5SWZA

Crystal structure of np1-b17 tcr-h2db-np complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
277
structure length
277
Chain Sequence
b'GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
molecule tags Immune system
source organism Mus musculus
publication title Reversed T Cell Receptor Docking on a Major Histocompatibility Class I Complex Limits Involvement in the Immune Response.
pubmed doi rcsb
total genus 63
structure length 277
sequence length 277
chains with identical sequence F, K, P
ec nomenclature
pdb deposition date 2016-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5swzA01
3QIUA 3CH8A 4UNTA 5I75B 1X5ZA 3PJSB 3VWKD 4UUJB 3SDAD 4QRUB 1HOCB 5F6IB 1S9VB 5KSUB 1E6JL 2YUZA 5JXEA 5K9KA 1BEYL 3VDCA 1TXKA 2ZOLB 1UEYA 2ZUXA 1IKFH 2RCSH 2M2DA 2FD6L 1LO5A 3DV6B 3S36L 2W0FA 5IFAL 4PJCE 1UJ3C 4ZOCA 3CFBB 2X42A 3O3BA 5FHBH 3F12B 1G7QA 4JFEE 1BD2A 2E9JA 1MJ8H 4LNRA 3G9AB 3O11A 4IRJA 3Q1SL 4QF1A 4PJ7B 1I1FA 2AJVH 1RIHH 4N8CL 3MBEC 4MXQA 4ELMB 2VH5H 1LEKA 4W6WB 5FYJL 2BXYA 1UYWH 4XP5L 2FH6A 3DETC 3KHOA 5LGHH 1UCBH 4YHKH 4AEIL 3JTTA 5IG7B 2IADB 2RQ8A 4ORGB 5F1NB 3AXLB 2APTA 5ECJE 1WCQA 4FOMA 3WO4C 5L2JB 4M6NH 4U6VH 2WUBL 2NTFA 4XP1L 5E0QA 2YPVH 4NZJA 1IGTB 3QH3A 2OR9L 2FYYB 1RZJH 1OP9A 1ZKAA 4PG2C 3W5MA 2CDFA 1FZJB 5TE4H 3S35X 1K6QL 1A5FL 1ZA6A 1W0WA 3N50A 2B1AL 2YZ1A 5HHOD 3X13B 1LEGA 3D25B 3CVHL 1N5YH 2GHWB 3QIUB 3ARYA 1INEH 5DRXA 1NMCB 5F7UA 5EA0H 4Y5VB 4I48A 1E4WH 4WHTA 2VKWA 5I1AA 4WWKB 2WWMC 4TQEL 1ZS8A 3OHXA 3MFFA 2OI9C 4BFIA 1F2QA 4JFEA 4Z5RB 1KPVB 3MV8B 3VFUB 3OKDB 3VXSE 3LKRB 4OZGE 2WP3O 4EEEA 5HGAB 5DK2B 3IFLH 4CVUA 3EYOA 1EFXD 4NUGH 1DSFH 4HS8H 4PJ8C 1CLZH 4PLOB 3SQOH 4HV8A 5F93C 3GMLB 2IH1A 1UKQA 3MLTB 3MFGB 5IVXA 3VA2C 4L8BB 2DIJA 1MPAH 4XTRC 5DMIL 1A7PL 2V5RA 3KPQB 1M1SA 1RURH 4OI9A 1J8HB 4D2NA 4OCNC 2HT3D 4TUKL 2QQQA 2OJZH 4RMSA 4QHUB 4PJ7E 2JB6A 4XBEH 5SWSB 1QPPA 4I13B 5TF1H 4N9OB 3PWLA 3UBXB 2YMXH 4KDTA 3VH8A 2EYRB 1KIQB 4I0PD 4KJQC 4ZAKD 4YIQA 3S34H 5GGRB 4Y0GA 1SVCP 4NQXA 2QQNH 3CK0L 1T0NA 3F7QA 4CNIB 1AY1L 1L9MA 2VOTA 4JN1L 4UNVA 2AABL 4KMTL 3GMQB 1JNLH 2Z91B 3PV6A 4KH2A 3C6LD 2VMFA 3NCJH 1OAYL 3BX7C 5IGXL 4WTZG 1ZGLP 3TBSB 3TVMA 5JOFA 4Z7WB 4ZXBC 1QQDA 5C9JA 2JIXD 4M61B 2DQGL 3JTSB 4GH7B 4N0UA 2IH3B 5EO9A 3BD4A 1MUJA 1MCFA 3WFBL 3WS6C 5JXAH 3V4UL 1U58A 1FNHA 3FOMB 3SGKC 2VAAA 5CEZL 3CFJA 2QQKH 4HSQA 2J1KA 4GKOA 4X6DE 4MJ4A 4P9HL 4UI2A 2Y5TB 5KG9A 3RWIB 2V7HA 2DL2A 3VU2A 5IBLC 4OZIB 1EIBA 4X99A 1SM3H 5E2UL 2FBJH 1CK0H 5GS0D 3UAJC 2FX9L 2DAVA 2DLTA 4IRSC 4XP4L 2VLJB 1MAJA 4L9LA 4LLDA 5JQHC 4U2ZA 2HJKA 1SY6A 4TUJB 3MLRL 4HC1A 1I8LA 3I50L 5JW3L 3EJZC 1U8KA 4NDMA 1BFOA 2QR0A 1QUNA 2PTUA 4M7ZC 3VD3A 4OGYH 3V52L 3MJ9L 3NA4A 1DBMH 2XT1B 2W60B 3LQAH 1GXEA 3RWCA 4ZO9A 1A4JA 2AJ3A 2R56H 5LWYH 2NZIA 2WINA 3DECA 1DP0A 4R0LB 2VZ1A 1VKXB 5IV2A 1ZK9A 3T09A 4P3CH 3L5XH 2PTVA 1UGNA 2QV2A 5IFHL 3BGMB 5F3BB 2ZUQB 3FT3A 1AI1L 3V0AC 5DS8B 3W0WA 3UPRA 1GGUA 5ADPH 4CRPA 2GJ6B 2ZCHH 5ESAB 4B41A 3VRLF 3MA9L 5I66B 1TMCA 3HG1D 3PNWA 3Q6GH 2F54E 1G6RH 1EH9A 1PSKH 3V5DB 5B21A 1FJ1B 4FFWD 2CDGB 4G9FE 2QADB 5C08E 1ZT4B 4K23L 3S7GA 2EDOA 4LBEB 4RNRA 1S5HA 5INDA 4PJBB 2UY7A 4ZOBA 4LPWA 3V9FA 1GYAA 3O41A 4QHKJ 3TWCH 3EOBB 5I73C 1IEAA 3GJFB 4L3EA 4BQ9A 4RNRB 3SKJL 4XWOD 3G5VA 2XZAH 4LHUD 5DXWA 3ARFA 2Y7QA 3BIKB 4OB5L 5D7SH 2CXGA 4LRNL 3BP7B 1A9EA 3BP6A 1Z0NA 4RIRB 4IOFD 5DC4B 4LLVB 1SMAA 5E00A 4OI7A 1IGCL 3UTTA 4PRIA 1P4BH 2R0WH 4U2YA 3VFPA 3JWDC 2ZJSL 4Z18A 5E8NB 1UC6A 2BMKB 1MI5A 3C8DA 3OWEA 3QWQB 4BZ1H 4RIRA 3KLHD 4P5MB 1X5IA 3KGRA 3GSVA 4P2RA 1D5MA 2WQ8A 4LCWB 4U6HB 4DCQB 1J1PH 4EUPH 4OGZA 3CZJA 1NLDH 3CFCL 5D7LD 4LAQH 3HS0A 2LVEA 1LP9B 4YPGB 1OW0C 3L5WB 1J1XH 1V3MA 3VFTB 5JDSB 5HDBE 1T1YA 3PWJA 4CDGC 1HXYA 5EZIL 1CFVL 3HNVH 1QFWL 3R0NA 3T2QA 3VXSA 4NDMB 4XPGH 4AEFA 4AT6A 5JHDE 1V3LA 5TDNA 3S96B 2OXGA 4GKNA 1ND0A 3VGDA 3WD5H 1Y18A 4P9ML 5KSBF 5K9JL 1L7IH 1CGTA 1EBAA 4FXKB 4JHWL 5DJDA 3MA7B 3WUWA 3HC0A 4R0LA 2F8OA 1WLHA 4Y19E 1SJVA 3LN4A 1IBGL 1SQ2N 2IQ9H 4R2GB 4FQXB 4S1SH 1RPQA 2CPCA 2IAND 3U1SL 2X4QA 5ITBL 2CIKB 1P2CA 1AXTL 3MNZA 4IRJB 1YEEH 1H3GA 1RV6X 3MGTB 4R7NB 3DX9A 5EDXA 2R9HC 3SGDH 3NFPA 1GZQB 3ARVA 4PB9L 2X41A 1G7PA 5L88L 5EZLA 3UTSE 4ZXBD 5D2NE 3N85L 5C0AA 3WN5B 1BIHA 4X9GA 3RWFB 3MTRA 2HLAA 3UC0H 2FBOJ 5BO1L 2WZPD 3P9MA 4X6CA 3PQYE 2XKNB 2ARWA 3IF1A 5IR1B 3Q5TA 2GJZA 3DRTB 1E27A 1KXTB 4C4KT 5KG9B 3RKDD 3PL6B 2VXUL 3G6DL 3QXVA 4LSDA 3D48R 4ZODA 1ZEAH 4I0PB 1ORSB 1IQWH 5CMAB 4DN3H 5D6DA 1ULVA 5GGTL 1MQKH 4GQPH 5C6TL 1UVQB 3MRNB 4MQ7B 1IC7H 3RVWD 1OARH 1RK1B 1H3UA 3I6GA 4M6AA 4XPGL 5C0IB 1UYWL 4XP5H 1R3JB 3MR9B 2P5WB 3L95B 2MQ3A 4YBLC 3QWRA 4JVWA 4G8EB 3MJ8B 4XBPA 4PV9A 4MJ6A 1YNKL 5BZDB 4GXUM 2CQVA 3GJFK 4UV7L 5GRJH 2OMNA 1MF2L 2DB8A 1HYSC 3PQYD 3CC5A 2R1XB 2XRAH 3CSYB 4JKPL 1OAKH 4UDUA 3GMLA 5JORA 3UXFA 1LE5A 3QUYB 5CFHA 1BMGA 3MLTA 4MJ2A 1QA9B 3QEHB 3FB8A 4H0IA 3S4SB 1JHKH 3HPJA 2DYPA 5I1EH 1U3HA 3FQNA 3UBXA 5MEND 2Q3AA 3NCFB 5DI8B 1P1ZB 5ITBH 5I1KH 3BSZH 4YZFF 3KS0J 4YWGH 1ZS8B 5I9QB 5JA8B 3LPFA 1KCUH 2X4PA 4XCYA 1JK8A 3UTSA 2VIRB 3U9PL 1EBPA 1HKFA 2B2XL 4PB0L 3NA9H 1S7WA 2B5IB 3PWUA 3HTLX 3C5SB 2SEBB 1AGCA 3M45A 3BIBX 4ZUUB 4JZJC 1WBZB 3EZ8A 3EW3B 4DFHA 2C4XA 3Q2CA 5JNYB 4DWHA 1TZHB 5EA0L 2BFVL 4LQFH 2D0HA 2OTWB 2W9DL 1UA6L 3EGSB 2ICCA 1N4XL 4HC1L 4X8JA 3WN5A 4OV5B 4XWGL 3C2AH 3VXNB 4IOFC 3O3DA 1OLZA 3ARPA 4L4VD 4Y5XC 1FZJA 1VADB 4WTZA 1MCWM 4D3CL 4EN3D 4HKBB 5J0BA 5JXEC 2EDQA 1RUPL 2J8UA 3O6ML 1MHEA 4TVPD 5GJSH 5LCVH 3WHE1 4E41D 3LAFA 4XCNA 4KK6C 5HYQB 2XQBH 3MNZB 4MCYA 5EIVA 5HJ3A 4WW2C 5KVEL 1RK0A 4Q9RL 4O58L 4P5TC 2X4OB 2F54A 1QZ1A 3FL7A 2P48B 1QYGH 3BGFB 2E27H 3DURB 5ADOH 4HT1L 1YYLH 4G5ZL 1KB5A 43C9A 2CO7B 2IANE 2F54B 2NY6D 3FZUC 1UM6H 4OJFL 4PJAB 2DI9A 3GHBL 5HDOA 1NCDL 4LHUB 3QIBC 4PD4J 5ALCH 3JTCA 3RY4A 1Q0YL 2ENYA 4PJ7A 4M00A 3VI4F 3RKPA 3ZYZA 3ZHKA 3G04A 5T33L 1U3JA 3MMEB 5T1LD 2MCPH 2FSEB 3DVNB 4AH2A 2A9ML 3MGAA 5D7IB 3L5WA 5TE7H 3O41B 3BRDA 2VERN 4NC1E 1QSEA 2RGSA 4PB0H 3OB8A 1AY1H 2WBJC 4BA8A 4X7TB 1MHHA 5B3JE 2OL3H 3EO0B 4NC0B 3CGTA 4O2CA 4ODVH 3IAGC 1BVKA 1CDUA 1S9VA 2UWEE 1DR9A 4LLAA 5KSUA 4F8TA 2XG5A 4MJ5B 1TPXB 3F7VA 4DVRH 1OM3H 4G42A 3BGAA 3GMPA 1GOHA 3BKMH 3UZQA 4JM2A 1UJ3B 3GMRB 4D3CH 1T2XA 5EOCH 3WS3A 3I02A 3OKKA 2AJ3B 4MNQE 4PJBF 5DUML 2ESVD 3GSRB 2XIDA 3VFMA 1LILA 3P0GB 1S9XA 4JAMA 2UZYB 2W60A 5EUKB 3VMPA 4RZCB 3VGFA 4NCDA 1KPRB 4J7RA 1A3RL 1MAMH 4BK4A 4PJ5A 3VRJB 3RZWA 2V6HA 5HHNA 5CJXC 4PV9B 1LHZA 5HI3C 1NANH 3UO1H 3OKMB 2BVPB 1FCCA 3WO3B 5KVFL 5FIEA 4NO3A 5CCKL 1OSZB 1AQDA 2AXGB 5IHUL 4DKEH 4R97B 5CGMA 3TZVC 4DW2H 5HPMA 4MX7B 1K3ZA 1FVCA 1FO0B 1CIDA 5L2KB 1FLRH 1U58B 2A9MH 5I1DB 5C0EB 2XTJD 3PIQA 2J8HA 4OZ4B 3BESR 4LF3A 3RA7L 3GHEL 4E41A 5F9OH 5FCUH 4NZTH 2ZZUT 3RX5A 1C5BL 1QLRB 4H1LG 4PJAE 2OQJA 4LAJH 4XCCL 1W2KT 3FQXB 3U2SB 2DKUA 4DAGH 3BE1L 3BQUA 4UIKH 3K4ZA 3GRWL 1T5XA 3MBXL 1T7ZA 5GGVY 3SJVA 3X3FL 1QPXA 2FR4A 2VDKL 2ZPKL 5T5FH 4WHDA 3BT2H 4CBPA 3TWCL 2P1YA 4OZGA 1OGAA 2AKRA 3WUWG 5J1TC 4I77H 2HVKB 3L3DA 4JKKA 5JUEL 5F6IC 1RIUL 1Y0LB 2Y36L 1REIA 1T1WA 4QHNB 2GY5A 4G6KL 2ZG3A 2IMNA 3K1KC 25C8H 3RGVA 4G3YL 5I1LB 4FQXA 4OZGB 1HZHH 3QRFM 2YRZA 1A7QH 1I9IH 3VXME 5GZNC 1D7FA 5IEHB 5EIQA 5J12B 5IOPB 1PKQA 3DUHA 5HYEA 1CG9A 1QFHA 2DICA 2H8PB 1QSED 3IDIA 1S9YB 1C12A 4KJYB 4OM0H 4NQDD 4EKXA 2R15A 4UAOB 3K2MC 3MXWH 3K8KA 1MIEL 4KKCD 4TSCH 4LAQL 2QSQA 1L0YA 1FAIH 5K9QG 4UILH 2E8YA 4HGKC 1MOEA 1QP1A 2NNAA 1OSPH 3L3GA 3TH2T 2MQ0A 4RGNE 4YIQB 5DK2A 4OGAC 5FECA 1RJYB 1NGWA 5D2NC 2YPKB 3T4YA 4EUPG 4YE4H 1UXWB 4IS6B 1TFHA 3QB7C 1J8HA 1WISA 3Q3GA 3F7YA 5AZ2L 2ATKB 1CT8A 3WD5L 1KJVA 2E9WA 2HH0L 2P8LB 5C09E 4ZUWA 1J0KA 4FQQA 1N7ML 1U91A 3KPQA 3DRTA 4L4VB 5CS7A 1J0ZA 4LRIC 4QY8A 5C0DB 1LQSR 2JJWA 4IHOA 3EJYC 5FO7B 4HV8B 4JPVL 1QHOA 1I8MA 3MUGA 3OX8A 3WJJA 4WUKL 1PEZA 3BMVA 2XY2A 2DQJL 5DZNA 5TDOA 1BX2A 3GI9H 1GZQA 1KENL 3GNML 1F4YL 4LPUA 1Z9OA 4WWKC 3PL6D 1YEDB 3FN9A 4OFPA 4KKNA 4WHTB 5C0AE 3TIEB 1JCKA 5I30L 3QJHA 5LJYH 4F9PC 4PV8A 4JRYA 1DTUA 3AU1A 1VERA 3UPRB 1OTUD 4CMMB 3L6FB 4F15C 1U3HC 2XZQH 5F89B 4XMKH 3LSOB 1IVLA 1Q0XH 1CICB 4IIQA 3ZDYF 1LNUB 2P5WD 3M1BA 1ZTXH 5FOBA 4ESKA 2V2TA 3JUYA 4C54A 2K7QA 2X89D 1A8JH 1N8ZA 4RBPH 4CJ0A 2Q8AH 4EQ2A 4GBXD 2CJUH 3FHQA 4HMEA 1ADQH 2F5BL 5BRZA 3N0PB 5IJVB 1MJUH 4TULL 2D0GA 3A6BL 1R5VB 5DVKA 3REVA 4QO1A 4RWHA 1MFCL 3RGVD 4FTVE 3U83A 3TZVD 5IMKA 3ILQC 2Z35B 3LKSB 3AY4C 4GMSL 3FT4B 5AD0B 2VLME 1KB5H 1KLUB 4H0HB 5HDLA 4Y5XA 1MI5B 2CLVB 3RWIA 2IAMB 4JPVH 4CN4A 3LKNB 3UTZA 3QUKB 3MA9H 1HHHA 1GRWA 2PN5A 2LVCA 5DJYB 4XBEL 5JHDB 5LXGL 2KL6A 2ZNWA 3BIKA 4UT6H 3TF7A 1ZHLB 2J2ZA 4TVSa 3MLWL 1N6QH 4HBCL 1EGJL 2L4OA 1MRDL 3S36H 1G7MB 4F37F 4NSKB 4HUVA 4EN3B 3MRMB 3IRZA 2Y9RT 3BHBA 5BQ7A 2FJGA 2FECI 3E6FB 3VDAA 4LPYA 1CD0A 3TYGL 3FO2B 4HC1H 1OGTA 1WTGT 3WNKA 1CGWA 4FQQB 2BJMH 3SDCA 2CRYA 1S9YA 1JPGB 2NXYC 1QSFA 3FQWA 3T1FB 1XF2B 1D9KA 5HYSG 1AFVH 4EDXA 4JJ5A 1A6WH 35C8H 3ZDXF 4ZUTB 4RQQB 5CUSL 4X7EC 2KQMA 1JPSH 4UINL 2OK0H 2EO1A 3ZT5A 4I18B 5MI0C 1QBLL 2WW8A 5DLMH 1JV5B 1G6RA 2YD1A 3VG0H 5I17A 4OCWH 2ZKHL 2ORBL 3LIZH 2B39A 4P3DA 2VLRD 3HMXH 2WUBH 4XP1H 4QRPA 2BY3A 2GJZB 5D1XA 5JORB 4K3EH 3PL6A 1IZJA 1YPZB 1MREL 2VZTA 1R3IH 1KPUA 4FS0A 1U9KA 4U33A 2XWTA 2Q7YB 2XKNA 3A67H 2PYED 3QFDB 3DI3B 5HHPA 4BSWB 3ECBA 2VJXA 3IDIB 2GJ6E 1DQQB 1NLBL 1WT5C 5D1QC 5IMLB 3F7PC 1FZMB 4QHKI 5ISZD 1F13A 4OZIA 2NXYB 4NQEA 1HSAA 3MRCB 2EDWA 1JVKA 2HN7B 1RZ8A 3IJHA 3K1DA 4MB4A 1FL3B 1DQJB 3DXAE 1U0QA 2AJXH 1GGYA 1FGVL 1IM9D 5I1IL 1BQUA 1J87A 2NY4B 2YA1A 3TBYB 5CJXA 4GKZA 2DKSA 4IDJL 4NQDB 4MA3B 4JO1H 1YZZA 3KXFB 4F7PB 2D4FA 5HDQL 1GCFA 1RU9L 2PCPB 1B6DA 2C3XA 5FA3B 3RDTA 2XXCB 2BDNH 5I6XC 3MC0A 5FYLE 2R69H 1YPZA 4NJAL 1UWEL 5E95B 1FFOB 2Y72A 3EDEA 4KDWA 4R9HA 4FTVB 4R26L 2VXSL 3CFDA 5TGBB 4WFFD 3HLAB 4Y2DC 4I18A 2HLFC 3S5LB 1RULL 4NCC1 2FO1A 3T0EE 1LGVA 3NFSH 2PXYB 4NZRH 1CU4H 1YC8A 3UO1L 1I8IA 5E08H 3B4NA 2ZJSH 4NBYB 1L9NA 3F6LA 2EDEA 2HVJB 4QCIB 1BZQK 1W72B 3HUJA 2GAZA 5CCKH 3OKMA 2V2WB 2K1MA 4FZ8L 5I8CB 4PRIB 2LAGB 5CBAB 2CUMA 5JPNA 3E2HA 1TVBB 4HD9A 4JN1H 4P5KA 2VLKA 1YY8B 1CBVH 5EO0B 3SE8L 4KWUA 4BSJA 1T03L 1BX2B 1XR9A 4P5TD 3TO4B 2ADGB 3HE7B 2C1OB 5GS0H 3G6JA 1OF2A 3C2SA 1LP9A 5INDB 3LHPL 3CFKA 1CFNA 1U2HA 3TFKD 4DCQA 3V5DA 3MFFB 5JHDA 5DMJB 4Z7OF 3JV4A 1CICD 4G42B 4PJAA 5C6WH 1G1YA 4BFBD 5K9JH 4MZ2A 4G6FB 3GMPB 1XF5A 5D72L 5DRXB 1FG9C 3TLRA 4FQ2L 4WFEE 2XN9B 1KLUA 1E6JH 2V7NA 4NKDA 3STLB 5I16A 5IV2B 3DVGB 1RIUH 2EKSA 2R29L 3C09C 5EZOL 1QSEB 4XRCB 1MFBH 2BSRB 3GKWL 5DQJB 3G04B 5FYJU 4ONHB 3MODL 5HHVL 4YHOL 4FN0A 3ULUE 1YY8A 1G7IB 5DHYA 3ILQD 3PV7A 3I9GL 5EIIA 1KEGL 4PGCB 3HC4H 2DQTH 3QI9A 3T0VA 5GRWA 1T1ZB 3HUJE 4YHZL 2FGWL 5IM7B 1G7HB 4DK3A 1CDGA 3IFOA 1A6VL 5D8JL 3MJ6A 1RAMA 1F4WH 5DJCA 4O9HH 5LBSH 4K71C 3FAWA 3FKUS 5KAQG 4HXAH 1KT2A 1AI1H 4PJEF 4GO6B 4MXWH 3RTQC 3V5KA 1KLGB 2HTKC 1Y0LA 3MZTA 1NANI 5HJ3B 2OTPA 2AJSL 4NKOA 3C09B 5FGRA 3Q5YA 4Z7WA 1J8HE 5AYUH 1H3PH 5CIPA 4HK3J 5HI3D 5IESL 3U0WH 4NQSB 2X05A 1OPGL 2A0LD 3LKPA 5F71A 2EEDA 4BH8B 3X3GL 3SKJH 3U2SA 3GMQA 2VDLL 2FNBA 4ODVL 3JWDL 4MJIB 2RBLA 1INEL 3DXAD 1YDPA 1F3DH 1VFOA 1A6TB 4I2XB 2GK0A 4K9EH 4L4TA 2YD6A 4MNGB 5TFSH 5EFIA 1MLCA 3RWEB 3WXWL 2VZUA 3L95A 5C0EA 1YYMH 5I0DA 2VLRB 1A14L 5D96C 1HCVA 2BNRE 2IALB 4Q9CA 4XB7A 2IPTH 4XVJH 1B88A 4GAFB 4QGYA 3TPUE 4JFZH 1IAII 3QO1A 3S98A 2VLKD 1RZ8B 4ZOAA 2QLVB 2OZ4L 1XGPB 4Z78A 4NUGL 4I4WA 1HWHB 2PYEB 1RHHA 4OT1L 3V6ZA 1S78C 5DWUH 4O51A 1B0RB 1IGFH 5AAWA 2NY3D 2Q7YA 3H9YA 5ISZB 1K5NB 5FM5O 4NQCE 2G60H 3ES6B 4GMTL 4LP4A 4PJEE 3MRMA 5F96L 3BZ4B 4Y88A 1FNFA 5C1MB 3OKOB 3TZVB 3ARBC 4P2QD 5FOJA 4UMGA 3VH8B 4RWYL 1EV2E 3MUY1 3TO2B 1NC4A 3OPZL 5HGAA 2AJVL 4U1KB 5J06A 3MRFB 3MLSL 3RBGA 3EYFA 3ZE0E 1HINH 3GBML 2ESVE 4PR5A 1S9KC 3X17A 3QIBB 5EUOF 4G43A 4MA7H 3BEWA 3FN3A 4IOIB 3N9GL 3QHZH 1A64A 2WLYA 4LSRL 1FGNH 2E27L 5MP6H 5E8EB 1NCBL 3MLVH 2D7PA 1MQ8A 1Q72L 1S7QB 4HEME 4NRYB 5GRUH 4KROC 1OP3H 3S3JA 2HRPL 5GJTL 2BCKA 4JDTH 4Q74A 4OLYL 5IVOA 4HK0B 1Q0YH 1NEZG 3OXRB 3SKMA 5I19L 3QI9B 3MRGA 4X4YB 4ZFZB 3LKRA 2MCG1 2H32B 3EOAB 3BDBA 1NQBA 4KVNL 5FYKL 1FFRA 2XNAB 3TA3B 2O5ZH 5E6ZA 5HI5D 2W0LA 3TV3H 1LMKA 4ONHA 1TJIL 2XFXB 2APWA 3T08A 5AWNH 3CVHH 3HNSH 5E2TH 3H6JA 4FXLA 4DJMA 2IAMA 4OT1H 1SM3L 5E2UH 2DM4A 3IJYB 2PW1B 4ZOEA 4CMMA 4XH2A 4OKVA 1DBAL 4DQOH 1CIUA 2ZUVA 1KULA 4Y4HA 4HKZA 3D3VB 4OM0L 5BW7C 1V3KA 5JW3H 1CFTB 1YNKH 2DI7A 4G6AC 5E6ID 5BRZB 2EZ0C 1Z5LA 5EOCL 1W0VA 4JR9L 4J6RH 3GUTA 1NUFA 1EEYA 4L4TD 2B4CC 5I8OH 5D5MA 1PZUB 3HG1E 3PWPA 2R8SH 1CFNB 3MRRB 4Y16B 3UCRA 4KZDH 3ZKND 4PJXA 5JLZA 5C09A 3SE9L 4YHML 3BIAX 1DVFC 3L5IA 4JLRB 3OAUH 5I1GL 2VL4A 5FM8A 1WUNT 5FB8B 1MREH 4FNLH 4M6MH 3G6JF 1JZ2A 1GC1C 1UJ3A 1Z9MA 4NBXB 4HIEA 2XY1A 4YHPA 1MJJA 4MNQD 1SYSA 4HG4K 2GJ6A 4XX1E 4F7MB 1G6RL 3RNQA 4M7JL 1T80A 5I19H 3JZ7A 3VXTB 5A16A 3HFMH 3IAQA 4NJ9L 1A1NB 5I8KL 1RZ7H 3KLAA 4R90L 4FFVC 2Y7QB 2RCSL 4LCCA 5EC2B 4FQHB 3VMNA 4IMLB 2JCCF 1G9MC 2X70B 3RA7H 4DKDC 3AREA 4Y2OA 4PJ9D 5HHXL 3QR2A 4KJPC 5KVGH 3KPOB 4HGWB 4LCCB 5EC2A 1BBJA 4HUXA 3O6MH 1RUPH 2ICEA 1MCIA 3W0WD 5LCVL 4V1DB 5C0BD 4PJGB 1BVZA 2F53D 4IRZL 5EOTB 1VGKA 3P0VH 2GUOB 3EYUL 2FX8L 5F70A 4ACPA 2ZPKH 5T5FL 1BAFH 1C8PA 4NHUA 2P42B 5IWLC 3RL1B 2YC1B 2MOVA 1M7DB 2X4UA 2XTLA 1GGIH 3KVQA 3Q0HA 4NIKB 4TYUA 2H41A 4L5FL 1ZANL 4EOWH 1N2RB 1JHTB 3HNVL 5I9QC 3MV9D 4RFNB 1TIUA 3KPSE 4LSPL 5EBWB 1IT9H 4H20H 5GGUA 3GUTB 5D2NB 5JOFB 4ODSH 3LDBB 3BD5A 1MAKA 4WV1B 3A6BH 4UNUA 1GPOL 5HHMA 3WIHH 5HHPB 1AGBB 4HS3B 4I3RH 4YHYC 1U95A 1VEPA 5C3TA 3GSXB 5F3HA 3ARGD 3IJSB 3NN8A 4HUUA 3WIIH 4TTGA 4ODUB 3TESA 3T8XB 2EC9T 4LF3B 43CAB 2D31B 1T89C 3NFPB 3QDMB 4AG4H 3CXDL 4ZSOA 4QRRE 2NY0D 5DJZA 1IMHC 3MXVH 4G6JL 3OV6A 5ID0A 1G6RB 4RX4A 2LU7A 2AKRB 2NY2B 2CKBB 7FABH 2WM0A 4XXCA 5ESQA 5DRZA 3MA7A 4P9HC 5KSBE 4H5SA 5CWSB 4ZQKA 1FZMA 2H2SC 2BSSB 1YUHB 4NGHL 3P0YL 4K94C 2GCYB 5C0FB 4UDTA 5IHZA 2EH7H 2AJUL 4NQCD 4PJGA 3P0VL 4OCRL 3U9UA 1A47A 1RIVL 3QFJD 1AO7B 3TYGH 5GSVB 1YEJL 4S2SB 3HR6A 4ZFOL 3D69B 4P46A 1JIBA 3W0WE 1SEQL 3VXRD 1KELL 5TQ2H 3RY5A 1WFOA 1XZ0A 1PX3A 2XYCA 4UB0L 2ICES 5CUSH 5FGBA 2VO5A 3IS1X 5AEAA 2ICWJ 5IHUH 3GSQA 4XAKD 2J4WL 3MRDA 1IGCH 4ZD3L 4YBQD 4YHZH 4DUXA 5I15H 1A7BA 1NMAH 3PP4H 5T1MA 3P30L 5H8DA 4FQ1L 3TNMB 3T1FA 3TYFA 5T1KB 2DQHL 4LCWE 1OAKL 1URLA 3L3IA 4UTAL 1JGDB 3LS5L 1K5NA 4TPRH 4ZSOE 4GT7A 5FKAA 3CLEL 4Z9KB 2CO6B 4DZ8B 2DQFA 4UIKL 3KHQA 3BN9C 2V9QA 1C16B 3GRWH 5EZLB 2YD4A 3FQTA 4AIXA 1KIPA 2DQGH 4HUNB 3DX9B 2Z4QB 4Y5YB 1U8OB 4JM2B 3QO1B 3VXTA 1ZAGA 4HXBH 4BFIB 1ZA3B 4MD0A 4OCXL 2QQKL 4HKXA 4XBGB 4OIAA 1T0MB 4QT5A 5I1AB 1XF4B 2ZCLL 3OMZA 4KFZC 5D1ZA 3GI8H 2ARJA 4GBXC 1FO0H 1A6TA 4MNGA 1KB9K 4JM4L 2IFFH 4AIOA 2XICA 1YEJH 3U1SH 4DUVA 4JO3H 4X9IA 4PUBL 3DUUA 1A7RH 4XNMB 3C87A 3CX5K 3O2WL 2BDNL 3DNKA 1KF9B 2JCCA 1I1AC 4Y16A 5DHYB 3KPNA 3PWJB 1JWUB 5DFWH 2BVQA 3MV7D 4OGYL 1MH5B 4AL8L 1F8TH 4GG6E 4J23A 1RZJC 2PXYC 5L2JA 4QXTB 3JSSA 1WIOA 2JCCB 5K93A 1VGEL 3GMOB 1LNUA 4UIMB 5ABDE 3BZEB 1C7TA 1NCAL 3GKZA 5B8CC 4Y4HB 4NWTH 4NKDB 4TVPL 1GVIA 3AS0A 2P8PA 3EUUA 4HIHA 2DQHH 3WSQL 3EHBC 3MBEB 1UH3A 2J7LA 3WNPA 1AFVL 1E4JA 3NCMA 3RVXD 3QUXD 2A74A 5I71C 1HSBA 1P9MA 1JK8B 5CD5C 3NBNA 1RZGA 2YD8A 4HIJA 5I0ZA 3EYFB 3B8YA 2X4NB 4L8SB 1KFAH 1OAQL 1UWGL 3T4YB 1J05A 2I5YH 2ITCA 3V4PL 4RGOL 3L9RA 5MP6L 2GFBA 4LRIA 1YJDL 4GKSA 5I76B 2OTWA 2ZUWA 3JV6A 4NFDA 1FFPA 2ZCLH 3D85B 4X6CF 4NRYA 4P23C 4I1NB 5CBAA 1T89A 1ONQB 1ED3B 3QIWB 4JDTL 4XPHL 1J5OL 4L3EE 2YK1L 5JIPA 4BQCA 2E6QA 3C60C 5D72H 4KTDL 4DVBA 2DLIA 5J6HA 4ONFL 3QUMA 3BSZL 3I6GB 1Z3GH 5EZJA 3B2VL 5H37H 2O5XL 5HYJD 4XPAL 3ARUA 3ZKXB 2X4PB 5BS0E 3VGGA 5SX4H 2B2XH 3OZ9L 1MCEA 4LSVL 2R29H 4PRNA 1ZGLA 4PP2B 3PDOA 1MCQA 4K3JH 5FGSA 3FB7B 1ES0A 3MODH 5HHVH 3N1PC 3VWKB 4PP1C 8FABA 2GK0B 4I2XA 4L4TB 3FFCB 1BLNA 3RHWK 4MHHI 4NWTL 3OAYK 4TVPH 5B39B 4E9LA 4KJYA 3HC4L 3H9SB 3OJVC 4CW1B 4OKDA 4OIBA 2J8UF 1BZ7B 3GSOB 5E03A 3BUTA 4MCZB 3VXPB 1P6AB 2R9HD 2VE6B 4UDTB 3EYSL 1IRAY 5E9DA 4XZUA 5E99L 2MHAB 1BOGA 5FKPB 3FB5A 1R24B 1CDYA 3FOLB 4PJIA 4HPOH 5DMGD 32C2B 4QHNA 2JJUA 1IJ9A 1SYVB 3VXUA 1FFQA 4MD4A 1J1OH 4P4RA 4O00A 1WFNA 2HAZA 3WL9B 4J12A 4P48A 1YMHB 1FL3A 1KT2B 4OF8A 3CLFH 5D7LA 5JQ6L 3ULVF 3V95A 3TO4C 4RAHA 2GSGA 4Z7OE 5GRVL 1YDPB 2PNDA 3U7YL 2H3NB 1NCDH 4ODHL 2EYSA 3B5GA 1Q9LA 4JPKH 3WV0A 2LABA 4URTB 2BNQA 5A3IC 1BQSA 2JIXB 5JHLL 1CE1H 2WUCL 5DEFA 3FMGH 2FWOB 1T0NB 2FLRT 5MHSD 4M43H 1JZ5A 3DSNA 4NKOB 4H1LB 3QDJE 4S10A 3ZDXE 4HWZA 2UUDH 5GHWH 1J18A 1VHPA 3L3JA 4M93C 1WWWX 4PRNB 5J13B 4NN7B 1JWMB 4K7PL 3STLA 5I16B 2NW3A 1WICA 3GB7B 1Q9OA 3GSVB 3W82A 5AZEL 1QHPA 2H26A 1ZWIB 2BVPA 4GW1A 2NQCA 3VG0L 4WWKD 3FB6B 4KTYA 4PJ8A 1YMMA 3S9DB 2WIIA 1IGFL 1LP9E 3SDCB 3IGAA 5D7KD 4F80A 3ARTA 4LARH 3F12A 3VFMB 1YNTB 1QSVA 1RZIA 1B90A 4MQXD 4EOWL 4O02H 5D7IA 1AXSA 4JDVB 5FUCE 3U30C 4L9DA 1ETZB 2JCCE 2DDQL 3QUYC 4PJHB 4OZFB 1QBAA 3WHXA 1ZT4A 3GK8H 4PJ5E 5ACLA 2F8XC 1DN0A 2E7LA 1L6ZA 4M7KH 1H8OA 1FNEB 3F7VB 4MXVE 4I48B 4TNWK 4PYHA 3L7FB 3O6LH 3FRPA 4EN3C 2N7AA 5F3BA 5JXED 1PX4A 1VFAA 4KV5E 3GZKA 1KJ3H 5DR5L 2PYFA 2YRPA 4H26B 3BP6B 3TNNA 4X4ME 5DUPH 3V0WH 4MXWL 2DTML 3E6FA 4O2CB 3JV6B 2X4OA 3E6HA 4Z77B 1UM5H 1LD9B 1UB6B 1H8SA 1CVSC 2PETA 3OKLA 1UWXH 1GGTA 1G84A 2A83B 3FHAA 1S9WA 2Y06H 5EU6A 4KVNH 5FYKH 1F3DJ 3QH3B 4CGTA 3P11H 3V0VA 4HKBA 3KPNB 3FO1B 2DYPD 3TT1H 5KSBA 2OYPA 1EJ6A 1QG3A 5IVXF 3GBNL 1RULH 1CF8L 3WDIA 1MHPL 3QT2A 4ORGA 4O2FB 4LCWD 4JFHE 3FN0H 4XVSH 5ESVB 4WNQA 5JUEH 1TVDA 1JJUA 2A0LC 1CQKA 5B38B 3LH2L 5EC1B 2NYYD 1DCLA 1T1XB 4XC1L 2MFNA 2X4RB 4UBDC 2IH3A 2R2HA 2PO6C 3D85D 2EE2A 1F11A 5I15L 3MREA 1KIPB 3MRGB 1AE6H 4X4YA 3VD9A 1JUFA 2IBBA 3MLPA 2D7MA 5DEFB 4GQ9L 2NY4C 4KMQA 1ZHKA 3ALWA 4M6OH 4R96B 3RRQA 1JTOA 4HH8A 2VXTH 5DD6B 1SMOA 1QACA 4HFUL 4GUPA 2Z8WC 5FO8A 3VXNA 3B2UD 3WUZA 2Z8RA 3OX8B 3WFHA 4I3SL 4MAYC 1ZV5A 1KJ3L 5DR5H 3O6FA 4QY8B 4Y4KD 5C0DA 1YN6A 3OBAA 1MCHA 1GOFA 3MROB 1WFUA 1KOAA 1RZFL 3KXFA 4OZIF 4XBPB 1DDHA 1CYGA 2AGJH 5E9DE 2H9GA 3FTGA 2VAAB 3HI6H 2ATPB 1T7WA 3MLSH 4IDLA 4MD5A 3MRHA 4UT6L 1ZVYA 1KB9J 4M7LL 1EFXA 2VUOA 8CGTA 3L5JA 2VSCA 4Y5YA 2HMID 1E4WL 1Z6JT 1WC7B 5A3ID 3G6AB 4OLXH 1WSST 4Z95H 1P1ZA 3TZVA 4KU1A 2IC2A 1D6EB 2VLJE 4PTTB 2J12B 3SDDB 5IB5A 4WI6A 3FQRB 3VFVB 5F88B 1L4IA 1D5ZA 2A6JA 1ROWA 5BZDA 4ETQA 2VZSA 1WBXB 4NHCL 3ME0A 4F9PA 5DFVC 2YR3A 3SDDA 3JWOH 3EO1B 5F88A 5DA0B 3A6CH 5IOPA 4HPYH 1IE5A 4S1QL 2J6EA 1IGML 1OTSC 5CIPH 5I17B 3C5ZC 1CT8B 2EYTA 1C08A 1N6VA 2O5ZL 3BAEH 3WFDH 2W9EH 4N90D 5DD5H 1K85A 4U1JA 3H3PL 4WW2A 1KCRL 4WUUA 3LKQA 1UKSA 1UVQA 4P23A 3QXWA 3HNSL 4ZO6A 3HE7C 5C0JB 5J57B 5DHXB 4L5FH 4MQTB 1WF5A 1BFVH 1TTFA 5FO9B 5FUZH 2BC4B 2IWGA 4XMKL 2MTPA 4QLRA 2G5RA 4LDOB 1MRFL 3MV8E 4ODUA 2HLFD 2MWCA 1HDMA 1NGPL 2C3VA 1U8HB 5HI5C 4N0RA 3TVMD 1WEJH 3IU4H 3FO9B 2AJYH 4C58B 5INCA 4QRRB 1RHHB 3JVGA 5F1IB 4PREB 4YR6A 4FHBD 5BRZE 2NY1D 1YJDC 3QEQA 3QDME 1IEBA 3KNBA 5IK3B 5D70H 2EDLA 4GRLA 5ITFB 5IGXH 4GW4A 3UMTA 5T3XH 3H9ZA 2CIKA 5HI4D 2OR9H 3WXWH 4PGDA 1J12A 3CVHB 4QOKE 3T0XA 1KSRA 3HZMA 4WWID 3DGGB 5C7XH 5D1XD 1YN7B 2OL3B 4JO1L 4N1EA 3RL2B 1FN4B 3UJJH 3D9AL 5BJTB 4JM2F 4X6DB 4ODWA 2CKBL 2DD8L 2HWZH 4AIZA 4PBVC 4LVHC 5K9OA 2VL5B 1QRNB 1BGXL 2XOTA 3QBTB 4Z7VB 5DJ6B 3SGEH 3H42L 1S7RB 3DI2B 5ICYA 1OTTD 2EIDA 4XP9H 2GTWA 3NH7H 4Q6IC 5IJVA 5F21B 3MLWH 3C9NB 4Y2DD 4M1CC 4YZFE 1Q1JL 1HI6A 4WI9A 1BBDL 3G08B 4KK8D 3IAPA 1KELH 5F9AC 1CL7H 2AAVA 2NW2A 5JPMB 4FQHA 4W4OA 1O7VA 5K9KB 4FA8A 2W92A 4MX7A 2V5SA 3I02B 3NPSC 1T3FA 4X6BB 3HPLA 2QTEA 2IFGA 3RWDA 3H9HA 1DBKH 1RFDL 1MCBA 1P5UA 4UBDD 3DO7B 1J0HA 4NO5A 3B6SA 4N5UA 1N7MH 1G0YR 3H8NA 4XNYH 4ELMA 1ZLSH 3LDBC 5J89A 5ILTL 5I1JH 1MJJB 5IFHH 1IAOA 3MLVL 1VFUA 4M9OA 2AEQL 2NZ9D 2ADFL 4QYOA 3LS5H 5BMFH 1DJSA 3U4BH 4OZHE 1IL1B 3ARFD 2GFBB 3AB0C 4IIQC 4ZDHB 3KYMB 4X6EA 2APBA 3T1WA 4XX1G 3MMEA 5EORL 1RMFH 1GL4B 1KENH 2BRRL 1T20A 3LEYH 5BZWB 1IL1A 5ANME 5IBUB 4JFOA 4HWBH 2CMRH 2XN9A 5E24E 4MYWB 3E2HB 1I7RB 1KIRA 1R5WA 5CEXB 4V3EB 2P49B 5DUBB 2WBJB 4NBZB 4P59L 1E6OL 4RAVB 4WEUD 5IMMA 1FIGH 5DJ0A 1QRNA 1T6WA 2OSLA 4KAQL 4XP9L 2OZ4A 5L0QB 3H9HB 4OKVB 4XNXH 1QNZL 3TBWB 3VXOB 1LDPL 3RFZC 4Y1AA 4JO3L 3MCKA 3S5LA 3GSNH 3CFKB 1QSZA 4OD3L 1B0GA 3CCHA 4R6UA 2EKJA 5E70A 4HG4J 2IAMC 3QFJE 3V79C 4OFYD 3QISA 1P5VA 2NNAB 1WZMA 4NNYA 4Z76B 3GSWA 1NFDE 4JQIH 4N0UB 2H32A 3EOAA 3B9KA 4MWFB 4BQ8A 4XNUH 1I7UB 4IJ3C 3MUHL 1P7QB 1BD2E 2P5ED 3GSUA 1ZMYA 1VACB 1TETL 4NJAH 4TNVK 1Q9LB 4JG0H 1IQDB 4ZQKB 3EO9H 3PUCA 4E41B 1PAMA 2ZSVA 4HXAL 1JYWA 5J3HD 5JW4Q 4MA3A 3ZKQD 1YMHA 2RFXB 1JWMA 3ESVF 5ISZE 4QOKD 3AS1A 4YLQT 3HLAA 5GGRA 4OD2B 2B4CH 4IRSB 5K59F 3TVMC 2W0KA 3NABH 3QIBA 2E5EA 4GW4B 4RMQA 3IDJB 4XI5C 4ZSOB 4C4KO 1CXFA 2DM3A 1MHEB 1S7XB 1N26A 3PP4L 4QHUA 1C5DA 2NY6B 3IDGB 2ILLA 4K55A 3P4MB 1R3HA 4LLYA 1DLFL 3JBG7 4NZUH 2MSPA 2X44D 3GGWB 5IVZB 3WNOA 3JV0A 4FQIL 1QLRA 1U8IB 2W91A 3SE8H 3HNTL 4KRLB 2FX7H 3BO8B 4JANB 3U0TB 5DF0A 1VFBA 4NQXB 4CNIA 4HQQL 1T04B 3CMOL 2WWKO 1TLKA 4Y19D 4P57A 3OR7B 1BJ8A 5GGSA 2EDHA 2J88L 4I4WB 4WUUB 1BAFL 3P11L 4HUWA 3UYRL 3VWKC 1ORQB 2HYMA 3CMGA 1DEDA 4HXBL 3W9EB 4DGVL 4H1LH 3ARSA 4PRPD 2GITA 4YXKH 5D7SL 1QLEH 1FZKB 5LGJB 3SDYH 3FFCE 5I2IB 2Y23A 4Z0BL 3EFDH 2EIBA 1D5BA 1LEIA 1TCRA 2JKXA 1U8PA 5DDHA 5I18H 3MRLB 4K3EL 1PVHA 4GMTH 3KYKH 2AJZB 2QBWA 4L8BA 1IC4L 3O8XD 4Z7WF 5E6YA 1D5ZB 2WV3A 1IKNA 5TPWH 2IH1B 4AH2B 5JZ7C 4JKPH 3RBSA 4FQJL 3QNYB 3DETD 2M1KA 4RFEB 3RDTC 1F8TL 4J1UA 4JFHD 3OHXB 1LWRA 4M6OL 4APQD 3KJ6H 4UT7H 4YGVA 3AGVA 4X4ZA 3HZVB 1MNUH 1EFXB 1O5DT 3VGEA 5IROC 1DUYB 4GRWF 4OFIA 3AUVA 3W81A 2P45B 3HE6B 1KB5B 43C9B 3ARFC 1I1AD 4PJDB 1L6XA 4Z0XB 4EUPA 1SYSB 2Q1EA 5JR1H 2XZCL 1LEGB 1A6UL 2FIKA 3D25A 3T0WA 3HNTH 4OLWL 3CH1B 4HIHB 1PDKA 4EN3A 3IETB 2A1WH 3HN3A 1GGCH 3LKSA 3VRIB 5ICZB 2AP2A 3BKCH 4D9RE 3BZEA 2AJUH 4DEPC 2P5WE 5IESH 2WWKT 3PWPB 2X4RA 3C6SA 4M9PA 5I6XB 1SEQH 5GHWL 3VD4A 3M1BB 5BVJB 2DM2A 1A6AA 4JFYA 1TJGL 4DTGH 2V2TB 2R23A 2CLZB 3QQ3B 3LV3B 4FQXC 4PPTA 3DMMC 5T1DH 3PXJA 1N0XH 4P46C 3QXUA 4QRUA 3KYKL 3FT4A 5AD0A 3QP3A 5GS3A 5C6PB 1LEKB 3IDNB 1TTGA 1FNSH 1NH6A 1VESA 1U8QB 4YHKL 4AEIH 4TNVF 2QHRH 1GH7A 4YHNB 4Z7VE 3QAZB 4MCYB 3ZTNH 4X7FC 4Y8AA 3H3PH 1G7QB 1CS6A 3BMWA 3CFBA 4OJFH 1PFCA 4FRWA 1G1CA 2I60L 5EUOE 4NNPH 2X70A 2B0SL 4J1UB 2JLLA 1IC7L 2YSSA 3HMXA 1FVDB 4JDZB 5DMKA 5CKAA 5I1GH 1WAAA 4AK1A 3LHPH 3PL6C 4XNMA 3V5HB 5D9SB 3WIFB 4M1GH 2P4AB 2P46B 4XNZC 1U8NA 1JZ7A 1MCSA 4CVXA 9CGTA 1QKZH 5T1KA 3VE0B 5FM4A 1NAML 2OL3L 3E1F1 3MLYH 4FQLL 3PGDB 3OPZH 5EOCJ 3MV8D 4X6FA 3HFML 4X4XA 1NCTA 5I2IA 1XIWA 2ESVA 5KAQF 2Z92B 3VW3H 3LKOB 1YEGL 5DGRA 3BWAA 3I2CL 4TQEH 5T3XD 4UU9A 2AI0H 4NQVB 3B2UC 3THML 4K94L 3HPJB 2GW5A 1NJ9A 3HB3C 5DJ2B 3EO1A 4PJBA 1AP2A 4MNHA 4X98B 1DBJL 4KQ3H 1DSFL 4HS8L 4MNQA 5D7JA 5CJ8A 1MFAL 5F9JA 4IRZH 3P73B 2GJ6D 1JZ4A 1AHWC 1ZT7A 3FO0H 5CEYA 4NQEE 2AV1A 2FGWH 3T4AB 1U8PB 5DDHB 2V17H 1X5KA 3EYVA 5H35B 1JTTA 5E4IA 1I1AA 1R3JA 1NPUA 3MR9A 2AVGA 4G8GB 3LB6C 4TUKH 3KPSA 3U6RA 3U48A 4GW1B 5IB3A 3HRZA 2PXYA 1I7TA 1AJ7H 3LQZA 5FHBL 2KBGA 1FN4A 3E0GA 2FZ3A 2X9XA 1JYVA 1QR4A 3L3DB 5DK0B 5IW3A 5E94B 5B8CA 4XPTL 1JPTL 5MEOB 2V5YA 4HJGA 2FZ3B 4NKQB 4R4ND 2HN7A 3IJHB 4WJ5B 2I24N 3SGJC 3U30B 2VB5A 1EHAA 1YN6B 3RPIB 4ZFZA 1BQHG 5DO2C 1A7OH 4E0RA 4QRRA 4GG8A 2ZSVB 1S5IH 4HWEH 1FSKC 1P9MC 1CQYA 2VDLH 3HZYB 2F5AL 1NAMH 3LKPB 3LEVL 1P7QA 2OI9A 2VC2L 1SBSL 1AHWB 4WVRA 3S35H 4N8VB 2I07B 2BVYA 1MCKA 4K9EL 5D7LB 4N8VG 4OZ4A 5FAAA 4OZHA 2IPKB 3VI3E 1RZJL 3RGVB 1RUAL 1A14H 5MERA 3V4UH 4X80H 1S3KH 3LD8B 5BV7L 3SJVE 1IGIL 4TOYL 2DLFL 1KTDB 3B2VH 3MV9A 4P4KD 4KHXL 1TVHA 2C3WA 1X7QB 2EDYA 5HY9B 2OZ4H 3MRIA 5B39G 3RVUC 1HSAB 3MRCA 4LSVH 5FYKD 3V6BR 5L9DL 3FOLA 5F3HB 4WFGD 3DJ9A 1NBVL 1FDLH 2A73A 3QXAA 4M7JH 2NMSA 3RY6A 1FIGL 4XP4H 4YAQB 3N1QC 3AREC 2EH7L 2VQ1B 2YWZA 2UZIH 2VR5A 5DD1L 3QEUA 4BUGA 1X5YA 3P73A 5I8KH 1BREA 4PGCA 5IMOA 4ENED 2YWYA 1UM5L 2DWEA 4R3SA 3CX5J 1QFUL 5IB5B 3O3AB 3MV11 3K0WA 4YBQC 4ZFFA 3VXQA 4PJXF 4OFDA 2KPNA 4UT9L 4UILL 1B0WA 1V5JA 3STZA 3INUH 3PDOB 2R56L 2C7UA 1SY6L 2QSCH 4LSQL 1WQVT 2OJEA 2LAAA 3QI9C 1NKRA 4GRWB 5DD3H 5E7FA 4HIJB 1GC1L 1AQDB 4MD5B 3I75A 3W39A 1CF8H 1IAKA 3LKNA 5ADPL 2J5LB 3J8F7 3SY0A 1I9JL 2WBJA 2ZCHL 3RNQB 5DMIH 2LV4A 4ELMF 5JQ6H 1C1EL 4FFWC 5BXFB 3QZWA 3SE3C 2NY5L 1OGTB 3JV4B 1MHHB 1ZSDB 3RTQA 1IM3A 1WEJL 1YQ2A 2ITDB 4PY8J 1BVKB 1FFPB 4HGWA 1MIML 5B22A 2P8MA 4L3CB 1FIEA 5A2KH 1K4DB 4LSTH 1J10A 3ZTJH 1ZVSA 3E3QC 3QUXC 3S34L 4NZDA 3OKDA 2WANA 5T3XL 4P2QA 4YXLL 2I27N 4OB5H 5A16B 1CFTA 4HFUH 1GAFL 4FFZL 4AENA 5L9DH 2YXFA 2KQNA 3I84A 5LGKA 4L9LB 3D2UB 3UJJL 2BK8A 4C57C 3HUJB 3FT2A 3NAAH 4YAQA 2HWZL 5IBUG 3UX9B 3CMOH 1VEMA 4U31A 4MSWA 1G7JB 1WITA 1HHIB 3MBXH 1FG2B 5FB8A 5ICXB 3CFCH 4X5LA 1FNGA 1QFUH 4HAGA 3F7RA 5IQ7L 2HTKD 1OP5K 3O0RL 1I1FB 1BEYH 2Z93A 3ALXA 1J1XL 4U6TA 5CEZH 2O26U 1Q1JH 4YXKL 2WBKA 2FD6H 3O8XB 2AEIT 4OLXL 4BK5A 2JB5L 1NGXA 1A2YB 4Z95L 4DUWA 1KCVL 2CUIA 4QXUH 1DLHB 4LHUA 4KI5F 3DRQA 4QHMB 5K33A 2H1PL 3CDCA 5D1ZD 2RJMA 5DJXB 4S0SD 2ED9A 3RVXC 1J9CT 5TH2B 4FFVD 5J56B 3GMMB 3MLRH 4ZUUA 4X0KA 2H6PA 1T2QH 3MXWL 5JNYA 4IRJD 4HPYL 5JOPE 3RIFK 1F6AA 4JRWA 4KGJA 4G43B 3HE6D 1KB5L 3AY4A 5J4MA 3VFOA 3VH8G 2EO9A 5FYJD 4K3DH 3LQAL 4OQTL 2QJDA 5E5UB 1E4KA 1KCRH 5EBLB 1MUJB 3U0PA 4N0YH 3CDGB 4RMVA 4U6VL 5E2JA 4HX1A 3HZVA 3ZKMD 3SCMD 2OCFD 4GJTB 3W9EA 4OZFA 4JREB 3L1OH 4G9DB 1IFHH 5HDBF 1NMCC 5M95B 1GAFH 5F7LB 1NGZA 3DBXA 4JFPB 1A3LH 1I3VA 2EDFA 5I1CL 3PWPD 4YDVB 3VFNA 4M7LT 1QSFD 1U93B 5SV3A 2OM5A 4S2SA 3U0TA 3MCLL 4MJ6B 1QLFB 4P5TB 4RGND 3UC0L 3TO4D 5JIKA 4U6YB 2VZ3A 3HE7D 4N9GA 2V2WA 1N5YL 1NEZB 5BS0B 1PKQB 4K7FB 5D70L 2O5XH 1OAZH 3SKUD 4XNXL 5T1MB 4GXUN 3MJ7B 1FZKA 2ERJB 2ATKA 2XA8H 4K8RL 4D0DB 2MPAH 1AGEB 4YFLI 3UBXG 2JJSC 3QXDB 1C08B 5J11C 3LKOA 3N06B 3NIGE 1NGYB 3ZE1F 4IEFB 1FFNB 5KN5A 15C8L 3FTGB 3QDMA 3QEQE 1A3QA 1AKJB 3C08L 4FG6D 4OCSL 4PJIE 4JRXB 1T04A 4PBXA 1LK3L 2R1XA 3CSYA 3P9MB 1T83C 1P7KB 1MF2H 4PRAA 3WE6A 5ISZA 3B9VA 5GGVH 2ZNXA 5CSGA 4J3SA 4QRPE 5D1XC 3WFEL 4MS8C 3OJ2C 1PY4A 4YH6A 3QO0B 2PTTB 3AMLA 2F53A 5GGUB 3GM8A 1XCQA 2R4SL 3AM8C 4RCAA 3PGFH 3TCLA 2Q87A 4Z76A 2IJ0C 5C92A 2X4NA 2Q8AL 5EBLA 1HILA 2NY6C 3V8CA 4U6XA 4PGEA 5D7JC 3L1OL 4M5YL 4G6JH 2IBZY 4KTEL 3VFOB 4OF6A 1AD0A 4RA0C 3F6IA 5ICXA 4HZAA 3T8XA 3HZKB 1U8QA 4QRTA 4J3OC 4NHUB 1OQOA 5E56A 3OTTA 4N0UE 3D0LA 3O4OB 4LFHG 2ZCKL 3HR5A 3TN0B 5DZLA 1ZLSL 4XCFL 5BV7C 4J8RB 1FE8H 1WZKA 2JJVA 5TE6L 1EEZA 3SDXE 2Y1VA 2AABH 5DURD 4NM8L 1OAZL 4KKAD 4JPWL 4HHAB 4U3HA 5E8PB 4QRQB 2R0LL 4HUXB 3MV01 5HHMD 1YNLH 1MJ8L 3QXTA 5LXGH 4QTHA 4C83A 1XGUB 5GRYA 5EU6B 2HFEB 1OAUH 4MA1C 3MV7E 1DVFD 4MVBD 5L7XL 2R4RL 1KJ2A 1R5IA 4HW6A 1OP5H 1FVCB 2YC1A 4X6DF 5FYJH 4JO2L 5JXAL 4Q97A 5F44A 1FYTD 3SCMA 5KVEH 2IPUG 1K4CA 3HC0B 5F8QC 4ZUTA 2F19H 2DN7A 4P59H 4X4XB 1TQBB 3V6OA 4I18C 3QUMB 5ID1B 1KTLA 5BVPH 3QDGB 4WFED 4N0FA 1B9ZA 3TBTA 2DJ4A 3KPRD 3L5HA 3WFEH 3DO7A 1CLOL 1WWBX 5B4MC 2VDRL 3D87B 4TPRL 2C7UB 1OF2B 1Q9WA 3RU8L 3ULVC 1HIMH 1T22A 1MFNA 2G2RA 3QFJA 5LQBH 2APVA 4IBLT 4U1IB 2XA3A 4ALAL 5DMKB 3RVVD 3L3KA 1ETZA 1DEEA 1DBML 2NYYC 5F7HA 2OX5A 3F62A 3VXRA 4DZBB 4Y16C 5KS9E 1YEKH 2YPLD 1KBGH 3I6LD 1FH5L 4QYOB 1IGJB 2AJZA 5GGTA 1FJ1A 2J8OA 3PDGA 2AQ1A 3O4LB 4NO2B 1JF1B 4P3CL 1OM3L 4R4FH 3HR5B 3TN0A 4PY8I 5LGJA 1NLBH 4UOW0 4U4BA 2VN7A 2R1WA 2JE8A 4D0CA 1UH4A 4TSAH 5DT1H 2HFTA 5E2WH 4PJHA 5J9PB 1AR2A 4TOYH 4I8DA 3KPMB 2NW3B 4CU6A 4PG9B 4J2XA 5HYQA 4PRIE 4PJ9B 5H37G 1CLZL 3SQOL 4LLMB 2AJXL 3L3GB 2D7QA 4PGDB 1YEIL 3U7YH 2R4RH 4HS6B 3NA9L 3VWJB 4NHUE 4PDCE 5MEQB 3B5HA 5TF0A 1A7NH 3D69A 4P46B 4KI5C 2R2CA 4I5BA 1H5BC 2F53B 4HMCA 1U8KB 2OI9B 2UZIL 4YBHA 3ABZA 1VGEH 3CSGA 1UB5A 3F8UB 3K4AA 4AQ1B 1MAML 3IETA 3KYOA 3V4VL 5F72S 4GS7C 4J4PC 2XPGA 1ADQA 3WE6B 4ODWB 1LO0H 5CHNA 1F5WA 3IDGA 2RR3A 5DVMA 2HP4A 4X99B 2K7PA 4OFKA 5DK3A 4UT9H 1UXSA 4H0GA 2P43B 1NCNA 3L3JB 5FEBA 4YHIA 1JWSB 3M8OH 1FLRL 2XQBL 5DJZB 3KWWA 4DW2L 5C3LD 2FB4H 3JTSA 4XMPH 3QEQB 1W0YT 5SWQB 4GRLB 2JIXA 2DQFB 4KJPD 4KRMB 5KSAD 1SJHB 3H0TA 4LHUG 5AYUL 4RFNC 2A6IA 5TDPB 4DAGL 4NRXA 2F15A 2CR6A 2BCKB 1IC4H 4N5ED 3ARGB 4OFVA 4U1GC 3AM8A 1NCCH 4U1LB 2YN5A 2I9LA 3OG6B 3RWGA 4PRAB 3ZMRA 4D94A 5T3ZH 3B9KB 4MWFA 1EX0A 4PRDB 5JTWA 1FVEB 1E28B 3WFBH 3FFCA 1HEZA 1NAMB 5MEOA 3MPCA 4GKZB 2Z31B 4I77L 3T3ME 3QG7H 3WXVH 3KPRA 4UQ2A 2R1YA 4U1JB 1ZHBA 3R4DA 2GQHA 4KC3B 1NGYA 5SWZA 4BYHA 4XXDB 4EZMA 3GSQB 2D03L 5J6GB 1I9IL 2VABA 1A21A 1GHFH 1HZHL 1Z2KA 3GO1L 5I74C 1HXMB 1F6FB 5E2VL 3HUJF 3CNKA 1UACH 2IQAA 2Q76A 5DMGC 4N90E 1EPFA 1DN2A 2O5YH 3JWOL 3SDAC 5I76A 5DWUL 2UWEA 1U93A 2X4TA 1NKOA 2VITB 3BHBB 1MIEH 3MJ8A 5C08B 3VXMD 5SX5K 3G6AA 5FYJE 1EEQA 1BWWA 4OD1L 4JG0L 5EU6E 2HFGH 2BOCA 5D2LB 3QEGH 4KHTL 3B9KC 1KPVA 1NC2D 4QTIH 3MZGB 3MO1A 2RAMA 4DN3L 1RZGB 4YHOH 1PD6A 1LK2B 4UTBH 4OQ1A 2ESVB 4XPBH 4YE4L 2IEPA 5FYLH 3VCLA 2DQCL 1R3KA 1UH2A 4KK8C 4XVSL 3ARXA 3P40A 4ENEC 1MRFH 4P2OD 2Y4SA 3ZE2E 4JPIB 2ZSWB 1NGPH 3B6SB 4ZMAT 2C4FT 1FNSL 2EE9A 1DZBA 3L3HB 3BP4B 3LH2H 3N9GH 5FXCH 3HC3L 3V6OE 1GOGA 4PJEB 3UAJD 1DLFH 3FQXA 5LBSL 2DI8A 2HKHL 4ODBD 5HI4C 5D2LF 4U3CA 4LPTA 3RGVC 1X5LA 5EU7E 1JGUH 2VDNH 1DLHA 3RUGE 4AENB 4PJXB 5JLZB 2FX7L 4XGZB 4M8QA 3IS0X 4QHMA 3P77B 4M43L 3WLWD 1FYTB 4WENB 4LEOA 5TJWK 1JHKL 1TZIA 4R4BB 3GNMH 5B38G 4LRNH 1F4YH 3RIFF 1MWAL 3EDKA 1MH5A 2D03H 4P2RD 4ODTH 1CD1A 5GPRA 3KWWB 3DYOA 4I3SH 5DRWB 4JZOA 1UZ8B 3D9AH 5J9PA 1HHIA 4P49A 1M6OB 1OPGH 4Y5YC 3S3SA 4QWWD 1FNGB 1U3HD 2V7NB 2GTZB 2Y07L 4AMKL 5AWNL 4LLQA 1A4KA 4F8QA 2VL5A 3LSOA 4IMKC 5E6IA 4M93B 2OSLB 4TVPE 4E41E 4D9QE 4FABH 1Y18B 1PQZA 2NLJA 3VW3L 3LN9A 4GBXB 1YEGH 5IM7A 3I3BA 5TDNB 1BD2B 5FF6B 4PJCA 5EIIB 4YDIL 3TM6A 1ZTXL 2EXYC 4K2UL 4NN6C 1T4KA 4NM4H 5LVEA 4DKAA 1VPOH 2BNQD 4RMTA 1IARB 4ZUVA 1JNNH 4E5XA 2VITA 2A77L 3QFJB 4JKLA 3INUL 3O4LE 2BSRA 4J4PA 4BFGA 4FFYH 1NBZA 4U7KA 1FV1B 5IW1B 2AERT 3T0ED 1IM3B 3L6FA 1CN4A 2ARJB 1UCBL 2G60L 3W2DH 5HHOB 4PS4H 4ZXBA 3BAEL 1FCGA 2EC9U 4LOUC 4JFFB 1BFSA 2HKHH 2R4SH 2HT3C 1RVFL 1YEEL 5BMFL 2D2OA 4ZFGL 1BFVL 5IROA 5C0CD 5FHAH 5TDOB 4GRMB 4YO0B 5EO1A 5GS2D 3RJDA 1GGCL 2R1YB 1XZ0B 2HJFB 4F2MB 3QEHA 1DQDL 1T22B 1I8KB 3GIVB 4Z7UF 5KVDL 3SO5A 2E7HA 5GQBA 5TE7L 1AO7A 2PO6A 4IRJC 1FGNL 2B1AH 3K74B 4FFZH 2EE3A 4GW5A 5JO5B 3VFSB 3BPNB 2G75B 2Q76B 3PNWB 1VB9A 1RSFA 4FABL 2UYLA 4KAQH 5FA3A 1S8DB 1FC1A 1EVTC 3DROB 4I0KA 4XVTH 2HRPH 1IQWL 3FB6A 1JZ3A 4DVRL 1A6WL 3O45B 1EHLL 3QXAB 3RPIA 1WCBA 4PJFB 1ZWIA 3MRDB 4G9FA 4H88L 3VJ6B 3BKML 1NGWB 4F57L 4N1CA 1R5IB 5GXBB 3BPOC 3KPRB 3TV3L 4I0PA 3VXUB 5TGBA 4PTUB 1QBLH 2A77H 5HGDA 4LPCA 2GSIB 1CD8A 3SE4A 5MENA 1KTRL 5E2TL 4OZHB 2P44B 3WEXB 4KY1H 2VYRE 4U1HA 5GS0C 3SKMB 1RJLB 4U3XA 1U95B 5KS9F 3ARGA 3NH7L 3PP3H 1YUHA 4YNYB 1LP9F 4GUPB 5FO8B 4LLDB 2MKLC 5A2FA 1KPUB 2FJFA 2GSGB 1TZHA 4WFGE 5DA4A 5SWZE 2FRGP 3VFGL 5LQBL 1AGCB 4QXGH 4Z7WE 4J6RL 5F7DA 2O93L 4LLMA 3RIAF 1OD7A 2YXMA 5HXMA 5C07B 4NP4L 3FOMA 3OR6A 5J1AB 4YHMH 1SYVA 5F7DB 2Z8SA 3CPLB 2YBRB 4NPYA 3WLBB 3U6RB 2P5EA 1JGLH 3B83A 3NN8B 4G6ML 4GLRI 4H8WH 5ILTH 4RMWA 1KCSH 3GBLA 3QFDA 1JF1A 5DVOA 5IMLA 3CU1A 5F9OL 3DX7A 4L4JA 1NC2B 1JPFB 5D2LE 1EAPB 3T0EA 3BE1H 1UADC 2FHCA 4HKJA 3DO3A 4PTTA 1BZ9B 5JMOC 4YDJA 4YQXH 3HCVB 3EYOB 1JV5A 4HEPG 4UU9B 4Q9RH 3N1FC 3X14A 4HAFA 1CE6A 3L3OA 1PZ5A 3ARZA 4YO0A 5C0CA 1LE9B 2E3VA 4E42A 1IAOB 1NFKA 2IGFH 5FUOH 2IALA 1X4ZA 1BM3L 3X12A 1R3LA 3BDYL 1CK0L 3NIFF 2EXYD 5IBLD 3HHRB 3QDGA 4Y1AE 4KKAC 4O5LL 1B2WH 4FZ8H 1QBMH 5DZOA 1TDQA 4FQCH 4JZNB 5A2LH 3RDTD 5HPOA 2VDOH 4LKXA 1OY3B 5GGVL 5BZWA 4MVBC 1ZA6B 4LDEB 4FQJH 5DD6A 5IQ9A 3G6JB 4X6EB 4CU7A 4OCWL 4JFFE 1ZHLA 1GGIL 3V6FB 3ZE0F 2W9LA 4I3GA 1RZIB 4OF0A 4C59B 2YSSB 3KJ6L 4UT7L 3WS3B 2D7NA 4AEHL 1OTUC 2PR4H 4KK5C 1QR1B 5FK9B 3IU3A 1TMCB 4KK6D 2CLVA 1JNHB 1BF2A 4JREC 2VLLA 3BVNA 2GAZB 1IAMA 3E3QE 4ZS6D 4Y5VA 3X11B 3F65A 3MBEA 5CZXC 1J88A 5E7BA 2UV3A 3GMMA 3WIIL 3HPLB 3CUPB 1YN7A 2GJJA 2OL3A 2P24B 2V2XB 3MV7A 5CZKA 1FO0L 1TNNA 1F4HA 3FRPG 1CGSH 3CXDH 3RWCB 1R5VA 3CFDB 5F7FA 1GHFL 2H2PD 2Z4QA 3ARBB 2BERA 1IFHL 1VADA 1T1YB 5D5MF 2XNAA 1IEBB 2F58H 1MFDH 3QO0A 5F97E 1OAUL 5C08D 1JGVL 1JNJA 4MMZC 4NC2B 3BRFA 3QDGE 1CICA 4IIQB 3BDYH 3UROR 1B2WL 1P4BL 2R0WL 1DBKL 1RFDH 4LOUD 2NXZD 4LSSH 5E8EA 2W07A 1MRCH 2VDOL 1XGYH 5DMYA 3BH9B 1F4WL 3WJLC 4Q9BA 4IOIA 5GS1C 1NLDL 1RZKL 5EU5A 1DQJA 2E9IA 5CLTA 3IVKB 5M94B 5L0QC 3TBVA 4IOSD 3SJVD 3OAYH 3CJJA 3U4EB 3NCYP 3G5ZB 1ZVSB 4MJID 6FABL 4XC3H 4JZJA 3OG4B 1INDL 1G0DA 3D5OF 3QHFH 1HN1A 3OQ3B 4R7DB 5TPWL 2A6JB 4OTXH 2AV7B 5B39A 4UDUB 1YJDH 4JRXA 3WMSA 3QPXL 3DX7B 1G9NC 1M71B 5HYSB 5BRZD 4R4FL 5CWSA 4ZO8A 4P3DB 5IEHA 4M1DH 1EAJA 1UM4H 3HB3D 4KTDH 2R2EA 1KN4L 3HRPA 4ONFH 3MRHB 4XVJL 3MRNA 2DQUL 2F58L 3WFZA 1CE6B 2I26N 4F7CB 4XNQA 5BS0A 5J6HB 4P57B 2KDGA 3G6JE 5CP3H 3NVQA 3MLUL 3BRGC 2R0ZL 2YUVA 1ED3A 3QIWA 3PQYA 4DK6A 4LASL 5KZCD 3TJHA 2BNQB 1KUMA 1Q38A 4QNPE 3VFNB 4X6CB 3K80A 1HHGA 4Q2ZB 2IFFL 5HGHB 4WI2A 3EDFA 4Z8FL 4NSKA 4JPWH 4IJ3B 2BSSA 5GGQH 2XN9D 4H5SB 2X4SB 1AJ7L 2R39A 4OLUL 4NRZB 1D6VH 2CLRB 1INQA 5HGDB 5IT2L 5E99H 4LLWA 1KLGA 4DGIL 4JO2H 3O9WA 1N0XL 5I1HH 3LN5A 4HUKB 3QQ4B 4IRSA 3QUKA 4LSRH 4PRHA 4XP6H 4CDHA 2ZKHH 5TQ0L 2VAJA 4IM8A 3QPQC 4JN2A 5D6CB 2XPGB 5IVXE 3TVMB 3KPSB 4F33A 3PWNA 1NSNL 3WFHB 4QXWA 2F5AH 4RDQF 3VXPA 3S3PA 3P4NB 3HMWH 4HS3A 4OLYH 5F7MC 5DUBA 5HHNB 4AT6B 1L7TH 4NO0D 4RBPK 1UB5B 4PD4K 1JF6A 3NCYS 3S96A 5HGBA 1RUKL 1CGVA 2ICEB 2EXWC 3DX6A 3BYYA 2XTJE 4XPFH 1SBBA 5E8DH 3OGOE 1RJZB 1HXYB 1NC4D 1NJ9B 4L8DB 4HJGB 1SEBB 1JHLH 2DKMA 1M7DA 5KVDH 4UV4L 1VFMA 1EO8H 2O61B 5JDJA 2BVOA 4KHXH 3V4PH 4Y5VC 4Y1AB 2VISA 4YDLC 3X3GH 1AR1C 3VXOA 12E8H 3S6CA 2X89A 2BMKA 3BKJL 2H2PC 1CGUA 4Z0BH 2YA2A 3BPCA 4OCYH 5EOQH 4MJ5A 4X7SL 4WEBL 5H35A 1BECA 1KJ2L 4LL9A 4Y2DB 5HVWA 3BP7A 4I5BB 3VXSB 3H9SE 2NZ9C 5BQ7B 4OLUH 2NY0B 1S9WB 4M6NL 3TFKC 4M4RA 3GIVA 5T1LA 5IT2H 5E1HB 1KACB 1CICC 4ZDHA 1UB6A 4K3GA 4QWWC 3DVNA 4S1RL 1SJXA 3KPMA 5I1HL 4IMLA 2FO4A 2VLKB 2QKIA 2ZOKA 2G2RB 2ZUUA 4OF7A 5T1LB 3PGFL 4D0CB 3QRGL 4ODXB 5D7IF 1R0AH 4LBEA 5EG6C 1GSMA 4WIQA 3MX0A 2CDGA 3MGOB 3G9VA 1YMMB 2MMXA 2XZZA 4MXQD 3SY0B 4CMHB 1O7SA 4YDKL 1XH3A 2E7LC 4ZUWB 4YHPB 4PGJA 4A6YH 3SGJA 3CXHJ 1UM6L 4PJAF 5ID1A 5A40E 3FT3B 1OW0A 3RWDB 1BVLB 1KGCD 4OZFH 2YOCA 5C70A 3VXRB 4DZBA 3ARFB 5FV2A 3D39D 4NP4H 1FBIH 3RZCB 1NEUA 1CBVL 1A22B 4HGMA 3UTQA 4KRPD 4RGMB 1KEML 3HCVA 4JY5L 1Q9WB 1HE7A 4GAGH 2VDML 4XAWH 3AB0B 4HWEL 4H8WL 5HGBB 5GS0L 2Z9TA 4QRSA 3CLFL 3KPTA 4PJ5D 3AAZB 2BJML 1V7ML 2WBJD 1SBSH 1AD9B 1B3JA 2R2BB 1X6LA 2DF3A 4JG1H 2UVFA 3FO9A 2QHLA 35C8L 1EEZB 3EDDA 5DJ6A 3BWUC 1RUAH 3QUML 4JPIA 1Q9OB 2CK0L 2EECA 4WDIA 4EVNA 2NCMA 4LCUB 1KTDA 1FPTH 2YD2A 5IF0B 4KI1A 4OLVL 2BP3A 3DGGA 1UZ8A 1K8IA 2XFXA 1NBVH 1MFBL 4UQ3A 1RJZA 2VN4A 2IGFL 1JFMA 2VDRH 3TJHC 1R24A 2I60H 5L2KD 1MCJA 2QADC 1TZGH 3O3DB 1MY7A 1AGDA 4H20L 5IHBA 2I07A 2XQYG 3QNYA 4OSUL 1PYWB 5DHVB 2VE6A 2VR9A 2VLRE 4LEXL 3GM0A 4F37K 4GQ9H 1EMTL 1UZ6F 1P4IL 1JE6A 1YEKL 2E9BA 1IKNC 1BLNB 4I3RL 3L7EB 1GGBL 3C5ZD 4XT1C 4ZNEE 5DJ2A 2BOBA 3QPQD 5C0RH 2NY2D 1FGVH 2B8OT 1RVFH 1UQSB 1MVUB 1VSCA 4HIIA 3QUZA 2EIZB 4IS6A 1GJIA 4ZFGH 3MRJA 1INQB 5FHAL 4M6ML 1KYOK 2QQLL 2ID5A 1RU9H 3ZTJG 3QCTH 4X5XB 7FABL 5JW4N 4M7LH 1NBQA 3RHWF 2XKUA 4N9GB 4MQSB 1C5BH 3ZLQC 3WNLA 5D96B 1NEZA 1DBJH 1AIFA 2DBLH 3ARBD 1M71A 5IVXB 4ETYA 2AXFB 3MRKA 2FJGB 4F9LC 3JXAA 4MNQB 5GZOD 4JFDD 1B4JH 2AXJA 1WAAF 4NJ9H 1MSPA 4WUUE 1AIFB 5C0IA 3TIDB 1A6PA 3EJZD 4XVTL 1RK1A 4WUUD 4JAMB 3GIZL 5J3HC 3I50H 3UZVB 1D6EA 2A2QT 3QULB 4KUZH 1MFDL 5HHXH 1JI1A 4OM1H 4G3YH 5AUMB 1CU4L 5J1SC 3MV8A 1ORSA 2A6DB 2JJTC 3IVKA 5BOPA 3DMMA 4WGVB 1P53A 2HT4D 4W70A 3SOBH 2K3TA 4Y7MA 3WYRA 2ZUSA 4X9BA 1F6AB 2WBWB 5C0BB 1T5XB 3SJVB 4NQCA 3X13A 2OS7A 1F4AA 3IFNL 5E8OA 1U8NB 1IQDA 3WKNA 3RWFA 2XXMB 4EXKA 1PYWA 5DHVA 5HHOE 5C0RL 3W9DB 2R0KH 2BNRB 3TF7C 3U46A 4U1HB 3RVUD 4HZLA 5KSBB 2FYYA 3RWHA 1MHCA 1BPVA 2L7UA 2H1PH 3GSWB 4OF3A 1N3NA 4NOBA 1JHTA 5ANMB 3NMEA 3S88H 3EOTL 1XT5A 3SDXA 1X5GA 3IDYB 2BRQA 2DLFH 4KKLC 4ZUSA 3BEVA 1LD9A 1FG2A 4FMFA 4FQ2H 3BH9A 2VXTL 2APXA 2YPLE 2V2XA 1RQ5A 4JM4H 1G7JA 5F7EL 4Z0XA 4EUPB 1KCSL 3K81A 3GI8L 1G7HA 4RFOH 1V7NH 1T2JA 2NY7H 3NCEB 1F58H 3IFOB 3LRGA 1F4XH 5H94B 3K7UA 5E00B 3NIDE 4C56A 4YFEA 4KK9D 3V0VB 4TN9A 5ENWA 4KUZL 3KPOA 3U7WL 3I9GH 5IKCA 1DANU 4EI6B 4LKCB 1CLYH 1UEMA 4AY0A 4ZFOB 4OD1H 1IC1A 2EH8L 3BN3B 1YNTA 1I4FB 4LASH 1A0QH 1HQ4B 3QUXB 1RIVH 4LKXB 2DBJA 3WO4B 4Z8FH 4BZ2L 2D9QB 3UTTB 2CGRL 5A2IH 3B9AA 5E8NA 1W72H 5KVMC 2JELL 2BNUB 3R06B 1EVUA 5ERWB 5GSRA 5IFJB 4KRPB 1G7LA 4J3UA 2MPAL 1MI5D 4FXGA 4L9LC 3RVVC 4QF1B 2DRUA 3A6CL 4LP5A 5EUOB 2IAMD 2ICWB 1IGMH 3U36B 1NBZB 3T3PE 4V2CB 1UWGH 3HAEG 3U0WL 3WFDL 3MRQA 1K4DA 1LK3H 3O3AA 1J7VR 3U4BL 3CVIL 4ZFFB 3NOIA 1MFCH 3PHQA 1UENA 1QFWM 3OAUL 2DWEB 4R3SB 1U8IA 3OKEA 1DFBL 3C60D 3SDCD 1XGTB 5EU4B 2W65A 4JVPA 5I8CA 3QDJB 4Y1AD 1DQML 2EYSB 5F6HI 5ESAA 2F74A 1HXMA 2ICWI 2AJYL 4HBQA 4M5YH 5BJTA 1ZLVH 3MOAH 4WV1C 1ORQA 4XPAH 3S37L 4UV4H 4KI5D 2NX5D 4NUJB 3IXTB 4KJQD 2BVOB 1UQSA 3UTPE 1EA9C 2VLRA 3R8QA 2IPKA 1HKLH 5C07A 4X9HA 1N3NB 3FRUB 2VXQL 2APFA 4LEOB 4WI7A 5EFIB 1ZLUK 2X9WA 4A2MA 5CILH 1XAUA 1E4XL 2PTTA 2RHEA 3BO8A 4JANA 2A9NH 1H15A 3DVFA 3ARRA 3V4VH 1KJ2H 4ZPVB 3IDXH 4S0TD 1C7SA 4M4PA 2UWEF 2NY2C 4G8GD 1YNLL 2QSTA 3EYSH 1S7TA 2X1QA 1OOAA 2HFFA 3MNWB 4QHLA 5IB2A 2GSIA 3PG2A 2ZSWA 3MYJB 1H9VA 4CVWA 1D5IH 5JW5A 4K8RD 3CFEA 3IDJA 4MD4B 4P4RB 1IM9A 4HCRL 1ES0B 3KYNB 4C56D 2Q20A 3LN5B 3ZSTA 3VJ6A 4XCYB 4P4KC 3ELAT 4YWGL 5T3XE 1J1OL 3TCXA 1WIUA 3TBSA 1OSZA 4X8XA 4D0BA 1X3DA 1XCQB 3RZCD 1WCBB 4PJFA 1F2XK 4YEFA 4YDKH 3ECBB 3EOYG 3KXFE 5GGSY 3K2UH 4RMUA 4WU7B 5GJTH 2FEEI 3SE3A 4LVOC 4NQDE 4ODSL 1ND0B 4TNWF 3QHFL 3OKEB 4GG8B 4Q2ZA 2BFVH 1T1ZA 3CC5B 4HFWA 3QCUL 3C8KA 1GIGH 5C0CE 3PHQB 3VFSA 4PJ5B 2V5MA 5MENB 1Y6NR 3B9EA 2EDRA 4WO4A 1JTPA 5KW9L 4JFPA 4LHJB 4JY5H 3PWLB 4WI5A 4G8GE 5LAXA 4WY7H 5DVLA 5EO1B 5GRXG 5I1IH 1VENA 1ZHNB 3KR3H 2V9RA 5DQ9A 3RL1A 3DSFH 1XGQB 2QSVA 4D0DA 1MVUA 4KK9C 5EU5B 3GO1H 3TBWA 1OHQA 4JGJA 2BVUA 2NY5C 4PJHE 4Y4KB 4CVXB 4EDWL 1AC6A 1TQCC 3O2VH 5I73B 4JM2C 3UJTL 4ZTPL 2WP3T 1P6FA 3QUZC 3TT3L 2VRAA 1ZXQA 2FX9H 2VTFA 5DJXA 1YEIH 5JPMA 5DTFA 4B0MM 3NTCH 4MAUL 1HHKB 4R26H 5HYJB 4QTIL 3TO4A 3H2WA 2GT9A 5F7YC 3IKCB 3IDMB 3HI1A 3WJJC 2BY1A 1KN2H 2FSEA 1JGVH 5HHQB 2Q86B 2HTLD 3RP1A 2CDEB 5K9QI 4M3KB 3P9LB 5KOMC 1HHHB 3KJ4B 2J4WH 3EYQC 4WFHD 3KLDA 4WFHE 1A6ZA 4ISVA 1YEHL 3SHSA 3SBWA 2F54D 2HVJA 4QCIA 1G6VK 4JFED 1MRCL 3HC3H 4I2XE 5CZVL 4F7EA 3EO0A 3QJFB 2C5DC 3M8OL 5H2BB 5TH2A 3D2UA 5HVHB 4JRYB 2O61A 1AQKL 1CD1B 3PGCA 1T03H 3QJHB 3ULUL 4MD0B 3C6SB 4MAYD 4LKCA 3AC0A 3ARDA 1EZVY 1T4KB 1TZIB 4AYFA 5ITFA 4JFDB 5MEPB 5ELIA 1GZPB 1UG9A 3GRWA 5ENWB 1NGXB 3PGCB 4PJ7F 3OKLB 4YR6B 5F1IA 4JY4A 3RX8A 1LO2H 4KKBD 3BPOB 2Q6WA 1HHKA 5FKAB 1F3JB 2X40A 2IPUK 2Y07H 4AMKH 3FCTB 4BELD 1IC5L 3PHSA 12E8L 1T7YA 1XCTA 2F19L 4H26A 4N0CC 3QZWB 2PW1A 1MHPH 3OB0H 3DUSB 2DQIH 3LS4L 5D4QA 4TUOA 2RB8A 4HJ0D 2E6JA 4XBGA 5FO9A 5L6YH 5FK9A 4HQQH 1NGQL 4M48L 1QBML 4JFYB 3CFJB 2PKDA 2AK4A 3RUGF 1IGJA 1WAAE 4PV8B 4OQTA 1EJOL 1OCWH 3TA3A 3DYMA 2DQUH 3MRFA 2QHRL 4XVUD 1TJHH 4Y4FD 4L29B 3C6LA 2YA0A 3RWHB 5AZEH 5F8RC 3STZB 3O3BB 3QQ9D 5C9JB 3WDJA 3C60B 3HI1B 3I6KB 1TENA 3QG6A 3MLXL 3V6FA 3QDJD 3CK0H 4DZ8A 4QKXB 2R0ZH 3LQMA 3MUGB 5ETUB 4KDTC 4NNPL 4YXHL 3TIDA 3GJEB 4OBRA 5I18L 2AXFA 3MRKB 1S7QA 3LMJH 4HDIB 4RGNC 4Z7UA 3VFVA 4RDQG 1H8NA 1U2CA 3PABA 5C0FA 1H5BB 4HWNA 3LQAC 3R0MA 4WI8A 4POZC 1EEUA 3VXRE 1I8IB 2EYRA 1L7IL 1PG7W 2AGJL 4BJLA 1LK2A 3SCMB 2CK2A 4XHJC 1U6AL 2DQCH 1QVOA 2VABB 2XTJB 3GK8L 4Y89A 1D9KC 5D5ME 3BFOA 3I3DA 4P9HH 4WCYL 3ZSSA 4M7KL 4L4VE 2B1HH 4XP6L 4HKJB 1I3RB 1FVEA 2E6PA 5FECB 1XGUA 2E7CA 5GZND 3IRPX 5GGSB 3WS6A 2X4TB 2EE6A 1B6UA 3L7EA 4OCRH 3O6FB 1IC5H 4POYA 1WBXA 1NAKH 2LU3A 1W8NA 1JFQH 4PJFE 1E27B 4MMXC 4PB9H 3RVTC 4N8CH 3TJEH 3JWDH 5IMOB 3MRBB 1OGAE 1VEOA 3QNZA 3VWJC 2PW2A 2DTMH 4KMLB 3BQUB 1XGRB 2EDNA 1QEWA 3WBDA 1RUKH 1NGZB 3DBXB 4W81A 3ZDYE 5IVZA 1EHLH 5JMRA 1G7PB 3ZYIA 5DEGA 4F9LA 1G9EA 5KJRL 4JN2B 1XGPA 2MJWA 4ZD3H 3MGTA 4R7NA 2Y5TA 2P7TB 1XGYL 3CDGA 1FZOB 1WT5A 1TVHB 3D2UD 1QRNE 4YBLB 2VXUH 3G6DH 1OTTC 1T1XA 3OR6B 1A9BB 2YRLA 4N5EC 5J1AA 4F58H 1Z0MA 2F53E 3FQUA 4MAYA 3A6OA 3GBNH 4M1CD 2GK2A 3BKJH 5DJCB 1NBYA 3LN4B 5EOQL 5FKPA 5TE4L 4JE4B 2ADJA 1XMWA 2F74B 2DIAA 3QIUD 4L3ED 3FCTA 5HYFA 4WV1A 3KDMA 3VXUE 4G7VL 3MOBL 3REVB 1A7OL 1X5HA 3I3EA 2FHBA 3NFNA 4ZS7H 1AD9A 1F02I 4OTXL 3ZTNL 4QXGL 1RUMH 5D1XB 3LEVH 1A2YA 1UKTA 4PTUA 3T2NH 2R2HB 5JIHA 2DQJH 4R8WH 1KG0A 2Z93B 4WCYH 5C7XL 4GLRH 2OP4L 3FONA 3IXTA 4B53A 4XCEB 4MA7L 4CL7A 1R0AL 3TA3D 3BKYH 4OAWA 1A1OA 2R1WB 3D39E 4P5MA 1ZLWK 5AYQA 1BJ1H 4WNQB 5I30H 3WUWB 1IGYA 2PYFB 4MSWB 1XIWB 4FXGB