5I19L 4S1RL 4W81A 4WU5B 15C8L 4OLZH 5D7KE 4N8CL 4LMQE 4ZS6D 1FFNA 4YBHA 1ZLUH 4JM4L 5DD5L 2C3VA 3W39B 4Z7WE 1WBZA 1A6UL 1FZMB 4GG8B 4NKOA 4X7TB 1YYMH 5DEZA 3L3OB 4MD4A 3X11B 2BVYA 4C59B 5FK9B 4YXHH 5F3BA 3L6FA 1JN6A 1IGYA 4JPIB 3ARBA 4I5BA 5F7KC 1FYHB 3BZ4B 4S2SA 3EDKA 1A9BB 5BO1L 2O5YH 1CD0A 2W91A 1JWMA 3JTTB 4KXZI 3OXRB 4GW4B 3KGRA 1WBYA 4Z8FH 4TVPE 3UTTB 3QIWB 3U9PL 4H0HB 4HJ0C 2X4RA 4AT6B 2X4PA 4DCQA 5F7UA 1D5XB 4JVUA 1KOAA 2PR4H 3TC9A 4KJPC 1VGKB 5DUMH 1EO8L 2A6KA 3MLTB 3P11L 4PJ5E 3IAGC 3BWAA 3QUYA 1HHGA 4HJJL 4P3CL 4P5KB 1WFUA 1KJMA 2ATKA 3VXTA 3QDGB 2DQEL 3ARFD 4Y4KC 5GS1C 1A7RH 1SYVB 2EKSB 1LO4H 3MNVA 1F4WL 2IANE 1D5MA 4HUVB 3O4LD 1TJGL 4PPTA 4JHWL 2Y25A 4HF5H 4LRNH 4P2QD 2BY2A 1Q94B 5EU5B 2VZ1A 1S5HA 1C12B 2ATPA 1F58L 1N5YH 3VFGH 4ZPVB 1EGJH 2MQ3A 4GBXB 1BAFL 3SDCB 2QQKH 3WJJA 4PJIE 3DRTA 3M17A 4MNHB 2FZ3B 3QUZA 1AJ7L 1EEZA 4LCCB 2O5XH 2WIIA 1IGML 1BQLL 3HPLA 3BH8B 3GMPA 2BVUA 4LKXA 4PG9B 3JTSB 5F7FA 4F7PA 5KJRL 4YHLH 4L8CB 1CT8A 2Q86B 3ULVF 3BKML 2RCSL 2EE9A 3X13A 1ED3A 2ED7A 5TQ2H 3INUH 4P46A 4NZDA 3QNYB 1ZWIA 2F19L 3NCYP 2E27H 4D9RE 1U8QA 2AJZB 3PHQA 2BOCB 3JUZA 2Z8RA 5HYJA 3OKOB 1PX3A 1FJ1A 3X17A 4FQHB 3OKNA 1JMZA 3SPVA 5D5ME 3V52L 4JPKL 1X6LA 2X1XR 2A74B 1HSAB 4MD0A 4HCRA 5F96L 3QYCA 1FIGH 2HFEB 4I4WA 3QEUA 5FA4B 3N85L 2BRRH 4H20H 1MFDH 2X5PA 3QCVH 4I0PB 5HHQA 5IEKB 5DMKA 3BIAX 5GS0L 3CDFA 3IXTB 1IT9H 3V7MA 3DTXB 2CXGA 3GSNB 2DWDA 4WUKH 1U6AH 5IIEA 1X7QB 3EFDL 1IC5H 1KLUB 2Q3ZA 1CGTA 3I6GA 2Z91A 2VLJB 4Z7QF 4WUUB 4HG4K 4HAFA 4PP2A 1BFVL 3MREA 3VXNB 4U6HB 4Y8AA 4OD1L 3LPWA 5IF0B 4L3CB 2Y5EA 1I9IH 4BSVA 2BOBB 4BQ6A 2G5RA 2YD6A 3ET9F 5J8OA 5D1ZD 2JELH 1U8PB 3GMQA 4KDVA 4CU7A 3LKPB 4NRXB 1IBGH 3CSPA 1SBBA 3BDXA 5GRJH 5E4EC 1KLGB 4FQCL 4Z7WA 2N7AA 4NO0A 1IEAA 5BJTB 1AHWB 3QCUH 3RAJH 3LN4B 1PDKA 1A14H 3OKKB 4WRLA 4J3TA 4NZUL 2ZCKH 3VGHA 3HE6B 1S78C 3A6BL 4OGAD 5IB2A 4Q97A 2BNQD 4PRAB 5ALBH 5EBWA 1OPGL 3GMMA 1MJ7L 3P9LA 3GSWA 3CJJA 4WWKA 2VLKE 4XVTH 5KW9L 1V3LA 4L4VE 3RIAF 1EBAA 3TNNB 3KPLA 1RZIA 3WV0A 5L6YH 2AV7A 3MJ8B 2Q87A 5HVHB 1AXSB 4EUPH 1U91A 2FJGB 4PJ5A 3AY4C 4MD5A 4PREA 5J6GB 4QRPB 3CXHK 3J7HA 4JFYB 4JPWH 3B5GA 5IEHB 5MEPA 3H9YA 2E8ZA 1HZHL 4QRTA 4OI8A 4APQD 4K55A 4F15C 4G7YL 3OF6D 4N1HB 2IANA 3WL9A 3TVMC 3Q5OA 2ESVE 4P3WA 2WK2A 5D1QD 4JE4B 3C60C 4LBEA 3VMNA 1AGFB 1JHLH 5IM7B 4ZXBD 1AI1L 4ZFZB 2G60L 3QXAA 2VLRE 2OP4H 4PJIA 5T1LD 1G7QB 4MLSA 1WWCA 3KYNB 3G5ZA 2DQDL 4OCNC 4JR9H 2HMID 3MA9L 3G04B 2PF6A 4F80A 4F9PA 3FB5A 3MOBH 1HSBA 4HGWA 3PWNA 3IDIA 5E8OB 1AXIB 2F9BT 3S37L 3FB8B 3LZFH 3O3DA 5MEOB 1J1XL 2K1MA 4ZFGL 2EDKA 3CSGA 3EOTH 3PIQA 4YDVA 4OFYA 5FYJU 2FLRT 3KLAA 3VFNA 3ZYOA 9CGTA 5ENWA 3LKNB 1MRCL 4OIAA 4WI2A 1FAKT 1T66D 5EZLA 4NJ9L 4XNYH 3BPNC 3SBWA 3IDJB 35C8H 5L2KB 1RUAH 1CS6A 1YYLH 4JFZL 5E5MB 2G75B 3BKCH 3HB3C 5D5MA 1NLBH 3LHPL 3NFNB 3T65B 5GSVA 2V5SA 1MI5A 4Y4KA 3GJFH 5CJOL 5GS1A 1FZOB 5KVGH 4OV5A 5ILTL 5GZOD 3DGGA 4JQVA 5DO2D 4JFEE 1J5OL 5DS8A 3RWFA 4GXVL 2A0LC 1TQBC 1CICB 1QLEH 3N1MC 1ZOXA 4O4YL 4NN6C 5LBSL 3T0EE 3C6LA 5F7WC 4HQQH 2DLHA 3UO1L 1T2QH 5DK2B 5I75B 1NQBA 5LCVL 4UIKL 4EDWH 1Q9OA 1DQJB 4WJ5B 4PRBB 1PSKH 1U3ZA 1WWWX 1CDIA 1MPAH 3K2UL 2V7NA 4ETQA 5IFAL 5JLZB 1FL5B 3LCYA 3SE8H 5D6DA 4YHML 5IBTH 3QH3B 2A6DB 4A6YH 3ME0A 3HRZA 3CX5K 1BZ9A 5LGHH 1DUYB 5F1OB 4HX1A 3QQNA 4O2FB 3TYGL 3M8OL 4KVNH 4LRIA 1P5UA 5FM5O 1CLZL 2AJSL 5ESVA 4MA1B 2ZPKH 3G6JE 1TDQA 5IB5A 3HPJB 4M7LL 4XC3H 3L7EA 5IB4A 3IS0X 2WLZA 4H8WH 4QTHA 2GITA 3MRGA 4X7FC 3RI5K 3U7WH 4WEBL 4NM8H 1E27A 3QI9C 4PD4K 1HXYB 2ICWA 1L0XA 1WCQA 4K7FB 4ZO8A 4N0CC 1E6JH 4OGZA 25C8H 4RWYL 3EO1A 1HN1A 1YEDB 3Q5YA 3BEWB 5HXMA 3HAEA 1OARL 4B7IA 4GRWH 3K4DA 1XGYH 1Z5LB 1QLFA 4M7KH 4R0LA 3ZSTA 2M26A 2MJWA 5J1AA 1UEMA 5I1IH 4FQQA 3MGAA 5IG7A 2UZYB 4KKAC 1HKFA 1ZA3A 5DQJA 5IR1A 4FHBD 1RIUL 3C87A 4DKFL 2NTFB 2VLKA 3K8KA 5DURB 4L4VA 1CDHA 4FG6C 3SDXE 1MLBA 1ORQB 4ORZC 5L0QB 1WCBA 1B0RA 3WS6C 4ZOEA 5LWYL 1LK3H 2MHAB 1H5BA 5HHOD 1SQ2N 2XWBA 3BYYA 3QWOB 3VI4E 1B0GB 4K9EC 2IWGA 3S35H 5BZWA 3H9SE 3ULUL 3ZE0E 3BN9D 2AXHA 4K7PH 4GUPA 5F9WC 1LEIA 4OZFA 3RNKA 2ESVA 2GKIA 4WHCA 2YUXA 2IADB 1QNZL 5D7SL 3ZDZE 4KROC 1VERA 1HDMB 4EN3C 4MS8C 2VLRA 5IP4A 3DBXB 1AC0A 4NSKB 4NFCA 2BC4A 3KYOB 3NIGE 1M7DA 1AP2A 2BNUA 4ZTOH 5CBAA 1NGPL 4LIQL 1A5FH 3HE7C 3JWNC 4NRYA 4LSSL 2WZPD 1WC7B 2Z31B 4EDXB 5FYLH 5AUMB 1XCTA 4MQTB 2R9HD 1DVFC 1U8MA 2R29L 4G59A 3STLB 3V5HA 5T3ZL 1SEQL 2QBWA 3L3IB 3RWGA 4UDUB 3FO1A 5EOTA 5FO9B 3DV4B 4XNXH 3NPSB 2OI9C 4HUMB 2J3SA 4HIHA 3GMRB 5FUCC 3FN3A 2GY5A 1QBMH 1OB1A 4W6YB 2ZUUA 2IPTH 4G6ML 1S5IH 5J1TC 3KDMA 3ULUE 4E42B 3I6KA 3WFBL 5IFHH 1GPOH 4XCYA 1U8KA 4KTEL 4K3GA 2QKIB 4JFEA 3EHBC 3TVMA 4GG6B 1EUTA 5LKNA 2NX5D 4ZQKB 1U8NB 4LU5L 3T0EA 3C60A 5C7XH 4XZUA 1IC4L 1RY7B 1VKXB 4HJGA 4GQPH 4UOJA 5FAAA 5C07D 5B39A 4U6YB 4OLXH 2HWZL 1MFCH 2EO1A 2R1WB 1NDGB 4LIQE 3I6LE 4NM4H 1QRNB 3KXFE 3UPCA 5SX4I 3CCHB 3FQTA 4M61A 1RIVL 3TO2B 3S3PA 1FDLL 3HZYB 5I1CL 2JF1A 2X10A 1QBBA 5B8CB 1ZA6A 2ED9A 3BQUA 5I18L 3RVXD 3VXMB 2AEPL 4ZSOB 3MODL 4JN1H 4PJBB 2OZ4H 3OJDA 3V4PH 5T3ZE 1HHJA 3FB6B 4CU6A 5GSRA 4CAGA 1T7YA 3AU1A 3G6JA 3VXRE 4S1DD 1TQBB 5I1GH 4NN6B 5FIEA 1KT2B 4IHOA 1OAQH 4NUJA 5I8KL 1QO3B 1A47A 1S9WB 4FQ1L 3TNMA 4HXBH 2X1PA 4JLRA 4U1NA 2GK0A 4DEPC 2EDFA 4ODWA 3GMOA 4LNVA 5L9DH 1KCSL 1GYAA 4KPHH 2C1OB 4JFPB 1E4KA 3VFSB 2H6PB 2E5EA 4MDIA 4OZHE 2ZG2A 3PF2A 2NPLX 5C09D 3UJJL 3V5KA 4J7RA 4ZDHA 4BSJA 5CLWA 1BLNB 3K1DA 4LLVA 1S9YA 2NYYC 4NKDB 3VD5A 1ZLVK 4EOWL 1KCVL 4WFEE 2FIKB 3IFLH 1II4E 3SDXA 3QHZL 1TJIH 2JKXA 43C9B 5GGQH 4N5UA 1WICA 3MO1B 3MXVH 3ALXA 4I18A 4PGCB 2QSCL 1Y6KR 3F58H 1ACYH 2PTTB 2OS7A 3JWDL 1DQML 4XP6L 1U3HB 5CUSH 2AEQL 2BVEA 2AJUH 3O8XD 2ZG3A 3UTPE 2YHGA 3H9SA 1F3DJ 5INDB 1UM5L 2DQHL 3RBGA 4RFNC 4YE4H 1P4IL 3C5ZD 1S8DB 3GHEH 2FHBA 4PY8J 4UILH 5I0ZA 1W2KT 4F7MB 2E7BA 4LSRH 3BYTA 5INCB 4QNPE 4N0UB 1VGEL 3BIKA 3LSOA 1QOKA 4HIIB 3E1F1 1K5NB 3QQ3B 5FHAL 4OGXH 1OAKH 1FLTX 5DXWA 4JO2H 2FX9H 1RZJC 3D18B 3SGDI 1CR9H 5JR1H 1A6WH 3MLRL 2FATL 1AQDA 1IGJA 1RZJL 2CKBB 3RDTB 5DRWA 3OJ2C 3DX8A 3GEWB 4F2MB 4Q2ZB 3WUZA 5F89B 5T3XH 4HIJA 2QHRH 5F8QC 3PWUB 1P7QB 4ODHH 2HVKA 5BRZB 1CFTB 1FCGA 5IQ7H 3WS6A 1NKOA 4EI5D 2F8XC 5GGVY 4YGAB 4EN3B 3FAXA 5J3HC 4P5MA 3O9WD 3UPAA 4I3RH 2GJJA 1X5ZA 2YPLD 1PKQE 3L95B 4WW2C 5DVOA 5EZIH 5JNYA 3ESVF 4JO1H 5C0BB 3ZDXE 3LRSA 1BJ1J 4C56E 2VXVH 1QLRB 5ACZA 2YA1A 3DX6B 4FFWD 1QKZL 1KCUL 4GQ9L 3KYMA 4RCAA 3EO9H 1HH9A 2VLLA 3FZUD 1FSKB 1CDGA 4Z78A 4R7DB 5EO0A 1BJMA 5HBBA 4J3VA 3CMGA 3RWHB 5K9OB 5B4MD 2OTUB 1W72L 4LVNB 3VFWB 4NO3A 4JRXD 2BSED 1I8MA 2EH8H 4XVUD 4F8QA 1LEGB 1AR1D 5FO7B 3Q6FB 3MYJA 5F88B 5CJ8A 4RWHA 4ELKA 3TF7A 3QULA 5GGSY 1E28B 4RGMB 4B5EA 4WW1B 3S34H 4DZ8B 2H1PH 4TUKH 3JV4B 1YPZE 1QSEB 4UT9H 4Y4HA 5I1KL 5EU7C 4OJFH 3RWIA 3VXRA 3MRMA 3BDBA 4UBDC 5DD6B 2HFFA 4TSCH 2WINB 2XQYK 5IHZA 5TPWH 5JQ6H 3DVNB 1FGNH 1SEBB 4ZYKA 2LABA 4WO4C 4KK5D 5I6XC 1CTOA 4TRPH 5EN2A 1QSFE 2DQFA 12E8H 2F8OA 3L1OH 4BKLA 5CSZB 2XRAL 1KPVB 4KAQH 1AO7D 3O2VL 4OZHA 4IS6B 4JQIL 1BEYL 1UWGH 3CVHL 3HMWL 5KN5B 2OK0L 5F6IB 2PKDA 1FE8L 5C8JA 1G1CA 1YJDH 3DETC 1AR2A 2QSTA 4FXKA 3MV8D 2FX8L 5I1HH 3P9MA 1BOYA 1CD1B 3GI8H 3EYQD 4O2EA 4U1MB 4X9BA 3SJVA 4D3CH 1L4IA 1NSNH 3RZCD 3QFJB 4L8DB 3O4OC 3LKQB 1ZTXH 3HC4H 4D0DB 5DJCA 1EHLL 3KJ6L 3PL6D 5EU7E 5EU4B 3BI9X 1PGRB 2ILLA 4XBEH 3ARGD 3BPCB 3KWWB 3ARFB 2OTWA 1A6AA 5IB3B 5JHLL 1F90L 4HIXL 3AM8A 5HHMD 4N5EA 1SY6H 1P1ZB 3NACH 4HGKC 3WBDA 4PJAF 3O4LB 4ODUA 4O51A 1BVLB 1S7XA 2XWJA 1F3DH 2DLFL 3MFFB 5J56B 3LS5H 1XR8B 4CJ0A 1RMFL 2P7TB 3IB4A 3VFRA 4JM2C 2MCG1 3S35X 3B9KC 2WBJD 4MZ3A 2SEBB 4K7PX 4Y4FD 4KY1L 4PJEE 3MJ7A 4G8FA 1IQDB 4Z18A 1O7SA 5HHPA 1S7SB 3OX8B 3GI9L 4RFNB 3OKDB 5FYJH 3D0LB 6CGTA 1A02N 1RHHB 3SE9L 3MRDA 4E0RA 4PJFE 4LLQA 1RU9H 4UV7L 1UKSA 5C0DB 2OLDA 3OXSA 4ETYA 3FTGA 1PKQA 5CEXA 4XPAH 3U9UB 2LQRA 1F4XH 4MJ4A 4FXGA 4KU1A 2NZIA 2MFNA 4LEOB 1G6RH 4RX4D 4C56A 1FO0B 3O45B 2QSQA 3MRJA 4HS6B 4MXQD 2VXTL 1OSPH 5B22A 1GHFL 1V3KA 2D2OA 3BGFC 2VR5A 2V2WB 3JWOH 1I7ZB 3WNKA 2EDDA 2BRQA 4X6FB 4XPTL 1BJ1H 2HAZA 3AREC 5E95B 1TLKA 1CGVA 5GIRB 2XQYG 3O6ML 5H35A 2Y5TB 2HN7B 5DHYB 5JW3L 3RA7H 2HH0H 2VDLH 1T03H 4JY4B 3AXLA 4R97C 4X6DB 4WU7B 5DUBB 3OGCB 1IC1A 1NCTA 3WLBA 1I8IA 2D7NA 4D0BA 1EDQA 1YPZA 3LDBB 2X40A 3BUYB 5HJ3A 2X4QA 2H2SD 1R3LB 4LHUD 3M1BA 2YPVL 3PQYD 2WNGA 4XAWL 1NCAL 3UAJD 5BS0D 5IK3B 3T0WA 3QIUA 4IM8A 3BKYL 5DSCB 3KPQB 4NP4H 5JORA 5D1ZB 3CFDB 4NNYB 4XWOD 1R3IH 4YHOL 5I1JH 1QSFA 2X70A 4MNQD 2JJUA 5DA0B 1M6OA 4F7CB 4EQ2A 3MRIA 4YHPB 1IQWH 1YQVL 4YHIA 1P4BH 3NCJL 5CCKL 3IDXL 2OJZL 1CXEA 3L3KA 4N0YH 1OL0A 4TULL 3VA6A 4Z7NF 2KBGA 2VDKH 4OZGE 2ZJSL 1F4YL 1AE6H 3NABH 1T5XA 3UYOD 3H3PH 1CF8L 1HOCA 2XPGB 5LGJA 5EOQH 5F1IA 1DEEB 5DYOA 4EEEA 2BNQB 4XCEA 5ADOH 4YNYB 1DQTA 3BZDA 4JANA 4RISH 1FG2A 4WO4B 3NMEA 4H25A 1ZE3C 5EDXA 1S7WB 4ZUUB 4MVBC 4PRPE 3T4YB 3SOBH 2GJ6E 3REWA 4BZ1H 1J1PL 4U0QB 4PB9H 3HR5B 4QY8A 1U8HA 2APTA 2LV4A 2PXYA 3B43A 1Q0XL 3OHXB 3QSKB 1MEXH 5ID1B 2FR4B 2Y36L 1ZT4B 5D7JA 1JBJA 5E00B 2GEEA 2NXYD 2XKNA 3D39E 4XMKL 2NY0C 2PCPB 2FECL 4I3GA 3V0VB 3QEGH 5BOPA 2W92A 4U1KA 3ISWA 3S9DB 1V7NL 5F44A 2HJLB 1JF5A 3GSRA 4IRSD 5B38B 3OKLA 2X1QA 2ARWA 3TEUA 1SJVA 2W0LA 2HA1A 4LVEA 3EOBB 4ZXBB 2YUVA 4WVRA 3CVHA 1A7NH 3D0VB 4GO6B 5T1LB 1QHOA 2M2DA 3B4NA 4LLWA 3TBVB 5F9JA 1SMAA 4PJEA 4C83B 4H5SA 4ODXB 3VDAA 5ESQB 4P9HL 5CMAB 3G5VB 5KG9A 1CFQA 3SGJC 1E4JA 4PGEB 3WNLA 5I76B 3W9EA 2ARJB 3K46A 5T3XD 3TN0A 4AEIL 2YA0A 4PJDE 1FQ9C 1NGYB 1JYNA 5DD0L 2BDNH 5EU3B 1LO5A 3WHE0 2YPKB 1TZIA 4PJFA 3FN0L 5FDWA 4BM7A 3KPMB 2Z8SA 2VZTA 3VG0H 5CHNA 3CVIH 1H3PL 1QA9B 1A4KB 2Q8BH 4C55A 3EYUH 3B9KB 2F53D 4P2OD 4JAMB 4P23D 5HY9B 1ZHKA 1R0AH 1Z3GH 1CXHA 4ESKA 1P7KB 5E8DL 3QDGE 4X80H 5KANG 5I1LA 2WMPA 4G7VL 5C2BH 4NWTL 2O5ZL 3DI3B 3LQZA 3MV7A 1YNKH 3TT1H 1A22B 4HUXB 4U7KA 4IMKA 3ROLA 4LCYA 4NQED 3ULVH 1N59A 4NPYA 4QGYA 3CFBB 4M48H 3U82B 1MFAH 3V2AR 3ZT7A 5H37G 3PABB 5MERA 5EU6D 3UC0H 2FO4A 1N5AB 2BMKB 3MA7B 1NCNA 1EUUA 1BZQK 4BK4A 3F7RA 4WTZA 1NAML 2BP3A 1LNUB 3QA3A 4K94H 2R2EA 4U0RC 3PV6B 5EA0L 4YHYC 4OTXH 1DBKH 3SKUD 1MHCA 2UWEB 4PV9B 5E08L 1JPGA 2JTDA 1BIIA 4OKVB 5JW4R 3JZ7A 1KBGH 3H42H 1UGNA 4CMMA 2EE6A 5EUKA 2WW8A 4P4RA 1Q72L 2ZSVB 4OZGA 1QFWH 4MAUH 3RI5F 3L3JB 5IROC 1I8LC 3CMOH 3U4BL 3L5WB 4L1DA 1MH5A 4KKLD 4U3CA 3CDGA 5EULV 1LHZA 1OSZB 4UOW1 4RZCA 3QEQD 4KK6C 3AGVA 2EO9A 4OF3A 1CZ8L 1OTTD 1N2RB 4PRPA 4ZS7H 2GJ6A 1FORL 1JF1A 4KI5C 4PS4L 2MOVA 5GS3A 5J13C 4UDTA 2CRIA 4ERSL 1MHEB 1QR4A 4FZEL 3O3BA 3T3PE 1SJEB 1T22A 3HFMH 3D39A 3WJLC 3GSQA 1F2QA 2NQCA 3BO8A 4TUOA 3WEXA 2CLRB 3C08H 5BZDB 4LPYA 1RK0A 2QQLL 4G5ZH 3MSPA 1LEKB 2WBKA 1NMAL 2JLLA 3O6FC 5LXGL 4X7TA 4D0CA 2R0LL 4ZUWB 4G43B 4MXWH 5DC4B 5FK9A 3RP1A 3VRLF 1D5ZB 1IJ9A 4UTBL 1H3XA 3MRRB 4JPIA 5E2TL 3FB7A 3BZ4A 1XF4B 4LCUB 1HI6B 1A9BA 3MOQA 3QO0A 4PJDA 3SGKC 5ESAA 4PBVC 5FYJD 3SCMC 4GLRH 4W4OA 3JTTA 4GW4A 3FQWA 4HWZA 3RY4A 1GC1C 1S7VA 4MVBA 1AXTL 1BQUA 3TPKA 1KCRH 4NC0B 4AYFA 1K4CA 3PWPE 1MAMH 1D5XA 3GKZA 4P3DA 5B38G 1RUMH 1ZANL 5BVPH 1VGKA 2FX7H 4LSVH 3MLTA 4MX7B 3RU8H 2NXZC 4AEHL 3O81A 5T1KA 2X9YA 1LO3L 1UEYA 3K1KC 3QDGA 3N1FC 2VERN 4XB8A 1I9JL 1SYVA 4JO3H 5J9PA 4RGOL 4GAGH 4XNZB 4NKIH 3MLVL 2DLEA 3WFHA 3P4NB 1Q94A 1ZHBB 1C12A 4JDTH 4ZPVA 3RY6C 3QUMB 4U1JA 2JB6A 3MBXH 4GBXA 2ADFL 5C07B 3NGBB 4MNHA 1A1NB 3V6ZB 3VWKC 3ERYA 2GSGB 1KEGL 1MJUH 5ACMA 3BH8A 1IFHL 4PG9A 3JTSA 4OM0L 4P9MH 3SGJA 5L7XL 4JJHA 4M1GL 5C6TH 5B3JF 1DSFH 2Q86A 3W81A 2R1XB 2UYLB 2H32H 3WFCL 4YBQD 1YUHB 4AMKL 3QDMB 3QNYA 4HDIA 2BFVH 3NAAL 5GRVL 2GHWB 5F72S 1T83C 1XCQB 2F5AL 2AJZA 1WT5A 1SBSL 1TIUA 5EO1B 3D3VB 3OKOA 1JYWA 5E24E 2EECA 4KRNA 1WGOA 4FQHA 3PP4H 3QUXC 4POZC 4K07A 4NDMB 1RJYB 3T2NL 4GKNA 4U1SA 2R0KH 1KG0B 4FMKA 1HSAA 4FNLL 3SDDA 3TT3L 1OWWA 2XQBL 3K80A 3Q6GL 4PYGA 4P2RE 4MSWA 2VAAA 4I0PA 4XCNA 1YMHB 5IW1B 5BV7H 3IXTA 3O3AB 4KHXH 5ISZD 2F54E 2DB8A 3F5WA 5J6HB 4O02L 3LKOB 2X4OA 4GG6F 3G5YA 1CDBA 5AZEL 4OCXL 4MHHI 1KLUA 3GJEA 1GGYA 2B4CL 4EUPB 1NAMA 1WFNA 4Z0XB 4DN4H 1BBDL 3DMMC 4AY0A 2ZCHL 5IF0A 2N1KA 1JZ8A 3O8XB 2G9HA 4G8EB 4I2XE 2MQ0A 3Q1SH 3H9HA 1KB5L 1UG9A 3SO3C 2X4TA 2NTSP 2NY3C 5F21B 5HD8D 1T0PB 1Z0MA 1U8PA 5D72L 3BPOB 3PWLA 1N64H 1T4KB 2BVOB 1ZLSH 5KAQG 2CH8A 4PJBF 2NY7H 2HRPH 5F1SA 4MNGE 3U2SB 1AHWA 4HKJB 2CLVB 3LN4A 5A16A 1J8KA 1W8OA 1HNGA 5MEQA 5J0BA 4G8GB 4LOUD 1HH6B 5D6CB 3OKKA 3BISA 4FQJH 2BSSA 1ZV5A 4OLWH 3E8UL 3QHFL 4G9FB 5GGUB 3FO9B 4GH7B 2DMCA 2YKLL 3PNWA 3MRLA 4KZDL 3PHOB 2VZOA 4LSPH 2W65B 5ID0A 1ORSB 5F7DA 1TVHA 1U9KA 2HRLA 1KTLB 1GGBH 3BP7B 2GTWB 2KL6A 4ELMB 3GNML 1D9KD 3SE3A 4QTIH 3PWPA 3T09A 4EI5B 1D6EA 1A3LL 4MCZA 3QXTA 4TVSa 4YLQT 4O9HH 5DEFB 2YPLB 4WY7L 5HHVH 4JN2B 3V0AC 5HPOA 5J6GA 3ES6B 3G5XA 3U7YH 5IMLB 4JFYA 2OJEA 3MLUL 5IEHA 1KN2L 3MOAL 2XT1B 4AJ0A 4JFXB 1NEZA 3VXSD 3LVEA 5IKCA 3ZT6A 3GJFB 4EQ3A 1AFVH 4R96A 1DQQB 4WEMB 3IDMA 4U6VH 3P4MA 1JIBA 3HKFA 4G80B 3ULVD 2XXCB 5T5FL 5IM7A 4LLUB 1UZ8A 1VEOA 5I74C 2GYSA 5I17B 4XAKE 2VL5A 1I7RB 5HGDB 2ITCA 4PJ9D 3MFGB 3IF1B 1OP3H 2J4WH 3B3IB 4X7EC 2KZ1B 1DLFH 4K7PY 2NY1D 3ALWA 5DRXB 1VFOA 2DIBA 3FRPA 4TSAH 1LDPL 4LPUA 3T1WA 4A6YB 4IRJD 4WCYH 5E8OA 3S36H 1KENL 4LQFL 3SCMA 2DKUA 2NW2B 4UB0H 1U58B 5CJBA 2NLJB 3IU3B 3TO4C 4HWBH 2FEDD 4WHTB 1CFNA 4XHQA 3EZ8A 1EHXA 1G7HB 1JGUL 1OGTA 4K8RL 4U4BA 3Q5TA 4X6BB 2WV3A 1GGCL 5CEZL 1MY7A 1GGUA 2ZUQB 4HFUL 3VWKB 5I2IA 2ORBH 1GIGL 1KN4L 5EOCJ 1U92B 3VRIA 1CD9B 3T65A 4OZ4B 2VABB 1XH3B 3HC3L 4X9GA 3W11D 3FMGH 2OQJA 2DQCH 5CILL 4P2RA 1AO7B 4JG0H 4P4KC 4RAUB 3DARA 3VD4A 2XZQH 1GZQB 3GJFK 1UJTA 2QQNH 4FQXA 4ZG1A 5EBMA 1OTSD 3ZTNL 1NDMB 2WQ8A 2Z93A 5C0GA 4U1LB 2X7LA 2DDQL 2AQ3A 5DK2A 3RY6A 4JY5H 2F54A 1GZPB 2MTPA 4Z7OE 3MV8B 2XIDA 1TETL 4L8SC 4PRBA 3H3KA 3TA3C 3WIIH 1UH4A 4S1QL 3FQXB 4XBGB 1QRNE 4UI2A 1B6UA 2Q76B 2Z4QA 1NCDL 3ZYJA 5T1DH 3RZCB 1NJ9A 3UDWA 2BERA 1NC4A 2KH2B 4P0DA 4R26L 1OAYL 2AK4D 3B2UD 3OR6B 3P40A 4I2XA 4OM1H 4NZTH 1UXWA 4X7DC 2HG5A 4XWGL 2B2XH 4R2GD 3HPJA 3GO1L 2FL5B 2FH6A 3EYVB 5CZVH 2DI7A 4X4ZA 4M7JL 3QUXA 1J0IA 1HXYA 4K2UL 4MNGA 2HT2D 1WV7T 4M4PA 2VMFA 1CN4A 1JPSH 2Y07H 5D7LD 3FCTB 3L7FA 1J0HA 4NCC2 2W0PA 1YEDA 4QOKE 3RTQD 4YDLB 1UYWH 2VISA 2WBJB 1Z5LA 4AEFA 5C0FB 2DTML 4Y4FB 3QNXA 4QRSA 4XX1E 4YJZL 5MI0B 2Q6WB 4EUPG 3QIBC 1XGRB 5HGAA 1ZGLM 4R7NB 3DX9A 2NTFA 4HKBA 1V3MA 4QXGL 5D96C 4MJIB 3ARDD 4EXKA 4ONHB 3ARUA 4YHZH 3TWCH 2DQTH 5AZ2H 1HILB 5IHLB 1OCWH 2D7MA 1G9NC 3CZFB 2VDRH 3WD5H 4YAQA 4LF3A 4LPCA 3EJYD 2MHAA 1I8KA 1QVOB 1N7MH 4JG1L 3CFCH 3MCKA 5FGCE 4HWNA 3ROOA 1B4JH 2EYRB 4OZIE 2H9GB 1KB5A 1WZMA 2HT4D 1VHPA 5JXAH 1GL4B 1MCPL 3BVNB 3E0GA 5EFIA 3KPOB 1MCSA 3TZVC 1FN4B 2IADA 2NY6D 1ONQB 3CLFH 5HDQH 1MHHA 3MX0A 3AAZB 3NCYS 3RUGB 1IM9D 1A1OB 4NNPL 4AM0A 2EDQA 2C26A 4OCYH 4DVRL 2J12B 4NT6B 3KYOA 4HUNB 2MCPL 3BT2H 1RIHH 1DR9A 4DOHB 1MUJB 3GSVB 2Z31A 4WFGE 2CK2A 1HQ4A 5DHXB 2ENSA 1RURH 2P8MB 3HMXL 1A7PH 3OGOE 3STLA 2XA8H 1DBBH 1YJDC 4NKMB 3SY0B 4Y2DC 1ULVA 1OAZL 4AH2A 4GJTB 5ACLA 5I74B 4NNXB 5BS0B 5E4IA 1G0YR 1S7TB 5DJYA 4Q9QL 3QQ9D 3S4SB 1I3GL 5D7IE 2RAMA 3LQMA 4FMFA 4YXLL 2QEJA 4YDIL 3WN5B 2Z35A 1B90A 2XTJD 3QJFA 2QADC 2AJVL 3QO1B 4ZQKA 1U8NA 2IBGA 1I7UB 5EOCH 4IRZH 5GGVL 2F58L 5GJSL 3OMZA 6FABL 4KKNA 1HEZB 4RFOH 3ULSA 5JOEA 4Q6IB 1INEH 3P0YH 4U6YA 2X44D 1YN6A 2DQGL 2E3VA 3GSUB 1QRNA 4QCIA 3CCHA 4KKCC 4HZLA 3TO2A 1PZ5B 4MQSB 3FN9A 1X9QA 5JDSB 1LP9B 3C5SA 4QHUB 5DVKA 1KJ2B 4R4FL 1QSEE 4P4KB 3TO4A 3I3DA 1G1YA 1QBLH 2IMNA 2NXYB 5SWZE 5A43C 3BRFA 2EC8A 4WW2F 5IBUB 1KT2A 3DIFB 4R6UA 2EIEA 4X6DF 4K3JL 1S9WA 2X41A 4WENB 3E2HB 3X14B 1T6WA 2XWTA 4L8SB 3MXWL 4PJCB 3TA3B 2FGWL 3W2DL 3MRKB 4LLMB 2VZUA 4JO4L 2EDHA 1YY8B 2I27N 3TBTA 5K9JH 3VGFA 4Z7VF 5TDOB 3JV6B 4KHTH 1E4WL 4QOKA 4HT1H 3O3EB 2C1OA 4JFPA 2H6PA 3VFPB 4CL7A 4Y88A 5DFVD 2C4FU 3QHTC 3DVFA 4LSUH 2Y6SD 4PJ7B 2C3HA 1T0NB 5TH2A 4J12A 1TFHA 4RGNC 2AV1A 4X99A 1SMOA 5HVFB 1EX0A 1T7ZA 3CXHJ 1DBJL 4WFHD 5K59E 1IGIL 3D5OF 43C9A 3HI1A 4R4BB 4PJ8C 1CGSH 5EBLB 2E7LE 4PGCA 4NN5C 4Q74A 4XH2A 4XNQA 3I9GL 4OZIA 4M5ZL 4YFLF 1EAPB 3CXDL 4P2OB 4OFDA 1I9RH 5TE7L 2DQIL 2XN9B 1K9TA 4XGZA 5L88L 5C1MB 5E1HB 4F7MA 4JREB 3AMLA 1NBVH 4N8VB 5D96B 5INCA 3TFKC 5F7EL 2EXWD 4LSQH 4HIIA 1F8TL 3CC5B 4OLVL 4P5TC 3MLWL 1A4JB 4P2QE 3D2UA 4NQEB 3SKNA 4X7SL 1KXTB 1KXQE 4ENED 1A0QL 1CGYA 1XGPA 4NQUA 4KVCH 2IPKB 4JDVB 5JUEH 3GBNL 1F11A 3UPRB 2CKBA 1W0WB 2J2ZA 1U3JA 3QIBA 5F89A 2BSTB 1EVTC 3TJHD 4CGTA 4AK1A 2ZUYA 3QXUA 1P7QA 5KS9E 2YD2A 1RZ8A 2UY6A 4Y16A 5GHWL 1P6AB 2BJMH 5M94B 1OP5H 4BK5A 2YOCA 3OPZL 4U31A 5JXED 4LCWB 4PRDB 2AEWA 4NRZB 4WHYH 5I73C 1FRGL 1X5LA 2HFGH 5D7IA 1E4XI 1NGWB 5KSUB 4RMQA 4UTAL 3B9AA 1G7LB 1LO2L 1XZ0B 1JF6A 3PWVB 2PETA 3DX7B 4ZUVA 2R0WH 3V6FB 1T20B 1HHKB 4IDLA 2EC9T 2M1KA 3GM8A 4JM2F 3MLSH 3LV3B 1X5YA 4XBPB 1KTKE 4R7DA 3QZWA 1J10A 5E94B 5C3LD 4PP1D 1FV1A 2OTUA 3GDBA 1A9EA 3VFWA 3T77B 2C1PB 2WIMA 3PGFL 4ZO7A 3BKJL 1FL3B 1I1YB 1I1AC 1L7TH 3F7QA 2CK0H 3HMXA 1F6AA 1BZ7A 4O00A 4WW1A 3TH2T 4PD4J 1E4XH 5I9QB 3S88H 1QSEA 3S4SG 2P24A 3BHBB 1OT1A 4FP8L 4MA3B 5HYIA 5ICZB 4S11A 4LMQI 1AY1L 1MSPA 4GAYB 2P8PB 3LH2H 2P8LB 4UINH 4YK4B 4PLJD 4Y2DA 2NZ9C 3FT3B 4F57L 5IMKB 1YMMD 2H45A 1SEBA 2I9LB 5C86A 3HZVA 4YR6B 5E6ZA 5TE6H 1OD7A 5EZOL 1NAKH 1LQVA 5H8DA 3NCMA 3P77A 3TV3H 1X4ZA 3RVVC 3L3HB 1RPQA 2Y9RT 5GJTH 1JGLH 5E6IB 4H26B 1JGVH 3I3BA 2Q8AH 5BW7C 3LAFA 1JGEA 3PDOB 4M93B 4GRMB 4JFDE 5IESL 1RZFL 3HNVH 4X4XB 4MCYB 2UWEF 3HS0A 4KKBC 3DXAD 3OAUH 2DAVA 2VIRA 3P73B 3IKKA 4L9LC 4N9GB 1CD1A 3IS1X 2E7LA 5J12C 5IBUG 3GRWH 3L5XH 3R1GL 4L8DA 5DEGA 1ZEAH 5EG6C 4Z77B 1C5DA 2CPCA 4D0DA 1OT2A 5EZJB 1AKJB 3BP5B 4X0KA 1FNGA 1KIRA 3DVIA 5E1AB 2ZCLL 4YX2L 3BPCA 4J8RB 3E6HA 1IZKA 4RGNB 3WE6B 1BFOB 1DCLA 2R56H 3PDDA 1GAFL 5GGSA 3O4LA 1DQDL 4FFZL 1BVLA 4TVPH 1OAUL 2LE9A 4JZNA 3ZHDA 1T3FA 1J0JA 3X3GL 4P2QA 1BX2B 2ZSWB 5IHUH 5T5NG 4IEFB 4JRYD 4CADB 1JRHL 1VEMA 4TTDD 2XY2A 3MV9E 5C6WH 2E9WA 3MRFA 2A77H 4ISVB 1K8DB 4TN9A 5CS7A 2XZAH 3RGVC 2VXQL 3OX8A 4WTXA 5I19H 4J3WA 15C8H 1Q9WB 2PO6D 3OKDA 4MJ6B 5KVFH 4M43L 4OUOA 4JM4H 4RQQA 1LK2B 3PE9A 4PJ8A 5DTFB 1YEGL 5C0DA 4P5TB 3BRGC 3AROA 4KK9C 2A1WH 2GTZA 2CIKB 1T1XB 3J8F7 3IT8D 4N8VG 3T2PA 4OLZL 4JKLA 1FO0A 3O45A 2ZWLT 1N3NB 3NBNA 2RBLA 1DN2A 5JPNB 4OGYL 3QWQB 2NY2C 3HHRB 1DDHB 4E9LA 5IOPB 2V2WA 4YO0A 4YXHL 1TZHB 5SV4A 4X6FA 3TFKA 3U9PH 3OR7B 1NMCC 4DKDC 4ZFFB 3SGEI 4X6CB 1JZ2A 1ZHNB 4WNQB 2YC1A 4DVBA 1MCJA 2WP3T 1EO8H 5ISZB 4LSTH 4L3ED 1B88A 4X8XA 4P3CH 4JY4A 4WU7A 5DUBA 4XPBH 4NFBA 5LQBL 2DQEH 3FOMB 1IEBB 4HWEL 4TYUA 1RUKH 3AS3A 3BUYA 1TJGH 1G7MB 1TVDA 2PR4L 4IMLB 4GXUN 2E7MA 4JHWH 1I9EA 1R3LA 3IU4H 1INDL 2OR8A 5A2JH 2VR4A 2I5YH 5DRZA 3DOSA 3IVKA 1WZLA 1BAFH 2ICWI 5IK3A 3KPQA 1AJ7H 3UYRH 3U30C 4ALAH 2DN7A 5D1ZA 1LO4L 5I16B 4AENB 1EMTH 5DJ6B 5FB8B 3SGEH 5JPMB 4F7CA 1I1AB 1QBAA 4YHPA 3WIFA 3UTQB 4OBRA 2RCSH 4JZJB 4X8JB 3VFGL 1N5YL 1JI1A 1SJHB 2PN5A 1ZVHA 2BVTA 2DI8A 4QRRD 4O5LL 4JFDA 4V1DD 3DSNA 4DUXA 3ARRA 4P57A 2O5XL 3T4AB 2F19H 1JNHB 2HVJB 1XF3B 2BNQA 1MCQA 5GZND 4YHLL 2DLIA 2R9HC 1KFAH 1JWSB 3EJZC 1NCWL 4F9LA 5TQ2L 3INUL 3G08A 4JPKH 4XPGL 3JVGA 1BM3H 5CD3A 3T1FA 2RGSA 5E9DD 5HHOE 3N85H 1G9MC 5J11C 3K4AA 4WI3A 3H7LA 5E00A 1G9ML 2KUTA 2XFXB 2JJTA 5CIPB 3VFUB 4HV8A 3EFFA 4HBQA 3VXSB 5CP3A 1WUNT 5AD0A 3WNNA 4APQA 3B8SA 1FIGL 2RIKA 3OF6A 4QRUB 1CBVH 5D1QA 4L9LB 1EZVY 2BRRL 3QCVL 4GKSA 1TTGA 5E56A 3EOBA 4ZXBA 3VCLB 5HI3D 2D7PA 2R1YB 5T1LA 1Q9KA 4NO2B 4M8QA 1QQDB 2NY1B 5ADPH 5FUZL 4C83A 4LL9A 4Y5VC 2FYYA 4R90L 3VFTB 2A6JB 1J12A 5DJ2B 4OFKA 4HK0A 1U6AL 2ARJA 1KJVB 1CK0H 3C09B 2ICEB 5C0IB 2JJSA 2ZOKA 2VDPH 1U8OB 4KI5F 1KIQB 3IDGB 3UTTD 2YPKA 2OX5A 4FQCH 3QIWD 4RFEB 1A6ZB 4KH2A 1I9IL 3GHBL 2EH7L 5IJKC 3CDCA 3PWJB 1CU4H 3BW9A 1T04A 1G7IB 1EJOL 4YEEA 2CIIB 1T5WA 3ZKXB 2JELL 1INQB 4KQ3H 1TPXB 3ZKQD 3A6BH 3FFCD 3P30H 5GRJL 4F37K 1OPGH 2NNAA 4IIQC 4RAVA 3DV6B 4JRWA 4ELMF 3QCUL 4MAYC 1ZMYA 3Q2CA 5HI5D 3H8NA 1A14L 4XXDB 4MGXA 1SVZA 2NX5E 2ZCKL 3DSFH 3U4EB 3T2OA 2BVQB 3SDCD 3EW3B 1PZUB 3LRHA 3CFBA 5ALBL 3T04D 3MBEC 5C0AD 2COQA 1P2CA 1TQCB 1QRKA 2XG4A 1IE5A 4NOBA 1HZHH 4KV5F 1FVDA 3IDNA 1N5AA 1ZVSA 4IJ3C 3GSOB 5BQ7B 4OQ1A 3RGVA 3EDFA 3KPRD 5L6YL 3D69A 5KSAC 2NY2B 2XNAB 4KMLB 2VDQL 5HYSA 1DANT 4TUJA 5D9SA 1LNUA 3IAQA 1AI1H 3QCTL 1A3QA 2G60H 4MJ5B 4ZUSB 1BD2E 3VWJD 4R2GB 2DQDH 3MA9H 3MUZ1 1JK8A 1MJJA 2UWEA 4PV9A 5IB1B 5KSVB 4S0UC 3HZKB 1FNFA 2WWMC 4M1CD 4I3SH 2EDWA 1JHLL 1R3JA 3U0PA 1UADC 1HWHB 4KRMB 2EDLA 4XP9L 3UROR 4PP8C 3UBXB 4HH9A 3RTQB 3GMLB 3WLWC 2OL3L 1VACB 4JR9L 5C09E 3R06B 2BX5A 1OSZA 4L29A 5EORL 3UZEA 3O0RL 5TFSL 3BIBX 3KPTA 2I07A 4JFZH 5DJZB 4M5YH 4J4PD 2P4AB 3U30B 3LHPH 4AIZB 3ARDB 3EOTL 2I9TB 2GT9B 2DMKA 2YMXL 4YHKH 2VLJD 5K9KB 2LU7A 3SKJL 5HHOA 4TSBH 5ILTH 4NZRL 4PFEA 4XNYL 1M05B 4PJGB 1UJ3A 5AG8A 2GIYA 1YYLL 5FF6B 4H1LB 4O4YH 5D70H 4OCWL 5LBSH 3BKCL 1PQZB 1FVCB 1NLBL 2PW1B 3UO1H 5T1MB 2BXYA 5CJ5A 3RFZC 3V6OC 2CLRA 3RX5A 1Y6MR 1VPOL 4WWKD 3MNWB 4HFWB 3U36B 3I75B 5CJQH 1Z0NA 1RHFA 3GFUA 3K2UH 2W60A 1OY3B 1CE6B 3MRBA 5KVGL 4QRQA 1A6TB 1LEKA 5IFAH 3GIVA 3ZKMC 3C2AH 4YHMH 3NCBB 4U49A 1CLYL 2VLMD 2A73A 5GGRB 3HNSL 4HQQL 1IM9B 5CWSA 4CVXB 1D6VL 1A2YB 5F8RC 3TYGH 4GAFB 1RK1B 4EDWL 1CLZH 3HE6D 2AJSH 4DGIH 5J11B 2OBGA 4GRLC 1MPAL 3RIAK 1JZ3A 3DYOA 4LCUA 1HI6A 5IBTL 4KUCF 4M7LH 3NIDF 2FB4L 1D5BB 1EEYA 2E9JA 5LGHL 3GGWB 2H32B 2B1AH 3QNZB 2HTKC 5ANMB 4KVNL 1DL7L 2ZPKL 4RWYH 4Z76B 5E8NA 3STBA 1MF2L 1X5IA 3K3QA 1QSVA 1OARH 3VXQA 3QUKB 3FT4B 2FJHB 2IH3A 1MWAL 3S96A 4BFIA 4XC3L 1U8IA 2DOCA 5FUOL 5JIPA 2L4OA 2W38A 2YPLE 3S3SA 4NM8L 4PLNC 5SWQB 2PYED 2Q7YB 5DZOA 1EEUA 3QDAA 2XTJB 4HXAH 4JCLA 4M7ZC 3KR3H 4M8VA 3UZQA 2NX5A 4YHNA 5JMOC 4M7KL 5FEBA 1I3VA 4HJ0D 4KJYA 5BV7B 2AS5M 3HUJF 5D1XC 3KHOA 3PUCA 4KJPD 5HSFA 5C07A 1CFSB 2CUHA 2GSGA 3OKEA 4K9EH 1EXUB 4JRXE 3EYQC 2X9WA 3OBAA 3O6LL 4ZD3H 5DUPH 3QJHA 4YIQB 3LQAC 1LK3L 4QHMB 5HHXH 1GRWA 2FIRT 3V4VL 4MAYB 2R1XA 3LQAL 2YRPA 3EDDA 1QNZH 3SDAC 5D7SH 5HYEA 5L2JA 5DK0A 1XEDA 1YUHA 1KNOB 4K7PL 1XCQA 2CDFB 1VFAB 2ERJC 3B83A 5EO1A 2W9DH 3FHQA 3MBEB 4LIQH 5DJXA 4UZGA 3W9DA 4LSSH 2V7HB 4R8WL 1RJYA 1QFWM 5I30L 4HBCL 5FV1L 2R29H 5DZNA 1NMBH 4LHQB 3N06B 1EEQA 5F93C 1NFIB 1ZVYA 2P5EE 2EYSB 5T3ZH 4GRWE 2YK1L 1CL7H 5C09A 4WIQA 4ZTOL 32C2B 4YDJB 3QDJB 2IC2A 3VD9A 1ZGLA 3LRGA 4ZAKC 3HRPA 3MV8E 2ADGB 3L5HA 5J6HA 1QEWB 4E5XB 1PYWB 1FPTH 3MR9A 5EC2A 4U3HA 3MUY1 1L0YA 3R0NA 4KTEH 3CNKA 5CKGA 1BIHA 2A9NH 2H8PB 4Z0XA 4OCSL 1JWUB 4NQDD 4S1SH 1X5HA 1KELH 3BD3A 3O8XA 1BGXH 5I66B 5IWLA 5ITFA 2IAMC 1MRFL 3UBXG 2D7TL 5IFHL 4IOSD 1GPOL 1XIWB 2HWZH 3C5ZA 3QFDB 5F6HJ 1B4RA 3REVA 1IGCL 1LP9F 5HHME 2BVOA 1NGZB 3CK0L 3DHJA 4XI5C 5C7XL 1DLHA 3U2SA 4ZO9A 4JQXC 1MNUH 4NCC1 2CLVA 1FYTB 1A3RH 3MODH 4K71C 2DTSA 2OL3A 4UU9A 4Y5YB 1EO5A 1HH6A 1WBXB 3LN5A 3EGSB 3O6KH 5D6CA 1OF2A 1FL6B 4DTGH 4LVHC 4NM4L 3ZZ1A 3VH8A 5GGUA 3FO9A 3WS3B 5EC1A 5I8KH 3QPQC 3UTSD 3VJ6A 1KJ3H 4FQ1H 4H88H 2ESVD 2W65A 5DURD 2ADJA 2LAGB 2BSRA 3BSZH 4QO1A 5KOVC 3NH7L 4H1LG 5JW5B 2D31B 4JN1L 2OZ4L 1T80A 4BH7B 3KNBB 4X98B 5HHNB 2DRUA 1FLRH 2RFXB 4PJ7F 5DJ0B 5I1GL 3RHWF 1IAOB 3O9WA 5DEFA 2YPLA 4U1GC 3RWEA 3MLXH 1VESA 1S78D 4M6NH 3O41B 5EH1A 4Z7UB 2LTQB 1N26A 2ADIA 4EOWH 1KCVH 3R4DA 3GJFA 4KPHL 3ABZA 1DQQA 5JW4M 1UCTA 5LAXA 3V7AG 4G80A 2R2HB 1IVLA 4UUJB 2QSCH 2D4FA 3IKCB 4LLUA 1JNJA 5I17A 3RUGE 1U93B 4ZFOL 4BH8B 4XP6H 1A7BA 3IF1A 1QFPA 3SQBA 5DRXA 3VE0A 2J8HA 1CTNA 3IFLL 4JRXA 3DUUA 1VFBB 1OP3K 1UM5H 4NQXA 4GRLA 4J1UA 5GGQL 4U6XA 4HHAB 3V5DB 1NLDH 1P4IH 5ETUB 3MYZA 3F58L 1ACYL 2NW2A 1U95A 3OB8A 4G6JH 5IBLC 1IC7H 3C60D 4NN7B 1I7TA 5CUSL 5H37H 4M7ZB 2AJUL 3NFPA 4PR5B 1C16A 1G7HA 4GT7A 3PQYE 2QSVA 4PUBH 1Z6JT 2I25N 3F7VA 1UKTA 5D1XB 5BS0E 5DFWH 2CDGA 5D4QA 2FATH 1RZJH 3IRZA 2KDGA 1LE5A 5FA3B 4MNQE 5ERWA 4OZ4A 2VABA 1DBMH 2Q1EA 4O2CB 3IETA 4NYLB 4OGXL 1OAKL 1Z9OA 5H94A 4PJXB 4JO2L 3ARBC 3SDAB 1GZQA 1AD9A 1CR9L 5JR1L 3CSYB 4PYHA 3RPIB 1JUFA 1UXSA 2QTEA 2C5DC 4U1LA 3QT2A 5HYQB 4AL8L 3DXAB 5KVDL 3MV8A 2ERJB 3HB3D 3WDHA 4ODHL 3FQXA 4WWID 2XKUA 5IQ7L 2HKFL 2VAJA 4DFIA 5K93A 3PV7A 3VXMD 5GS2D 3TCLA 3Q3GB 3RZCA 4W4NA 4BA8A 4D9LH 3E6FB 4I3RL 3VFMB 3VD7A 2J7LA 3QUYC 1J0YA 2A0LD 4JO1L 5BMFL 1T1ZA 3G6DH 3PL6A 7CGTA 4OQTH 4NC1C 2C9AA 5HPMB 2VDNL 2W07A 3U46B 3VFOA 1W72H 3RL1B 1WAAF 3ARGA 5HGGS 5AG9A 3MRNA 2J8OA 4C54A 4MHHG 4NHCH 3T8XB 5I1DA 5HHMA 3ZE1F 1WZ1H 2YD3A 4L3AA 4DKEH 4CVUA 4PJCE 2MWCA 2AXGA 3CH1B 2W0FB 1RZKC 3FCTA 5F3HA 3WJJC 1AIFB 2OR7A 5FO8B 1MJ8L 1IKFL 3AB0C 1DN0B 5FOBA 1RZKL 5I1KH 4JRYB 3QUZC 2J5LC 4J3XA 1MLCB 1OWRM 2EH8L 3FRUA 3HA0A 5HDBF 4ZNEE 5C0JA 1NBYA 3CFKB 4GS7B 4XHJC 2Q6WA 2XA3A 1XGRA 3UTZA 2IAMB 3CPLA 4P46C 1I85A 4CN1A 4UT9L 2PO6B 3QI9D 4OJFL 3P2TA 1HILA 1S7QA 2A9MH 2Y7QB 4PTUA 3WFEH 3CZJA 4O58L 4N0CD 4TSCL 5JQ6L 4AZ8A 1U3HD 1MVUB 4JQIH 1BEYH 3MPCA 4LGPB 3HMWH 3CVHH 1UZ6E 2OK0H 3MRCB 2H9GA 4JKPH 4GKZA 1FE8H 2F53E 1KTRL 2GAZA 4LVHB 4QGTA 4RX4A 4KKAD 12E8L 1S9KC 3L1OL 4FTVB 4MXQA 1HHHB 4NC1E 5EO9B 4WI4A 1UVQB 3BVNA 2A6IB 2RHEA 4PJHB 4FG6D 1UWGL 1ND0A 3CH8A 1A6VH 2GFBB 3AAZA 1FGVH 4HULB 3N1GC 4FQ2L 3RUGA 3VXUE 4OT1H 1NKRA 3WIHH 4ORGA 4NQEE 4D8PA 1Z9MA 4OAWB 4ZUTB 1EHLH 5I1HL 3WHXB 3Q0HA 4U1GB 4L3EB 1K85A 2GSIA 3GI8L 3GSVA 1CDCA 4KTDH 4XCCH 5EU6E 4QHLA 1IILE 4EIGB 3QQ4A 1JNNL 1NSNL 1YDPA 2DM7A 5JHLH 1F90H 2KQNA 2OZ4A 2ITDA 1EK3A 3S5LA 4I48B 5BRZD 1IAKA 1ZTXL 4LHUA 4KROD 4XMLH 1AD0B 1NC2B 4EN3D 4MS8D 3PQYA 1RMFH 2AK1L 3MRPB 4XT1C 4XBEL 1XF1A 2Z0BA 2HT3C 5BS0A 5E5UB 2R23A 3PP3K 3KXFD 4KY1H 2NY5C 3S4SA 1SY6L 3NACL 2ZNWA 3HE7D 4MNQA 1TCMA 3WMSA 2KKQA 3QAZC 3GI9H 3LS5L 4CDGC 1DVFD 1F97A 3DYMA 5FKAB 2VRAA 5F7YC 3VGDA 4U1IB 3ARVA 4FRWA 3QO1A 3MRQA 3ILQC 4MDJB 4QRRB 4V1DB 5E8EB 1I3RB 3BXNB 2YUWA 4UV7H 5EIIB 2JIXD 2AKRA 2JCCE 4ZFOA 2R0ZL 1R5WA 4RIRB 2PYFA 4LP4A 1A1MB 2L7JA 4DFHA 5KSBE 3HC0B 4DQOH 3QEQE 1NEUA 1XGQA 1WBZB 1RU9L 1QTYT 4PJAB 4NKOB 1PEZA 5JDSA 1K3ZA 4MD4B 4EI6A 2BZDA 4X6CF 3EHBD 2WQRA 1JN6B 4XPTH 1SM3L 1IGYB 1F4XL 4YZFE 4NWUH 3OSKA 3P0GB 4MA8L 1G6RL 2UVEA 5TDPA 1JZ5A 2N4IA 3O6MH 1VEPA 4CVZA 4KZEH 3C8HA 4FFYH 5JW3H 1JWMB 1LD9B 5A3IC 4IRSA 1WBYB 3QBTB 4QXTB 4PJCA 1AGCA 5EUOE 3WKNA 4LNRA 3TBSA 1L6XA 3OAZK 3EYOB 4PDCE 2KPNA 5FKPB 2X4RB 4WFFD 5C70A 3QEHA 3G6AB 1GOHA 5E6YA 4AIXA 4F9PC 4ZNEA 2YPVH 3BWAB 5FM8A 1T0NA 1HHGB 2HH0L 2VDLL 3U7AA 5IFJA 1KJMB 2ATKB 3VXTB 5D2LE 3BKYH 1NFDE 2IFFH 2OR9H 5GGTL 3BN3B 4UQ2B 4YHOH 4TNWK 1D5MB 5FYJE 1YNLH 1JHKL 1OTUD 2DBLL 4HEME 1YQVH 1L8JA 5EBLA 1S5HB 4X5LA 2ATPB 3NCJH 3QFJD 4QKXB 5CCKH 3SBWC 1J18A 2OJZH 3BPLB 5DJDA 2FECI 3CIQA 5DRNA 1KXVC 2HJFA 1YEEH 1X5AA 1EEZB 3K0WA 3QUZB 2J5LB 2F53A 2WIIB 4P2OA 1R3IL 3HPLB 3LB6C 3GMPB 4LKXB 3FFCB 3STZA 4J3OC 2NYYD 2IQ9L 4P23A 5A2FA 1UKQA 3B8YA 3RJDA 3FO0H 2DJUA 4JQVC 1TTFA 3BJ91 3X13B 2VDKL 4P46B 3CU1A 3C6LC 1AE6L 4F37F 4NBZB 3VXUA 1RUQH 1A4JA 2O26U 4NQEA 4HPYH 5E2VL 4KMTL 2W59A 2Y36H 1U8QB 3KJ4B 4KXZH 1TNNA 3HTLX 4RISL 5HYJB 3QXDB 1PG7L 3OJMB 5C0AB 2IPKA 5ICYA 3SPVB 5D6DC 4XMKH 5EU6A 4DN3H 3RL2A 1JE6A 3SOBL 1JTPA 4BZ1L 4MD0B 3H9ZA 4I4WB 1CXFA 2J8UE 3QEUB 3KPRB 1MEXL 3HLAA 4LRIC 3O11A 1R5VB 1T0MA 5MEND 5DMKB 1OVZA 4XRCB 1TNMA 1JV5A 3NA4A 1FNAA 3QEGL 3VWJB 1U0QA 1MVFA 1OP5K 2FBJL 3RVTD 4P9HH 1QSZA 3KPPB 2DWDB 4XVSL 5K9QI 1W0VB 1G7LA 5DJ8A 4AEIH 4NBXB 4OLUH 3I6GB 2Z91B 1MI5E 5SV3A 2V9RA 4WV1A 4HMCA 5DD0H 1M71B 1A7NL 1UCBH 2Z9TA 4PP2B 3MREB 3FN0H 1T20A 4JEGB 4R0LC 1HHKA 1YN7A 5IVXF 2JCCA 5GS0C 1I1FA 4XBPA 4BSVB 1H3PH 5J3HD 3KPNA 3QUMH 5KSBA 2Z92A 3ESUF 3QEQA 5B21A 3GMQB 4OD2A 2C1PA 2AJYH 3SEPA 2BDNL 4LARH 1I1YA 1TVBB 4Z7WB 1H5BC 2YD4A 4NO0B 4EBQH 5E8DH 4J3SA 4G7VH 1G7PA 4NWTH 3BHBA 4K23L 2O5ZH 2Q8BL 3EYUL 1LVEA 1JVKA 4GAYA 2P8PA 4G8IA 2H3NB 3KLSA 1FZJB 5EBWB 2FHFA 4X4ME 4Q0XH 1C1EL 3WSQL 1Z3GL 1T89A 2I9LA 1ITBB 3GSWB 4WWKB 4YR6A 1SY6A 4N0FA 1L9MA 5EUOA 1UWEL 4KUZL 2VWEE 3F12A 2FSEA 4MLIA 4HD9A 1ETZA 5C6PB 3ECBA 3OL2A 5F7LB 3ULVL 3EZJB 1FNEA 1RZIB 3OG6B 3DO7B 5CJXA 2AV7B 2B5IC 3BD5A 4PJ5B 4M48L 3BFOA 4UBDD 2WAHA 4MCYA 3UC0L 1J05A 1T1YA 5D2LA 1NFDA 1Y6NR 5EA0H 4WO4D 3V6BR 2GI7A 2IANB 3WL9B 5E08H 3P73A 2C4FT 2LVCA 4LBEB 3KLHD 5FM5M 4FZ8L 1BJ8A 1IM3A 1Q72H 4NO5A 3FQRA 2VUYA 3TBYB 5TQ0H 4PJIB 3OAYH 5FYKU 4QHNB 4QXUH 3U4BH 2VNCA 5DMGC 2NY4C 1M7IA 1G6RA 3FB5B 3IJYA 3OV6A 4HGWB 2AABH 4JCMA 3DETD 3PWNB 4W6XB 3MLPA 4LPTA 4X5WA 4J6RH 4J8RA 2HJKA 2PYEB 4DGYL 1H8OA 3O3DB 1QFWL 4MAUL 3T0EC 1IAIM 3X12A 3PIQB 4YDVB 3CMOL 3FQNB 3KLAB 2ZKHH 4PJGF 5CFHA 5ENWB 4RA0C 3ULVE 3VI3F 1CQYA 4OV6F 3SDYL 5EZLB 4N68A 4FZEH 5JIHA 1BQHA 2O61A 1FVEB 5D5MB 2Y1VA 4JB9L 4PRHD 1K8DA 3BQUC 3O2DH 4WHYG 1YEFL 5GGTA 1HINL 2J8UA 3ZDYF 4Y4KB 5GS1B 5IV2B 1KCLA 4OV5B 3O2WL 3PHSA 1NMAH 1G9EA 2AGJL 2FWOA 5DS8B 3RWFB 3TPUE 3HFML 2WSKA 3BX7C 5LXGH 5C9KA 4LPXA 4JM2D 3ILPA 3B9KD 2CIKA 4M7LT 3C08L 4OLYH 3EOAA 4G5ZL 3MRHB 5E2TH 5CZXC 4BUGA 2DQUH 4ETQB 1N3NA 2ZUXA 1PX4A 3MCLL 3A6CH 1E4KC 1KUMA 3HRZB 1BZ9B 1U8LA 3JXAA 3LN9A 2WUBH 2FEEL 2AXFB 3HZMA 3RVUD 4MXWL 4B7LA 4PBWD 1JPTL 5IQ9A 2WWKO 1AXTH 5ESVB 5HI4C 1FHGA 1GC1H 4Z7QE 5DK3A 5IB5B 4HLZH 3FO2A 4WNQA 3L7EB 1O0VA 5IB4B 4QTHB 5ISZA 4AEHH 3H2WA 4PRIE 1MCFA 3GIZH 3FOLA 3GBLA 1E27B 4I18C 1IRAY 1LO3H 2WANA 4HKZB 2EKJA 4TOYL 1KCRL 3EO1B 1MAML 3HAEB 4PY7A 5E8PB 1RUML 4M62H 3DVGB 1QLFB 3BEVA 2VE6A 5EWIH 4LSVL 3SQOL 1MFBL 4ODVH 3ARED 2EIZA 3MUGA 4NQDB 1YC7A 3MGOA 2AK4E 4X4MA 5IG7B 5F9OL 3NFSH 5DQJB 2ZOLA 2YS4A 1QUNA 4I0CC 4QHKI 2VLKB 1H15B 1QPXA 3DYPA 2FNBA 4L4VB 2IG2H 4JO3L 5I16A 3MROB 1IFHH 2NY6C 3UX9B 1WCBB 1B0RB 5C92A 4CRPA 4P99A 1H5BB 4WHDA 4JZJA 5EBGA 4X8JA 4JDTL 2CGRL 5D7LE 4YWGH 3WFCH 2I60H 4GMSL 3T4AA 3V8OA 1MJUL 4EXPX 2F5AH 2ZP0T 4GUPB 4OUUA 4R9HA 1LEIB 3D48R 3UTSB 1SBSH 5C6TL 1DSFL 2ESVB 1JWSA 1NANI 4GMTH 4ZPTA 4PLKC 4KGLA 3QRFM 5E4EB 3T2NH 3QG6A 4XMPL 1CE1H 2VLRB 2VYRE 1D9KA 2BFVL 4G6AC 4XVJH 2BC4B 1M7DB 1BVKA 1MCOH 1AP2B 2BNUB 4OB5H 3VMOA 3ULUC 1JTOA 1GXEA 4MMZC 1N4XL 2XFXA 4CNIB 1N0XH 4JGMA 4F33A 4YPJA 2R0KL 1XCTB 1NCCH 5SX5H 1FFPA 2CJUL 3VXSA 1YC8A 1U8MB 2VL4A 2DM3A 3T2QA 2IBZX 3V5HB 5AZEH 3FO1B 4NKQB 4OCXH 4PV8A 1HQRA 1HCFX 2DI9A 3GK8H 3DECA 3VFVA 4TQEH 4HIHB 1TZGH 2R1YA 2QR0B 4PJ9A 1OB1B 2XYCA 4YFEA 4RAHA 4MXVF 2VXSH 4HUWB 2NY4B 3KDMB 1Q1JL 4QYOB 3VFTA 3U83A 4NC2B 3WNPA 1KB5H 3TF7C 5DJ2A 2NY0D 2YSSB 4IRJA 3D6GA 2HTLC 1XT5A 4XCYB 1U8KB 4Y4HC 4F15B 5C0IA 4POUB 4JFEB 3TVMB 4PGDA 1I3UA 3I02A 3V0WH 1OM3H 5GRUL 4JHAH 3T0EB 4DN4L 3QPXH 3C60B 3TPUA 3K8MA 4XZUB 2YD7A 4HJGB 2F8VA 1S9VA 5B39B 1KACB 1JPFB 2X2YA 1INQA 1BF2A 3FQTB 4HZAA 1N64L 4M61B 2GCYB 2W9EL 4R4NC 3ARWA 2YKLH 4KZDH 3HN3A 2NY7L 1ZA6B 2HRPL 3KYAA 3QRGH 5ITBH 3KYKH 3U0WH 3OJDB 3FFDB 3TESA 1HHJB 1CYGA 5GSRB 1AQKL 2XTJE 3H6JA 2APWA 4XXDA 1KEMH 3AU1B 3G6JB 3EJJX 2UZIH 3CX2A 4IHOB 4NUJB 3BPNB 4Y5XA 2IH1A 4Z7UF 2EEBA 4PRIA 3V8CA 3AUVA 4JLRB 5AYQA 5JOFA 2GK0B 1GGBL 3KVQA 1KN2H 2EYTA 3MOAH 4ODWB 1F5WA 2B1HL 3GSOA 3QXWA 4QTIL 2NR6C 1LILA 4MDIB 2XNAA 3P0VH 3V5KB 3QDMD 4ZDHB 5T5FH 5D2NC 2AK4A 3LEXB 5CKAA 4MJ5A 1S9YB 4ONGL 4XNUH 1VADB 3E3QC 1XGTA 4WI5A 3D3VD 1F6FB 4N5EC 3AM8C 3BAEL 2MQCA 1LDPH 3SDXB 4U6VL 1KSRA 2P48B 3U6RB 3HZKA 2WY3A 2OXGA 5BVJA 1D7FA 2F74A 2P43B 1RD6A 5D7LA 3R8QA 3UBXA 4ENEC 5SX4H 3RTQA 3GMLA 2J4WL 1IAMA 5HVWA 5CZKA 1DLFL 3I2CL 2PTUA 1VB9A 1VACA 5DQ9A 4TSAL 1Y18A 3H9SB 1MFEH 4K3EH 4K8RH 3PGCA 5CEYB 4LPVA 3HAEG 3S36L 1GGCH 5CEZH 3HCVA 3JSSA 4WTWA 1HIMH 5DI8A 5I1AB 4HFUH 3UCRA 4UB0L 1IGTA 4WFHE 4OBSA 5FGBA 3QI9B 3LSOB 5IMOA 3ARTA 4PJXF 4HWBL 3JWDC 4LEXH 3SJVE 4LASH 1WLHA 5CSBA 5CILH 1YECH 4N90E 1RUPH 3QG7L 3TBWB 4PJGA 4BQCA 1KJ2H 1C08B 4HK3J 1FVCA 1AQDB 1X5KA 5D2NE 3ZTNH 3L9RA 4KDTA 1VFUA 2DDQH 4BQBA 2Y23A 4KK6D 2VXUH 3MNWA 3E3QE 4HIJB 1F3RB 4WDIA 5J7CC 2DQCL 2VB5A 4JG0L 2HVKB 2VC2L 3VGGA 2EDJA 4KI5D 3PWPD 2QQNL 3MQIA 1IM9A 1YEKH 4G8GD 1KTDA 4PP1C 1WSST 4JY5L 1N8ZA 2DD8H 5JNYB 3MNZA 2YBRA 3TIEB 5L8KB 4G9FD 5TF0A 3LRSB 2EE2A 4XWGH 3LY6A 5KTEL 5JMRA 3GO1H 5ACZB 5F9WB 4V2BA 3TIDA 3KYMB 1XR9A 2H32A 1FZKA 4M7JH 2R8SH 3T3MF 3QNZA 3CSBA 1HH9B 4CMHC 2VLLB 4KROB 3O6FD 4Z78B 3QIUC 4PLJC 2B2XL 1FCCA 3EYSL 2FJHA 1I8MB 4Q9RL 2ZUVA 2NW3B 3DROA 3KXFB 1UB5A 3RBSA 4IOIB 3MYJB 5CZVL 3HE7B 2GJZB 2Z8WC 4JFQB 4DGVH 1K3IA 4ELKB 3VW3H 3QULB 3RWDA 5DVLA 4V3EB 3SGDH 4QXGH 1DVFB 3ZKND 4Y4HB 1K2DB 2X09A 3RWIB 3VXRB 3MRMB 1WFTA 3VXPA 2HFFB 5C08D 1G9NH 4JG1H 5IHZB 1Q0YL 2JIXB 1ZS8B 4GSDL 2OI9B 4ZYKB 4X4YA 4PRNB 1X5JA 1RJCA 2NXZD 1ZT1A 1EXUA 4HUUA 5EN2B 1PY4A 4PJHF 2DQTL 1WWBX 5AZ2L 4BKLB 1OCWL 1Z9LA 1MCPH 2PXYC 5B39G 1ERNA 4YIQA 4QHMA 2NMSA 5D7JC 4OZHB 1BOGA 4LP5A 4NQSA 4UT6H 5CD5C 1B4JL 1XGUB 1YNTA 1PAMA 5IGXL 1FP5A 1C5CH 8FABB 5C8JB 2XKSA 4DVRH 5JXAL 3IFOA 3KPSD 2DWEA 1UACL 3N1PC 4FXKB 2MCPH 1HXMA 1YMME 5I8OH 3VWKD 3VA2C 3LMJH 1ADQL 3CLFL 2V2TB 3VG9C 5JHDD 5D8JH 3HMXH 4G6KL 5EIVA 4OCYL 1F13A 3L3GA 1NFIA 2N7BA 4OFIA 2EYSA 1IMHC 2BY1A 4F7TA 3N9GH 1RIHL 4Z95L 4A2MA 4XCFH 3TN0C 3RKPA 5C9JA 4YDJA 1O7VA 3LPGA 3S7GA 1ES0B 3BE1L 3MZGB 3PGDA 2OTWB 1RURL 2R69L 3DXAE 1I3GH 3ZE2F 1YEIH 1A7PL 2ADGA 2B39A 3QUXD 3ETBF 4ODUB 4O51B 1DUZA 1S7XB 2XWJB 4POZD 4ACPA 1QEWA 1KGCD 2XA8L 4DEPB 1PYWA 3FONA 2XZZA 1DBBL 5FYKH 4YDKH 3VFRB 4TNWF 2AJVH 2H8PA 5FV2A 1X5FA 1V7MH 4M3KB 4IOFC 4NOFA 3V95A 1VSCA 1HCVA 4G8FB 5GGVH 2F58H 3TJEH 5D2NA 4HIEA 1PY9A 6FABH 2YZ1A 4URTB 2MNUA 1JYVA 3IGAA 3E3QA 1MRDL 2JB5H 5F1KC 5I8EA 4K3DL 1T21A 2IQAA 4G6FB 4KUCD 3MRDB 2X05A 4E0RB 1NGZA 3LIZL 4IMKC 2EZ0C 4LLQB 4YH6A 3SHSA 1C5BH 1U42A 3OXSB 4MA7H 3FTGB 1PKQB 5CEXB 4Y5YA 1A6PA 1UB6A 3DMMD 3MGTB 4JRYE 4HS8H 5FYLD 3B2VH 1U8JA 3WS3A 1PG7W 2NY3D 1HHIA 4RNRA 4HPOL 4MJID 3TJHA 3NN8B 1WIPA 1SVCP 3MXWH 4HWBA 4JO4H 4X98A 3N0PB 2VJXA 4XAKD 4OCLC 5MENB 1E4WH 3NZHL 1R6VA 5H35B 1QR1A 4XPFL 2VITA 5JXEA 4Y7MA 2G2RA 3NA9H 3AXLB 3GMNB 2AEIT 3WLBB 4BSWA 5CINL 1I8IB 4D0BB 1B3JA 4L4TD 1IGIH 2C7UA 3FT2A 1KV3A 5HJ3B 2X4QB 1UWXK 1UM4H 4LSUL 4KC3B 5C0EB 4FFVC 3MV7E 4YGVA 2R2HA 3PXJA 3DWTA 4CMHB 3IDUA 3NIFF 5J06A 3GZKA 4GKOA 1QACA 3QIUB 3I50L 4BH8A 1LO0L 4M5ZH 5DQDL 3CXDH 5M7QA 4WW2B 1QSFB 2X70B 3VRJB 1VFBA 1M6OB 3RPKA 2DQIH 4L3EE 3B6SA 4HHAA 3V5DA 1CGSL 3D85A 5ETUA 4RRPG 5L88H 1YY9C 1O5DT 3L3KB 3MV01 5GISH 4Z7VB 5F7EH 1T5XB 2QLVB 2ZZUT 1F8TH 1HOCB 3MLWH 1GGTA 5F1IB 2DYPA 1I9RL 1W72B 4XCEB 1LQSR 1DE4B 1VCAA 4DZBB 4JANB 1YMMA 3DRQB 1BPVA 1FG2B 1H0DA 3MUHL 3GBNH 1NUGA 5FA3A 4LSQL 3REWB 5EPMB 1DBAH 1IAIL 2DM4A 1U8HB 2PXYB 5D93C 1M1SA 4O2CA 4TNVF 5DA4A 5FFLA 4NYLA 5D7JB 3FKUS 5GHWH 2F5BL 4QRRE 4KVCL 5JW4Q 4V1DE 4KGJA 5JUEL 3RPIA 5E2UL 5CEZD 4UNTA 1J87A 4U1KB 3GSXA 3DXAA 3THML 5D71L 1BFSA 3GSRB 4W4OC 1DEDA 5I6XB 3OKLB 1FAIH 4AIOA 4UTAH 2E6PA 5DHVA 1LO2H 1GGIL 1J7VR 4MWFB 4M02A 2BJML 3VG9B 4I9WD 3BUTA 3CVHB 5L8JB 4PJAE 3Q3GA 4P4KD 4LLWB 1QYGH 5E9DE 4H5SB 2HFGL 1K4DA 1EFXD 5IUSA 1CFQB 4LKCB 1CG9B 3W9EB 1RZ7L 5MP6H 1SJXA 4Z7WF 1R3KA 1HKLH 2R0WL 5GRYA 3PGFH 3TA3D 3UJTL 1ADQA 3BKJH 4PJFB 3U0TA 5BXFB 2IFGA 2LU4A 5CGYC 1BWWA 5DC9B 3MLSL 4GBXC 3G9VA 1AIFA 2MSPA 5CHNB 4XPHL 5FO8A 3O4OB 4FP8H 4P9HC 4JJ5A 4JRYA 4U05A 4LCCC 3C9NA 5E2WH 3ZLQC 4FQLL 1MY5A 4PRHB 3CFKA 1R3HA 1L7TL 5JQHC 1TITA 3H7BB 3BGMA 3DUSB 3P9WB 2CRMA 2FJFB 3P4OB 5T33H 2PO6A 4OF0A 3D9AL 3UTTE 4BFGA 3OB0H 3ROLB 4LCYB 1N59B 3LH2L 3R0MA 5EB9A 4OSUL 1WT5C 4NPYB 2DIJA 3EO0A 2JK5B 4JM2B 5I1EL 5IESH 5MERB 3IFPA 1RZFH 4RMWA 5TE6L 1C8PA 2LVEA 4Y19D 2XN9D 5DC0A 5CIPH 3MTRA 4BYHA 5HDOA 3RWCB 3QIBD 3SDDC 3EBAA 2A6IA 3P3YA 1JRHI 1WITA 4PJIF 4I0PC 4MB4A 1U3YA 1KCGC 2GFBA 2GY7B 3HNVL 2R2EB 4JFOB 3OG4B 5HGHB 3R1GH 3OTTA 1CLOL 1MHCB 3DJ9A 1JPGB 5ICXA 3C8KB 1BIIB 4L3EA 5C0AE 4CMMB 5EUKB 3GSNL 1TENA 1RZGA 4P4RB 3GRWL 3L5XL 1D5IL 3BGFB 4OZGB 4RMUA 2H26A 3CUPA 3TZVD 1JFQH 4I48A 3KPRE 4MQ7B 1OAUH 3WFDL 1MH5B 1MHPL 2K9UA 5KVEH 3CDGB 1U2HA 3AREB 1AD0A 1UQSA 2OSLB 3RVWC 5D5MF 4LCWD 4Z7NE 3MRPA 3RIFK 2IALA 3BZFA 2Y06H 4F58L 4MJ2A 4PRPB 2R56L 4JY6A 2CDEA 1I4FB 4R97B 1AHWC 1JF1B 1FNHA 2AI0H 4UDTB 4UT7H 4TPRH 4X9HA 5TF1H 5DLMH 1XF2B 4M43H 4QRRA 3O3BB 3T0DA 4V1DA 5SWZD 1TMCA 5DMYA 1T22B 4CW1A 2KQMA 3GSQB 5EIIA 1WK0A 2A77L 1YEGH 2YD8A 4Y2DD 1GJIA 3BO8B 4TUOB 4YPGA 4FS0A 2XZAL 2R4RH 3BZEA 1A1MA 1RK0B 2PUQT 3HC0A 1PLGL 1AGDA 5KVFL 3BP4A 3SE3C 5FYKD 4OGYH 3WKML 5IT2H 4PJAA 5HVHC 2X4NB 3SE4A 4D0CB 1L7IL 2EEDA 2VLJE 2A1WL 2CMRH 2QADD 4G9DA 4WUUE 5D93B 5E9DA 4HS3B 2EXYD 4U6TA 4Z5RA 3TLRA 2CSPA 2H2PC 1S3KH 4LLDA 4UIMA 3FB7B 3ZL4L 3QO0B 2YN3A 4PJDB 1J11A 4NGHH 5ESAB 1N6UA 1PW3A 4WU5A 1AGEB 1LD9A 1TTUA 3FQWB 4HWZB 4A2LA 4QXTA 1EBPA 1S7VB 4KKCD 5IW6B 5LQBH 3WXWL 3W39A 4HWEH 3EYOA 5FKPA 5E6I