5SWZA

Crystal structure of np1-b17 tcr-h2db-np complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
277
structure length
277
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversed T Cell Receptor Docking on a Major Histocompatibility Class I Complex Limits Involvement in the Immune Response.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 63
structure length 277
sequence length 277
chains with identical sequence F, K, P
ec nomenclature
pdb deposition date 2016-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5swzA01
5I1JL 1C1EL 2CO6B 4C56D 3C5JA 3R06A 4F33A 5D6CB 3RWIA 1OGTA 2VDLH 4KK5C 2DQGL 5HGDA 3S37H 2XT1B 3OBAA 4FQ2L 1OAUL 3VGGA 4BUGA 2XV6B 1BFOA 1H8SA 4X8XA 1I9IL 1ZS8B 2X4OA 4G6JH 2QADD 4NFDA 4BSVB 4NKIH 4BZYA 3R1GL 1OGAE 1FDLH 4H1LB 1H5BB 2O93L 4OGXH 2ZNWA 4NBYB 4OQ1A 5JLZB 1RZIA 3GIVA 3PGDA 2J2ZA 4HWBL 2BHYA 3MUJA 4YHLH 5F1SA 1KJ2L 1ORQB 4WI4A 4UQ3B 4MA3B 2A83B 3RY5A 3KJ4C 3C5JB 3CMOH 1H15B 1HWHB 2X4QB 3NCYP 5DMKA 5T1MA 3G5XA 3QUYD 5IG7A 3FB8A 3IXTA 4YHZL 4DEPC 3G5VA 3GDBA 3W2DH 3EDKA 2JJTA 1A0QH 3CDCA 3LVEA 4H0HB 2J8UE 5MHSD 1R5IA 4QOKD 3QWOA 4UILH 1INQB 1ZANL 1N5AA 3RVUD 5L8LB 5CUSH 1XGRA 5E00A 4HAGA 4ODXB 2D7MA 4Y4HD 3C2SA 3UTPE 3GBML 4LSTL 3X12B 1CBVH 4HX1A 4QYOA 1U8MB 5E9DA 5EC2A 1RIVL 2ICWB 1EEQA 5HYIA 5C09A 4XAWH 4PGEB 2FHCA 4M6MH 3T8XA 3KPSB 4NZJA 5GGRA 3ZYOA 1Z9SA 1BLNA 4DN4H 5IBUB 1AQKH 1MUJB 3BGMA 3A6OA 4P23A 1QP1A 4IOSD 1OTSD 1GOFA 1BQLL 4EVNA 1RJZB 2EDLA 3BESR 3LQAL 4MXVE 4X6CB 3STLB 3CSYA 1AFVH 1S7UB 5L7XL 2HJKB 4AL8L 1KJVB 5E95B 4K3EL 5C8JB 2LFGA 3O8XA 1L8JA 1V3MA 1JGEA 1IGMH 5GZND 5C0GA 5B3JF 2X5PA 1RHFA 2CDEA 3T2NH 3IJHA 3X14B 1YEEH 2A1WL 4GAGL 3A6CH 3DJ9A 4ZOAA 4M3JA 3PXJA 4JRYE 1QFHA 5D1XB 3NH7L 5JDSA 1RZKL 1UH4A 3WKMH 4PJAB 5ELIA 1UM6L 1ZWIA 3DVNA 4I4WA 4LPYA 4F58L 4FTVE 3KS0H 1A7QL 4DOHB 2EC8A 2EIEA 3OB8A 1R5VA 2XXCB 3ROOB 4FXKB 3VJ6A 5D7IA 5IB2B 4G8EB 2MOVA 4I77H 4LLVB 2KQMA 1YEJL 4H0IA 5ESAB 5K9JL 4G3YH 4Y2DB 2FATH 1XH3B 2AK4E 5HHXL 1MCSA 1WT5A 1FE8H 3UAJC 3WYRA 1JN6A 3G6DH 3LD8B 3NZHL 3EYFA 1ZGLP 3RKPA 5B4MC 1OM3H 1HSAA 1I8IA 4R4FL 5A1AA 15C8H 3HPLA 2NY2B 4QRRA 4TVPE 1TCRB 6FABL 1Z9MA 3RNKA 4QHNB 2XYCA 2CRMA 1MHHB 1WISA 2ZUUA 5C70A 1DANU 4PRIE 1PY9A 1NSNL 4WU5A 3LN5B 3AS1A 4YFLF 1L7TH 5ANMA 2EE3A 1BM3L 5ESAA 5AG8A 1J1PL 1PKQB 2CDFB 5IG7B 4H20H 3SGEH 3U7AA 5HVHB 5T3ZE 3WXVH 5SWZD 2DL9A 3E2HC 2APBA 4WFHE 2XG4A 4XNMB 5DJ8B 1WWAX 1YMME 4MA7H 2DYPA 2FZ3A 5HHME 5HGAA 3ROLA 5JHDB 2MKWA 4TULH 2NW2A 4IJ3B 1WZKA 3VG0H 1VACB 4I9WD 2ARWA 3K46A 3S4SA 4P2QA 1S9KC 4FFVC 4JLRB 2HT3C 2DQJL 4BYHA 2CLVA 1MHEA 3RVXD 5HDBF 3LKQB 5EWIH 1XR8A 4KJYB 2WNGA 4G59A 4DGVH 4XXCC 4HUVA 1JV5B 1UXWA 4G6JL 4MJ2A 1R3LA 1GIGL 2E9JA 4IDJL 4AG4L 4X7TB 5I18L 2ERJC 4MA1C 5C0CB 4N8VB 2BFVL 3ULUH 1OOAA 1MWAB 4M5ZL 1S7UA 5L88L 3AGVA 1ACYL 1NCTA 1K6QL 3IDGB 3IJYA 4HWEL 5K9QG 1KYOK 2X4SA 1T0MA 3T3MF 4O58L 5DRNB 2HN7B 4NO0A 3B9EA 3EYVB 5CSGA 5TE4L 2IAMA 1BAFL 2H3NA 3RY6C 5EOCH 3TJEL 2JJVA 4CN6A 4P2RA 5DURD 5I8KL 4GRWF 1EZVY 4GMSL 1EMTL 1I7ZA 5GRVK 3PF2A 1MCLA 5CBAB 1GC1C 3TWCL 3S8WA 1BHGA 2YK1H 5JOPD 2YMXH 1J0HA 3VFRB 5C07B 4WHYG 2HH0L 1ADQL 3D2UB 3ECBB 3DO3A 3FCTB 3O2VL 2UUDH 5ERWA 2BNUA 5HHQB 3SE8H 3BHBA 4X7SL 5GISL 2E5EA 4CBPA 3ARVA 4X7TA 2DKSA 4LHUG 1JZ2A 3ULUE 4HUWB 4R4BB 5C0FA 5EUOA 2DQUH 4BH8B 1CXHA 5C6TL 1UQSA 2QKIA 4OFKA 3X11B 4YHML 3FB5A 5IVXF 1JN6B 3DRQB 2XG5A 3UTZB 4XBGA 1BWMA 3VXQB 3DGCR 2RIKA 1WCQA 1BOGA 2D9QB 3CZFA 5GS0L 5GSVB 2AQ1A 2B4CL 4FQPA 3V6FB 3VXRB 5C3LD 1Q94A 3OKMA 4CDGC 1ZGLB 3P11L 4QXUL 5L2JB 3FFDB 5CHNB 1U8JB 1YEFL 2H6PB 4O00A 3QHZL 4GAFB 5E56A 4U0RC 4JHWH 1BOGB 3QT2A 1A6WH 1TMCA 1PD6A 4OCYL 3RWHB 4CMHB 3EJZC 1G7MB 3DARA 3A67H 3RWDA 4RFOL 3W0WD 4UOW0 5CKAA 2Q7YB 1ROWA 5DJ6A 2EICA 1CDIA 2VC2L 5EUOB 2VDML 2L0DA 3D0LB 3RVUC 5D2NB 1RPQA 2PO6A 1AXSA 1KLGA 2MCPL 2ZP0T 3GIZL 3ULUD 1A1OB 3BKYL 3PDDA 4PD4K 3CCHA 3S35H 3IDYC 4BFGA 4QTHB 1WK0A 4X6DA 3JWDH 1A9EA 3QRGL 1FZKB 1M1SA 2LU7A 2RR3A 4YHOH 5FYKL 4G9FE 3HG1E 2H32B 1FG2B 4XCNB 1H9VA 4OF7A 4HS6B 3F6IA 1ZT4B 2VXQH 2E9WA 4ZPVB 4DFHA 3EDFA 4U1IB 3SDAC 3PIQA 5HYFA 4JFFB 5IFJA 2R2HB 3GMLA 4P2OA 1EX0A 3EOAB 1U8IA 4A6YH 1I85A 1E4XH 3ARPA 1T1ZB 4X6BB 1MRDH 2DDQL 5TFSL 3TVMD 4KV5F 2SEBA 3P4MA 5M95B 3S88L 4OZGF 4EDWL 4KK8C 4P46D 5DJZB 5FYKU 5C0CA 3PABA 3G9VA 1KCVH 4XPGL 3ZE1E 1TZHB 5J9PA 4M7LT 3S96A 4LASH 4JPIA 4UT7L 1BVLA 2ZPKL 5DUMH 2HRPH 1KG0A 4LQFL 3DX7B 4KZDH 4HQQL 3MUGA 5DK0B 2LTQB 4EN3C 1AD0B 4JZOA 5HPMA 3SCMB 3V6OA 1I9RH 1S7XB 2HA1A 3L3OA 5CINL 5FA3B 4DK3A 1RK0B 3UPAA 2Z92B 1HKLH 5E8NB 2OTWB 1VGKB 3MLRH 1MFBL 3VXOB 3U7WL 2QSVA 2VDPL 4F2MA 5F9WB 3HE6A 5CJQH 3RWCA 4J4PA 3LY6A 5D6CA 3DX6B 5BZDB 4OM0H 3MV9E 5DJYA 1AO7A 3O2DH 2ZUQB 3GJFA 4GKSB 4YAQA 4KGLA 1P4BH 1Z3GH 3QUZB 4YHIB 1P4IL 1CD0A 1ZA3A 3GSXA 1T66D 3T0DA 4W4OA 4BFIB 1D5BA 1CXFA 2NLJB 2QHRH 4LVOC 2NR6C 4PRID 4OLZH 4TQEH 3QFDA 4Y1AE 3L6FB 4XTRD 2YMXL 3S7GA 1HNGA 4KXZH 1A6UH 4MA3A 1D5MA 3RTQC 1NAMB 4YE4H 3JV6A 1ADQH 2AJ3B 5DJAA 1MLBA 4P2RB 2F8VA 4F7TB 3CXDL 1G7JB 4FQCH 1I9JH 1DL7H 4HMCA 1FVDB 3VXSA 4LFHG 4PB9L 2PF6A 2YKLL 1VADB 1CFNA 1EA9C 3WNOA 4ZSOE 1QHPA 4OCLC 5KANI 5DO2C 3T2OA 1T0NB 1OLLA 3HNSL 4M02A 4TTGA 4MQSB 1TITA 4MXWH 1Q9OA 3LS4L 4N1EA 2WANA 3CPLA 2PN5A 1O7SA 4HJ0D 4F57L 5GJTH 2K7QA 4LBEA 4JO2H 2CPCA 3BVNB 1DQML 5E99L 1FFNB 1XT5A 5DJ2A 2EDNA 3MJ7A 5KS9A 1NBQA 4ORGB 1FN4A 3BP4B 4YWGL 4D9LH 4JDTL 2VNCA 2FX8H 3SE9H 5I1DB 4OI8A 3HFML 1JNLH 5J3HC 1HHHA 4WRLA 1FZJA 5D1QC 5FHAL 2H1PH 1MHPL 1OAZL 1CFSB 1KEML 1LHZA 1URLA 2D3VA 2VLKB 2V5YA 2WUCH 3QWQB 5DUPH 3NTCH 5E2VL 1GC1L 4OLYL 5T5FL 3P0VH 3D87B 1ZMYA 5E2TL 4F7MA 1IZJA 3VFNA 4J4PC 5TE6H 2YD1A 4Y4HC 4LSQL 4OZGE 4PJ7B 2VDMH 3BPOC 1CVSC 2AJYL 1JZ7A 1YN7B 5HI4C 1QOKA 1QFWH 2APTA 3KS0J 2HT3D 4IRJD 2ZUXA 4JDVB 1ND0A 4W4OC 2BRRL 4ZUSB 3GSRB 2W60A 3D85B 4ELME 5C0RH 1ZT7B 2XKNB 3UJJH 1QSFB 4TSBH 1MREH 4P2QE 4XPAH 4QRTB 3KPQB 4M7JH 3X17A 3ARFC 1HI6A 3O6FA 1N59A 3L1OL 5F1NB 2VABA 1T22A 4EDXB 5TQ2H 4PJFB 1MCQA 1R3KB 3IB4A 2CKBB 4P9HH 3O9WD 4Y2DA 1NC4B 2A38A 3W39A 5ADOL 3O6KH 5CWSA 3LS5H 3L3GA 1CT8B 1INEL 4HBQA 4XH2B 4M43H 2DDQH 5FF6B 2CLZB 1AGBB 4I3RL 1MCOL 4M03A 4EDWH 4EBQL 4XXCA 3GIVB 2VZUA 5E4EC 1YNTB 3HE7D 4JVUA 3MLTB 2EDWA 1MLCA 1Q0YL 1U3JA 5JXAH 1JF1A 3DV4A 4P9MH 5ICXA 2Z8VC 3GGWA 1IFHH 3O3EA 5E2WL 3NIDE 3HMXL 1JFQH 3QCUH 4FN0A 2Y7QA 1ZA6B 1U2CA 3OJDA 2IANB 3MCLH 3OR7A 4HQQH 2FO4B 3O3AA 4DUXA 1Z5LB 2BY2A 4PJ7F 2ATPB 2IH3A 4NOFA 1RUQL 2FDBP 2AJXH 1HZHH 5TJWK 3VXUD 1DQTA 5D2LF 3SGEI 1E6OH 3WS3B 4YHYB 1EDQA 2FJHB 5C0NC 4MVBC 4OZFG 2PTTA 5T1LD 3ZDYF 3FO9A 3VXNB 1BJMA 1MHEB 4LCWA 3AY4A 1AXIB 4LL9A 2EDTA 3C60A 4DVRL 1A6TB 1EFXA 1Y6KR 3WUWG 4C4KO 4E41E 4U1KB 3PDOB 3QUYA 2A9MH 1NUGA 5HGAB 5IQ9B 3U0WL 1U3HA 4UUJB 2JF1A 1IC1A 2AJSH 4HH9A 1T66C 2J8UF 1GRWA 2XY2A 4JFZL 1N0XH 5DVLA 3WIFA 5J11C 1KTKE 3KWWA 3DX9A 5MEOB 1JPFB 3FO9B 4ODTH 1A4KB 4IDLA 4B50A 5H37G 5DJDB 1SVCP 5CBEB 3ZE0E 3S37L 5ACZA 2VN7A 3D3VB 3WFHB 4V2CB 1J0KA 1MY7A 1DBKL 1PBYA 3OHXB 1YEKH 1RJYB 4HS3A 4W68A 3FOMB 1QPPA 3C5ZD 1MELA 3MOAL 3REWA 2FIRT 1AQDA 2YHGA 3TN0A 3UTQA 5D1ZD 4IBLT 5IW6A 1KELH 1HN1A 4MAUL 1YNLL 2DN7A 3I3DA 2XFXA 1DVFA 3T0XA 2X4RB 1DQDH 1VHPA 2EE6A 3GGWB 4NKMA 4EEEA 4YHLL 3V8OA 5DRWB 1Q9WA 4MXQD 3WNPA 4CMMA 3OAYH 4IRSD 4JO3L 5EORL 1GZQA 4Z7VE 4G8FA 1DEEB 4BSVA 1BZ9A 4MJ6B 4OCNC 2X89D 1CDBA 5KSVA 4JY5L 4O5LL 3FT2B 4EI6B 1HXYA 5HHPA 5JPMA 1HEZB 5FECA 2FEEL 3RDTB 5HGBB 3B83A 1YN6A 3DVGB 3OX8B 3BD5A 3WLBA 2V2XA 1Q94B 3OKMB 5J13C 1H3WM 4E5XA 3SDCB 2ZCLL 4Y2DD 3NA4A 4XCFL 1U8NB 3KPRE 5CUSL 1TJHL 2XZCL 4CU6A 5DUPL 3QCTH 4LHUA 3TYFA 2BY3A 3UYOD 2NY7L 1WSST 1ZVYA 2HLFD 4ZXBA 1S7WA 4PRDA 3MLZL 2R0WL 3MGOA 3REWB 5EUKB 3AB0B 1MNUL 3O41A 1RK1B 1NAML 4XVSH 4Z6AT 3PIQB 3LN4A 5J8OA 4XPFH 4YQXL 1JCKA 3L3HB 4XVJH 1WVZA 4ZUSA 2HFFA 4JFOB 3WSQL 1PZ5B 2P43B 3EUUA 3PXHA 4BUHA 4TSBL 1NFDF 2GSGA 3D39D 2H2SD 1CICB 3ZMRA 3UJIH 1IGTA 2VE6A 1R6VA 3K4DA 1MUJA 3BGMB 1F3DJ 2F8OA 3GBMH 4LSTH 4S11A 5F3BA 3LEXB 2FD6H 1IKFL 1RUPL 4I4WB 4KROD 1HHIA 5C2BH 2QL1A 4MQTB 4H88H 1R24B 3L6FA 1PVHA 1TTGA 4NO0B 1AR2A 2DQHH 3JV4B 4JRYD 4LF3B 2Q86B 1BVKA 5AYUL 2XWBB 3P9MA 4GW1A 4HEPG 2ARJB 5DHVB 1JYXA 1FFNA 3QR2A 4Y4FC 4F15C 3HC4H 3QIWC 1VSCA 4FOMA 1FV1A 4XAKD 3SPVA 3LQMA 3H3KA 4WTZA 1V05A 3LHPL 1Q0YH 1CN4A 1I1AC 2I5YL 4P9ML 5ICZB 3DX6A 2Q3ZA 3FFDA 1WBZB 1A5FL 4KJPD 3TJHD 2ZG1A 4NC1E 4Y8DC 4LPUA 5C86A 2DQGH 4M4PA 5KSVB 2NXYD 3MTRA 4HXBH 5F89B 3QZWA 3UPRA 4F3FA 4U6HB 3TPUA 4U7KA 5JHDE 5TF1L 3G9AB 4P2QB 1D6EB 4PGBB 4KV5E 4JR9L 5BZWA 4I18B 1E0OB 3DRQA 5B8CC 2OJEA 2UZIL 1P4LB 3U0TA 4LARL 3KPRD 4IRSA 4OI9A 1OAYH 5K9OA 2GJ6D 4JJ5B 1ITBB 1DVFD 4XNZC 3QEUB 4UIKL 1B3JA 1AD9A 3LMJL 4C59B 4TNVK 1P7QB 1G6VK 3E3QE 1KCSL 4GUPA 3UTPD 4ZUVB 2CUHA 1HHKB 1FBIH 3PE9A 5DC4B 3ORJA 4PTUB 4N5UA 5CCKL 2GFBA 3RX8A 4BFIA 1HIML 1JHKL 4GSDH 3VFSB 1XGUB 1DBAL 5T1KA 1UYWL 4WUUA 2MJWA 1OQXA 4NT6A 4RMUA 4XZUA 4OF8A 1N4XH 4RZCA 3SCMC 4JM2C 1REIA 4RSVA 3EO0A 4MQ7B 2X6MA 4PRAA 4Z7WE 1N64L 3OL2A 3TBTA 5EU6B 1ZAGA 3DX8B 4NBZB 3CDGA 4X9FA 4P5TD 4XNUH 4DQOH 2F19H 3HG1B 3GRWA 4MJIE 1P7KA 4IRJB 1WWBX 5GRXG 4O51B 4Z0BL 3MRDA 1XEDA 1W8NA 3BDXA 1TVHA 3WHXA 3T2NL 2FO4A 5BOZG 3U4EB 2AABH 4HIHB 4HFUL 4R4ND 5SWSE 3RU8L 4OGZA 4O5LH 2J5LC 1OAQH 5CP3H 3ZL4L 1NBVH 4KXZI 4Z7VB 5B21A 3UYRH 3QH3A 2AGJH 3PWPE 5DQ9B 4Q2ZB 4GLRI 4QXWA 2X44D 4PJBE 4YXLH 4B5EA 3WNKA 2AEWA 3WFBL 1JGLH 2COQA 3QUXB 4QRPE 4IRJA 5IB1A 5HDQH 5LGJB 4WFGD 2Z0BA 1HQ4B 3FQTA 1A7RL 3KPOA 1JI1A 3MRHA 3EOBA 1NCBL 4JG0L 4MA8H 4Y5VA 4OSUH 4JFQA 5H94B 2PYFA 3QEQE 1XCQA 4LU5L 3I3EA 5KAQG 4AEHL 4JM2B 1NC4A 3VXQA 1BD2B 3SJVD 4TVPL 3ZYJA 2EKSB 1PQZA 2DLFL 4QTHA 4LEXH 5ECJE 2FGWL 3S36L 2AEQL 1JPTL 3U0PA 3TWCH 1D5MB 1KENL 2YK1L 1I8IB 5B38A 3UO1H 4WWKD 1X4ZA 1U95B 3V4PL 3HC0A 2YPVL 3IU3A 5D71H 3MX0A 1P1ZA 3QWOB 3VGAB 1T3FB 2NX5B 3FN9A 3ZDXF 5EU5A 5GS0D 1VFMA 1K3ZA 1D9KC 4PLJC 3V8CA 5E8PB 5EIIA 3KJ6L 3OTTA 4YAQB 1OP3H 3NABL 2IMNA 1J86A 5DF0A 2FLBT 1CDGA 1QFWI 1WIOA 4ZO8A 3MLWH 1QR1A 4IEFB 2FJFA 4H1LH 4XGZB 4C4KT 4P4KD 3MOBL 1MVUB 5FO9B 2H41A 4D2NA 1NMAH 3G6JE 2FBJH 4N8CH 2XTJC 3RJDA 1BFTA 1DVFB 3MBXL 1K85A 1DQQA 1EHLH 4MXQA 5D4QA 1KLFA 2BNRD 2EEDA 1KJ3L 1T2JA 1F5WA 3RWIB 1IEAA 4M9PA 4ZUTA 3QA3B 1VGEL 5IWLA 1M71B 3QUKB 2E7LE 2GITA 4P5TA 1J5OH 4PJEA 4G42A 5I1IL 3QXVA 3MRRA 4NZDA 1XGYH 1X5FA 2N56A 2EYTA 2C26A 1EFXD 2F8XC 3WN5B 3S3PA 3STZA 3IDJA 3CVHL 4S0UC 3ILPB 3WIFB 4IMLB 5TE4H 3CH1B 1J0ZA 2Z35A 4ONHB 1TZIB 1TJGH 4NBXB 3WKNA 4LDEB 1YEHL 5FO7A 4RGOL 5D2LB 3H9ZA 3V7AE 4K23H 4UTAL 2F58L 1RJLA 4I2XA 3T0EE 2IPTH 3QDGD 3EAKA 5J12C 4YDIH 3H9HB 2OP4L 1NJ9A 2E7LC 4NQCE 4WDIA 4ELMB 2FEDD 4L8CA 4YFLI 1HCFX 4LCWB 2WZPD 5DC9B 2NY4D 1CGYA 3I6LE 4DTGL 4ZAKB 3MRBA 4Q9CA 1F6AA 1WFNA 3RWEA 4M61A 3EJZD 3OG6B 1OTSC 5C0JA 1VFUA 3DXAB 1MFAL 4G9DB 4X5XB 1R5WB 2ATPA 1AXSB 1FL3A 4FFYH 1JHTB 1D6VH 4KZEL 4PJ8A 2DQUL 1EXUA 2UY7A 1FC2D 5IQ7L 1QVOB 3U4AA 3O3EB 4HHAB 1IBGL 4KMQA 4JFED 4Y89A 4I2XE 3ULSB 4LHUB 3RVTC 1UCBH 4MSWB 2CJUH 5BS0E 5DD0H 5DS8B 1BEYL 1WWWX 4Q9QH 2WLZA 4GG8B 2DYPD 1JHLH 1FORH 4WGVB 1QR1B 3HAEH 4R7DA 2BNQE 4N5EC 3BO8B 5JORB 3EYUH 1CQKA 1CYGA 5JIIA 3SDDA 1I1YB 4HDIA 5CP7A 5DTFA 4I0PD 5I73B 4OD3H 3BQUD 3OR6A 5CZXD 4PS4L 4WEBH 1NH6A 4XPBH 5ADPH 4PJAA 4JRYA 3GMMB 1CFSA 1B0GB 3FHQA 1X44A 1QQDA 3NA9H 4Z18A 1S7RA 2DJUA 1FLTX 2NY3B 3BP4A 5FOJA 5IJKC 2FX7H 2DQFA 5CSZA 4G6FD 4WCYH 2ICES 1S78C 4FMKA 5EBMA 4I0PB 4HGKC 2WMPA 2RCSL 1MCHA 2GT9B 2CH8A 1RJYA 3BSZL 2R2HA 4JN1H 4BM7A 1A1NB 3PUCA 5JW4R 3DMMC 5D7JC 1NC2B 1NFDA 4Y5XC 5IW1A 3TJHC 1JNNL 3LIZL 1YPZE 4FHBD 3JTSA 1J10A 2IQ9L 3TVMC 3QDJE 1LO3H 2ZJSH 5IV2A 2Z93B 3TIDA 3KWWB 2R1WB 4LSUL 5IVXB 4RX4A 4R26H 1OWWA 5DLMH 2DIJA 4LRIC 4MZ3A 1G6RL 5I1KH 1A7PH 3G04B 3TFKA 3CX5J 2VZ1A 4GKZB 3ZZ1A 4OZIB 4MS8A 1YC7A 4XI5C 1CL7L 1GGUA 1U91B 3MV8A 2ED7A 1MSPA 3K7UA 4M6OH 1A1NA 1NLDH 5C0IB 3SDAD 3T77B 4WFFE 2IPUK 3GMOB 2FWOB 1YPZF 4CNIB 4PB9H 1NLBH 2Z35B 4PFEA 4OLUH 1MHPH 1OAZH 5A43C 3NABH 4QHUA 5DJ2B 4FABL 3VFMA 3U4EA 1A9BA 2DRUA 3QJHB 4AH2B 2YZ8A 1A3RH 3TO4C 2CIKB 1BZ7A 2VR9A 1DQMH 4L5FH 4U2ZA 2KL6A 3S4SG 3RQ3A 3DTXA 4FG6C 2YD9A 1LEGB 3DETC 3TH3T 4YHZH 2P4AB 2EXWD 1ZA6A 1G7LB 4E41B 3UBXA 4RAUB 5L0QC 3AS0A 5IMMA 4W4NA 2L4OA 5MENE 4GW5B 4PJGB 2GTZB 2XXMB 4PJEF 1MEXL 3W0WE 4KKLC 4PRPB 3D9AL 4ZG1A 4M5YL 3JWDC 3U2SA 1QLEH 3FT3A 4OLYH 5T5FH 2HT2D 3MLRL 4FFZL 2AEIT 3UBXB 5KSBB 2VDPH 3UTQB 2IH1B 1ZE3C 1HILB 2F53A 4XP6L 2E27H 4KUZH 5D7LE 1AGCB 5DK3A 4QNPF 5D5MA 1U92A 3O4OB 2KZWA 4O2EA 4AMKL 2NY6B 4Y4KB 2Z31A 1CE6A 1DP0A 3GJFK 1CFBA 4GQ9L 3A6CL 3LQZA 1FC1A 35C8H 3P9MB 1J05A 4FS0A 3VCLA 4JY4B 2FHFA 1LO4L 3JV0A 4AYFA 3U30C 1R3KA 5HHNB 4ODVH 4ALAH 3L3KA 3VFRA 3SBWC 5A2JH 3MRKB 5KS9F 3EOAA 1MFDL 5EU7E 4P49A 1JGUH 3V6OE 5IFJB 3RWCB 3EYFB 4LAQL 4R6UA 5IQ9A 3FRPG 3CLFL 1S9VB 4WNQB 1UVQA 1UGNA 1M05A 5EDXA 2KDGA 3UTTA 4BELD 3BEWA 1D6EA 1U8PA 2BVEA 3ZDXE 1C5BH 5H94A 4TNWF 4I0CC 5I8CB 3L3DA 1EO8L 5E4IA 5DDHB 4I3RH 3LS4H 4MD4A 5MP6L 4KH2A 3S96B 3QXAA 3GKZA 4J3UA 3MPCA 2NYYD 1WTGT 1NGQH 2DM7A 3FB7A 1QLRB 1IAIH 4P5MB 1YEIL 4K3JL 4Y4KD 3AXLA 5DJ6B 3QUZD 3RPIA 3PJSA 5DI8A 3QHFL 5GZOC 4PJHA 5TDPB 3BDYL 1KN4L 4KJQD 4KQ4L 2Q8AH 4QHKJ 3LEVL 2ZUYA 3MCLL 4M4RA 4H20L 4IS6A 4JDZB 4PJ5A 5KAQF 4KDTC 1JPGB 2ESVD 2BVQA 2VDRL 5E7BA 4BSWA 2FWOA 3WXVL 5ILTL 4U3CA 3CFEA 3ZE2E 3QXAB 3OKDB 2DMKA 4LSVH 2ADFH 3RGVA 2JK5A 3PHQB 1JTOA 4M6NH 3EO9L 1BP3B 4XPTH 1X5LA 1AP2B 3GSQA 4IIQA 2CDFA 1MVFA 2J8OA 4RISH 5E6ID 3O6LL 4HC1A 3VW3H 1I7RB 3V4UH 4AIZB 5B39G 3CX2A 2APVA 3NIDF 4NKOB 4TOYH 5FCSH 3FQNA 2HFFB 2ADIB 1NGYA 3MC0A 1RZJC 1IM9A 1TQBB 4PY8I 5E0QA 4R97C 4Y4FD 4NSKB 5LBSH 5F7FA 3P30H 1OGAB 3CNKA 1DZBA 4OIBA 3MJ8A 4O2FA 2VISB 3SDAB 4GLRH 2A9NH 2GJ6A 2P5EB 2YC1A 4Y1AD 5L88H 1P6AB 1IGFL 3BKJH 1XH3A 1J1XL 1Q0XH 4UINH 4NN6C 1K2DB 2Y6SD 5BS0D 1X4XA 5EU4A 3LS5L 3JZ7A 1E28A 4HKZB 5ALBH 4PJHF 5D5MB 2PXYB 2DM3A 3MRPA 4IDJH 4LVNC 5BVJA 3TBYA 4PLNC 4GRWE 3AS2A 1U3HB 2Z31C 1ZGLA 1NCCH 3T65B 2BXZA 2OL3H 2JB5H 4EBQH 5DMJB 4XVUD 4JO3H 4O58H 1C5DB 3VXPA 1ZEAH 3INUL 3PL6B 4JRXD 3UTZA 3DHMA 3SGJA 3IFPB 1YMMA 1GAFH 5EOCL 1BFOB 1FE8L 4HHAA 4PB0H 4RMWA 4NZRL 3IDIA 3ZYIA 4E41A 1DQLL 3RPIB 1DE4B 2B8OT 1OVZA 3QP3A 3MCKA 3LQAC 3WJJC 1WEJL 2VSCA 3HB3D 4XCYB 5E2UL 5KOVC 3ISWA 2YD2A 4LCWE 3GSUB 1AHWB 2WY3A 1KPVA 1M71A 4M7ZB 8FABA 2VDNH 3REVB 5C9KA 4D0DB 3QCTL 4YGVB 2Y9RT 4PREA 2HH0H 4IOIB 3RTQA 4KK9C 3STLA 2QQNL 4GS7B 5E70A 5HGHA 4X7SH 3OAYK 1FFOA 2J6EL 5DVNA 4R8WH 1T2QL 3UDWA 2E27L 4KUZL 2V7NB 4QXGH 2EC9T 1LP9A 2FX9H 2N7BA 3MV9B 4GXVL 5EZOL 1F97A 1IM3B 2ZSVB 5EG6C 4DVBB 5IFAL 1RZ8B 1IC7L 4CJ0A 4ZYKB 1MAML 3G04A 4N0CD 4HJGA 1TJIL 3GM8A 1WICA 2LQRA 4N1HB 3IDJB 4MZ2A 2XZZA 1L9NA 5BVPL 1HK6A 4HPOH 4MMXC 5E08L 2B20A 5ALCH 5F72S 1H3PL 4NDMA 4QXUH 3FB8B 2CUMA 3O81A 3RWFA 1PGRB 3TN0D 1DBKH 3HZKB 1TCRA 1MH5B 1J1PH 4NQDE 4HGMA 2DWDB 4IHOA 1AO7B 1TFHA 3HUJB 2YD6A 4JRXA 1TLKA 2OZ4A 4RQQB 3M45A 2PR4L 1IM9B 1G9NC 1EHAA 5DEGB 4K2UH 5AYUH 4BK4A 3SDCD 2D4DA 3BX7C 1OAYL 4MHHI 4P2OC 5DWUH 5EBWB 1N7MH 3DVIA 1KPUA 4MXQC 3VG0L 5HVWA 1KNOB 2OJZH 5C6PB 4FP8L 1YEIH 1ZXQA 2YD7A 4WI2A 5IMMB 1UT9A 3OXSB 3MROA 2G60L 3TJEH 4HSQA 2YRLA 5ANME 4R9HA 4OT1L 3FT4B 5SV3A 1JGVL 1J0YA 3AREC 3P9LA 2DTSA 3ZKXB 2FEEI 2XQBL 1F8TL 1ZT1A 4Z9KB 2BSSA 4HUMB 1JPGA 2VZTA 1MRDL 3F8UB 4NWTL 3MBED 2W9DL 4Y5XA 3SGDH 1SYSA 2I07A 3RA7L 1LO0H 1V7MH 3I2CL 3QH3B 12E8H 2BSTB 1OGAD 4L9DA 3MYJA 3U1SH 1SBSH 3QDMA 2DTML 3NAAH 4NQCD 5DJ0A 3IJHB 5C08B 2BX5A 2A6DA 3QI9B 1MHCB 4F9PC 1W2KT 4OZHF 1SY6H 4UT7H 2Z9TA 4WY7H 4J3XA 3S3SA 3IDXH 1PLGL 5ERWB 2R1YA 5DJDA 1ND0B 3QI9D 2HVJB 4LOUC 1GCFA 3IGAA 3KLSA 4BSJA 3SDYL 4PTTA 1NMBL 4LFHD 3EO0B 3FL7A 5C0ND 3BYTA 1CK0H 4ODHL 2D2OA 1FZOA 1UJ3A 1MPAH 3UEZA 1DN2A 2Z8WC 1XIWA 2DLTA 4G7YL 2DAVA 1BJ1H 3A0OA 5IBTH 2C3GA 4WUUB 5I1CL 4OKVB 1G7HA 2VLRE 1KBGL 4EN3D 2IBGA 2YRZA 4HBCH 4UOW1 1ZTXL 5JMOC 1C12B 5F97E 4MYWB 3VDCA 3ALPA 5HYJB 2VWEE 4AT6B 1MWAA 4Y2OA 1NCNA 5C08D 1RUMH 3CC5A 5DD1L 1XGQB 4OM0L 2ZZUT 3GB7B 3DUUA 2E7MA 4YO0B 5EO1B 5TF0A 3RP1A 1II4E 3DGGB 4KAQH 4GKNA 3ARFB 4Y7MA 1ZOXA 3O0RH 5C09E 1BREA 4KRPC 1YYML 2YD5A 3T1FB 3R1GH 1JPTH 1RK0A 4EUPG 1AO7E 5I8OH 4MNGB 4CUCA 4C83B 3NPZB 2IFFL 1QFPA 4G6MH 2GTZA 1ZK9A 2FJGA 1A6UL 2IAND 3DRTB 3DV6A 3MNZA 4U1GB 5C6WH 3MV7A 5HDQL 1KJ2A 3PQYA 2XPGA 4JFEB 2B4CC 4U1MA 4NO5A 2OK0L 2W9LA 1YYLL 5E03A 4RMSA 4ODSH 3RWJB 3UTOA 3S9DB 2NLJA 3U48A 5GIRA 1ZGLM 3HNSH 5LWYL 3C2AL 4FFWD 5CKGA 2G2RB 2R29H 2FGWH 1G9ML 1IC7H 3FRUA 3B43A 4YZFF 4NHUB 5HXMA 2F5AH 1KENH 5FYJU 3I02B 5C0CE 4TYUA 2WUCL 1MCFA 4L4TB 2W0FB 5BZDA 1UYWH 1LK2B 4FRWA 4C56E 4TVPD 5C2UB 3T0WA 1U9KA 2ITCB 4D8PA 4TVSa 2YEZA 4GRMB 2CMRL 4GXUN 5L9DH 4XAWL 4WW1A 5CSBA 4BKLA 5E8NA 2GK2A 4EI5A 2MFNA 4U6YA 2VKWA 4ZOCA 3PHOA 3O6MH 4JPKL 4U0QB 1B0RB 5EOQL 5SWSD 4NN5B 1MFCH 3BQUC 3DYMA 4XNUL 4FQXA 5DFVC 1NAKL 4WFFD 5IT2H 3O11A 2EH8H 5D7KD 2DQEL 2VL5B 3ILQD 3V6ZB 3BWUC 4K8RD 5TE6L 2Z91B 5I17A 1W0YT 3O2DL 4FFVD 3GSNB 4OFIA 4BZ1H 5CIPH 3CFKA 5HHOA 1TTUA 3NCBB 2EC9U 1QFWM 2O5ZL 3ARRA 3N06B 3U46A 2G60H 1T21B 3SKMB 2QQQA 5L2KA 2FO1A 1IT9H 4DUVA 5HY9A 2HVKA 4R96A 3O6KL 3Q6GL 3LSOA 3K81A 3H2WA 4XWGH 5CINH 3BWAA 3R4DA 1UM6H 4NRZA 4JHAL 4ODUB 4E0RA 4O51A 3F7PC 4FZEL 1JL8A 5L2JA 4ORZC 4XI5D 4KI5E 2VLLA 4YHKL 2GCYB 4L1DA 3HZMB 2DLGA 3B5GA 1C1EH 1NGZB 1CTOA 2I60L 1P4IH 4FXGA 2EDDA 2EDKA 1K2DA 4U4BA 4DW2H 3LRHA 1WZ1H 2VQ1B 1FAIH 4OAWA 1DEDA 1BQSA 3MO1A 1INDL 3C5SA 2YEZB 3NZHH 3RRQA 3C60C 2HMID 5ISZE 1D5IH 5ITBH 4M48L 4PJXF 1WFOA 3H7BB 2B39A 1UB6B 5I19H 1LEIA 4OV5B 1FNSH 2XRAL 1CICC 3BXNB 4KI5C 1KJ2H 4JY6A 1LO2L 2VN4A 3FCTA 4HPYL 4RFNB 4PP1D 4WV1B 5GGTA 5L8KB 3QQ9C 1JPFA 1JMZA 1CXLA 2X4PB 1B6DA 4G7YH 4Z7UF 5DMKB 3OKEB 5MEQA 3MZGB 4GG6A 3VFNB 1AGCA 4ZFZA 1WAAF 5E94B 1ZLWK 3NTCL 5E2VH 4JJ5A 4NRXA 1LD9A 5FECB 4G8IB 4LCIL 1RIHL 1QKZH 2C7UB 4PJ9A 2OBGA 4J6RH 3IXAA 3CMOL 5CEZH 1A6TA 2AV7B 3WXWL 4XP1L 2B0SH 2H32H 3MNVA 4F15B 1YC8A 2X4OB 3TIEB 5I30H 1MWAH 3QZWB 2YBRA 3UPRB 5GRJH 3WLWD 1E4WL 3QG7H 1IMHC 4GKNB 1N8ZB 5C07D 1H8NA 1Q9LA 3BZEA 1JHTA 2AXFA 2GKIA 3BUTA 1EAPB 1TVHB 3HFMH 3LRSB 3CFJB 2DWDA 1YY9D 1Q72H 4P5TB 2R2EB 4PRHB 5J6GB 2JCCE 5AUMB 4MD4B 4KKCD 4Z78A 5DJZA 3GEWB 5E8EA 1E6JH 1DQDL 3LKQA 5IMLB 4ZAKA 3B6SB 3IFPA 3WE6B 2WWKT 2W0KA 4PRHD 4NQED 2VDQH 2P42B 1X5IA 1Q9KA 4L29B 4Z5RA 1ZHLA 3GMLB 1IILE 4ISVB 3EJYC 5KSAA 3L3IB 5KVGH 1IGCH 1KELL 4FA8A 4XWOC 1T20B 5LWYH 3OXRB 5C0CD 4OZIA 3CVIH 1G9MH 3LEYL 4PBVC 5F7WC 2I27N 5ETUA 3X13B 4FABH 2XA8L 3LPGA 5GRUH 1FJ1B 1AGDA 3EYOB 5F6HJ 1U8KA 1F3RB 1LMKA 3EYVA 1TJHH 3QXUA 3VFOB 4JFDD 3D48R 3STBA 5FO8A 3QIBB 2ITDB 5IHLB 2A0LC 1IFHL 2CMRH 4LLYB 1FNLA 5KANG 4WWKA 3G5VB 5D9SA 1ZA3B 2HFGH 2BNRB 3DECA 3C08L 2XA3A 1KB5B 2QR0A 1ONQB 1AD9B 4X6EB 2A6DB 1A2YB 3MLVL 3QI9A 4OD2A 3OJMB 3R8QA 4M5YH 4YQXH 3PQYB 5CMAB 4QCIB 1AR1C 3JTTB 5GGRY 1TVBA 4MHHG 3K1KC 2YBRB 3EYQD 5C1MB 5BW7A 4MJ5B 4LDLB 1FIGL 1SYSB 4LRNL 4ZFGL 1YDPB 5HPMB 4GW5A 1NCDL 2EKJA 3JWOH 3KR3L 4PJGA 3SGJC 4BFEA 2BRQA 4OB5L 4MMZC 3T1WA 2WW8A 5KTEL 2V2TB 1KULA 4IM8A 2ESVB 4LKCB 3S5LA 4F33B 1W0WA 5EC1B 3NN8A 3VDAA 2G9HB 1GL4B 1IE5A 2GJ6E 5I6XC 4DKAA 4RWYL 4GOSA 1G9MC 2R69H 3SDXF 3MACH 3C6LD 1JGUL 3KLAA 1IQWH 1CDUA 3MLUL 5KN5B 1A02N 4U0RB 1C12A 3QISA 1FO0L 3SE4A 3IKKA 4YHNA 5FDWA 3BH8A 1BFVL 3MV01 3B9KA 1GGBH 4PJ8B 1VESA 1EZVX 2VC2H 3TYGH 4UB0H 1R24A 4DVRH 4QRPD 4M7LL 2OR7A 3KPLA 3CAFA 3WN5C 3QO0A 1U6AL 1X5KA 3RWGB 3QEHB 1JNNH 1SMAA 1CFQA 2V7HA 4S2SA 1U41A 3TCLA 3QIBA 2IQ9H 4E42A 1U58B 3PWPD 2UUDK 4HD9A 3I6KA 1LEKA 2B1HL 1WLHA 1VCAA 4QXTB 1O7VA 2FECI 1FVDA 5HJ3A 2P7TA 4G8GE 1AGDB 5B38G 1MCCA 3NCJH 3MV7E 2UVEA 2PW1B 4HT1H 3D0VB 1FVCB 3SGDI 4PJHE 1BX2A 2P48B 4X9BA 2DQCL 3HRPA 1JZ3A 2NCMA 3TFKD 2UZXB 2IAMB 1C5BL 1NCUA 3IAGC 1YPZA 4H8WC 1OT1A 4OLUL 3V4VL 3OAZK 1I8KB 3MRLB 4HG4K 4M62L 3PWUB 5GGTL 4LARH 1MCPL 3OAZH 4HFWA 1PDKA 1QKZL 1EEYA 2FJHA 4PREB 3T0BA 2D0GA 4JPWH 3AY4C 4L4TD 5DQJA 4G6FB 4QRUA 4HUUB 1NFIB 1FZMA 4S1RH 2X4NB 5F70A 3RUGB 4E9LA 3LH2L 3F7YA 1IEAB 2EZ0D 2IAMD 2IANA 4XPFL 2YSSA 2CKBH 3KPMA 1NUFA 1W72A 4P3CH 4QT5A 2VO5A 3BEVB 5GSVA 1ERNA 3HR6A 4AM0B 2JIXB 4QWWC 2ZCLH 4FTVA 3T08A 4GH7B 1JF1B 3DV4B 3PHOB 5ICXB 3IS1X 3S4SB 3F5WA 5LG1A 4EJ1C 5EA0H 2O5XL 1OTTC 3DMMA 5D7JA 4HJJH 5IROA 4DGYL 5I15L 1CQYA 4MAYD 4YDKH 5A40E 3FTGA 1W72L 2VZVA 1IKFH 4WW2A 4NQDD 2FSEB 1KCRH 1YNKL 4I48A 3EFDL 4L3CA 4ZFZB 3G5ZA 3VWJB 2VRAA 5AZ2H 2VDQL 2E6QA 4IRJC 4JKLA 5JW3H 3VW3L 2FIKB 5DEZA 2R56L 3NGBB 1INQA 5HYJA 3GO1L 2A6IA 2E6PA 4M93C 1SJVA 4YHMH 5J7CC 5CD3B 1EHXA 1VFBA 4UZGA 4Y5VC 2JB5L 1EV2E 2Q76B 5JXEC 3AAZB 5I1LA 4PJIB 5J1TC 4XC1H 2YRPA 4GKSA 1EJ6A 4W6YB 2J4WH 2BVUA 3ALWA 3ARWA 4X8JA 5DD6A 5C0IA 4HXAL 2XACC 2B4CH 4HLZG 3VFUB 5CEZD 4HS8H 5HYQA 1KIQB 4IIQC 3L3JA 1OAQL 3SKJH 5C0EA 1AJ7H 1QSZA 4H26B 3F5WB 3QEGL 1WBXB 1I7RA 4XNQB 5IVXA 1QSVA 1KTLA 4QO1A 4DCQB 3BKYH 1QRNA 3C6SA 4X98B 4APQC 1JGLL 3BJ91 1NCCL 4MNQA 2A6KB 3FQUB 5DUBB 4I3SL 2AQ3A 4LIQE 5T1LB 4JCLA 5D7KE 1FSKB 3UO1L 3PABB 1BGXL 1CLYL 1ZEAL 1A8JH 3INUH 3RL2A 3S97C 3W81A 4RMTA 2NY0B 4KI1A 2PO6D 1U36A 1KPRB 3EO1B 4C58B 4PJHB 5D5MF 4YFEA 2PUQT 4K9EL 3ARTA 2HKFH 1HINH 4G80A 4N8VG 3QNYA 5A16B 4GMTL 2QHLA 3QDME 4V1DD 4JRYB 1CLZL 5ILTH 1KLUB 2QQKH 3MJ6A 4MLIA 1FYTA 3D39A 5CJBA 1ZT4A 2W91A 3N9GL 3CSYB 4YBQD 3BE1H 2NY0D 4OD1L 3SBWA 4XPGH 5I8CA 1I9EA 4NQVA 3ZTNH 4L4VE 5T3ZL 1CGTA 4UDTB 2NZIA 4A6YL 3X3FH 1YQVH 7FABL 2FX9L 4I13B 1NGPH 3BOVA 2NXZD 3MRCA 1JWSB 1U8OA 2F19L 4RA3A 1JZ4A 3IDMA 4WW1B 5HDBE 1I3RA 4F7CA 2FB4L 3UJJL 2BCKB 4K94L 1DQJB 4WFEE 1JHKH 2VXTL 5DD5H 1LK2A 1KB5L 4Z7OE 5LXGH 5DC0A 2D7TL 4ONFH 3BPNB 2NY4B 4ELKA 4KKCC 2OYPA 2CR6A 3KPNA 1JWSA 1U8OB 3NCYS 3RZCD 4JY4A 4RGMC 2ZPKH 2FH6A 1A7NH 4NQSA 5CJQL 2ENYA 4XCEB 2ATKA 3GBNL 3D1MC 3QUMB 3IXTB 3PV6B 2BHUA 2JELL 1P7QA 5MI0B 4YK4C 3Q5YA 4E5XB 3V4VH 4HIXH 1UCTA 2J8UB 3BYYA 1UB5A 4RRPA 4UV7L 5HHPB 3QDAA 1QYGH 3RY4A 4EQ3A 2NMSA 1MCPH 4Y5YA 1ZWIB 3DVNB 1WFTA 5C08E 1QSED 3VGBA 1OAKL 3DMMB 4U1HB 5D7JB 1H3UA 3W11D 4ERSL 2LV4A 4PJ5B 4K3HA 3VWKD 3TESA 4TUJB 4Q9RH 4BH7A 3JTCA 1YEHH 2W1NA 2FR4A 1NBYB 1X5GA 3TPKA 3FONA 1S3KH 3KPMB 4PJBA 5JOPE 1F90L 2X4TA 3LB6C 2DBJA 4JFDB 1SJHB 4L3EB 3BJLA 3UC0L 1A14H 2NY1B 4E41D 4HUUA 1IKNC 1Q9LB 1E6OL 1L0XA 1BBJA 3RA7H 5ACZB 1MI5B 2P5ED 3N1GC 1ZLVK 1FLRL 4OCWH 5FAAA 4OZFA 1UWXH 3TIEA 4N90D 5B3NA 1K5NB 1IEHA 1DANT 3LCYA 5CIPA 43C9B 3RTQD 1NCAL 4PJDA 1ZLSL 3VXRD 1UVQB 4AEHH 3MXVL 4PRBB 4HBCL 3GMNB 1YZZA 5FYKD 3D85D 1CG9A 2W59A 3X12A 5CGYD 2V9RA 4OFYA 1DFBL 2JCCF 4PJDB 4N9GB 4OGXL 3HI6L 5LGKA 4M6AA 3TJHA 1D7FA 2EE9A 1CICA 2CRZA 3HC3H 4OZHB 3VFPB 1FZKA 9CGTA 4K7PY 2PTUA 3VU2A 4WO4A 2VJXA 2FYYA 4Y2DC 3MBEC 1JK8A 1KPVB 5E5MA 1NC2A 1NFDB 3QEGH 3VI3F 1ZSDB 6CGTA 4BZ2H 4P3DB 1MAKA 5JPNA 2JJSC 4PYHA 5FHAH 3E8UH 1FHGA 3S34H 3CUPB 1QBBA 4S1DC 2PR4H 1GC1H 1DQQB 3W5NA 2PO6C 1AKJA 4P2YA 3VE0B 1P69B 3QJFB 4OAWB 4JZJB 5JOFA 1KIPA 1ITCA 2BVPB 3CVHB 3LKSA 4Y4KC 5ESVB 4X5LA 1XZ0B 5ENWA 3SEPA 5EO0A 1HH6B 1VACA 4LSUH 3ARGD 3BRDA 1IEBA 1BGXH 1CLYH 1HHJA 3L7FA 3FAXA 5H2BA 4AM0A 5GGSY 1FVEA 5E5UB 4JY5H 3GMPB 3UTSA 3WL9A 3T65A 5GPRA 1PJ9A 4Z0XB 2MQ3A 5EO9A 3QBTB 3RHWK 2ESVA 4HKJB 5F88A 5GGVY 1F11A 4YO0A 1NFIA 4JM2D 3BWAB 4M7JL 5A2LH 4G8FB 3N85L 3HI5L 4IS6B 4N8PA 4HIIB 3TA3A 1CLOH 3RUGE 4G6KH 5KVEL 5E9DD 5ISZB 3UMTA 2AKRA 1YEGL 3QO1B 5ACMA 1UQSB 1GHFL 1I7UA 4PJCA 4ZS7L 3MFFA 1YYLH 1PX4A 4R0LC 1BX2B 2DQTH 1CGSL 5KVFL 5E2WH 3C5SB 1Q9OB 5EU7C 5MEPB 5IQ7H 3B4NA 5I1HL 1T5WA 5F3BB 2R9HD 3QIWD 4LNRA 4X9HA 4YDJB 4WENB 4DUWA 3CDGB 3H9SA 3ZSSA 5D70L 2PYFB 1NGZA 1WBYA 2LABA 4G8EA 4LLVA 4P23B 2HLAA 4MQ7A 4PRAB 1NMBH 3RGHA 4U6YB 3MXWL 1CZ8H 4NYLA 5HYJD 4DTGH 2EO1A 4NHCH 3H9HA 4WHTB 3GRWL 4WEMB 3V0AC 3OKDA 1XF3B 2ICWA 4OGAD 1G7PB 4RMVA 5IW1B 5I6XB 3DSFL 4ODUA 4WEBL 4FQQB 5IWLC 2B7DT 2YD3A 1EGJA 4MD5A 3S6CA 2ILLA 4QRQB 3RKDC 1LE9B 1KTDB 5T1KD 1DBBL 3ZKQD 1CVRA 4XHQA 2DKMA 4EN3A 3AREA 5JQHC 5I66A 4LLUA 2IADB 3LHPH 3VD5A 2RCSH 1U92B 1FORL 1CU4L 3H9YA 3C9NA 1AY1L 4AMKH 5F6IC 2A83A 3TBWB 4U1SB 3UAJD 2GJJA 4MS8D 1HXYB 3KYAA 1HXMB 1G6RA 3RPKA 2OJEB 4PS4H 1YYMH 3MLYH 3OGOE 5DA0B 1SMOA 1YEDB 1S5HA 2V5TA 2ZOKA 2F54A 3SQOL 3FN0L 4XP9L 2AXHA 3RAJL 1H3XA 1T83C 3BP5B 4UNUA 2IG2H 5HBBA 1K6QH 3B9KC 3RVVC 1GXEA 1AKJD 2GTWA 3U6RB 5IEKA 4LCUA 3V0VA 1ZHBA 1NDMB 3L5XH 3H3PH 1F58H 3E6HA 3P0GB 3VRJA 4LLQB 4FQJH 2IJ0C 5IB5B 4AJ0A 2EXYC 2OS7A 1B4JH 2EEBA 4YX2L 3LIZH 3WFCL 4RNRB 5SV4A 4WTWA 1PZUB 3NCMA 1HQRA 4QF1A 1QA9A 4U31A 1WC7A 3FB6A 3M8OL 3QQ3A 2XTLA 3T4AB 1C08B 4KROC 2XN9A 1A6AB 3MNWB 1IGJB 2NY3D 4PY8J 4JFEA 5DZLA 1MWAL 3ALXA 2OL3A 3W9EA 1MJJA 2BSRB 4U1KA 1AC0A 4HS6A 2OTWA 1KN4H 4UV4H 3UCRA 2ZCKL 3IAQA 4N90E 1TTFA 3P40A 4FXGB 5IJKA 2GUOB 4R90L 4UDTA 4UQ2B 4L3EE 4PJ7A 5F96H 2V9QA 3HNTH 4MCZB 1UWEL 3W82A 1U58A 3IETA 3TT1L 5I8KH 1MFCL 2XWTB 4LNRB 2CK0H 3QXTA 2YSSB 4MNQE 3WEXB 5MEPA 2WINB 5KOMC 4MDJB 5D72H 5F7NC 3QIWA 2ID5A 3WHE1 2O61B 1R3LB 3SPVB 1F4AA 3PV7A 3B9KB 4XP1H 5DO2D 3VG9C 1N5YL 5I30L 3BKJL 3IFLL 1KN2H 1CGXA 3DBXA 5ID1A 2PCPA 1KCLA 4PJ9C 2FECL 3MLSL 2BXYA 4H88L 1F4XH 2OZ4H 2MPAL 1MEXH 4JN2B 2BOBB 4N0UB 5SX4I 1CCZA 1IC4H 3TT3H 2DLIA 2FNBA 3TVMB 3ROLB 2R0LH 1IAMA 5CHNA 5LQBL 1H8OA 2D03H 3M17B 3WIIH 1K4CA 1IGFH 3KXFB 2KPNA 3FT2A 4EI6A 1T0NA 3RIFK 5DDHA 4AQ1B 4Y16B 4X99A 2ZG2A 4NQTA 1NBZB 4NO2B 4YPJA 1KNOA 5ALBL 4L8SB 5DURB 1CGVA 4S2SB 4NKMB 5IUSA 4LVEA 2X1XR 4YPGB 3JWDL 5KBNC 4B7IA 2OI9A 4X6DF 5D2NA 3D25A 2Y5TA 5IESL 4IHOB 3GI8H 4OZGB 4PJ7E 4UDUA 1XGUA 3QFDB 4X7DC 1SEBA 1JK8B 1PX3A 1A7OL 4X6CF 3MLPA 1FNSL 2XRAH 1I8LC 3CX5K 5D71L 3FQXB 1S7VB 3CLFH 3BFOA 3RNQA 3HAEA 3VD9A 4LCCA 4FZ8H 1OF2B 2HFGL 2ZWLT 3BD3A 2M2DA 1U8NA 4GRWB 5DMYA 4OJFH 3WD5H 5HI3D 3BZDA 3T0VA 1NDMA 3ET9F 3VFTB 4APQA 3GSQB 5EZLB 3MACL 1U8JA 5IGXL 3OXRA 2XPGB 3J8F7 3PP4L 2C1PB 2YA0A 3QDMD 4NQCA 4ETYA 2NQCA 1JNHB 1RZFL 4JQIH 3P9WB 4KWUA 3DRTA 3MNZB 2BNQB 4U1LB 3ZKSD 1RZ7L 4OF3A 2BVQB 1ODAA 3ARDC 1DBAH 4G80B 1KCKA 3I9GL 1N6UA 1QNZL 1SVZA 1UM5L 2DQDL 5JZ7D 5LCVH 2HVKB 1T0MB 1NKOA 4NQDB 2B2XH 5JR1L 1AKJB 4P59L 5JUEH 2Y06H 3B2VH 3SO5A 3BDYH 4J3VA 3S35X 3GSOA 1FGVH 2V5SA 4AEFA 5BW7C 5KJRL 5LBSL 3QQ4B 2X4NA 3HMWH 3QDGE 4L9LC 3CFJA 5HGGS 5IBUG 5C0BA 1SJHA 1HKLL 3SQOH 2ADGA 2WWMD 1KT2B 5DRXB 3WEXA 2GAZA 2QEJA 2UWEF 2XWTA 2NNAB 4DN3L 5HVHC 4HT1L 4X98A 3QFJE 3CMGA 3VFPA 4WI8A 3SKOB 3QDJD 4KFZC 3TF7A 3RL1A 4QRQA 1JTTA 1XF1A 5IHUH 4MD5B 5LVEA 2AQ2A 4RGOH 1V3KA 5CEZE 4XP5L 3U7YH 4PLKD 5IW3A 2ZSVA 3DNKA 2CR3A 4KZDL 3JV6B 3RVTD 2D0HA 5GS1B 3WS6A 1IVLA 2VIRA 5KSUB 1EFXB 2A2QT 3QQ3B 4IMLA 2QQLH 3WFBH 1FFOB 2X41A 2J6EA 4KVNH 3ZHLA 2A9NL 4XMLL 3L95B 4F9PA 4PTUA 5IB3B 2FCBA 1HHKA 1P9MC 4D0CB 2R2BB 3C6LC 4Y4KA 2Q8BL 4Q7DA 2M8XA 5HHMD 4ZXBC 3ULUF 1OD9A 4W81A 1M6OB 5SWZE 1RZJL 3WJLA 3O3AB 1KB9J 5EA0L 5FYJD 5FHBL 4Q0XH 2R8SH 3IDIB 3RBSA 3FOLA 4FQLL 5LJYH 5GGVL 2ADIA 4M00A 3DLQR 2O5YL 3BAEL 2XTJD 5JHDD 4JLRA 4TSCL 1NCBH 4WI9A 3SCMA 3HR5A 4QGYA 2JIXA 1YNTA 4U1LA 3G08B 4X4XB 4PJCE 2GW5A 4GXVH 4JPIB 4NZRH 3RZWA 2LVEA 1S9XA 3QDHA 4NKIL 1VFAA 1CD1B 5E2UH 5JTWA 1BZ9B 1TJIH 3CK0L 4GG8A 4NNPL 5L6YH 5GSRB 1IC4L 3LSOB 4OV6F 4MJ5A 1VPOL 5I1AB 1Z6JT 1O5DT 3IU3B 4HS8L 2WAHA 4ORGA 3FN3A 2YC1B 1X5AA 2EDJA 4MX7A 5BMFH 1U8LA 4NUJB 4UMGA 3MA7B 1ULVA 2QADC 2ZUWA 3PNWB 3WIHA 2R4RL 3IF1B 3A6BH 2EDOA 3LD8C 3KPQA 4WFGE 4JFFA 4QRSA 2FBJL 4N8CL 2WSKA 4UILL 3ZDYE 3ES6A 3VI4E 3LZFH 2ZJSL 3U9UA 1A4JB 4EVNB 3V9FA 2IFFH 5EOTB 2JTDA 1EGJL 3H9SB 1CLCA 4GRLC 4FP8H 3ABZA 3GMRA 2X2YA 4WDIB 3L7EB 5D1XD 4YXKH 1T20A 1TCMA 1MJ7H 2AJ3A 4ZFFB 1EHLL 3VXSD 1P9MA 5KS9E 1D5ZA 5JXEA 2OK0H 3BIKB 4N0UA 3QPQC 1C08A 1TZIA 1OW0A 1BQLH 2HG5A 3R8BB 5CGYC 3OQ3B 3EDJA 3THMH 4RGND 4OGYL 2RBLA 4XC3L 5IKCB 5JO5A 5KS9B 5BRZE 1FRGH 3L5IA 5F6IB 4TUOB 2GI7A 4Z78B 2ADGB 4J3SA 5T3ZH 4S1RL 3G5ZB 4XB7A 2VL5A 3V6ZA 5FV2A 3O45B 2A6KA 3FQUA 1NGPL 4PJBB 2X1QA 1FL5A 3FMGH 4ZD3L 5DTFB 1PLGH 4X4XA 3V6FA 1AO7D 1OLZA 3V52L 1JTPA 3OKNB 1G9NL 4QWWD 2GUOA 4LCYA 1J87A 4XNXH 4ZTOL 5J1AB 1MVUA 3TA3C 1RUQH 5IVOA 4ZFOL 3UZEA 1L0YA 5HVFB 5JNYB 4JZJA 1ORSA 5JOEA 5D8JH 2GQHA 4NCDA 1LO0L 1V7ML 3WMSA 1KG0B 2CLRB 4CU8A 4QYOB 4NRXB 4MWFA 3U1SL 4OLVH 1NAMA 4U1SA 2VZOA 3ARBA 4X6EA 3MRFB 1JHLL 1YEJH 1TPXB 1FNGB 3VFSA 3OHXA 5C9JB 1YQVL 1RVFL 2B5IB 5BRZD 5HHNA 4XP5H 2A9ML 4LSPL 1MCRA 1TPXC 1TVDA 5FK9B 2NY6C 1QTYT 4DFIA 1SY6A 3MQIA 1B0WA 5DRZB 1CTNA 1FNGA 4XWGL 2HYMA 3N1QC 4WJ5B 4WEUD 3O6FB 2H9GB 6FABH 4KVNL 1HSBB 2FSEA 3W0WB 1KV3A 4H0GA 5EZIH 5D7LA 4I2XB 3BGAA 3QUYB 4B41A 1T04A 1P53A 2DI7A 3VH8A 3GBNH 4XAKE 2NXYB 4DKEL 1IGYA 4PRHE 3GUTB 1S5HB 3BSZH 3NPSB 5JIKA 2X4SB 2P46B 1XMWA 43CAA 4PG9B 3ARFA 5FV1L 1MCBA 2M1KA 4P23C 4OQTL 1RY7B 2Y4SA 1FYTB 3REVA 1QRND 4MJID 2G75B 4M8QB 2ICEB 3QO0B 4Z76B 1HOCA 1X7QA 1T4KB 4NN6B 3E3QA 1I7UB 4KPHL 4L4VA 1UA6H 4OQTA 1YMMB 1JUFA 2DS4A 5FO9A 2E7HA 5D1ZB 3D39E 4UNVA 1FYTE 4Z7QF 5IB4A 2HG5B 3UC0H 3BIKA 4NC1C 5CEYA 1IAIM 1CLZH 3QIWB 1LDSA 5T1LA 3P2TA 4YHPA 5EULV 1YN6B 2NY7H 3GJEA 5LGHH 3BT2H 2Y5EA 4ZODA 1J18A 1FO0A 1QZ1A 4HWEH 4NYLB 2Q7NA 1NQBA 4LKXB 3KAAA 2EIZB 5DMIH 1YDPA 1JJUA 3KYMA 1NLBL 3HE6D 4H25B 5E8OA 4CN1A 1WJ3A 4JCMA 1Q9WB 5HDLA 4CMMB 3QG7L 4HMDA 5CEXA 1KXTB 5T1DH 3W9EB 5F3HB 5B39B 5C09B 3K0WA 1L7IH 1RURL 4O2CB 2EH8L 2OTUA 4XBPA 5B3JE 4WHCA 3O41B 3MNWA 3D9AH 4ZXBD 2C3XA 4JANA 5A2IH 5KSAC 5H8DA 1CL7I 4G7VL 4NJAL 4JFPB 2XNAB 3GSRA 4OLXL 1NGWB 3FQNB 1K3IA 4KTEL 3BH9B 1E4KA 4L8SA 2P8MA 4GAJL 5C0AD 4LLQA 4KGJA 3M1BB 1N0LA 3KPTA 3IS0X 3KVQA 4KI5D 2W0PA 5CZVH 1Q72L 1Y6MR 2GCYA 4K9EC 3P9LB 4GKOA 5ETUB 3WLBB 4UUJA 5D96C 3M17A 4OLEA 4PLKC 4WW2B 3WSQH 5JPMB 4RWHA 1H5BC 1OP3K 4UTBH 4IRSB 5GRWA 4Y1AB 1FFPB 3FJTA 2BOBA 4EOWL 1WT5C 5FA3A 3QFJD 3E3QC 3BIBX 4U3XA 4PGJA 2PCPB 2W0LA 3VE0A 1OL0A 1CGSH 1HNFA 5KVFH 3FO1B 1RUPH 1NUDA 3V52H 1QBML 3EFFA 5A2FA 2DI8A 2B1AL 1DN0A 1EO8H 2EEAA 4N9OB 1EIBA 5EU3A 3QCVH 2AJZB 2RFXB 1LO2H 3PWUA 2YS4A 2V9TA 2WBJA 4TUJA 4QXGL 1X5HA 3VXSB 1EBPA 2ZCHH 4M93B 4EI5B 3BKCH 3ZLQC 4OZFH 4PJXE 1HHIB 3TO4B 1F2QA 4N5ED 5K93A 4EUPB 4F8TA 2VDOL 1S78D 2R0KH 3HAEG 5CCKH 1DBBH 1RIHH 4LQ1A 1AR1D 1MAMH 5TGBA 2BVOB 4L4TA 1A6VH 3U36B 2DWEB 3HZYB 5I18H 1T1WA 5CEZL 3RDTC 3SKOA 5IV2B 3I6KB 4PV9B 3HMXA 2EDYA 3T04D 1FO0H 4MLSA 1T7YA 5HD8C 5J6HA 5CZXC 4HPYH 4L8SC 1HE7A 1GGBL 3LMJH 5EPMB 4JEGB 2Y07H 1DN0B 3H7BA 2IH3B 1FNEB 2Q20A 2WV3A 1DCLA 1F3JB 4RGMB 4L3CB 3CH8A 4K7PL 2GT9A 3OWEA 3H8NA 4TOYL 4Z7WB 1JBJA 4BQCA 1T7XA 3O2WH 2IANE 3O4OC 2EYSA 4LLWA 3MYJB 2N7AA 4PBWD 2ADFL 1NBYA 4OQTH 1MIEH 1KEGH 4HZLA 3TBSB 3P30L 1B6UA 1UFUA 2YUWA 3TYFB 5BZWB 1F00I 3PP3H 3PWNB 1MQKL 3F7QA 5GSRA 3KDMB 5GXBB 2V2WB 3ESVF 5IB2A 2W9EL 3BP7B 2IALA 4JPVH 2CDGA 1UB5B 1JWMA 4PRPE 4HWBA 4R3SB 5DJCA 3DGGA 2X42A 3DTXB 5IB1B 1JI2A 3VGEA 5C0DA 3BKML 2Q6WA 4OFVA 4RGNB 1PEWA 3BP6B 4CW1A 4Y4HB 3CVHA 3LN5A 4I0PC 2CKBA 5ID1B 4JFYA 3BI9X 1QFOA 4JPWL 3X11A 5DI8B 1ZVSA 5D6DA 5I1EL 1G7HB 4PGDA 3O4LB 4MA8L 3B5TA 4ZS7H 5GRYA 4RX4D 4NSKA 1E4JA 4J1UB 3WHE0 1R3IL 1ETZB 3RVXC 4K71C 2BERA 3IDNA 5K9QI 5CEXB 4PJ5D 3E6FB 5K59E 1WZLA 5C0BD 2D4FA 1WTLA 3TBTB 4YDLB 1XCQB 1A6WL 1NKRA 3HE6C 2KUTA 2OTPA 3HUJF 3N1FC 5J13B 3VA2C 1U3HD 1CDYA 4LSSL 4L4JA 2EIBA 1O0VA 4LAJH 3BZFB 3K8KA 2QQNH 4NQEB 1UEYA 4CGTA 5C7XH 4I18C 5F9OH 3QDJB 5CEYB 2E3VA 5TDOA 3JVGA 1BJ8A 5I74B 4BJLA 1KBGH 2R69L 3FQWB 4LPCA 1MCIA 4LEXL 3VWKC 2V6HA 5TDPA 5I74C 5AZEH 5L2KB 4YJZL 5CGTA 4N8VA 2NY5H 1IGML 3GJFB 3SDDC 5IEKB 1IC5L 4JKPL 1N5YH 3K8MA 3V4PH 4Q6YA 4LPXA 2HLFC 3IFLH 3SDDB 2RJMA 2CO7B 2JKXA 2ED9A 2FR4B 3L3DB 1RZIB 2P44B 2XKSA 1OY3B 2MPAH 5MEND 5LAXB 3WDJA 3UTTB 4G6ML 3GI8L 4CVZA 1UH2A 4X4YA 1GVIA 3SOBH 2IWGA 3IFOA 4TNVF 5F1IB 1LP9F 3D6GA 4W6WB 1KIQA 5FM8A 3AB0C 4I3SH 4XB8A 1QHOA 2J8UA 5F9JA 4U1GC 3GM0A 4PJGF 2UWEA 3ULVH 1JMXA 1XGQA 4PJAF 1CR9L 2HRPL 2ARJA 3IFNH 1HWGB 4NQSB 3Q1SL 1P1ZB 2R29L 4HJ0C 2X05A 2OP4H 4CVUA 4J4PD 5E6IC 3RNKB 3BMVA 1U8IB 5FB8B 4OIAA 1KIRA 2YN3A 2W9DH 1QNZH 4HWZB 1S7SB 1OGAA 1OW0C 5F9JB 1N3NA 1D3CA 1PSKH 4NRYB 4YPGA 3QNXB 1NANH 2EDQA 5B39A 1NSNH 4GKZA 3OB0H 1XFPA 3PWLB 1BD2A 2Y07L 4KJQC 2VITA 5DRNA 1OSPH 2F9BT 2GEEA 4Y19D 4WI7A 3BPLC 3QXDB 3RI5K 4U6XB 4X80H 4X6DB 2Y36L 1W72B 3MMEA 4QT5B 5FGCE 4P99A 2FB4H 3ARGC 1IQDA 4DN3H 3PL6C 5T3XE 4LCCC 3IRPX 1BVZA 3CDYA 4TULL 3CFIC 3HLAA 3BE1L 3SDYH 2PO6B 2AJVL 3MLXH 2AXFB 5AZ2L 4AH2A 4WV1C 5ESQB 4OM1H 5CJ5A 3BGFC 3ARDD 2O5ZH 1SY6L 3C8KB 2VWEC 4HFWB 2R56H 2YA2A 4AY0A 1A7NL 4PV8B 2AERT 3HI1B 3OZ9H 4HUNB 5JW5A 3PP3K 3B2VL 4I9WE 1I1FB 4H8WL 4XPBL 1IL1B 4M7ZC 1TETH 4NJ9H 3MLSH 1LQSR 2J88L 4U3HA 4ONOA 5KW9H 2VXTH 4JM4H 4V3DB 1GZPA 4X7EC 1D6VL 4KZEH 3WHXB 5IBLC 4YDVB 1MFEL 4M8QA 4WTZG 1T03L 3AFLA 4U7MA 1XF3A 4HIEB 1P5UA 1IBGH 2QTEA 1FQ9C 4HEME 4PP1C 2FX7L 2BNQD 1TDQA 2EH7H 4R3SA 5I1GH 5F1OB 1J12A 1NMCC 1SHMA 5H37H 4F57H 1UZ8A 3Q5TA 3EFDH 4R2GD 3QXDA 4MJ4A 1MIMH 3PV6A 4GXUM 3Q0HA 5CWSB 4YBLC 3MODL 3O3DA 4BQ9A 2VSDA 2AXJA 2HVJA 4ODBD 1WZ1L 4KAQL 1R3IH 1RUKH 2XZQH 4AIOA 4JO4L 1LWRA 3MFGB 3H9SD 4P5TC 4HIXL 2APFA 2OL3B 5IMOA 3OF6D 4QCIA 2BY1A 3TF7C 5J89A 3I75A 2L7UA 5EH1A 3MGAA 2H1PL 4JFZH 3ZYZA 1FL3B 3O4LA 4TUKL 5EUOE 2OTUB 2HT2C 4LVOB 4S0TD 5E6ZA 5C08A 3VXUB 3P0VL 1FP5A 4P3WA 5EPMA 4HXAH 3D69A 4ZS6D 4WW2F 3I85A 3RKDD 3I6LD 1G7MA 2NPLX 1T5XB 3SKJL 5D1QA 3F6LA 4HUXB 1U3HC 2Z31B 1ZLSH 4OJFL 1BZQK 4Z7VF 5F9AC 1Y0LB 4HKBA 3MXVH 3RVWC 4F7MB 2H6PA 3T0ED 2BRRH 1YNLH 2K1MA 5F8RC 4JO1H 2ESVE 3V6BR 3ARSA 4GAYB 4KQ3L 3VXRE 1VGKA 5BO1L 3QNYB 4OD1H 1Q9KB 4L29A 4QY8A 5A16A 4CU7A 4A6YB 5DS8A 3L5HA 4AZ8A 3FO2A 1SJEA 3G6JF 1UKQA 1KPUB 3CFDA 4QRPB 1J11A 3OKOB 1KIPB 2BVPA 5JQ6H 4ODSL 2WBJB 4Z95L 4PLJD 5KVDH 4YR6B 3QIBD 4P59H 5JUEL 5EZJB 3VWJC 2QKIB 1I4FA 4HIHA 5KJRH 3QSKB 4K94H 1DR9A 3KYOA 3ZDZF 3DUUB 1MH5A 2D7TH 2JCCA 1P7KB 3FZUC 2DD8H 3OF6A 3MA9H 1E6JL 1MCOH 4FQXB 3JVGC 1I1RA 4C56A 5L9DL 3L95A 5F71A 3KYNA 1MJ7L 4POYA 3AM8C 4MJIB 3OKOA 3FQWA 1T1WB 4XXDB 4UU9A 5DYOB 3KLHD 3IXAB 2EO9A 1G7JA 5K9JH 1NJ9B 1RFDL 2X7LB 3ZT5A 2IMMA 1JNHA 5MERB 3C09B 2J12B 4JHZA 3D0VA 3SDXB 3MGTB 3G5YB 5HHVH 1SQ2N 2UWEE 2XN9B 3MJGX 4ODXA 3LZFL 2R0ZL 4M1CD 2X9XA 1OAXL 3V7MA 3TNNB 2VLRA 1GJIA 3PWJA 3SY0A 1CS6A 1OF2A 5I9QB 3KYNB 5HHMA 3VCLB 3TV3L 4FFZH 2A6IB 5FK9A 3SKNB 5GIRB 3LQZB 5DEFA 3E6FA 4XMPL 4OF5A 4HIJB 5TH2B 2X09A 3CCHB 1TENA 3D69B 4PJCF 5D7LD 2FIKA 1F90H 1LE5A 2JCCB 3LPFA 3O9WA 4MCYB 3ME0A 3U6RA 2JELH 5TDNA 2DQTL 3MCKB 3K2UH 4K94C 1ZT7A 3EGSA 1XR8B 4KJYA 4G6KL 5KVEH 3DXAE 3SJVE 4QHLB 4YR6A 3AC0A 3MRCB 5JLZA 3E1F1 4Y4HA 4JGUA 4YHKH 2QSTA 3TBVA 1YN7A 4MNGA 3VXPB 4CW1B 5FCUL 2KKQA 4JFQB 3H42L 4K3JH 2BSSB 1KC5L 4K55A 2I60H 4LKXA 4PJ9B 2WLYA 3TNMB 4DKDC 4Q9RL 3VI3E 4LASL 4Y5YB 3GRWH 5DK2B 2C1PA 4NQCB 1FAIL 2VLJE 2PXYC 4DGVL 5I1HH 2D7OA 1H3GA 2ERJB 4NKDA 4NRZB 4GW4A 5J0BA 1FNAA 5TF1H 3HS0B 1DFBH 1GIGH 5D70H 1T1XB 1XIWC 2CKNA 4AG4H 4PYGA 4HWNA 1N26A 5D7IE 3QUMA 4TN9A 1MFEH 1OD7A 5EO0B 2HTKD 4QHKI 5DHVA 2Q1EA 1S7VA 1I1AA 1VEMA 2VAAB 4JZNB 3N1MC 1OCWL 5CJOL 3P4OB 4JFXA 3U46B 3O8XC 4JVPA 3DUSA 1K8DB 2AXGB 3TYGL 2Z8SA 3WXWH 1KCSH 3PWVA 4LBEB 1BAFH 4TTDD 3NACH 3MRDB 1VA9A 3E8UL 2I9TA 3HZKA 4XBEL 5F3HA 1YQ2A 5IM7B 2E6JA 1ZKAA 4P4KB 1NFKA 1TIUA 4IOFC 5KSBF 4KK8D 5E1AB 4HF5H 2P7TB 4B7LA 1LK3L 3AVEA 1DBJL 4HC1L 2YUVA 2EIZA 5LKNA 3WFDH 5F7DB 4OCRH 3GUTA 3QDGA 3O2DA 4JQVA 3MJ9L 3ARUA 4FXKA 4JFOA 2R1YB 2MQCA 3CU1A 3QEHA 5F6HI 1KCUL 3CLEL 4XPTL 3WDHA 3UTTD 1IZKA 4KRPD 4J1UA 3QUXA 4P0DA 3GBLA 3MJ9A 1G9EA 4ZAKC 1B4RA 2H9GA 1F42A 1J0IA 1N64H 2YKLH 4K7PX 4FQJL 3N85H 4KRPB 4QF1B 1QO3B 1MJ8L 4LNVA 3GI9L 3VWJD 1VDGA 2GYSA 1GGCL 5A3ID 1WQVT 2AJUL 2YWZA 3PDGA 4U05A 4XVTH 4JO1L 1ED3A 4Y5XB 4OIIL 4FQ1H 3CIQA 5HI5C 4F7PA 2UYLA 4OCXL 1RIUL 3EDEA 1GHFH 3QUZA 1OARL 3FB7B 5BS0B 1S9XB 4X0KA 1JYWA 4M9OA 5BXFA 2IBZY 3QG6B 1MJUH 4YDLC 5DJXA 4POZC 3FQRA 1G1YA 3MROB 2W65B 3P73A 5EZJA 3VXRA 3WFCH 2YA1A 3BO8A 4D9LL 4MNQD 5J11B 4MCZA 1HHJB 3L7FB 3RZCC 1AGEB 2NY0C 3QUMH 4RFEA 1G7IA 1U8PB 3TM6A 4MXVF 4XP4L 4WWID 2AV7A 4PLOB 1BIIA 2HT4D 4XBGB 5GGRB 2VDNL 3TT1H 4HZLB 1S5IH 3TBSA 4NO3A 2XI9A 4QHLA 1FSKC 1S9WA 1TZGH 3OG4B 3Q3GB 4RFOH 1BBDL 4O02H 2X1WL 1YEGH 2ZUVA 1S7SA 4I8DA 5FB8A 1A64A 1NEZA 3FFCA 3QIUB 4L4TE 4GG6B 4OSUL 5C3TA 3I02A 1ZLWH 1Q38A 5E5MB 2MCPH 3CC5B 4D0CA 4EIGB 1A5FH 2EIDA 4LGPB 2G2RA 5L7XH 1F6AB 3ZKMD 4CVXA 2DJ4A 4MQXC 4N0CA 3FQXA 1CF8H 4N0YL 3CXHK 2FBOJ 4ACPA 3UPCA 5BJTA 4CJ1A 4EDXA 4ODWB 3VDBA 5SWSB 1EUUA 3VWJA 1ZHNB 2XIDA 4R97B 2F54D 1BQHA 4OTXL 4DVBA 1U91A 3MV8B 3TV3H 4NUGH 1KACB 3GNMH 1EH9A 4HPOL 5E08H 3MV9A 4JKMA 5CILL 4MA1B 2CIIA 4KTEH 2HJLB 1PQZB 2HFEB 2JLLA 2H26B 1JZ5A 4DKEH 3H9SE 1RMFL 4S1QL 3RFZC 3RL1B 1E4XL 5B8CA 4ZUWB 3GSWA 5HGHB 3BEVA 4L8DB 1CFQB 2V7HB 4R0LA 5IIEA 1UXSA 4ZQKB 5IM7A 4NZTL 4WTXA 3IDNB 5DWUL 5HHOD 3GJEB 1HYSD 2KBGA 1BFVH 3ELAT 2V5RA 4DZ8A 2R1XB 5F7HA 4PJEB 5JW4Q 3QQ4A 2BNRE 1QBLL 4L3EA 3AS3A 3ARXA 4PJCB 3QJHA 1JRHH 3BDBA 2Y7QB 4KPHH 5FYLD 3VGHA 4AEIL 4DGIH 1N4XL 3CD4A 5DVOA 1B4JL 4LQFH 3QCUL 1IRAY 4PJEE 3AMLA 2F74A 2UV3A 1TMCB 2MWCA 2B1HH 2XN9E 1T1XA 4R4FH 4KMLB 5F9WC 2OR9L 4NWTH 2PYED 5F1KC 5DT1L 4GQPH 1R3HB 5FDYA 3IAPA 2PW1A 5LGHL 1N2RB 2IQAB 4WI3A 5ID0A 3K3QA 2GY7B 1M7DB 5FGBA 1BM3H 1CGWA 2C1OB 1GZQB 3IGAB 2AABL 4MSWA 5IR1A 4WY7L 5JR1H 4OT1H 2CKBL 4LOUD 1MJJB 2BSRA 5I16A 1FGVL 2P5WD 1DUYA 4JE4B 1KEGL 4HWZA 3M8OH 4MAYC 1A2YA 3KXFD 3SE4C 2O5XH 1FNEA 4ODWA 1UM5H 2DQDH 3I50H 1ZHKB 3BPCB 1XCTB 2Z4QA 3MO1B 2DF3A 3QB7C 1NGYB 4OLXH 3WNMA 3QEQD 2LVCA 3Q48A 2VLKD 4UV4L 3KYMB 5IBTL 1V7NH 3BKMH 1T83A 2OZ4L 2LE9A 5GGSA 1I8MA 3EOBB 3LKRB 1F11B 2VXVL 3TT3L 2V2XB 1WFUA 1NDGA 1AFVL 5IF0A 1MRFL 3DYPA 1QYGL 1U8QA 1YUHB 5JDSB 3MRNB 4PRNA 3NZ8B 2H3NB 3MRIA 5F7YC 1I3GH 4JG1H 5L0QB 5D1ZA 3MREA 4PY7A 1QSEB 1YEEL 4XNZB 5FUZH 1G84A 4AQOA 4WHYH 3VXUE 4JVWA 3AXLB 3P4LA 4JJHA 1QLFB 5DHVH 3WS3A 2R2EA 4PRHA 5J6GA 3TH4T 1UACH 1UM4H 5F7UA 5C07E 2NZ9D 3DIFB 2PTVA 2CD0A 4POZD 3O11B 1UXSB 2BNUB 4ZQKA 1NGXA 3KNBB 3PGFL 1UC6A 5IB3A 4LVNB 2IFGA 1CE1H 1SBBA 1CI5A 3CSPA 4JAMB 1RJZA 5GISH 1PW3A 1JF6A 3TNNA 3KG5A 1QEWB 1U3YA 5FOBA 3VFVA 4ZTPL 1MLCB 2FJFB 4HV8B 4XGZA 3U30B 1NMAL 2MKLC 2VB5A 4JFHE 3MBXH 1L4IA 4N68A 5L2KE 4X6FA 4W70A 1X6NA 2EDEA 4K9EH 1U3ZA 2VZSA 3ETBF 5IVZA 1LO3L 2O5YH 2VZ3A 2WIIA 2BHZA 4P2RE 3E2HA 3N0PB 2LTQC 4CL7A 1IM9D 1NMCB 5SWZA 5TQ2L 1LEKB 2WP3O 1XGYL 4RNRA 4D9RE 4YBLB 1CL7H 2A0LD 5CS7A 3E6HB 3CSBA 4FZ8L 2PW2A 4KRNA 3GSUA 1MCWW 1CXIA 4BZ2L 5ISZD 5IMKA 4JANB 2BMKA 4YLQT 4S1QH 1MHCA 2OXHA 4GMTH 2XICA 3O3BA 3D3VE 3IDMB 5E24E 2OQJB 1MIEL 5DD3H 2CK2A 4I18A 1BJ1J 3FO2B 4PRPA 5AEAA 3B9DA 5CJXC 4M1DH 5FKAA 3HZMA 4Q6IA 5D1ZC 1AGFB 2DQJH 5F88B 4AEIH 4WU7B 2J3SA 1G7LA 2QBWA 5EC1A 2GSIB 3F7VA 3V5KA 3EHBC 1V8HA 3IFNL 4WUKL 5DJ8A 3KLHC 4G5ZL 3Q6GH 3TBYB 4YHYC 2QSQA 2VLKA 4YDVA 5DD5L 1FV1B 3HMWL 1IEBB 1MCDA 1IGIL 5IB4B 3UP1A 5D93B 2UZIH 1C16A 1NAKH 5HY9B 5IT2L 5AG9A 3FO0H 1I8KA 2X4RA 3MRLA 1AHWC 3E0GA 3JTTA 3MCG1 3H3BC 3KGRA 2ORBH 4XTRC 4KVCH 4JRXB 1AI1L 5TDNB 4PUBH 3BW9B 4P4KC 3W9DB 3GSNL 3QDJA 4Z76A 1J8HA 1K8IB 2X9WA 3QQNA 4DKFL 3SDDD 4MNQB 2R8SL 4R0LB 5IIEB 1BOYA 4HIJA 4XCNA 3AUVA 4M61B 2YPLD 1CDHA 2EKSA 5K33A 2APWA 3IETB 2DBLH 3SDXE 4D94A 3ZTJH 5EOTA 1NBZA 2X9YA 1L9MA 1KCVL 2X70B 1U8KB 4JHAH 4IRZH 4HH9B 3HE7A 2H26A 3KPSA 1MF2L 4P46B 1S7TB 2C4FU 2YPKA 4ZPTB 4ZDHB 5GS1A 2H8PA 1FLRH 4OCWL 4GRMA 2I9TB 2C3WA 4KMTH 1J8HB 3W0WA 5SWQA 2X7LA 4HV8A 1WCBA 1A14L 5EBMB 5FOBB 5I1DA 2Q76A 4Y0GA 2RAMA 3GZKA 5D2NE 4P2CG 1BQUA 2Y36H 3VFWA 1NUNB 4CVXB 5AZEL 3RWHA 4PGCB 3KLAB 3FFCE 4TRPL 2MNUA 5BMFL 5JA8B 4X4MA 4Z0BH 1RUAH 3OKLA 4UI2A 2WIMA 1A6ZB 3C09C 3MV9D 4TSCH 5EN2A 4PJFE 5T1MB 2R4RH 1CU4H 2A74A 3P0YL 1XF2A 2BOCB 1JV5A 1UXWB 3QPQD 1E4WH 3OR7B 5F9DC 1I4FB 3ZKXC 4AK1A 3OZ9L 3QQ9D 4H8WH 2DJSA 4CRPA 4O9HL 3FO1A 3WS6C 4XNYH 2FJGB 4LMQE 5DGRA 4FQXC 5LAXA 2XOTA 4FQHB 3S34L 4JZOB 1ZS8A 1CFTA 2PNDA 2OQJA 2WK2A 3Q6FA 4Q58C 3H0TA 3RAJH 1YJDC 3PGFH 1UZ6E 4WVRA 2IG2L 5J3HD 1RULL 1U93A 4HMEA 4U2YA 3MLZH 4J6RL 1S7QA 1UWGL 1KOAA 4U7SA 1ZSDA 4O4YL 4V2BA 5GGSB 3BRGC 1I8MB 3B8SA 2IADA 3ZHDA 5DQJB 3L3GB 3FRUB 1UA6L 4U6TA 5AWNL 4OGYH 5DSCA 5K59F 3QHTC 2VXUH 3KHOA 1IAII 1HH9B 5HI4D 2XA8H 4F37F 4X6BA 4ZOEA 2WIIB 5EOCJ 1XGPB 2RQ8A 3V0VB 5I73C 3D25B 4XBPB 5E5RB 1XIWB 2D7QA 4YUEH 5IMOB 1U8HB 2NY1C 3LV3A 4G6AC 2W60B 5I16B 1BF8A 4P46A 3LEXA 4ZPTA 4ZDHA 5C2BL 1S8DA 3HNVH 5C92A 3C08H 3GMRB 1LVEA 3KPPB 1XIWD 3BD4A 4TSAH 4H1LA 3ILPA 1ZLVH 1KEMH 2R9HC 1B2WH 2H45A 2YZ1A 3MUGB 5DK0A 3L9RA 5E1AA 3TZVD 4X80L 3TCLB 3KXFA 4XC3H 1HQ4A 1UKSA 3WUWA 4DEPB 2K7PA 1R3HA 5BS0A 1E4KC 1FZMB 3ZKMC 1EAPA 1EJOL 5JZ7C 4LLUB 3JWOL 4NQUA 4P23D 1J9CT 1BF2A 4DWHA 3AREB 5FA4B 3TGXA 4APQD 3IU4L 4Z95H 3RVVD 4XHJC 3ARBD 5HYEA 4P48A 4Z7UB 1JUFB 4PJXA 1DQLH 1I75A 2CLVB 4GBXC 4WI5A 2WBKA 1A3LH 4HH8A 2YXMA 3JUZA 2V17L 4CKVX 1DVFC 3RL2B 5CZVL 4ESKA 4XNXL 4ZTOH 1HKFA 5HI3C 2Q6WB 4GBXD 3IT8D 2R1XA 1A6PA 2C7UA 3EHBD 3O8XB 5D8JL 3TFKC