5SWZA

Crystal structure of np1-b17 tcr-h2db-np complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
277
structure length
277
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversed T Cell Receptor Docking on a Major Histocompatibility Class I Complex Limits Involvement in the Immune Response.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 63
structure length 277
sequence length 277
chains with identical sequence F, K, P
ec nomenclature
pdb deposition date 2016-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5swzA01
3ABZA 4OUOA 1MCEA 2D3VA 3JTSB 5I76B 4UDTA 4ZPVB 3RTQA 4KTEH 3FB6A 3WXVH 3MACH 1NCDL 4R7NB 1JGEB 2XKSA 4ZXBD 4YXHL 4HX1B 3SKUD 3F12B 3NAAL 3QUMA 4L4TB 4R26H 4XNUH 2W60B 4U1MA 1YNLL 3U0TB 4U1SA 3VW3H 3KS0H 1YZZA 2HFGL 5E2UL 5F9JA 2AJYL 2A74B 3C08H 4WDIB 1W0VB 5C6WH 3MXWL 2ARJA 2G9HB 3TBTA 2CH8A 3L5HA 2CDFA 1NDGA 2VUOA 1T0MA 1GRWA 4DGVH 4XXDA 1F4AA 4MVBD 1WFOA 4S1DC 2V5YA 3BE1H 1LILA 5FYKH 4R4FH 5FFLA 2FHCA 3WIFA 3P77B 4XP4H 2EH8H 1J1PH 1L4IA 2H26A 1PKQE 4KK5C 3QDJB 2W60A 3MLRL 4M4PA 5HI3C 1D3CA 3GMMB 3H7BB 2NY7H 2J88L 2VNCA 4DQOH 2E7LC 1MCRA 4HKXA 1F3DJ 5I76A 2DYPD 3SO3C 3ZTNL 1BOGA 4XH2B 1G7LB 1U8IA 3N85L 3EO9H 4XZUA 1KCLA 4I0KA 3V7AE 1IKNA 4LSTL 4PJFF 1LQSR 1Z9SA 2Y9RT 2R4SL 3GSWB 4QCIB 5GGTA 1KJVB 5IR1B 3BMWA 1JUFB 4ZS7H 1OD9A 5E94A 3TVMD 4JFXB 3W0WA 5I6XB 3VGFA 3PG2A 1PQZB 3CH8A 2NTFA 1N64H 3WNKA 3AROA 4NUJB 4JHAH 3DROB 2YC1B 1QLEH 5A1AA 2AJSH 5AAMA 4QHKJ 1CGTA 3FQTB 3SDDD 4GKSA 5D1ZD 5E03A 1KJ2B 4I13B 1RZKL 3EOTH 4HKBA 4X6BB 5GSVA 4KDWA 3FO9A 1U93B 1SBBA 3CFIC 4FQQB 3QISA 4NM4L 3ZTJG 3FRPA 4LLMA 5DGQA 3OXRB 5GHWL 4J12A 1I9EA 4NQED 4GG6F 1Q94B 2HLAB 4PGBB 5I17B 1IFHL 1QVOA 2PYFB 1NH6A 1UH2A 4JREC 1B6DA 4PY7A 4ZFZA 3SQOL 3ALXA 1RIVL 3GKZA 2JELL 2JB5H 4OIAA 1NCNA 4JHAL 4RNRB 4J4PD 2HT2D 1FLRH 2X6MA 4ZFGH 4U0RC 4CVZA 5DEFA 2P48B 3MRRA 3TO4D 5ADOL 3AFLA 4HHAB 5T3ZH 3IDIB 4QXGL 4YHMH 3LPFA 1WWBX 1GOHA 1BREA 4OGYH 4QNPE 3FB8B 4XPAH 2G5RA 4HZLA 5BV7L 1I3VA 3TCXA 2PTVA 2FEDD 3VJ6A 2V2XA 4GQ9H 2IANA 3E8UH 2K7QA 1B0WA 1B4JL 1N0LA 1RUKL 2EKJA 2X1WL 3SE8H 4ZQKB 3UX9B 4ODHL 5EZIL 5HY9A 5DWUL 4YPGB 2HKHH 2EE6A 3QNYB 1BM3H 5KZCB 4HG4J 5DD0L 5F7EH 1XF3A 4PY7B 5J06A 2AEQH 1Z9OA 3T3MF 3UEZA 1M7DB 3FFCD 4K8RH 4YDLC 2V17H 5MEQA 3LAFA 3STZB 3RL2A 3VRIA 3EJYC 2IH1A 1JI1A 4JRWA 3QUYD 3FO9B 4LLUA 5DUML 3BEVA 2C4FU 4PY8J 4LLWB 1MJ7L 3GIVA 1BZ9B 2E3VA 2X42A 3KPPB 1MNUH 1T20B 1IT9H 3MFGB 1FFQA 3T1WA 3C8HA 4E41A 1FJ1A 2NY2D 4H0HB 2PW1A 3V9FA 4CMMB 3B43A 4M62H 4P23B 5J11B 1P4LB 1EXUB 4M03A 5D72H 1J0IA 3WSQL 4CVUA 5D6CB 3DHJA 3KPRA 5ISZE 4G6AC 5TDPA 1R0AH 1OF2A 1QFWL 4NQCE 3CDYA 1TCRB 3R0NA 4X5XA 1HHIA 4MJ2A 2C3VA 5DJXB 3CX5J 4JRYD 1QSFB 4ZUUB 2DLTA 3FTGB 5JMOC 4PJEE 5I1DA 3ARZA 1HHGB 4X6BA 5GSVB 4Z7QE 3RI5F 1KB5A 3EDKA 2BVOA 2CDEB 3IDYB 4RGMB 3RGVA 3VD5A 1ACYL 1RZGA 4J4PA 1V3KA 2DLHA 1UACH 3TCLA 1E4JA 1S7TB 1F3DH 1TJGH 2UUDH 3EIFA 1OT1A 1FYTB 3CCHA 3P77A 1CD1B 3BP5A 2HT4C 4FQLH 5DVNA 2GEEA 3PF2A 3U48A 3MUGB 3X17A 5C3LD 5E94B 3VI4E 3GI9L 3IRZA 1NBYA 5DD5L 4WU5B 3PL6B 4HDIA 4WW2F 3KPLB 5B8CB 3CFEB 3TBYB 1ULVA 3G6DL 3QUZB 4PJ8A 1I9JH 1S7UB 3C87A 1F4WL 4PRIE 2BZDA 2WIMA 3VRLF 4MNGE 4JZJA 3FCTB 3UTTD 2AJVL 4OF3A 5F6IC 1SBSL 2GJZB 5B4MD 5EA0L 1IEAA 3IJYB 5D93B 3VXPA 1JZ4A 1A6AA 4LRIA 5E00A 2J8UB 1IL1B 3KLDA 1NFIA 3WFEH 1MJUH 2DIJA 4OLXL 4X7TA 1PZUB 1CFSA 3QUYA 4NHCL 2ICWA 3T77A 1M4KA 4HIXH 4PS4L 4KKAC 1ZGLP 3NH7H 4JM4L 2BCKB 3DHMA 5F88A 3QJHB 5IJKC 4YR6A 2G5BB 2G5BA 4UIMB 1U3HD 1I1FA 3G6JA 3MLSL 3WFCL 3G6DH 4J7RA 3UTZB 3LQZB 4FQJH 3X11B 2ESVA 4XAWL 3HHRB 3BXNB 3UTSB 2OX5A 4JFYB 3ZT6A 2Q3AA 4XP6L 3LRSA 1MHCA 4F7TB 5IK3B 5HI5C 4BH8B 3QUMB 4PJ5B 3CFDB 1FVEB 1OPGH 2LU3A 1WV7T 1M6OA 3T1FA 4KPHL 2XKNA 4RBPH 4H1LG 1RUPL 4JG0H 3MRIB 4IBLT 3KPLA 5E08H 2DQUL 1AGCB 4FQCH 2HP4A 4WTXA 1WFTA 1TXKA 1VFUA 4N1EA 1S9XB 3BKYH 3B2VL 3JVGC 3U2SB 4PJCE 3AY4A 2RB8A 4GRLB 4J6RH 1JNNH 2F54A 3VGHA 4MAUH 1TQCB 3ALWA 3IRPX 5FCSH 2IFFH 3HC3L 2C7UA 4GG6B 2FJFB 4OKVB 1VEPA 4MCYB 5EU6D 4LPXA 2QADD 2CRMA 1RZGB 4Z7OF 3STLB 3BIAX 3UTQA 5E99H 2YEZB 1FC1A 4YAQA 3RZCA 5JXEA 1XH3B 4PJXA 5I8CA 1CVSC 3PWUB 1QOKA 4HW6A 2OR9H 2YKLL 4OF0A 5F6HI 3RWEB 3HZMB 2AI0H 4N0FA 4LU5H 4KTDL 5JW5A 5KTEH 5DD3L 1RIHH 3OG6B 4NN6B 5GGTH 4M1DL 3ARBB 3EYOB 4Y5VC 1W8OA 5DD6B 3MRPA 4K7PH 1S9WA 4U1NA 5EBMA 3IDXL 4O2CB 1AFVH 2MWCA 4HXBH 4YC2B 3KPQA 3BFOA 1E27B 4FZEL 5HGBB 2FX9L 4MD0A 1JHTB 5KZCD 1MI5B 1DVFA 4XNXH 5BO1H 3I02A 2BJML 5BMFL 2BNQD 5TDNA 2PO6D 3GB7A 3O4LE 4WI3A 3N50A 1DBJH 1F11B 1RUMH 1UM5H 4LFHG 1HYSD 4NIKB 5GS1B 1BZ9A 1K3ZA 3LKPA 3RL1B 3QWQB 3O6KL 1PG7X 3OKMB 4LFHD 5FUCC 1HH9A 4UQ3A 1TNNA 2FH8A 1J8KA 1TTFA 1FGVH 1I8LC 1JV5B 1MCKA 1TJHH 2ZJSL 3G6JE 1BGXL 2YRLA 4DCQA 1E4XL 2VDPL 3W39A 1W72H 5D7IB 4B7IA 1P7KB 4HMCA 1V8HA 5C8JA 3TF7C 2XY2A 4C56B 3G5YA 4J3UA 1MIMH 4JGMA 5BVJA 1FVCB 5ETUA 1TLKA 2Y06H 5MP6L 4UT9L 1YDPA 5D7IE 4LQFL 4LSQL 2SEBA 1SBSH 1R3JA 4HUXA 1YMHB 4H88L 2E27L 4U2ZA 3PWLA 4WWKC 1T7ZA 3B9DA 4EOWH 2HRLA 3KPOB 4YIQB 2XQBH 3JBG7 3MJ7B 4G6MH 5C0AD 3V6OC 1AHWB 2AJYH 3MZGB 1P4BH 2ICEA 2C4XA 3TFKC 3TBWB 3TVMC 3D1MC 3QNXA 1XGUB 3EJJX 4BQ8A 1NGWB 4RX4A 5ESAA 4NQDE 1KFAL 1U92B 4JM2B 2NQCA 2BVPA 1FCGA 1N7MH 1MEXL 1XR9A 1RJYA 2Q86A 2QQQA 2HWZL 2G75A 1I7RA 2GK2A 2QKIA 4LSRH 2BSSB 3KJ4B 3WUWA 3MPCA 4JDVB 1B9ZA 5HYFA 3L5XH 3OQ3B 1AQKL 4LHJB 3RZCC 3HRZB 2R15A 4P2QA 3UZVB 1N6VA 2X40A 2XPGA 1I4FA 9CGTA 1JPGA 3TPKA 5MERA 2V6HA 4WU7A 1EK3A 1H3VA 1NLBL 1JZ8A 4BZ1L 3SOBL 1F6LL 4M7JH 1JPFA 3N85H 3UTTB 4KH2A 1T0PB 4NPYA 5FYJE 1YY8B 3H9SA 4HUVB 3CH1B 2QQLH 5FOBB 3UTSA 3VXMA 2NXZC 4M1GH 3V6OE 4HPOH 4KROC 4KV5F 2H2PD 3RNKA 5LAXA 3U83A 4WFHE 2DJSA 4DN3H 3DO7A 1NBZB 5HGHA 1IC7L 1CTNA 3SHSA 3UO1H 1JFMA 3FT2B 3L5XL 3FB7B 5L88L 6FABH 5TQ2L 5H35A 3OR6A 1BIHA 4M7ZB 4JEGB 5CGYD 5HHMA 4O02L 3LEVH 2LVEA 3QQ9C 4D9RD 4G43B 4U49A 4G43A 4X7TB 1FNHA 5CIPA 2DBLH 1DUYA 3DRTB 5KVFH 4TN9A 2BMKA 2NXYD 5IMOB 5E8EA 2I9TB 3DBXA 3MRGA 4FQXB 1OAXH 3G5VA 3UPCA 3LS5L 4L3EB 3SJVE 4OM0H 4F15C 4JZJB 1DUZA 3RY4A 1CL7H 4FXLA 1S7UA 1IBGL 2NXZD 3VMPA 2VR4A 1WZMA 1WAAE 5E1AA 4Y1AB 2YUWA 5DK3A 4G7VH 4AH2A 3PV7A 2GAZB 3PWJB 1QFPA 3NABL 3MA9H 3BKMH 1KXTB 2OZ4A 2HJKB 2H3NA 2P24A 1A02N 4M7LL 5ACMA 5A2FA 3NTCH 2EDNA 5FM8A 2APVA 3O2VL 3WJJA 4D9LH 2WINA 4HUUA 3BHBA 2VITB 1GZQA 3TZVA 2VL5B 3D69B 4XPAL 3WO4B 1UM6H 3WLBA 1WFUA 1RUQH 1AO7B 4PR5B 4X99A 4X5LA 4YDIL 5D7KE 3FTGA 5BJTA 3M1BB 2A1WH 3VH8B 1U92A 4JM2A 2OJEB 2ZCHH 1WITA 3OPZL 4IRJC 2AVGA 4UU9A 2RFXA 4Y0GA 4JG1L 4WUUA 5HHOA 2Y7QA 5F1KC 4Y19A 1R5IB 3GKWL 4NQSA 1KELL 5T33H 5L8KB 4HCRA 2R69L 1V3MA 5AD0B 4NWUL 5LGKA 1LEKB 2R29L 1NCAL 4QRPE 4PUBL 3BW9A 4V1DA 2LU7A 5DJAB 3D3VE 3UMTA 5IEKA 1JRHH 4ZO8A 2ICWI 4BQCA 3VG0L 5GRXG 1OTTD 5EOQH 3TN0C 1DQDL 4WO4B 1D9KB 1FSKC 5DC4B 3N1GC 2EDDA 1U8LA 4XB7A 4J3VA 2ZG1A 4L3AA 4OCRL 1VERA 4RFOH 4L1HA 1RY7B 1FRGL 8FABB 2Z0BA 4LVHC 4NWUH 3SBWA 4GRMA 3KLAB 1OP9A 3DI2B 4Z6AT 4IOFC 2PN5A 1U8OB 4W68A 5D5MB 3IDNA 3VGBA 4YEFA 3L6FB 4L5FL 3DURA 4UT7L 3BH9A 2DQHL 3RVTD 3OTTA 2VN7A 1LO2H 4I0PC 2X70B 1DVFB 1Q0XH 2EDQA 3C8KA 5DVOA 4R90H 4KZEH 1J0KA 3GBMH 3MRCA 5EU4A 3MUHL 5J6HB 4FQ1L 5T1LB 3P11H 4OFDA 4ZFFB 3LH2L 5F7UA 1K4DB 4X9BA 5JOFA 3QUXA 1SJXA 4LCCA 4RMUA 4R4FL 4R8WL 4NQEA 4YGVA 4PTUB 1M71A 4CU8A 4GBXC 4JN2B 3QIBC 2PYFA 5EU7C 5HDLA 4CN1A 4EUPG 2NPLX 2QTEA 1UWGH 4DN4L 5B3JE 2NW3B 3UJIH 4Y5YC 2L4OA 3IFOB 1UZ8B 4HIJB 5CBEA 4QXUH 4X6CF 1JIBA 5DLMH 5A16B 2VJXA 3EOYG 1EJOL 5BXFB 3HE6B 1MHPH 3IU3A 4AH2B 3HI1A 3QWOA 5LXGL 1T7XA 1W0WB 4HBCL 1KCRH 1G6RH 1TZHB 4S1RH 3RWHA 2DB8A 4ALAL 4Y8AA 3F8UB 4YK4C 2GK0A 5FYLH 1JGLL 1UCBL 5F7DA 1W72A 4KI5E 2FJGB 4QF1B 1FL6B 1BOYA 2FO4B 3ZE2F 1MFAL 2XXMB 3O3BA 1AGEB 1NC2D 1CDUA 1CDHA 3CU7A 5JIHA 5D7LD 4W6WB 1T7VA 2Z93B 4K55A 1XGQA 1V7NH 3LRSB 4HFWB 1S7RA 3Q2CA 2VMFA 2XOTA 1FZMA 3BZFA 2A73B 1D5XB 1SYVB 1TETH 2V7NA 3GMRA 3ARTA 1QKZH 4K94H 3VXSD 5FHAH 2OMBA 4M6NL 4TULL 3RDTC 2ILLA 5I1JH 2BNQA 1VFBA 1SJEA 1S7WB 3K4AA 1G7HB 1LMKA 3G5ZA 5HXMA 3NCCB 1LGVA 4G9DB 4NFCA 5FDWA 1AE6H 1AH1A 1AGDA 5J7CC 4KUZH 3WNNA 4YHML 4XCEB 2VLRA 4FG6D 5I66B 2AK4A 5CMAB 1ZMYA 2J6EA 5IQ9A 4LHUD 2LAGB 4PP8C 3HS0A 3JTTB 3IAQA 1UB6B 1FVDA 4HBQA 4LEOA 1AD0A 5B21A 5HPMB 5JZ7C 1J5OL 3OJMB 1B4JH 5CEXA 1J9CT 5I75C 3KG5A 3MRQA 1XCQA 4WCYH 3L3JB 4X5WA 4ZS6C 5HJ3A 5KS9B 1KCSH 4NNPH 5ALBL 4IRSB 5ERWB 5IW1A 3H6JA 1FL5B 3GSXB 5MEOB 4NNXB 1FBIH 3HNSH 4KMQA 3AS1A 2P5WB 3RBSA 1AKJA 1ZVYA 1G9NC 2R1YB 4ZSOE 4HAGA 3B9VA 1P6FA 2NX5D 2ICEB 4GMSH 2GIYA 3HMXL 3RWDB 3SCMC 3VA6A 5BQ7B 1DQML 4KXZH 1JF6A 3LKRB 1FG2A 4GXUN 3H3PH 1WBYB 3EDDA 4AG4H 2A73A 2V2TA 4OD3L 4JO1L 2FEEL 2HKFH 2AXJA 3T0AA 4OKDA 2UZYB 3CSYB 1OL0A 2Z8VC 4S10A 3SDDC 3UPRA 1IC1A 2F8XC 3EYSL 3QQ4B 2FCBA 5EO9A 4CVXA 3FO2A 3MLZH 4ELMB 3PDGA 3TIDB 5FEBA 1ADQA 3TFKA 1SJHA 2GUOA 2J7LA 1CXFA 4U6VH 25C8L 4NZUL 3WL9A 3MROA 2WWKO 1PDKA 3HMXH 4YBLC 3DV6A 2Q20A 4LK4A 4N0UB 2VZVA 4L8BA 3BP4A 4PJ9A 1VHPA 3WN5C 2GKIA 4TTDD 3X14A 4JFFA 5ICXA 4F37K 1T20A 2ZUWA 3HR6A 5J3HC 3GIVB 4G3YL 1F4XL 4M6OH 4ODXB 2NTSP 3SE3C 3OKEB 1S9VA 4EN3D 2B1AL 4MA1B 2CUMA 5C08A 3KS0J 3PIQA 3IU4H 4NKMA 4XNMA 2PNDA 3VD4A 3RVUC 4RFNB 1P1ZA 1Y6MR 1IGJA 2R23A 4MQTB 2ATKB 1RZ7H 1CXIA 1Q0YH 4GW1B 3MODH 1OAKL 4Y4HC 5KVEL 4LAJH 3L7FB 4KHTL 2CDGB 4DJMA 4L4VB 3TBVB 3RIFF 4ENED 2XYCA 3F7YB 2VC2L 4PTTB 2NX5B 5FYKE 5C9JA 1KIRB 3QUKA 4QHLB 4R6UA 1GCFA 2JJSC 3D0LB 3QO1A 4ORGB 5FO8A 1NUGA 2E7LE 5JORB 4TUKL 4X7CC 5DSCA 2YEZA 1AJ7H 1RJCA 4JO2H 3UTQB 1S7XB 4GG8B 3LCYA 4YZFF 5TE4H 1YECL 4U05A 1DBAL 4POZD 4J8RB 1QO3B 2DN7A 3E2HC 2PETA 5KS9E 1U6AL 3WS6A 3QFJB 1IAII 2VQTA 1KC5H 4PRHB 3RUGA 4BA8A 2Q3ZA 4OTXL 3CVHB 5IJVB 1ZHBB 3BP4B 2G2RB 4PJDB 4PJ9B 5F1SA 3AMKA 4LCIL 35C8H 1UEMA 2YBRB 4LARH 4D8PB 2IC2A 4QWWD 5D2NC 4U6TA 3LZFL 1MRCL 3ARYA 4I5BA 3VXSE 1YYMH 4YFDB 1FFOB 2VQUA 2CGRH 2H9GA 2CMRH 2IQAB 5HHMD 4QGTA 2VYRE 3RNQB 4NZTL 5T5FL 5J13B 5C09A 4G9FD 1A1OB 4C57C 2GQHA 4Z77B 5A40E 1I7TA 4U1IB 2DBLL 3D3VA 3PHSA 4XPTL 4EN3B 3HAEG 5CHNA 5SV4A 5F3BA 1T04A 5ITBL 5AEAA 1YMME 1CICC 1OM3H 5AD0A 2A6JB 1XGPA 3HZKA 4RIRB 5L9DL 4MAYA 4HIIB 4Y19B 4CU6A 4F33A 5IR1A 3ULUE 1I1FB 4UIMA 2RJMA 2IAMC 5BZWA 1KIQA 4JGUA 4AT6A 1J87A 3GUTB 4JFFE 4QRSB 1T80A 3QHFL 4U33A 2HTLC 3IXTB 5DDHB 4PRHE 4OM1L 1FNFA 2X05A 3L3JA 1XCQB 3ARDA 4QGYA 5CEZL 2BRQA 1KPRB 1MLCB 3PGDA 2LTQB 5DHVB 3TZVB 4LEOB 2DLGA 3EOAB 3HFMH 4QRRD 4LRNL 5E8PB 5CZXD 5C0RL 3BVNA 5CMAA 2GTWA 3TEUA 1WBZB 4WIQA 1H0DB 2X9WA 3C2AH 4XNQA 1CU4L 4FHBD 5DUBA 3OXSA 1QUNA 1L0YA 4X8JB 3ELAT 5E6YA 4XPFL 5DQ9A 2IQ9L 2V7HA 4G8GB 1H5BC 1ZAGA 5CGMA 4NO2B 4MDIA 3C6LC 5GGUB 3V2AR 4AY0A 1OTTC 3CFCH 1WEJL 3CDCA 5B3NA 5D2LF 5E5MA 1XT5A 2XTJC 4XXCA 4Y2DD 4HCRL 2Z35B 3C9NB 3WJLA 5F44A 4PJGE 1FZJB 1OSPH 5LCVH 1N6QH 5CCKL 1X7QB 4OCLC 5JHDD 1MH5B 2GFBB 4G9FA 5AWNL 4AT6B 1P6AB 3TNNB 3FL7A 2PYED 3CC5B 1IAKB 3T4YA 4MAYB 2E8ZA 4NBYB 4WFFE 4LLYA 4KDVA 1A21A 1X4XA 5D5ME 4P46C 5C0ND 1T2QL 2I5YL 3ES6B 3OKDB 3QO0A 1N8ZB 4GKNB 2W9LA 4UT9H 4U1IA 3HE6A 2I26N 1F4HA 3DXAE 1T4KA 1EHLH 1YMMA 3IS1X 4ZUTA 2GCYA 5IT2H 3CX2A 2L0DA 5A16A 5HVGB 5I74C 4FXGB 4GSDL 4QY8A 1IC5L 4O9HH 4YWGL 3BI9X 3GMOB 3I6KA 2JB5L 2OI9C 3WHXB 2Y5TB 4KJWD 4ONHB 1ZK9A 4NKQB 3VH8G 2ZUVA 1F45A 2C3HA 1ZHBA 4XPBL 2VKXA 3K8MA 4EBQH 1A3QA 4A2LA 3LS5H 1T21B 3UDWC 2QHRH 1P84J 4JKWA 4PG9A 5DJ0B 5C0EA 1YNTB 4YXKL 4NHUA 3TPUE 3BGFB 3DTXB 4Q2ZB 2IANB 1KF9B 1BZ7B 3MJ9L 2DLEA 4ISVB 4PBVC 4FMFA 1KEGH 3MMEB 2MCPH 1QLEL 1FNSL 3B2UC 3SDXA 2BNRA 2IBBA 5D1ZC 3SDXB 5IB4B 2CRYA 3LV3A 3QPQD 4NQUA 1H3WM 1KIRA 4Z7WA 4Z7WF 1HIML 1I1AC 3DURB 3MRRB 3GJFA 5DC0A 4RRPA 3DLQR 5D70L 5JLZA 4RQQB 5E8NA 1U58A 1KG0B 1CFVH 3LDBC 5L8JB 4P5KB 5BV7B 2PYEB 2DYPA 3FQWA 3RU8H 1JBJA 4AEFA 4LGSB 2FATL 5ICZB 3KPMB 3BO8A 4R2GC 4MMXC 1J11A 3BUYA 2Z4QB 1A7RH 1DN0A 1KGCD 4JY6B 5HHOD 3QIWC 5CJXA 3QHFH 1A8JH 4ZODA 4JQVC 1YC8A 5E6IB 3FONA 5IHLB 3ZKXB 4DKAA 1RZIA 1ZHLB 3WHE0 1T1XA 2YPKB 2IGFL 1PSKL 1DE4B 4YEEA 3RY6C 3SBWC 3H3BC 3QDAA 1C5BH 4DZBB 2P5WD 2J8UF 5C07B 3MBEC 5IMKB 1E27A 3PABB 4L29B 4JFXA 1K5NA 4P2RB 1UEYA 2KZ1B 1INEH 3NIGE 4QCIA 2W0LA 3REVA 4HUNB 4PRID 3WDIA 3MLXL 2LV4A 3CAFA 3MREB 1T22A 3V6ZA 3OMZA 1IEBA 3U4EB 4LBEA 4OLZL 3QI9A 3CXDL 4YNYB 1PYWA 5IM7A 2XWTB 4PJXB 2FRGP 4X99B 4LVNC 4X6EB 3AAZB 3U4BL 5BS0E 7FABH 3ZYIA 4CW1B 4HKXB 2DQTH 5CJOH 4F7MB 5GXBB 3U9UA 5DJYA 5ENWB 2AJXL 5JO5B 4I0PA 2DD8H 5HSFA 3FRUA 1N6QL 3C09C 1CD9B 2X9XA 5FM5O 2GTZA 2R1XB 4J23A 4Z7VF 1BEYL 3HC4L 3RVWC 1RZJH 1GGBL 5HI4C 2Z31D 4PJXE 1GL4B 1RVFH 2ADIA 5L2JB 1EH9A 3IDJA 1U36A 1UADC 1FNGB 4J1UB 3WSQH 5C2UB 2DM4A 5E7FA 1KTDB 1EERB 5T1MB 5I8EA 1I85C 3NPSB 4PV9B 4GW1A 5D71L 3ETBF 5CZXC 3D25B 5EORL 3T2OA 4MQXD 5CEYB 3QHTC 4PGDB 1TVHB 1VFAB 3QZWG 4LGRB 2DD8L 2V2WB 3MGAA 1HSBB 3AVEA 3MRBB 5F3HB 1X3DA 4IIQC 5AYUL 2A9ML 3KPRE 4OZIE 2IMNA 1YEFL 2BMKB 1HK6A 3D9AH 1HINH 1LO3L 5MI0B 3VXTA 4ETQB 4JFFB 2FGWH 2DDQH 3IXTA 4QXUL 1ZT4B 1ZT7A 2QADC 2YD3A 4GQPH 5FB8A 3NN8B 3QA3A 2EC9U 1HOCB 5HI4D 5IB2B 2AP2A 3W2DH 3MBED 1CFBA 5C0CA 5HGDB 3MNWB 3DMMD 2W1NA 2A6JA 3S5LA 2C1PA 4P59L 1C5DA 1JWMA 2EE3A 2Z93A 4OD2B 1D6VL 5E00B 1YJDC 4OD2A 3UTTA 1ORSA 2VQ1A 3MV8A 4M7LT 3U7YL 5IFHH 3MLPA 1NCCH 2F58H 2BK8A 5D7SH 5FKPA 5DMYA 3S35L 2CLRA 3BT2H 3T65B 3M17B 1ES0A 2P4AB 1NMBH 2X9YA 2CKBH 4PJ7F 2E6PA 4WW1A 3W81A 3CMGA 3PWVA 4PS4H 4X6CE 3U0PA 3EOTL 4M9PA 3MBEA 5C0JB 1S5HB 2VDQH 3VDAA 4GQ9L 2Y6SC 3V4PL 2IG2L 3PL6D 1IARB 4FFZL 3QZWB 1A7OH 3BWAA 2R2CA 5I1LA 1A14L 5IW1B 4WWKD 3AREB 4RA3A 3PP3K 3IJHB 1C5CH 2I60H 5CFHA 4DVRL 5BRZD 3P40A 2NW2A 5IMLA 5C0BB 1OY3B 4H5SB 1CTOA 4O4YH 1QBMH 1QSEE 4JQVA 3S88L 4ZFGL 5FO8B 2JB6B 1XGYH 3G6AB 1F3JA 1CE6A 3L3OB 3F7VB 4JZNA 2P49B 5DRWB 5F97E 1YNKH 4NM8L 4P4KD 3RPIB 3ARDD 3TNMA 2DBJA 1OTUC 2UVEA 3PQYE 2I60L 3LN5A 4RZCA 1JVKA 4MNHA 4OZIF 2R8SH 4JM2F 5I6XC 3WKNA 1JCKA 3HI6L 4IDJL 4PB9L 1IGFL 3LMJL 1EBAA 4X6DB 2XWTA 3U36A 1E4KC 4J3XA 3TGXA 4NDMA 1QFWH 3KPPA 3IDGB 2WLYA 4OUUA 1DSFH 3BEVB 5B22A 4PJAE 1G7PA 4OGXL 4NN5B 3O9WD 4GMTL 4NO0D 3SDYL 3UDWA 4P4KA 3M07A 3FO1B 5DJCA 1L6XA 3HG1B 3QIWA 2D7MA 4LDLB 2LU4A 5CUSL 4RGNC 4O5LH 3REWB 1U8NB 4GKZB 2OBGA 1FPTL 1T83A 5FYJD 3HUJF 1XF5B 5DZLA 3ROOA 4U1NB 4WV1B 4CKVX 4RAUB 5L0QC 1AY1L 4TSBH 3BEWA 3Q1SH 4F9PA 3WFBL 2AEPH 1RU9L 4N8PA 4OJFL 1L9MA 1C7SA 2Z91B 3JV4A 4MVBA 1A2YB 4WWKA 4P46A 3OHXB 1SHMA 4NQSB 4Z7VA 1BQSA 2Q8BL 3AM8C 4YAQB 5DJ2B 3D9AL 4EDXB 1DN0B 4IDLA 1TVDA 3TA3A 1GHFH 3LQMA 5IGXH 2HWZH 3ZE1F 1Q38A 4WEBH 1PX3A 5C71A 3D87B 3MLYL 3S5LG 4GG6A 4JPVH 3BO8B 4ONGL 3PGCB 5JXED 2RCSL 2Y25A 3BWAB 1X6LA 2YUZA 4JPKL 4KKNA 2W0FB 4M5ZL 3TM6A 1VKXA 4GUPB 3ZSTA 1AO7A 4PR5A 2ENYA 3GJFB 3HLAB 1EUUA 3QP3A 4XCYA 2OP4H 2A0LC 1KT2B 3DGGA 2JJTC 1HHHA 2V9RA 4FQQA 2ZUSA 3S7GA 3GRWL 3GI9H 2ZNXA 15C8H 3EYFA 4Y19E 1KJ2A 3MSPA 4XP1L 3SO5A 2X4QB 5EU3B 2FYYA 4ZDHB 1J1PL 2W91A 1A6VH 3EDJA 4JPVL 3JXAA 4ONGH 4XCCL 4UOJA 5I1KH 1CGSH 4Y5XA 2EIBA 3HUJB 3VI4F 2X2YA 4TOYL 3R1GL 1S7WA 3NIFF 6CGTA 3LEVL 1VFBB 5CD3B 3IXAB 1J0JA 4JHWL 3VXMD 1X5ZA 4LASH 3A0OA 3DNKA 4XBEL 2QHLA 3GBLA 3VFMA 5KSUB 3VWJD 2F8VA 4NO5A 1NDMA 2VXVL 2V7NB 3PE9A 3QA3B 1D5XA 2X89D 3GSVB 5DHXB 5GGSB 3TC9A 5EU5A 4Y4FD 2ITDB 1TJIL 4KJPC 3GSRA 1NFIB 2NY4D 5C3TA 1VESA 3CUPB 1FGNH 4LHUB 2IPUK 3QDHA 3SOBH 3ZHKA 1KCUH 4ODVH 3LB6D 2HVJB 1G1CA 4RAHA 2GK0B 3ARXA 3MRNB 4XVUC 3QDGE 3I84A 2M2DA 5BVPL 1IGYB 5T5NF 4EBQL 1RHFA 2IEPA 3H9SB 1NBYB 4G6JL 4NCDA 5LQBH 2WBWB 2I24N 4QKXB 5L2JA 2DMCA 2B4CL 3KDMB 1VFMA 4JO3H 1U3JA 2OL3L 3T3PE 4BM7A 1YEGH 4IIQA 3LKQA 5ADPL 2E5EA 3LD8C 4L4VE 5E5MB 1NGPL 4APQC 4D3CL 1MCOL 1XZ0B 4M48L 1DLHB 5D5MF 4JDVA 3PGFH 4AK1A 1NUDA 1I85A 3BHBB 3VFOA 1KELH 4IMLA 3VG9C 5IP4A 4GBXD 2UWEE 4ERSL 1T66D 4V3EB 2Z8SA 4UIKL 4ODTH 1ZE3C 2A6DA 4MXVE 4XMKL 1FAIH 3T0BA 5ACZA 4LPVA 4PD4K 2AXGA 3PABA 3IJSA 1MCSA 3FQUB 1UT9A 2A77H 2ED8A 1I8IA 4OCSL 3PGFL 5ETUB 3QUYC 1CICA 5TE6H 3LS4H 4NO3B 1CL7I 3CFKA 5ALCL 4N9GA 4XMLL 5FO7A 3VXUA 1GOGA 1HCVA 4KVCH 1YYLL 3GMNB 1BBJA 1ZHKB 1A47A 3LIZH 5I1AB 4NJAL 3AB0B 1U91A 5JW3L 3CD4A 3FONB 3U7WH 2FH6A 4GO6B 5J57B 1X9QA 1FAIL 4NHCH 3FZUD 3MJ9A 2YD9A 5MEQB 4HIIA 2NY7L 3CLEH 3I2CL 1IM3B 1GC1C 4ODUB 1U8KB 1H8OA 1VACA 5I1CH 5SWQB 3RAJH 3O6FA 4Q0XL 4H26A 1OOAA 4AM0A 1X5KA 4EN3A 1TQCC 3D3VB 1BBDH 1I3GH 4YDJA 5TDNB 4QRPB 3E2HA 2VLRE 2LE9A 4FFWC 3QQ3A 4P9HC 3EYFB 1IQWH 2F15A 4WTWA 5I8OH 3S97C 1HHKA 4J4PC 4JHBA 2GY5A 3O2WH 3NAAH 4R26L 4HC1L 3VGEA 4DKFL 3VRJB 1CU4H 2YUVA 4XCYB 3HLAA 4LPTA 1BD2E 4V1DE 1OAQL 1QRNB 2EDTA 2PXYD 5AUMB 1IEHA 5MENA 2IBGA 2X1XR 1BWMA 2WWMC 4Y5VB 3NFPA 4Y5VA 4LPCA 5DO2C 3TF7A 3B83A 3P9LA 4X4XA 3PQYD 3S3PA 3HMWL 4JM2D 1MCHA 5DQJB 2DWEB 1RD6A 2OR7A 3DETC 5JZ7D 2MQ3A 3EGSA 1JYNA 1DQLH 3VRJA 3DMMB 2OLDA 3GBNL 1ZVHA 2UWEF 4OV5A 4PYGA 2VITA 4HC1A 2CXKA 4NSKB 4HUUB 1OLLA 4M1CC 4O02H 5EU6B 2GCYB 2QL1A 2P8PA 1S9YB 3BEWB 4XNUL 4CGTA 4N0CD 3DROA 3UTTE 4AQ1B 3P4LA 4JDZA 3R06A 1EJ6A 1ETZB 2I07A 3ZDZE 3O6FB 2YD7A 3QIWD 3W39B 4OM0L 4JE4B 3UTPE 3QEGL 1LE5A 4C4KT 3BPLB 1T0NA 3W0WB 4JFDB 2OM5A 1E4WL 1INQA 2FATH 1TETL 3FOMB 3LKNB 1LP9F 3P30L 3KLSA 3D85A 2VZ1A 5LG1A 3OKEA 1P69B 4ODWB 3SY0A 3RWGA 5AAWA 1B0RA 2ZCKH 3UO1L 5E6ZA 1JZ3A 3TN0D 1FH5L 5L2KD 4JFHE 3WNPA 2HKHL 5DHVH 3GSNH 4MNGB 5DA4A 4OCXL 1OW0C 2RGSA 4JJ5B 1YQVH 3QNZA 4H20L 1DL7H 1TDQA 4ZAKB 1KNOA 1LO4L 2O61A 5FGSA 1G9EA 1W0YT 3B8YA 1GGCH 3OKLB 1JHTA 1NBZA 4YFEA 5DQDL 4MJ6A 5ICYB 1T1YA 4YDIH 2Y1VA 3TVMB 4NJ9H 4X8JA 3ISWA 4XWGL 4MA3A 3L3OA 4GRWH 2UZIH 2NZ9D 4G7YL 5L8LB 1NDGB 3JVGA 5IESH 2FB4H 2UVFA 1F00I 5F7FA 4NC1C 1ZLWK 1EZVY 4M62L 3VFTA 2R2BA 3FMGH 1U8MA 2RAMA 5IFAL 3S4SB 3HN3A 4L4TA 3PGDB 1XZ0A 2OTUB 1KJ2H 3PP4H 3RWDA 4H25A 3INUL 4PRNB 2FJFA 4P2OD 1I7RB 3ARWA 3HNTH 4KTYA 4Y16B 1FORL 5DMKA 2DWDA 4QYOA 1KN4H 1WF5A 5F96H 2F54B 5E99L 5DDHA 1OTSC 3EO1B 3U2SA 2GSIA 5IVXB 1HQ4A 3V7AG 5JHLL 5IF0A 4IRSD 1PVHA 2HA1A 4MAYD 2YA0A 3GK8L 4KRPC 2FHFA 1RZKC 3I6LD 4M3JA 5DJ2A 3P0YL 3PWLB 4Q7DA 1BIIB 1YMHA 1JNLL 1T1ZA 5HDOA 2K1MA 2WM0A 1DBML 4K3JH 3VE0B 4MHHI 4UNTA 2APWA 4OF8A 2P46B 3QI9C 1EIBA 1EHNA 4C56E 4O2EA 1OF2B 2VR9A 2JIXB 5IEHA 1YY9D 3EYVA 5SWZA 5K9JL 3TVMA 4OLWH 3GSVA 5ALBH 3X11A 1JPSL 1JRHL 3QEQA 1NAKL 3GSUB 3D39B 2MHAA 4F15B 1FBIL 1OT2A 4Z95H 1RZFL 1PZ5B 4MVBC 2FD6L 3HC0A 5DJDA 1JNLH 1NLDL 4UILL 4M4RA 3RI5K 2CK0L 3BZFB 1A3LH 1HH9B 3BOVA 2VXSH 4UQ3B 1F90L 1A3RH 2JCCB 3SN6N 1IAMA 5HHXL 4LDOB 4LP5A 3RUGE 1KPUB 3MRMA 1LDPL 4R3SB 4ZD3L 1B0RB 4Y5XB 1NGZA 3GO1H 3MODL 1MHEA 3BE1L 3O2DH 2DI7A 3WIIL 1JPTH 3NH7L 2IPKA 1HQRA 4NQXA 2AQ1A 2KQNA 4CVWA 4NRYA 3FO0H 4Z7UE 1T0NB 3KPSE 2VDKH 5FGRA 5DSCB 3QUZA 3UYRH 1TZGL 3ZL4L 4P4KC 1NL0H 3KYOA 1J1XL 1S7SA 3H0TA 5FA4A 3U7AA 3F65A 1RUAL 4WHDA 2EECA 3QUKB 4X4MA 2EDOA 2XN9E 2OMNA 1MQKH 2KZWA 2R0WH 3VWJB 2J4WH 1P9MA 4P2RD 5DK2A 1R24B 3QRGH 4XP9L 3TWCL 2NY1D 4JRYE 4HIHA 4HJJH 4LCWB 1PY4A 3L7FA 5FA3A 5SWSB 4L8DB 4QOKB 2EDJA 1FCCA 4QHUB 5EWIH 2BFVH 4WWID 3C5SB 1X5IA 5JO5A 5DJYB 5ENWA 5E7BA 1MJ8H 1KB9K 2GT9B 4R4NC 1HDMB 3DVGB 1L8JA 3P4OB 2J5LC 2DQFA 5IVZA 3UBXB 5C0NC 4ZNEA 2VZUA 4PB0H 3MREA 1YQVL 4NC2B 4NQEB 5IV2B 1VFOA 2CIIA 1D9KC 1QLRA 2C1OA 5BW7A 4LPYA 3BGMA 5K9OB 5L2KE 1KCGC 4JPWH 3MRDA 1UZ6F 4HIEB 5C08E 4HGMA 4FQLL 12E8H 3MYJA 4PRHD 5JIKA 3SE4C 5C0GB 3MROB 2DQIL 5DZNA 1KN2L 3BH8A 1CIUA 1V3LA 4WI8A 4P23A 3HG1A 2D0GA 32C2B 1JK8A 1NC2A 4K3DH 4CVXB 4NRYB 1YQ2A 5CSGA 5B3JF 3JSSA 3L6FA 5CBAB 2FDBP 1X5AA 4K9EH 3PP3H 5IBTL 5E4EC 1F4WH 5FV2A 4HUWA 1JF5A 2ICWJ 1MHCB 4F7TA 1JNJA 4OIIL 2NY6C 3KHQA 1NGZB 4OUUB 4X4ZA 4FQHB 1ROWA 5C6PB 2FLRT 5F1IB 3I6GB 1LE9A 3D18A 1RURH 1KCUL 1LP9B 2EO1A 1PKQB 1WIUA 5GISL 4G8IA 1LO5A 1CLOL 3H9ZA 4OLXH 3WO3B 2W9EH 4CNIB 3BN9C 2VXTH 1OARL 5E8OB 5C1MB 3MR9B 5LGJA 1EHXA 1CDBA 2NNAB 4LCIH 2V17L 4YHIA 2ZZUT 3WLWD 2IALA 4HFUH 1NFDA 1DBJL 1UM5L 3DX7B 2PCPA 2PYEE 4NNXA 3VMNA 4A6YH 2AGJL 2V2XB 1IRAY 4LSUH 4Z7UF 5ABDE 4NYLA 3F7QA 4NHUE 1OP5K 1A6TB 5JA9A 5CP7B 3BD4A 3C5JB 5C7XH 4YO0A 4PJ8B 4GRWE 4OFYA 5IJKA 3AXLA 2DKMA 3HPJA 2Q8AL 4ISVA 5I8EB 1KTDA 4XCEA 1UB5A 3GBML 4Z76B 4HLZH 1MFCH 5KW9L 1JZ5A 1J8HD 4QTHA 4EI6B 2VLJA 3HE6C 4UTAL 5IB3B 3WN5A 4WFGE 4E41D 5HD8C 4G9DA 4K8RC 3V8OA 4PJCA 4QHNB 1G7HA 1QHOA 4TNVK 5I17A 1F97A 1JGUL 3DIFA 25C8H 5EU6E 1Q9LA 3BPOC 3FT3B 3I75A 5C0CD 2E9WA 2QSCH 1OQXA 3GMOA 2OTUA 3I6KB 2QJDA 1ZTXL 3WHXA 2ITCB 1L0QA 4UT6L 4C83A 2R2EB 3EKCA 1X5YA 4Y4KB 2JE8A 3P3YA 1QSFE 3MRLB 3MUJA 2MQ0A 3DV4B 2MFNA 3SDYH 2CKBB 1RZKH 5F71A 3VFNB 2Z8RA 4FOMA 2GAZA 1UXWB 2OCFD 4OF7A 3U7WL 2FZ3B 3LSOB 4B7LA 5IB1B 4G6AD 3WJLC 4WUKH 4X4YA 2WMPA 4ZNCD 4WI4A 2FO4A 5DURD 2NTFB 4HK0A 1K9TA 1CI5A 2BNRE 3MRNA 3RDTB 1TMCB 4K7PL 1ZLVK 2VXQH 1GOFA 1A6ZB 3TNNA 3QNZB 5HHQA 2H32A 3V0WH 3EOBA 5ISZA 3IT8D 1YN6B 4OLYL 4QXTA 4LOUC 1FLRL 2EKSB 3CVIH 1U8IB 1BVZA 1T1XB 1DJSA 3GI8L 3BQUC 4QRUA 1QFWM 5KOVC 2Y4SA 2UWEB 5T3ZL 4UV4H 1CN4A 2IH1B 2XWJB 3O2WL 4U0QB 5H2BA 2WBJA 3FOMA 3LKNA 1I8KB 4X6DF 3RX7A 1TJIH 4D0CB 2YPVH 4JY6A 4NO2A 4UV7L 4JKKA 2HT3C 5DFWH 3L3HB 4EI5D 2ED9A 5T1MA 2K3TA 4XVSH 4UAOB 2O5YH 1RHHA 5GZOD 4QTHB 1EAPB 2RIKA 1I1RA 2OSLB 1N3NA 1R3HB 3MLVL 2IH3B 4D0DB 5GPRA 4LARL 5AG8A 5T1LA 3NIDF 5E8PA 4NSKA 1CF8L 1CK0L 1CFTA 4JO3L 3IDIA 5C0AA 5IT2L 4GS7C 4Z0BL 3N1PC 4I2XA 4F7EB 4TRPH 4EJ1C 5JOPE 5DEFB 2OTPA 3JTSA 1G0XA 1RJYB 4X0KA 2HT2C 2Q86B 4NQTA 2E9IA 3KYNA 3SKMA 1NEZA 3PWPE 4JO2L 3SDDB 2EEDA 3VFPA 3MFFB 1OPGL 1E6JH 1IAOA 4EI5C 2NNAA 2ZOLB 3GSQA 4UI2A 4LSPH 5SX5K 5C2BH 3OX8A 2A83B 2Z92A 4ONHA 3M8OL 5JXEC 1GZPB 1SVZA 3HRPA 2XWBB 3KLHD 2J8HA 3BKJH 5BS0D 1IC4H 1D9KA 4HKBB 5JUEL 1CWVA 3O11B 4XC3H 2PTUA 5DJ8B 1R3KA 1J8HA 3RWIB 1BFSA 1RQ5A 1OAUH 4NC0B 1U8NA 1LEKA 3VFRB 1KBGH 5KS9F 2DIAA 3HAEA 3KPSD 1XGTB 2CQVA 3NCYS 3T4YB 5EBWB 1JUFA 1GH7A 3X3GL 4HKJB 3WDJA 3NFSL 3OG4B 4Y4HB 7FABL 4PJDA 2MSPA 2XFXA 4X98B 1HI6A 1F58L 4LAQL 1P9MC 1BBJB 3GMNA 3VH8A 4Z8FH 1YNLH 5I1EH 1C12A 2VDMH 1KIPB 1BOGB 2FB4L 4GAGL 2PXYB 3BPCA 4Y2OA 3TT1L 2OXHA 1S7XA 2EICA 4L4TD 5FM5M 1N59B 1YN7A 2R0KH 2BY1A 4I18C 5I30L 2XKUA 3DOSA 5JR1H 1ZGLA 2IPTL 3QDJA 5JDJA 1XCTB 2GITB 5T1DL 1U8QB 5FA3B 3PV6A 1C5BL 4PGCB 1TJHL 2DQEH 4QHLA 5D71H 2BVYA 1Q0YL 1ORQB 5F96L 1A7NL 2BDNL 3QFDB 3MV11 1EAPA 2Y5EA 3MLRH 3OB8A 3DX6B 1EHAA 4BK5A 2VDML 4GFTB 2Z31B 5EIIB 1PG7L 1SEBB 2P7TA 2KDGA 3PQYA 4PBXA 5KOMC 3P0VL 4YDKL 3C6LA 5TE7L 3ZTJH 1QG3A 3AS3A 5B38A 3S8WA 3QDME 3RVUD 1DLHA 4HXAL 1GGTA 1CXLA 4PJIE 4Y2DB 1YYLH 3RPKA 1A7PL 4PJDE 3V6FB 2C7UB 2Q76A 4IS6B 5IMMB 1ZVSA 5JHDA 2C5DC 1UCTA 2E7BA 2BVQA 1AQDA 1REIA 5ICXB 4DEPB 4W6XB 3PWPB 3OKYA 4PJAB 1YA5A 2P42B 3S96A 3JZ7A 3B5GA 4M5YH 1NANH 3PWNB 1AGCA 4KAQL 1XIWA 2IJ0C 3D39A 5F93C 3DO7B 4LSRL 3RDTA 4KFZC 1AP2B 3U0WL 3RGVC 1OW0A 2XV6B 3FO2B 1F90H 1HE7A 1GIGL 3DYMA 2YRPA 3SO3B 1FVEA 1KENH 2F8OA 4BELD 3B3IA 2IFFL 3B3IB 3VFNA 3CFBB 3EFDH 1IGTA 4XXCC 4MJ5B 2C1PB 4H0IA 4PUBH 3WUWG 1T1ZB 5MERB 2Z35A 2X4OB 2XZAL 3CSPA 4HQQL 3IFLH 1RI8A 2X4TB 5ESQA 1JTOA 5CSZA 1F4XH 4M6OL 2EZ0D 3V5HA 3SCMD 1SM3L 4YBHA 1KYOJ 3V5KB 2HFGH 3U82B 3QFJD 3MGOB 2DF3A 4FNLL 4YHKL 1TTUA 3NGBB 5GGQH 1S78C 4PJ9D 2O5XL 5DUBB 1IL1A 3MTRA 3SDAA 3OKOB 2QQLL 3TO4B 2V5MA 1FO0H 2EIEA 2GJZA 1A7RL 3BVNB 2X4QA 1D5MA 2UZIL 1D6VH 5FUOH 3V0VA 3C6LB 3WFHB 3FFDB 3PHOA 4JY5L 2YZ1A 3VGGA 4MNQE 5DHVA 4IOFD 2XTJB 3D0LA 1LDSA 3QHZH 4TSCL 3ESVF 4JREB 5I18L 4NZRL 1E4XI 5F9DC 2PF6A 2ORBH 5E24E 1IKFH 2NY5H 5J6GB 1DTUA 5DVKA 3L3IB 3D85D 4HJ0D 2D4FA 3T2NL 3ZT7A 5EC1B 4JDTL 3ILPB 5D7IA 5HVHC 1MRFL 4YHIB 3RA7L 3T08A 2DM7A 4MA8H 5FHBH 3DVNB 1UJ3A 5HHPB 1CS6A 5E8OA 4D9LL 1N59A 5FUOL 1K6QL 2D31B 3QPXH 2B2XL 4TNWK 2DJ4A 1WZ1L 2DLFL 2F74A 3BQUD 2JJSA 4YXLL 3I6GA 3QDJD 5T5NG 3MNVB 2I9LA 4OIIH 5EOTA 2DQGH 1T22B 1XGQB 4R7DA 3V6ZB 2D7OA 5HHME 4HUWB 4M7KL 3V52H 1FFNB 2FJHB 2HTKD 1MWAH 2PW2B 5DQDH 5I74B 1T6WA 5D6CA 1WIPA 1XF5A 3CIQA 2AJ3A 4GKZA 2BHUA 3SJVB 1IQDB 4YDLB 2F5BL 4S1QL 1Z9MA 1DFBL 2HG5A 5DR5H 3O9WB 2AXFB 4YE4L 2IADB 1MCNA 5CSBA 4B0MM 3RWIA 1W0WA 3MRDB 3MRPB 2YMXH 3OJDA 4E41B 3BQUA 3H42L 3HZYB 3OR7A 4GBXA 3FQRB 1FG9C 4I1NB 1T03H 5I2IB 1J05A 3QWRA 3QFJA 4N0YH 5DJZA 3PWUA 2GT9A 1HKLH 2MKLC 3OAUL 1A1NA 5IIEA 5D1ZB 5J11C 5BQ7A 4DZ8A 5F7HA 1EDQA 4IRZH 1HCFX 3VXSB 5CEZD 3B9EA 4HT1L 3UYPA 2VE6A 3H9YA 4YHZH 4XTRD 3GRWH 2W9DH 5MEOA 4JZNB 1L0XA 1QFUL 5E2UH 2MPAH 3QXDA 4XCCH 5I1KL 2HRPL 1AE6L 2BNRB 1FE8L 5GRUH 3MV7B 4ZUWB 1KENL 3WFHA 1HKFA 3H3PL 3CMOL 5CJBA 5KSVA 2X1PA 3GSNB 4WNQB 1RAMA 1Q0XL 3TESA 2ZUXA 3ZKXC 1LQVA 2NW2B 5IMLB 3ARFD 5FGBC 1MF2H 3UJTL 5JPMB 2HJFB 4LASL 3B2UD 5KSBB 3QDGD 3FT4A 1R3LA 3C6SB 1YEEH 1R5VA 2EXYD 3U7YH 5EZOL 2Q7YB 3HNVH 4JLRB 3SKNB 1Z5LB 5DF0A 1J88A 1LNUA 3WIHL 2VSCA 5IUSA 1QACA 2ARJQ 3GHEL 3PDOB 3ZYOA 3MBEB 2BSED 3W5NA 3L3DA 2QSTA 2Y5TA 4YR6B 1I8KA 4WW1B 3EO9L 3RUGF 5CIPH 1BAFH 3P11L 4HMDA 2ZUUA 5D7JD 1BJ1J 5F6IB 3BGAA 2CR6A 1MJJA 2FBJH 4ZUTB 5F9WB 2DQIH 4JHZA 5EO9B 4WFFD 4H1LB 4QOKD 5C0DB 2O5ZL 4N9GB 5DLML 1ORSB 1VGKA 1G9MH 4O2EB 5DJAA 4RMRA 3QI9D 1AR1D 2H32B 5IOPA 5EULV 1A6ZA 1G7IA 1DQJA 3O6MH 3KR3H 5FV1L 4LVNB 4EUPA 2O26U 1NL0L 3OKNA 4WI5A 4KMTH 1FL6A 3GM8A 4GLRI 1RUAH 3TT3H 4KQ4L 4OQTH 5E8DH 3IJSB 5GJSL 1Y0LA 2EDXA 4ZOBA 4P3CH 2CGRL 1RK0A 2J4WL 1XMWA 1HH6A 4U7SA 3O8XC 2F53E 1DDHB 4BYHA 4Y16D 4ESKA 5IB1A 4G5ZL 4N68A 2WSKA 3EAKA 4ELMF 5I19H 1Q9KA 4ELME 5DVLA 3PWPA 4OCWL 4U4BA 1CDCA 2BVQB 3GSXA 2A38A 3RWJB 4EUPB 2EZ0C 1KTKE 4RBPK 3MJ8B 3V6FA 2VB5A 4HIJA 5F3HA 3TH2T 5C0DA 1CXEA 1QFWI 2HAZA 4IDJH 4W6YB 2FHBA 4OZFA 4P9ML 1UB6A 2AJVH 4OFKA 4DVRH 4IIQB 2P7TB 1Z3GH 1RMFH 5FKAA 1LVEA 3QQ9D 4Y7MA 2IBZY 1MCFA 1NFDE 1P5UA 2AK4B 4WGWB 2BC4B 4GRLC 2VLJB 2VABB 5JQ6H 1E6JL 2CDFB 2X4NA 3TBTB 5FYKD 3BDXA 2QV2A 4P0DA 1IGYA 4DKDC 3PV6B 3OF6A 5DMJB 2DIBA 3B6SB 3VFWA 4HWZB 1RUKH 4R97B 4JANA 4L3EA 4KKAD 5EC2A 2VRAA 3E1F1 4N5ED 5E8EB 1INDH 4NYLB 5IMOA 4O00A 4MNGA 3AAZA 4KI5F 1ZA3A 1AXTH 2HJLB 1NC4B 2ITDA 4N5EA 4BSVB 2X41A 4NN6C 5AYUH 4HFWA 4G59A 3N0PB 1KUMA 4PJEA 4AQOA 4X83A 2D7NA 4NGHL 4PP1C 2KPNA 1BVLB 3PHQB 4CNIA 4FMKA 4F33B 2VE6B 2JJTA 4F7CB 5D2NA 4BFIB 3IGAA 3W2DL 2B0SL 3L95A 4KJWC 3CH1A 2PO6A 1ZHNA 4M61B 4P2QE 2A1WL 5KSBA 5LCVL 1CGYA 5J4MA 4KMLB 1IM9B 4I4WB 2XZZA 2XN9B 4MAUL 4RWHA 4XVJH 1J0YA 4NWTH 1JHKL 5IBLC 5DFVD 3V0WL 4HS8H 3DXAD 2M26A 4IJ3C 2R0ZL 4POUB 4XPTH 1KFAH 2LQRA 5HBBA 4JRXA 4GRWB 4IHOB 4PJIA 2FWOB 4S2SB 1EO8H 4GLRH 2ZPKH 4UU9B 5K9OA 4FRWA 4X4XB 2Q6WA 5FYLD 5L7XL 2Q8BH 3UTOA 4IMKC 4JFPB 1E28B 5E2WL 3PGCA 3DJ9A 1DQDH 1I1AA 4OZ4B 1I9JL 4XVSL 2EDLA 3OAZK 4HXBL 3RTQD 1GGBH 3WNOA 4YIQA 2D9QB 1ZLVH 2BVUA 4WFHD 1MCQA 1CDGA 4WGVB 4JRXB 5I8KH 1S7QA 4WWKB 4LLMB 2R0ZH 1PBYA 1CFTB 3QG7L 2X70A 5INDB 1NGQH 1A4KB 5FCUH 3SDAC 4HH9A 2YPLE 4JFEE 5HYJA 4YQXH 1NAMH 4C56A 3PWJA 1XEDA 4JM2C 5DK2B 3NCJL 4S0UC 1KXVC 3ARPA 3ZMRA 6FABL 2AJZA 2J88H 2ZG3A 2R0LH 3L95B 1DN2A 4UOW1 4M8VA 3SDCB 4DUWA 4I48A 2BRRH 4KRLB 5DJCB 2KUTA 4RGNB 1KJMB 2FGWL 1RFDH 3OL2A 5KVFL 5KVEH 3WDHA 3N1FC 4A6YA 1K3IA 3JUYA 4W4OA 1BF8A 1UA6H 3MRKB 5L0QB 3IDGA 4PJXF 3CGTA 1WSST 3E6HB 5I71C 1HSAA 1F11A 1ZSDB 3VDBA 5ANMA 3GEWB 5DUMH 5D7LB 4KROB 3IKCB 5HYSG 4EEEA 3JWOC 1RZJC 4D0BB 3MO1A 1WC7B 4H88H 4JANB 2EYRA 3GSUA 3LN5B 4F80A 3VFWB 1A0QH 5GS2D 4JRXD 3WIFB 1Y18B 1JGVL 3KPSA 4M7ZC 3ZKSD 5EBMB 1VA9A 5FOBA 3QQ4A 1S9WB 3RDTD 4KKLD 2H1PH 2FIKA 2FSEB 2VN4A 2X4TA 1N5YH 3Q3GA 1G6RB 5SX5H 5D1QB 3FRPG 3FN9A 5C09E 3K8LA 3R8QA 2AKRB 3RX5A 4A2MA 1HXYA 4DTGL 5TFSL 4P99A 4MDJB 3BDYL 4HJGA 4J6RL 4JZJC 1OGTB 3U46B 4CDHA 1EEZA 3D69A 3UBXG 2CJUH 4TUOA 5EUOA 1OAYL 4X80H 1KACB 3IJHA 4NZRH 3ZKMD 5IVXA 5A2LH 3A6BL 3ULVE 3LKQB 2NY5L 3LVEA 4DVBA 1HEZA 1MVUA 5EO1B 1N4XL 2EDEA 1FL5A 4LQ1A 4TVPE 2FL5B 3RU8L 3RQ3A 1V3JA 3BJLA 4XMPL 2BSTB 4DFIA 4JFHD 2HT3D 4ZTOL 4L3CB 2JCCE 5KTEL 1ZSDA 4LLQA 1MPAL 1AD0B 2EDWA 3T65A 4O58L 4PGZA 3WO4C 4Y4FA 4CL7A 5JW4R 4MJ5A 1D5BA 2AKRA 2X89A 1G7IB 1MCWM 4J3OC 1KEGL 4GW5A 4OGZA 4KWUA 1MHHB 3LKOA 3F7PC 4UINL 5B38B 4K8RL 3WMSA 1YEHL 3L3KA 1N4XH 4N90E 3IETB 4P57B 4YHLL 1K8DA 4PJ7B 4AZ8A 3RVXD 3SGJC 3A67H 3BRDA 1BGXH 3QT2A 1EO8L 4OBRA 4JZOA 2VWEE 3ARRA 2EH8L 4UTBL 4XPFH 2JK5A 1JV5A 1RULH 2J6EL 5F89A 2KQMA 1S8DB 4B41A 4XGZB 5IKCB 1II4E 3AUVA 2WP3T 1KEML 3FO0L 5F1NA 5JHDE 4FA8A 4HUVA 3E6HA 5E6ID 1S7QB 3NABH 1WZKA 3MRHB 4JFZH 5IVOA 5CHNB 3F5WB 1JYWA 4M7LH 3JWDC 4F57L 3TH3T 1IM9D 1IZKA 4DWHA 3BYTA 4PRDB 5GGSY 4Q58C 5CEYA 3D25A 3NIFE 5D7KD 5GZOC 1IGIL 2V5TA 4OZHF 2YS4A 2A6IB 5C0BD 3NCEB 4MQXC 3QIBA 3EJZC 1DANT 4WU5A 3VRLE 1CT8A 1VKXB 3ULVH 2P8MB 3WLWC 4ZFOA 2ADIB 4PV8A 2MNUA 3UPAA 3BWUC 4FQCL 1CR9H 2VAJA 1A4KA 1E4KA 3V6OA 3IYLW 1C16B 1D7FA 3VCLA 2DKUA 3W9EB 3PNWA 4GG8A 1DVFC 4HF5H 5K9QG 5JA8B 3BD3A 1FFPB 4KI5D 3OB0H 1J12A 3NZ8B 2PO6B 4M61A 1XGRB 1PYWB 3ULSA 4QHMB 1ZA6B 3RY6A 2A9MH 3LKSA 4KTEL 1BFTA 3P9LB 3T8XB 43CAB 4BKLA 3HUJE 3QO1B 4NT6A 3OKKA 1ZS8A 1E28A 1HI6B 2Z92B 4UB0L 4GRLA 4Y1AE 4K94C 3DGCR 3VW3L 1CD0A 4PG2A 4LEXL 4R96A 1NKOA 4DK3A 2A9NL 3QIBB 4LSVH 1EEYB 4LHUG 1MFBH 1JGDB 1VADB 1IQDA 3CSGA 4JFDE 3FJTA 3MCLH 1J8HB 3O3EB 4I2XB 2VZOA 5FXCH 1EFXD 3ZT5A 2YUXA 1J86A 5LVEA 4HS3B 5ESVA 2YPKA 4OCYH 2VC2H 5HDBE 1YEKH 5E6IA 1IM3A 4X6DA 1JWUB 3U36B 3TT3L 3P9MA 1HINL 4MXVF 3STZA 1YEDB 3BIKB 2JK5B 2WUBH 4RWYL 5GS0D 4XVUD 4KY1L 4MNHB 3VWKD 4NP4H 4BUHA 4G80A 5INCA 5FKAB 3G5XB 4RRPG 1F2XK 4PJEB 3TIDA 4IRJA 4ZXBB 4WO4A 4O2CA 3TYGL 4DAGL 1LP9E 4LF3A 4CDGC 1NC4A 3Q6FB 5JLZB 4FTVE 1CE6B 4WO4D 3CXHK 3VXPB 1P4IL 1CLYH 1FV1A 3CZFA 3QCVL 3ULUF 2AEIT 3QRFM 3UZEA 1EO5A 1YEKL 3Q6GL 1QRNE 4LMQE 1KB9J 4G7YH 4RSVA 3PHOB 4M43L 3DMMC 1IQWL 4KKLC 2DQJH 1DR9A 1BMGA 4GW4B 5HYQB 1G84A 1HWHB 3T0EE 1WTLA 1FPTH 2EDHA 1PW3A 2BSTA 3BPNB 4CVZB 4HDIB 2E27H 4AEHH 1G9NH 3TH4T 1NMAL 1WCBA 1TVBA 2BNRD 2EE2A 3OAUH 1ZXQA 3TBSB 4QHKI 3CFJA 4Z7WE 4OI7A 1OP5H 2CSPA 1NEUA 2AEPL 4OJFH 2HLFC 1I7UB 2C9AA 3MGTB 2VSDA 4PRNA 3ZKND 3ZYJA 3JV5A 3MRQB 5CEXB 2FX7H 4BFBD 3HMWH 5CSZB 3N06B 3S4SA 2D4DA 3MA7A 1FNLA 1NLDH 2XKNB 2BOBA 5I75B 5KSAC 1DQLL 4OFYD 5JXAL 3GDBA 1BZQK 1J7VR 5CINL 4CBPA 4KHXH 3DO3A 4YDVB 3GKWH 4ORZC 5J12B 4HGKC 5DYOB 3O45A 4JRYB 4NUJA 4WI7A 5GIRA 1QYGH 1IGIH 4PJCB 4QHNA 5GJTH 3H9HB 4M93C 3SCMB 4XP5L 3ZDYF 1R3LB 3WYRA 5JQHC 1UGNA 2EIZA 2VXUH 4W4NA 3SE8L 3MRFB 1PLGL 4S1DD 1LO0L 4MXQD 4LHQB 4LLVA 1NJ9A 3QEGH 1T03L 3HPJB 2VOTA 4P2CG 4FFVC 4XI5C 5DMIL 3WKML 2VWEC 3IKKA 5K9KB 4F9PC 2ICWB 3QRGL 3T77B 4PREB 4E9LA 4H1LA 1ADQL 4LSSH 1U8JB 2W38A 4HS8L 5DRNB 4JAMB 4NQDA 1FNSH 1NDMB 1JHLH 4N8VA 1T83C 2ADJB 1LDPH 3QEHA 5GSRB 4OFIA 1MCPL 1KJMA 2V7HB 4XPGH 5CD3A 4YBLB 1M7DA 2BXZA 2B8OT 2D7QA 3HR5B 3ARDC 4JLRA 3SKNA 1JL8A 4K8RD 3KXFD 3QNYA 4Y16C 1SY6L 1CGXA 3PL6A 4OGYL 2EEBA 1LO5B 2EXWD 4HLZG 2J3SA 5AZ2L 43C9B 1LHZA 1J1XH 2A74A 3LRHA 5FDYA 3DX9B 4V1DD 4N1CA 3GSNA 4WU7B 2R4SH 1FYTA 5I8KL 4Y5YA 5I1HL 3SE9L 4RFNC 5DEZA 2J2ZA 4OI9A 4HHAA 4F7MA 4K23L 4XP1H 4D94A 4MZ3A 3T0EB 5I15H 2Y36L 5IM7B 3HZVA 4KKCD 1MCBA 3QI9B 1MWAB 4JQIH 1JMZA 5ESAB 3GUTA 1NGWA 4PJ5D 4K7FB 4CAGA 2HTLD 4Z0XA 3OGOE 3MV9A 3R1GH 3MR9A 1KCVL 5KAQF 3S35H 4D3CH 4ONFL 5HHNB 4R7DB 5EOTB 3CK0L 2ZP0T 2DQFB 1XGPB 4RIRA 4KXZI 2VDNL 2LVCA 4UMGA 4LKXB 2FBOJ 3B5HA 2D0HA 2DOCA 3UTPD 3BH9B 1P4IH 3QXVA 2E6JA 2AV1B 2AV1A 5DD1L 3B5TA 2IADA 2VDLL 3NCBB 1S78D 1ZWIB 4PJ9C 1AXSB 1QPPA 5IBUB 2H9GB 5JW4M 1MLBB 4EXPX 1UZ6E 1CE1H 1KYOK 4C54A 4PJFE 4OLWL 2A77L 5C0BE 4P4KB 4PLJC 1YY9C 2GSGB 5J13C 4XPHH 4O2FB 5GS0C 1CDIA 5E2VL 4Z0XB 3LQAH 1CZ8H 4JJHA 5F21B 1QKZL 5FYJU 3ECBB 1IGFH 1NEZB 3CDGA 5EB9A 1U95B 2VDOL 3NBNA 4J8RA 1KG0A 4AIZA 2J8UE 5IEKB 3RWCA 4N8VB 4JAMA 4NQDB 4DUXA 2NY4B 4WFED 2V5RA 4LIQH 4HWEL 1CLCA 2H41A 4MD0B 5F1NB 3EZ8A 3T0XA 4BSWA 1RSFA 3FFCE 2ENSA 3KPQB 2IAMB 4ZUSB 3I3BA 1V7MH 2CUIA 4XGZA 3W0WE 4HIHB 1W72L 1DBAH 1W8NA 1TNMA 5DD6A 2J5LB 3QIUB 4NKOB 2YOCA 4Q2ZA 1ZANH 2EXWC 2FX9H 1MNUL 1RHHB 4LSTH 3AY4C 1YNTA 4MJ4A 3HZMA 4WDIA 3CNKA 1AO7D 3VXQA 4HULB 1UYWH 1CFNB 3IETA 2NXYC 2VISB 4L4VD 3V4VH 2Y06L 4RA0C 5FGCE 5MP6H 4F7PB 5JNYB 4H8WH 4NKIH 4BQ9A 1D5MB 3TZVC 5I1EL 5C0BA 5D7JC 3WJJC 3ZKNC 5I1IH 1XF1A 2R56L 4Y4FB 5DRNA 2ADFH 2NR6D 3I6LE 2XICA 1AY1H 4PBWD 4TSBL 2EKSA 1TJGL 3J7HA 2NY6B 2EIDA 5TF0A 2MKWA 1HQ4B 4K7PY 5DRXB 2CXGA 4NUGL 3MRIA 4ZG1A 3T0VA 4Q6IA 1I8MA 1H5BB 1BX2B 3W9DB 5LXGH 1QD0A 1HEZB 4WUUE 2HVJA 1GHFL 3C60A 3T4AA 4U3HA 3BZEA 3OAZH 1ONQB 1B2WL 4S1SL 5I1CL 1KN2H 5GRJL 4Y2DA 4X4YB 3DBXB 3MRGB 3MV8B 3K2MC 2NY1B 4FZEH 2EEAA 3LN4A 2CKBA 3NCYP 3ULUD 4KC3B 5ILTH 4XH2A 2XQBL 4F3FA 5T1KA 2E7LA 1NUNB 4K07A 4PJ7E 1FV1B 1QBML 3LS4L 3QYCA 5KN5A 1ZT1A 3OR6B 3G08B 3B9KD 4GAYB 1QZ1A 4MAYC 2P44B 1T7YA 4LOUD 4MDIB 4ZTPL 1IILE 1OQOA 1I7UA 3MGTA 1X4YA 4PD4J 1T5WB 2DKSA 3HUJA 4YBQD 3VXMB 1YEIH 3ZO0A 1WQVT 4G8FA 1SEQH 1F5WA 1LEIA 1A0QL 2CLZA 5KS9A 1I3UA 1H0DA 3QPQC 5IQ7L 3MRBA 4KK6D 4TPRL 2OR8A 4HIXL 1HSBA 4KHTH 4MX7B 4WNQA 3BPOB 3HI6H 1R3IH 1OAXL 4MJIA 2OI9B 4YO0B 4UQ2A 4ZS7L 5DI8A 2V9TA 1BBDL 1I3GL 1NMCB 2VDRL 4Y4KC 2AW2A 3QULB 4JN1L 4NZJA 5ADOH 1BQHA 1C8PA 3E0GA 2BSSA 5IFJA 4KK9C 1JTPA 5KVGL 3Q6FA 1JGDA 2DICA 1PEWA 3T04D 4Z0BH 4HEPG 4G42A 4JFQA 3BGFC 2BRRL 4OZFG 5GQBA 4NQCA 5LQBL 3V5DB 1KIQB 1BQLH 1FIGL 2DQGL 1BECA 4TQEL 1D5IH 2CKBL 3HC3H 1WJ3A 4QRRB 4MA7L 4XMPH 1FO0A 4LKXA 3X3FH 3T0WA 4G8GD 4PJGA 3NFNA 4O58H 3V0AC 4DGYL 1MFNA 2JF1A 3RWFB 3EGSB 4X98A 2PR4L 5BS0B 5HHNA 3NCFB 1A6WH 5BV7C 3REVB 1H15B 3BQUB 3HZYA 4U6HB 3MV9B 2OZ4L 4R2GB 4OCXH 4PJIF 1X5HA 2EE9A 5I9QC 4KJYA 5TQ0H 3Q5YA 4MNQB 5CJXC 4K3EL 3MLXH 4PLOB 1EBPA 3KYNB 2Q6WB 3QIWB 4I5BB 3O6FD 2AAVA 4H1LH 4M8QB 2FECI 3MBXH 3T0EA 1ETZA 4EQ2A 3R06B 5DURB 3SE3A 4R96B 3TYGH 3W0WD 3TPUB 3HG1D 5FM4A 4UAOC 5IJVA 4MZ2A 3KYKH 3V4VL 1CLOH 2BY3A 2HMIC 5DI8B 3VFUA 4LLWA 2X4RA 3QUXC 4LCCC 2P5EA 1WZ1H 5GS1A 4GXVL 1ZA6A 1EUTA 3DX9A 2CPCA 1RV6X 2W9DL 1MFDH 3MRHA 2AGJH 5SWSD 5DJ6A 3GMLB 3ZYZA 1AD9B 3FQXB 1HILB 1IMHC 3V5DA 2DTSA 1T5WA 3VFPB 1E6OL 2BNQE 3RVXC 1F42A 5K9QI 2B5IC 3QEHB 5E8NB 3P4NA 2WY3A 2Q8AH 4EI5B 2APXA 2OYPA 1T5XA 4NJ9L 2WBJD 5KSAD 1I1CA 4MGXA 5D1QD 4DGVL 2F53B 3AS2A 5DT1H 4UQ2B 3DRQB 2HJLA 2OI9A 3LN4B 5F1OB 1P1ZB 3U9PL 3BRGC 4K7PX 3CDFA 3STLA 3NTCL 4QRPA 1AC6A 3KXFA 1YJDH 3MNZA 3RVTC 1N5AA 2C4FT 1Y6KR 1Z6JT 5IFAH 3EJYD 5C86A 4G8FB 3MJ6A 5EUOF 4HK0B 1Q8MA 1BQUA 4TTDC 2VLLA 5D1XC 5AYQA 5DRXA 1GC1H 4N0UA 4HQQH 3QH3A 4AMKH 3ORJA 1B88A 4D0CA 4Z95L 1C1EL 1UENA 3N1QC 5DT1L 1ACYH 1ES0B 3UC0L 1QFUH 4MJID 4PJAF 1U2HA 5DS8B 2FEDC 4C83B 3EYVB 1A7QL 3FQTA 4P9HH 5CEZE 2XZCH 5H37G 3CSYA 2H2SC 3H7LA 4U7KA 1VCAA 4U1HB 2YSSA 5KSBE 1JPTL 4JFYA 4KI1A 4NQVB 5TH2B 3WD5L 4EIZC 3EYQD 1F4YH 2AJSL 1JRHI 3UROR 1A4JB 1FN4A 3L7EB 4XPGL 4I18B 1QR1A 1G6RA 3W9DA 1OCWH 5IG7A 3GBNH 2QQNL 1BVKA 4KPHH 3PWNA 1DBKH 1HOCA 1IKFL 4KK9D 1AIFB 3BISA 1K8IB 4ETQA 2DQUH 3AGVA 2VLME 4IRSA 5ERWA 4CADB 2GJ6B 1LK2A 3UP1A 4PJHE 1CDYA 4M1GL 5EWIL 2JELH 1H8NA 4N0UE 5F9OH 1YUHB 1DZBA 2H26B 1WK0A 3KYAA 1TVHA 4JB9L 3JWDH 3G5XA 4LLAA 2IMMA 1NCTA 3OWEA 4YHPB 1ZLUH 2XN9D 4S1RL 3KJ6H 4G8GE 3G04B 3EHBD 4PLJD 3KYMA 5SWZD 4RISH 4DEPC 1YEDA 1A7BA 3BIKA 5E1AB 1O0VA 2B7DT 1WBZA 1S5IL 3IDJB 3P73A 1W0VA 4RDQF 4ZYKA 5JOPD 1INDL 5HYJE 2OQJB 4KK8D 5F1IA 5DD3H 4I9WE 1SJEB 1LD9A 1G0YR 4M9OA 3B9KC 1EGJH 3LB6C 3QEUB 1RK1B 4HS3A 4UBDD 3WCYA 4HJJL 4ZDHA 1F6FB 3RGVB 1GXEA 3CUPA 4OGAC 1MCIA 1QSZA 4E5XA 1HHHB 2B4CH 1NCUA 1IGCL 3MYJB 4OT1L 5HHMB 3HNSL 1TCRA 1T5XB 1H3XA 4GOSA 2BY0A 4UDUB 4MWFA 1MJ7H 5GRYA 4M3KB 1CE1L 1HYRC 5L2KA 1F8TL 2H8PB 1WBXB 4M5YL 2ADGA 3L5WB 3QJFA 5ITFA 1LE5B 5LAXB 3HZKB 5IMKA 3O3UN 1M05B 5HYEA 1AXSA 1BWWA 3VXRD 4F58H 2NX5E 3TA3B 1OWRM 2FWOA 4OD3H 1FJ1B 1BHGA 3MC0A 3NGBC 5L9DH 5DJ8A 4ERSH 3OHXA 2N7BA 5HYJB 4I77H 3LRGA 5EPMB 1I9RH 5ISZD 3TO4C 1FAKT 4G6KH 5JDSB 4YXHH 1INEL 3RKDD 3CLFL 1U0QA 2X1OA 3RY5A 3BZ4B 2D2OA 4U1LA 4PV8B 4R9HA 1XR8A 5A2IH 2AABL 1L6ZA 4KJQC 2V9QA 1K2DA 3MOAL 2A83A 1M7IA 4XCFH 3H9SE 5KG9B 1BEYH 2YBRA 3QAZC 4EXKA 3C08L 4L4TE 3NA9H 4KGLA 4OZ4A 4U1GC 2IPUG 3KPMA 1PJ9A 1ZANL 1F6AB 2R0KL 4PJHB 2AJXH 2F54E 3UBXA 3QJFB 4UILH 4Q9CA 3QG7H 1T2JA 3VG0H 3E6FA 5H37H 5DC9B 4X9GA 5D7LE 1H15A 3OAYK 4P3WA 4P5TA 3NMEA 2R9HC 4EDXA 4YQXL 1NGYA 4HZLB 5GGRB 3O4OC 5D96C 3S37X 2ZNWA 3U6RA 3MRMB 4QHUA 3H2WA 2XZCL 2JJWA 4XB8A 3V4UL 1LO3H 4HS6A 4KRPD 2NX5A 4MSWB 4OLEA 4YDJB 3TJHA 3IDNB 3KPTA 4DK6A 1QRKA 4EDWL 4HWZA 5CKAA 4AM0B 1WFNA 3ILPA 1S7SB 5DK0A 5DD5H 3KYOB 5SWQA 1IVLA 1VACB 4DCQB 4P23D 5GIRB 4RAVA 1OGAB 2D7TH 1XF4A 4PGBA 2VABA 2H6PA 3O9WC 3ULUC 3QULA 3I3DA 1AR1C 2BP3A 3VE0A 3OKMA 3E8UL 4L4JA 4TULH 2QSCL 4L9LC 3V0VB 5KANI 4R8WH 1BAFL 3VXUB 3O41B 4XAWH 5FYLE 1ZEAL 3HE7D 3MJGX 2APFA 1YPZE 1CBVL 2YXFA 1I8IB 3LHPH 1UKQA 3HE7A 2IGFH 3S34L 5AG9A 1K8IA 3TLRA 1IGMH 2ZSVB 1AQKH 3CFJB 1FYTD 4CUCA 3KWWA 2RHEA 1KJVA 3RPIA 5FYLL 4GAYA 3K1KC 3G08A 4NBZB 4U6VL 1V05A 1WCQA 3L7EA 2YMXL 4CN6A 3IDMA 5FUZH 5TH2A 4JO4L 3LQAC 1EA9C 3PUCA 2DI9A 1JNNL 3OGCB 3VI3F 3K7UA 3Q3GB 4PLKC 1F13A 1VGKB 4KU1A 5EFIB 2XQYK 4K3DL 2C26A 1IGCH 1JFQL 4OT1H 2P43B 4MQSB 5DQ9B 4MJ6B 4Q6IB 2DWDB 4WW2C 5DWUH 4ZAKA 1N0XH 3JV6B 2O61B 5HJ3B 4P2OB 4XBPA 5JW4N 3ERYA 1DDHA 1JWUA 3FAXA 1P7QB 1ZT4A 4OZGE 4APQB 1QEWA 1VB9A 3ZLQC 1U3HB 2R2BB 1GPOH 3FT4B 1JYXA 2VZTA 5BOPA 2GI7A 1M6OB 5ESVB 3X3FL 3F12A 3UJJL 5J9PB 1MAML 4GAJH 4HX1A 3QDMD 3O3AB 3SGDI 5CLWA 1QQDB 4UDTB 4ZPVA 3KGRA 4WRLA 3SDCA 1C5DB 1MCLA 1CLZH 5DK0B 4HG4K 3A6BH 4XNYH 4MXQC 1NUFA 5TQ0L 2BNQB 1UG9A 4ZO9A 5H35B 2J12B 2E7MA 5CP3H 3QB7C 1S9YA 1LK3H 4XRCB 4P2YA 3BMVA 3O8XB 3IU4L 5D6DA 4MCZB 2N56A 4LSPL 3D39D 3QUYB 4QHMA 4NBXB 1MPAH 1WWCA 3B2VH 4E42A 4RMSA 2IF7A 4Q9QL 3U9UB 1GJIA 3Q0HA 3HE7C 4CMHC 3RWCB 4BQBA 5CBAA 3ZHLA 3DXAB 3AB0C 4LNVA 3OPZH 4AIZB 3BYYA 1NC2B 2BNUA 1JGUH 2COQA 4XNYL 2X4UA 2FX8H 3VWKA 4G7VL 5MENB 4DQOL 1VPOL 1OAZL 4N8CH 3DGGB 1QBLL 2EDRA 1OP3H 1ZGLM 1EAJA 4HIEA 2VH5L 4IHOA 4XAKE 2G2RA 2AXFA 1WGOA 1XR9B 4M5ZH 2NY0D 2VXQL 3TN0A 3U1SH 1FIEA 3K46A 3RUGB 1HHKB 1ZS8B 2CO7B 5D1XA 4PGJA 1H9VA 2ZSWB 5EZLB 5K9JH 4I9WD 2RBLA 1XGRA 3ULSB 2DAVA 3DSNA 5CBEB 2PW2A 1EGJA 1AHWA 4HPYH 5D8JH 2X4PB 3TCLB 3MJ7A 2DMKA 1IZJA 3IS0X 2R56H 1IM9A 4I4WA 4U3XA 5D1ZA 4R97C 5BS0A 4Z7VB 4E42B 4I0CC 4TPRH 4NO0A 4YX2L 5C92A 1QSFA 5SWSA 1V7NL 5CEZH 4OLYH 1UQSB 4RFEB 5ALCH 2DTMH 2QHRL 3ARVA 2QBWA 2H8PA 3PHQA 4ZFOB 1UH4A 3CMOH 4HEME 4KRMB 4G3YH 5HHPA 4NCC1 4LNRB 1DEEB 5A3ID 4P2RA 3REWA 1MY7A 4AMKL 2BDNH 2CRZA 1EXUA 2X5PA 4E5XB 2ATPA 1TQBC 1YEEL 4HH8A 3BKCH 2MCG1 1ITCA 4I8DA 1EX0A 3KPNA 3GSNL 1HQRB 1T2XA 2HFEA 3O3AA 4G6FB 4NQXB 4A6YL 4XNZC 3PXHA 1S9VB 1P5VA 1WISA 5D5MA 5E5UB 2R2HB 4X6CA 3X12B 3MV7E 5SV3A 1NBVH 4Z9KB 1LD9B 1SMOA 5TQ2H 4H26B 4XBEH 5TDOA 4RMQA 4QRTA 3BUTA 4MLIA 2AEWA 3TYFA 5MHSD 4KQ3H 4FXKB 5JIIA 3S35X 3HC0B 4XWGH 4HPOL 3SKOB 4UOW0 2CK2A 2BC4A 1QSVA 2CLZB 1CGUA 2WWKT 3BPLC 3OV6A 4KROD 2MHAB 4UNVA 3UJIL 1XF3B 4PRPE 3WL9B 1JWSA 4N8VG 5GS3A 5DMGC 2VIRA 4UTAH 5LWYH 4I3SH 5SWZB 5CUSH 4FNLH 4JY4B 1L7TH 5J6GA 3JWOH 2G60H 5BVPH 5JW5B 1EFXA 1FDLL 4QRUB 4YHYC 1E0OB 3O6LL 1AIFA 3HB3C 4ZAKC 5E2TL 1WBYA 3Q1SL 4LLQB 2X09A 1Q9KB 1E4XH 5HHOB 2YWZA 3ARED 3MRJA 2P8LB 4PJBB 4FN0A 3IVKB 5F7LB 1CLZL 4I3RH 1P84K 5C0AE 3KPSB 3SDAB 4LSDA 3X3GH 2R1YA 3F6IA 4OB5H 4N0CA 4Z78B 2VERN 5IGXL 5C07E 4LRIC 3QZWA 1IAKA 1MVUB 3MLYH 4X80L 5I1GL 1MUJA 5IOPB 5ID0B 3V5KA 3WLBB 4FABH 4FFYL 3SDCC 1MH5A 4HKZA 4NKDB 2D0FA 4YJZL 2BJMH 4HJGB 3MRLA 2APBA 2RQ8A 4LPUA 1CYGA 4L8SC 1P4BL 3GMQB 5DS8A 3GMQA 1BP3B 1A6WL 3LEXA 1HXYB 3K1DA 4A6YB 3ARGA 4L8SA 4PJ5A 4DOHE 5FDWB 1XIWD 3ARGD 3ARFA 1LEGB 3AU1B 3BAEL 4N0RA 1CFNA 1MCCA 4KTDH 2ICCA 3LQZA 2P5ED 1LO4H 3NCMA 2VH5H 3UAJC 2R1WA 1A5FH 1TVBB 3JV0A 3AM8A 3GO1L 1DSFL 1KNOB 4WI6A 4WY7L 4Q0XH 3S37H 4O9HL 5HYQA 1U8QA 5INDA 1T3FB 1I9IL 2YK1L 3IFPB 1HSAB 1JPST 2GHWB 5EU5B 1FZJA 5D1QC 5BMFH 4FZ8L 4PJBF 3U4AA 4JVUA 5FYKL 3MV9E 4ODHH 5CD5C 4P5TB 1WICA 1EMTL 1AI1H 3E6FB 2PXYA 3BPCB 3C6LD 4P9HL 5KVDH 5F7KC 3QUZD 1U8HA 2JJVA 3CDGB 4ZXBA 3MXWH 4JQXA 4ZOCA 1E6OH 4I48B 4PGDA 2IALB 4JFPA 2B1AH 3TWCH 3IFNL 4KUCF 1JWSB 4EUPH 3VXSA 3FZUC 2GSGA 3HMXA 1WT5A 5I1HH 4LCUB 1K2DB 4WTZG 2O5ZH 3QFDA 5CAYB 3WS6C 1LO0H 2DRUA 2P8PB 4ZS6D 2XG5A 5FGCB 2NY3B 1V5JA 2DM2A 3EYSH 1RPQA 5TDOB 4L5FH 2F19H 3VXUD 1I4FB 1JJUA 2F58L 4JG1H 1DQQA 1UZ8A 2UUDK 4FQPA 2IWGA 1KT2A 5D9SA 1A1OA 2DDQL 1UH3A 3TP4A 2R69H 4GSDH 2BVOB 2N1KA 3WEXB 5CKGA 4V2BA 1KCVH 4JN2A 3IGAB 2ZKHH 5EG6C 2CJUL 3VWJC 3ZHDA 1GYAA 3FFCB 3BKML 3MA9L 2IG2H 5CWSA 5F72S 3UYOD 5C0GA 3P2TA 2ADGB 3L5WA 4Q74A 5ITFB 3O4LB 3OX8B 4R0LC 5F7YC 3S4SG 4EVNB 4BFEA 3QR2A 1IAIH 4Y4HA 2ZOLA 1CQYA 1IAOB 4UIKH 1U3ZA 1N2RB 1UQSA 1RVFL 1R5WA 5FO9A 3OKKB 4TYUA 3GGWB 4HV8B 5K59E 4BSVA 1AC0A 2HH0H 2Z91A 5EDXA 3D39E 2MPAL 2NR6C 4F7EA 5BRZE 3QQ3B 4TOYH 4M00A 2DQCH 1JGLH 1UCBH 1S7VB 3QXAB 3PNWB 1UJ3B 3C5SA 4ZFOL 4WV1A 5C09B 1ZHLA 1E4WH 3VGAC 4DOHB 2AS5M 3P4MA 2WIIB 1DL7L 3O6ML 4BZ1H 3IDUA 3EDFA 2OTWB 2QQNH 5C9JB 1MF2L 4OF5A 1FYTE 3K8KA 3UJTH 4D0DA 1CK0H 2BOCA 2YD8A 1EO7A 1CT8B 3CXDH 1FH5H 2B4CC 5JW4Q 3CPLB 2WZPD 1QFOA 4MD5A 5CLTA 1EEQA 4O51A 5GRWA 2JKXA 4C4KO 1RULL 4BSJA 5ACLA 1VGEH 3VWKB 1T89C 4PRDA