5SWZA

Crystal structure of np1-b17 tcr-h2db-np complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
277
structure length
277
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Reversed T Cell Receptor Docking on a Major Histocompatibility Class I Complex Limits Involvement in the Immune Response.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 63
structure length 277
sequence length 277
chains with identical sequence F, K, P
ec nomenclature
pdb deposition date 2016-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5swzA01
4RMSA 3IXTA 1QFPA 1BGXL 3OMZA 5EBWA 1RJLB 3GBNL 4X6DB 4LAQL 2I07A 1PW3A 4WDIB 3HLAA 4GLRH 2WZPD 4M6OH 5CWSB 5D70H 2APXA 5GS1C 3FN3A 5DMGD 3U30B 2VZ3A 1ERNA 5C09D 1ES0A 1OT2A 2VZTA 3V6ZB 3EYFB 5E8NB 5DUMH 2J88L 4Y4HA 5E94B 3D9AH 2ADFL 4YHOH 2E7CA 3NCFB 3RX7A 4X6BA 4MD5A 1P2CA 2QSVA 1LO0L 4NC0B 3KWWB 4OLZH 1A7OH 3PWPB 4ODHH 5D7SH 3TPUE 3V4UH 4RZCB 3VI3E 2AK4B 2XTJC 4JG1L 2CMRH 5AEAA 3MXVH 4N5ED 5GZNC 4G8GD 1GOGA 4UT6L 3H9HA 5KSAC 2Q7YA 3ZYOA 1W0WA 4XVTH 3CPLA 4NFBA 2KKQA 4HH9B 4OI9A 1JNJA 1G7QB 4G7VL 3KYOB 4L3EE 3DVGA 5LCVH 3IKKA 5GIRA 3NA9H 3EBAA 1Y6MR 1W8OA 5IQ7L 3F58H 5ACZB 5IM7B 3KDMB 4ZUVA 4OFKA 2PTVA 4RGOH 3JVGC 1LP9A 2ID5A 4KY1H 4OTXL 3QHZL 5EFIB 1CF8H 5DA0B 3LRSB 5ABDE 1F00I 1PKQE 3SKOB 2YMXL 2I26N 3KXFD 4MAYD 5BS0D 1E4XL 5EC1B 3O2DH 1FRGL 3KJ4B 5DD0H 1FDLH 2GK0B 4OLXH 4NBYB 1KFAH 3IETA 1G6VK 4NRXA 3WFZA 5L2JB 3VD7A 4HJ0C 4RGMC 4NKMA 5JXEC 2ZKHH 5FGBA 4EBQH 1H0DB 1R6VA 1L9MA 2XXCB 4Y7MA 5D6CA 1KJMB 5IMKB 2VLJB 3BD4A 4J7RA 1D6VL 5D7LE 1G7JB 3CSGA 3MCLL 4FQXB 3GJFK 4F58L 2J3SA 1I9IH 5HSFA 1U8NA 4P2RE 1NAMB 2WUBL 4J3OC 3DI3B 3S7GA 4GRLB 4MNQD 3K81A 1BFVH 3MZTA 4PJ8A 5DD1H 3WUWB 3KLHC 2PO6D 5D72H 4OV6F 3DMMC 3QFJE 3I75B 1TQCC 2H2PC 3NMEA 1EBPA 4PV9B 3N1FC 3C8KA 5E4IA 3MBEC 1EAPB 2MWCA 3UZEA 4KVNH 4QRSA 2H6PB 1A9EB 4WGWB 2FJGB 3CD4A 4OQTH 3P9MB 2D9CA 2X4PB 3HI5H 3VGGA 4JM2C 3MLVH 3IDNB 2MCG1 3TIDB 4NHCH 1OSPH 3IDIA 5SWZD 4R3SB 3DJ9A 5BV7C 4Y1AB 3RIAF 3PP3H 4KHXL 2WW8A 2YA0A 2OK0H 1MFNA 1P4LB 5ESAA 1P53A 3VXOB 3GMOB 3M07A 1JGDA 2WBJA 4M61B 3T0WA 1BMGA 2R9HD 1AR1D 1A5FH 4PJXB 8FABB 3VFVB 4JVUA 3T8XA 5IHUL 3LZFL 2IH3B 4QTHB 2EDJA 4URTB 3O3BA 3VXNB 3WHXB 4NN7B 3BGFB 1AGDA 1Z0MA 1Q9KB 5DHVB 1DBJH 3MRNB 4I4WA 4FXGB 5F93C 4OZIA 3TZVD 4UOW1 3MV8E 4NUGH 1U91A 5TE6L 4D94A 3C6LA 4N0YL 4WUUA 2EC8A 3INUL 4M03A 3EDDA 3KYKL 3L5WB 2B1AL 4XNZB 4BSVA 3AS0A 4YQXH 2R1YA 4HDIA 3TNMB 2HFEB 2BSRB 1YPZB 2J7LA 2OJEA 1RJZB 5JQHC 3DTXB 3RDTD 3HNTL 3BGMA 2F5AH 4P46C 5I74B 1J8HD 5I19H 3VFNA 1WSST 3SDAD 4TSBL 2XZQH 2PUQT 1HOCB 3QIWA 3TJHA 1ETZB 2HTKC 2NY0C 4PGEB 3RY6C 1CD8A 2DN7A 1JTOA 4DZBB 1ZS8B 5E6YA 3QDJD 3R1GH 5E6IB 4HKBB 3W82A 3QUMH 5BVJB 1HI6B 3MLZL 3S36H 3V6FB 4LF3A 5TH2A 2VSCA 5T3ZE 3VD5A 4LSPH 3NZHH 4XXDA 3DX9A 3SDDC 4R4FL 3VW3H 2UY6A 1E4XI 2PTTB 5DVLA 2D03L 5EULV 1R3LB 5DJZB 2IQAA 5TQ2H 4DUVA 1LK2A 2F53E 1LE5B 4M7ZC 4PJGB 1WIOA 2YPLE 4LLDA 4G43B 1ZEAH 1OPGH 3MRLB 3P30H 4JFEB 4PRID 1CLZH 4O58H 1LP9F 3MV9A 4UINH 4K7PX 4UNTA 3FO0L 4YDKH 1N64L 1PX3A 5CKAA 3GUTB 3QA3B 4OM1H 4KGLA 3QEHA 3Q6FA 3KPSD 5I17B 2VDKH 5TDOB 4I0PA 2LE9A 5J12C 5F3HA 3UROR 5E0QA 4HKXB 3PIQB 3NOIA 3WLWC 2C3XA 1IEAA 4PG2A 2NYYC 2IBGA 5B8CB 1S7RA 1OY3B 3KPQA 3O2DA 5ERWB 4DGIL 3D39D 2R0LL 4NNYB 4OZHB 4X6FA 4YDIL 2IADB 3O0RL 4GG6B 2VNCA 5GSRB 1I1AB 2CJUL 3R0MA 3OJMB 2ICEB 1KN4H 3NCJH 4ZFZA 4HC1A 2AABL 1CFQB 5LG1A 3F12B 3VFSB 4LQ1A 3BH8B 4UBDD 4L8CA 3DGGA 4Y5XC 2MCPL 4RGND 3QEUB 2L7JA 5E2VL 2NY3B 2OXHA 1CBVL 5KSUA 2G5BB 3GBNH 3RUGB 3F7PC 2ZG2A 5EUOB 4N8VA 1AJ7L 3ARTA 1CU4L 1VFBB 4G6MH 1JFQL 3G08A 4DGVH 2DQDH 1RZJL 1H8SA 3LS4L 1QD0A 5F71A 1RZKL 3CMOH 4FTVD 4GBXD 4J6RH 5T3XE 3LQZB 1QFOA 4EOWL 3B6SA 4MNHB 4UMGA 5I75B 3MBXL 2ADFH 1NLBL 4FQCH 5EZOL 3UTTD 2Q6WB 1EK3A 5C0RL 1EEQA 5CJXC 1LEKB 5IEKA 1FV1A 1CTNA 4J2XA 1I9EA 1LMKA 4V1DD 2VITA 1LP9E 43CAA 1U8HB 3I2CH 3DX7B 1OAYL 4UT6H 1DQDL 5F7NC 5C86A 3DURA 4P5MA 1KC5L 3JSSA 2BNUA 4AK1A 2NY2D 4YDJB 3ESUF 2IPKA 4QYOA 1M71A 5EU7E 1Y6KR 4G7VH 2WINB 3BP6A 3QWQB 1YNLL 1MH5B 4D8PB 4F9PC 4JFOA 1U8KA 3V6BR 4H88L 4APQB 3ARZA 4Y4KA 1FVEB 1NPUA 1EFXB 3BPLB 4C56A 2JB6B 4HBQA 1S9VB 4H5SB 2AJZB 4JFDB 3C60C 1QNZL 4PB0L 4OZIF 4Y19A 1NGPL 1QP1A 4XC1L 1YEJL 1NSNL 2ZCHL 3O9WD 4M1GL 3PHOB 4Y88A 4DQOH 3RY4A 1ZLUH 2AEPL 3ET9F 1AE6H 3RWIA 2C3VA 4JRXB 4LEXL 3HR5A 1JTTA 4XBGA 1UB6B 3DETD 1JTPA 2HFTA 4R7NB 3PJSB 1E4XH 5EBLA 4M48L 4MD4A 3UX9B 5J0BA 2V2TB 4YHYB 3GI8H 3D2UA 5L8KB 4OF8A 3MR9A 2YR3A 4PJFA 2A6IB 4K8RL 1NAMH 1DBAL 2IALB 5L8LB 5GS3A 3HRZB 3WJJC 3RPKA 3RVWD 3QXVA 3V7MA 2EIEA 2IH1B 1ZWIB 2DQHL 3BWUC 4ZAKD 3MCLH 4N90E 1AO7E 2HG5A 4P4RA 2VN7A 3DECA 4ETQA 5F6IB 1JPTL 2BNQB 4JPIA 2WUBH 4KKLD 5I18H 4MJ6B 1DBKL 4XRCA 2G60H 5F1IB 1MF2H 4PLOB 2E6QA 3MFFB 3UZQA 5FDWB 1MCBA 5F96L 1E6JL 1T66D 1FC1A 5CCKL 3RL2A 3GMLA 1R3JA 5HDQL 2MTPA 4NQXB 4E0RA 5IB2B 2XNAB 1A3LH 2QSCL 3VRJB 1WFOA 4LQFL 2DI8A 1FG2B 4GFTB 2FSEB 2VQ1A 1Q9OB 4JREC 3RWCA 3KYNA 2WANA 2AJYH 4P5TA 1NDGB 4P57B 1JFMA 4Q6IA 3CZJA 2ORBL 4N5EC 1TJHH 3ORJA 1IEHA 4LFHG 3LV3A 4OLYL 3ZYZA 4YHNB 1RUML 3UO1L 1HSBA 3G5YB 4NCC1 4OZIE 4Z7OF 1OP9A 4JPVH 2Y06L 1KLFA 5GRWA 1KEGL 3C08L 3U9PL 1OAKL 3E6HB 5C1MB 3QIBA 2Y07L 2UZYB 5E2WL 5DHVH 3WYRA 2GSIA 4Q9BA 4JKPL 4Y4FD 4L8BB 3X11B 4HIXL 32C2B 3WS3B 1IJ9A 3JTTB 2VZVA 4E5XA 1A3RL 3K4ZA 1GZQA 4Y2DD 1IGIL 5ANME 3MLPA 1L8JA 2VXVH 2O93L 1MCSA 3QWRA 3O41B 3UYRH 5DJ2B 4KVCH 5EZLA 4MA1B 5HGBB 1U93B 3MNZB 1AKJB 2P48B 4LLMA 2ZUSA 4LLVB 1DFBH 5CWSA 3MRQB 3FQUB 4PRPB 2FCBA 2BOCB 1DJSA 1DP0A 2UYLB 3K7UA 1OP5H 3P40A 1EO7A 5J11B 4A6YL 1UKQA 2BDNH 3BUYA 1HKLH 3EYFA 5E8NA 1MLCB 3HNTH 1NFIB 3JUYA 3UBXA 1GYAA 4DK6A 2WUCL 1KTDB 3KHQA 3ULUL 3RIFF 5ICZA 1NC2B 3T2NH 1ZKAA 4NQDD 5JIPA 1KCUH 3EYVB 1V3KA 4LSUL 3PWPA 3QNYB 1X5HA 4R7DB 4A6YB 4RZCA 2PO6C 4PJHA 1DLHA 4J3TA 5C0CB 4DVRL 3MLRH 4OGYL 4HFUL 2UVFA 1ZANH 5INCA 4U1JB 5DRZA 3SGEI 3ARUA 2R69H 1Q0YH 4GMTH 4HIJB 4HH9A 3MLZH 5I9QC 5ACLA 3WNKA 4L4TD 4OGZA 5DEFA 4YJZL 1V7NL 3LEVH 4Z7OE 5C6TH 2FZ3B 4R4FH 3C5ZD 3JXAA 2EH7H 4HG4K 5I71B 1CYGA 1GGBH 1YN6A 3LQAC 4NWUH 5LAXB 1G7LA 4G9FA 4XCYA 5DMYA 5IM7A 1E6OH 3KDMA 4NT6B 3VFOA 2XQYK 2NY6D 4J4PA 3LN5B 1GC1H 5IIEB 1JZ5A 4W68A 5BW7A 1S8DA 2O61A 5FDYA 3L1OH 1HHGB 1VKXA 1N64H 2QKIA 3SKOA 5I0ZA 3CUPA 2L7UA 2X4UA 4TTDC 2H9GB 2GK0A 1MFDL 5T1KB 3S35X 1NEZA 1AR1C 3MLXL 5L2JA 3MGOA 1L7TL 4V2CB 1GPOH 3EDJA 3CVIH 1H0DA 5E2TL 3O6ML 5JUEL 1I1FA 5JA8B 1KJMA 4LRIC 4PJFF 2VLJA 2ED9A 4H26A 3TZVC 4FQXA 4QO1A 2BVQB 4W4OA 1CDIA 4NHUB 4TVPL 4ZYKA 3ARFD 3TGXA 1OSZA 1MFBH 2IEPA 2GFBB 2R1XB 3WUWA 4N9GB 1Q9WA 5BVPL 2MCPH 1S9WB 4UNUA 4JCLA 4MA8L 2YEZB 1QBLL 2FATH 5FO8A 4HS3A 1NCAH 3SDAC 1JFQH 1EX0A 4S1SL 1RZJH 4YR6A 5EB9A 5C08A 3S3SA 1FZKB 2IFFH 4U6YA 3LMJH 2WWMD 25C8L 1H15B 3P9MA 1B4RA 1HILA 4OKVB 5IESL 4KZDL 3MBXH 1CDHA 5FF6A 4XPAL 6CGTA 1UQSB 3HE6A 3IDNA 2H2SD 1NL0L 3BQUA 3U0TA 2PR4L 1XF1A 1T1XB 4C56E 2R2BB 3MLTA 3WEXA 1UCBL 4MAUH 4Y19E 1D5XA 3TBWA 1QRNB 3G04B 4H8WL 3GMOA 4YUEL 2EC9U 3MMEB 3O8XD 1JWSA 3VFRB 1UJ3C 1VESA 2ENSA 3VFVA 5ETUB 3VXUA 5ADPH 4Y5VB 4JN2B 4YBLC 3LAFA 3T3MF 4KI5F 3ULVD 3FQTB 3WHXA 3MRKA 4OM0L 4RRPG 4C54A 5DHVA 3TP4A 4PRHE 4IRZH 4FXGA 3NCYS 5L0QB 3DV6B 5KSVB 3OZ9L 1OARH 4F9LC 5KAQF 4GQ9L 4PB0H 5DK2B 1HIML 1NGPH 4FQ2L 4UNVA 5GHWL 4XC1H 4CVWA 1YEJH 4M1GH 3MQIA 4BFIA 3SGEH 4CADA 3L5WA 3O6FD 3GMQA 5J57B 5HGHA 2CLRB 1CDYA 4LEXH 3TNMA 2HFEA 3I6GB 1GOHA 1YPZA 1KJ2L 1QLEH 3CFCL 2R0KH 1HZHH 2VXSH 4PPTA 4QCIB 4ODTL 3P9LA 1CFTB 3QCVL 4M48H 3RL1B 1INQB 4EXPX 5D1QB 3A67H 4KXZI 1ZVHA 1RIUL 1T2QL 4JZJB 4ZODA 4BKLB 1KJ2B 2ZCLH 5JTWA 1EEZB 4P2QA 3WCYA 2R29L 4K3HA 1XGQA 4G80B 3BW9B 2DQHH 1WEJL 2FR4B 5DEGA 1KXTB 2NY5C 1CWVA 1M7IB 4PJHF 1JRHI 2NTFA 4JG0L 1ULVA 4OLVH 3T0EC 1JPTH 4GG8A 2A9NH 3DRTB 1FJ1A 1UWGL 5EUKB 3U6RA 4JR9L 5DF0A 1K4CB 5JA9A 4Z18A 5F96H 4NNPL 1E6JH 2EDNA 1UWXK 5DJZA 1M6OA 4XP9H 1F4YH 1LE5A 4NJAL 4LQFH 4IDLA 4G43A 5E00A 4XT1C 1EZVX 5D7KE 5J13C 2DL2A 3T3ME 4LLYA 3VMNA 2I60H 4U33A 5C0BB 4LVHC 1A2YA 4DAGL 4Z7UB 3GUTA 3QA3A 1CDGA 2ORBH 2B2XL 5C0EA 4MB3A 4GRWF 4FFEX 1MI5B 4K07A 3U46A 1U8IB 1FFOA 1N7ML 3PIQA 4OLWL 4LPWA 5DDHA 4ZD3H 5BJTB 3PDGA 2AXFB 2M8XA 3RHWF 4N0FB 4R2GD 3PGFH 3U9PH 5MERB 3ABZA 5GSVA 5E2WH 5ERWA 1XIWD 4OCWH 5GGVY 4GG6A 4DOHB 2JJVA 2P7TB 3BPCB 4WTWA 3SE9L 4X83A 7FABL 5HYIA 5IFJA 5JHDA 2HP4A 4JM4H 3ARBA 4LARH 1L7IH 3O9WC 5FYLD 2ADJB 3F12A 4OUUA 5T1DL 1P5VA 1WV7T 1RZ8A 4U2YA 3BH8A 3HNVL 3OWEA 1G7HA 1JVKA 4R97B 5H94B 3PWPE 5EUOA 4JLRB 2AK4E 1MFEH 4UU9B 4CJ1A 3F6IA 5DQJA 1VFBA 3VRLF 4F7PB 4PJHE 3MCKB 3PWNA 2E7HA 4FZEH 5D7LD 2CPCA 3H9SA 1D9KB 4I13B 4NSKB 3FRPA 1CG9B 4HJGB 2GAZB 4A6YH 1BEYH 3GHEL 1WWWX 3RVWC 3LQZA 3V79C 2FIRT 3MLSH 3FB5A 4MJIB 3SE4C 1CLYL 2WUCH 3C2SA 5JZ7D 1RZ7H 1LEKA 1KYOK 2LV4A 1T22A 4LSUH 1N5AA 4D9QD 1H5BC 2QSTA 5B3JF 5E9DA 5ITBL 3WKNA 1LEIA 1BHGA 4PTUB 2J4WL 1FYTD 3BN9D 4HFUH 1T66C 5FM5O 4GXVL 1HH9B 1FVDA 4RIRB 4YDJA 2PNDA 4NRZA 1QBBA 2VWEC 1VFUA 1AGBA 3GMPB 1TQBC 3H42H 3OF6D 3WN5B 3QDMA 3FT4B 5F70A 5E5RB 4CU7A 1V7NH 1EAJA 2DJSA 1DBML 3GMMB 5AG9A 2WQ8A 4D8PA 1MH5A 1NAKL 4G6AC 1RHHB 4LSQL 3MRDB 1EFXA 1T03H 5C2BL 5CJBA 5L9DH 4F8QA 1TZIB 4H5SA 5F44A 3VXSB 2R56L 3VJ6A 1JRHH 2VLJE 5HVHC 4M1DL 5HYQB 3WJLA 4Z0XA 2V7HB 5EOQH 1UB6A 5C0IB 1DN2A 4Q6YA 4XAWH 4R7NA 3PJSA 5DQDL 3T0XA 1MLBB 4Y4FC 3PL6C 3P77B 2QQKL 5KW9L 1MFDH 1CS6A 5C6PB 3VWKD 1IILE 4PGDB 3MLXH 1E4KA 5A2IH 1L7TH 4ODSL 1FGNH 4NIKB 4Y2DC 3VRLE 1DANU 3MPCA 5E2TH 4L8SB 1OT1A 2R23A 4U3XA 1EEYA 2IH1A 1JMZA 3B83A 2J6EL 4HK3N 5C08E 2FJHB 1EXUB 5I66B 2BRRL 1U3HA 2IF7A 3DROB 1LGVA 1GIGH 2Q7NA 2OQJA 4RNRB 1YJDH 4WY7H 2X7LA 3O45B 3G6JA 2UV3A 5KAQG 5BVPH 5FDWA 5IB2A 3PXJA 4K3DH 2XNAA 1D3CA 3D3VA 4KQ4L 3VRJA 3EIFA 4Q2ZB 1KN2H 2K3TA 1K3ZA 5A2FA 3MRHB 3FAXA 4S1SH 2AEWA 1H3XA 3LH2H 3ZKMD 3TA3B 4X7SL 1T4KA 5ELIA 2R2CA 3F5WB 2DJUA 2D9QB 4L9LC 4ZXBA 2AAVA 4K9EH 4PJ9C 1B4JH 4KK8D 2VDML 3QHFL 4Z78A 4YBHA 1NDMB 1RUAL 1YQ2A 1X5GA 4YHNA 1NL0H 1A6WH 2PW1B 3ZKNC 4PRNB 4P2OB 1WBXA 5LBSL 1F8TH 4K7PY 4DGYL 4Z95H 4HQQH 1QSED 1PBYA 4F80A 3C5ZC 3HAEB 3U0WL 2H8PB 4L8BA 1A9BB 3CX5J 2WIMA 3TYGL 4PYHA 3WS3A 3JTTA 1YPZE 4GG6F 4F7EB 2FEDC 5FECB 2NY6C 3BJLA 3CZFB 5KBNC 4JDVB 3K2MC 5EOTA 5MENB 1J5OH 5KVEL 3OZ9H 1D5ZA 2MOVA 4CBPA 3MLYL 5L6YL 1X6NA 1WTGT 1HIMH 4P2QE 2D7MA 5L2KA 3TBSB 2MKWA 3PQYD 2HJLB 1S78D 1H3VA 4PRPA 1CT8B 4M5YH 2UYLA 5I76A 2GIYA 3ZYIA 1NFDF 1KJ2H 1UZ6F 1JNLL 3CFCH 3WFHB 4NQUA 3VGDA 1T80A 1X5IA 4YHKH 1NFIA 3QCVH 4HUUB 5D7JC 4DW2L 2CUMA 1LO3H 3HZKB 2OP4H 3EHBD 2W9DL 2W1NA 3W9DB 3ARFC 1JNNL 3IU4H 3NABL 1JWUA 3QNYA 4KQ3H 4BH7B 1NMCC 3HUJB 3IDGB 4A6YA 3QI9C 1JNHB 4OFYA 3RP1A 2FDBP 1R3KB 5C0CA 3HCVB 1G9MH 1G7IB 2DQFA 2XQBH 3KPNB 1HH6A 1CFSB 3LKSB 4K7FB 4W6XB 1UWGH 3T2QA 4ZUSB 1CQKA 4HS8L 4I3SL 4UDUB 5LAXA 2VB5A 2VLKD 1CE1L 2EDOA 4FFZL 4GO6B 5B38G 3SDXB 4I3RH 4NJAH 2ZUQC 4EN3A 4YXLH 3L5XH 4XMLL 4NT6A 3U7YH 2H2SC 4QHMA 2ESVD 5IIEA 1AXSB 4GG6E 4P23B 2UWEB 4OB5H 4LSVH 5EU6D 4RISH 2BRQA 5JHDE 3EUUA 1SJEB 3P0VL 1AI1L 4WHDA 1C5BL 2B2XH 4WW2C 4OD1H 4S1QH 3O11A 3CLEL 4JFZL 4QRPB 4S1DD 3O8XC 5ALBL 5IFHH 2VDQL 3HZVB 1MHPH 1N7MH 2PF6A 1GSMA 1AHWB 1V3JA 4AYFA 1XCTB 4NQEB 1N3NB 1SM3L 5EUOE 1U36A 4F2MA 4IIQC 4JHAL 4OGAD 5DS8B 1MAMH 1UZ6E 2Q76A 4HCRL 7FABH 4CVUA 4CDHA 1KT2B 4YHML 2B8OT 1EFQA 2R1XA 3O6FC 1DUYA 3D87B 3VA6A 3NCCB 1VPOH 1XF4B 2W0FB 5DRWB 1T89A 2ED8A 5HI3C 3MYJB 3G6JF 1J9CT 1DQQA 2XOTA 3EYUL 4KMTL 2AERT 2FL5B 3JV6A 2I5YH 5IWLC 1MJJA 4N90D 1MRDH 2MNUA 1AO7D 1MIML 1OCWL 4JVWA 5CHNA 1MCIA 5L7XL 2CRZA 4ETYA 1DTUA 1YN7B 3H7BB 4LEOB 2A74B 4MS8A 1MOEA 1V05A 5B39G 4OKVA 5J8OA 3QDME 1SJHB 3B8SA 1NANI 1CLYH 5FUOH 1BREA 3WO3B 4LLAA 4WI5A 4PJAB 3MJ9H 5DR5L 3RIAK 3QJFB 4GAGH 2X42A 3HPLB 1T1XA 4RMQA 4WHTB 3MREB 2NX5A 2J1KA 3BEVB 1KB5B 2FGZA 3EJYD 3GB7A 3H3PL 3RZWA 1Z9LA 1QKZL 3IFNL 3HHRB 3ZHLA 1TVBA 1AP2A 3H3BC 5F7HA 3VFRA 4JRXE 4N1HB 3IDXH 4NC1E 3L7EB 5EG6C 3ARED 4JN2A 1OTUD 5D8JH 1FVCB 3FQTA 1CGWA 4CAGA 2DKUA 3BKJL 1DBMH 2NQCA 3MLUL 1CGSH 1NAKH 5FA4A 5A2LH 4ESKA 4G6FD 1JHLH 4BA8A 4LSQH 1CD0A 1NCBH 4QEGA 1AGEB 4LCIH 3DV6A 5C2BH 5C09B 3BZ4B 4M3JA 3CXHJ 1XZ0B 2NXYD 4MXWH 4PD4J 4RAVA 1LD9A 5DK2A 3T4AB 4ORZC 1MCCA 4Y2OA 5IHZB 1KUMA 4X7CC 5F6HI 1OGAD 1FZOB 2Y7QA 2YRLA 1V3MA 2CLRA 3NPZB 1X3DA 3H7LA 3TIEB 4R2GC 3I6GA 4F33B 3D25A 3ZTNH 2DBJA 1RIHH 4OF3A 5GRYA 2QQKH 4JJHA 1IQDB 1SEQL 2YN5A 3G6JE 1ZLSL 2Z92B 4POUB 1JF1A 5AZEH 3TO4D 1JGLL 2IBBA 3ARPA 5GGVL 4PJIA 1KJ2A 4BFBD 1M05B 3D3VE 2NW2B 4BQCA 4G9DB 3T0BA 4PJCB 2R39A 4JRYD 1KCVL 4G80A 3BW9A 4QOKA 4OGXL 4ZFOB 5C7XH 3QUZA 4R90H 2AKRA 3FMGL 2C7UB 3O4LB 4ELMB 1T1YB 1R3IH 2BRRH 4F3FB 1X9QA 5A3ID 3ULUF 3DRTA 3BP7B 4JZOB 4P4KD 4ZPVB 3GMRB 5DD5H 4KRPC 1NH6A 5FYKD 1K4CA 5T5FL 5DD6B 1BD2B 5DUPH 3RX5A 1F90L 3E8UH 5DJAB 4JAMA 1T1WA 1KOAA 3KXFB 3D0VA 4WGVB 1T1ZB 4MAYB 5BS0B 3KHOA 5JZ7C 5ACMA 2W65A 2EKSA 4PLKD 1GGTA 2F54B 3RY5A 4PTTB 1T0NB 5C0BA 2D7QA 2VDLL 2UUDK 4KUCF 3QHFH 3HAEH 3R06B 1T2JA 3BN9C 1MI5A 4JY5L 1K4DA 5F1KC 4ZO6A 5DFWH 1PLGH 4TRPL 3GO1H 3QDGD 1KG0B 5BJTA 1X5ZA 2AXFA 4AG4H 3TBYB 4DGYH 4IRSD 3SGKA 5CBEA 3KLAB 2R0WL 1T04B 4WV1C 4LK4A 4PRPE 2P7TA 2BSTB 3BPCA 5HHOB 1RMFH 5DT1L 1JF6A 5ESVA 3LQAL 4WFFD 1NANH 4U1MA 6FABH 1MJUH 3MACH 4LCCC 2R4SL 4YDVB 5HYSG 2DWEA 1RY7B 5HGAA 3SE3C 2ADJA 3MJ7B 4JFPB 5BMFL 3MRPA 2W60A 5TE7H 2AK1L 3BPOC 4PP1D 4LHUD 2E6PA 5IJVB 1A6VL 5KVEH 1WISA 5TF0A 4U31A 3WFEL 5L8JB 5J4MA 4JLRA 3NN8B 4UU9A 4P3CH 3GSXB 4F7PA 3P9WB 3RGVC 2VXQL 3MCKA 1A47A 2WQRA 1MHCB 1XFPA 3Q5YA 5C0CE 2O5ZL 3GSOA 5C0JB 3ULUE 1D9KA 5IG7B 4LVOB 2GAZA 1NC4D 3WNPA 2E8ZA 1FFQA 1TPXB 2YPVL 2D7PA 1FIEA 2K7QA 4ZFGL 1T0MA 1FZJB 2VZSA 2CO7B 1CGVA 1JNNH 3NABH 3RA7L 1MAJA 2BVTA 4PTUA 4E9LA 2C5DC 2JELH 4W4NA 3M8OH 4Z77B 2DYPB 4ZS7L 3LRGA 5JPMB 5H35B 2PXYB 4PRDB 1DQMH 5FKAA 5DFVD 2ZOLA 4HWBL 3GMMA 3DUUB 4CVZB 5FYKU 3D69A 1E4JA 3B2VL 1MIEL 3MRDA 3DMMA 5DFTA 5ICYB 4FFZH 1TZIA 1BQLH 4FQQB 4YIQB 4OUOA 1SYVB 2E7BA 1S7UB 5INDB 3SDYL 4PJEA 5F1OB 2GUOB 3VGBA 4JDTH 1N8ZB 1LO5A 1UXWA 1IBGH 3L3KB 2V7HA 2DIBA 5C0IA 3IAQA 3D85D 2A6KB 3SCMD 3WSQL 1MLBA 4JFZH 1A7PL 4BK4A 4RMWA 5ALBH 2NY4D 4NN5B 4PRHD 2VDQH 1EV2E 4LGRB 4WO4D 1ZHNB 3VFMB 5F72S 4OZFB 4K94C 3P4NB 4ZPTA 3MODH 4GH7B 4HLZG 1KCRL 1SM3H 1WT5C 4L8SA 1BBJA 5HTSA 1WWBX 5EDXA 5K9QG 1O7SA 1RD6A 3GM8A 4PJIF 5HYSB 3NZ8A 4WJ5B 5IBTL 3O6KL 1FQ9C 4HCRH 5IBLD 3RZCD 4YHMH 3GIVA 4QXTB 5JIHA 1T5XB 4F7TB 1OAZL 3X14B 1P5UA 3BAEL 5HHQA 4RNRA 1UH4A 3ULSA 5DEZA 4B50A 5FO7B 4LLQB 5GS0H 2E9IA 4J3XA 3ZE0F 1CLOL 5C07A 4Y4HC 5C0AB 2NX5E 4KMTH 4Q2ZA 3KPSB 3AMKA 3EHBC 2VLMD 5E7FA 3MRHA 1QRNE 2HFFB 5JXAH 4M4PA 1A4KB 4XCCL 1MIMH 2PYFB 1J18A 3TA3A 3QFDB 5JIIA 3F5WA 4UT7H 4PB9L 4YZFF 1KB5H 2DQCL 3BPNC 1KTLB 4NQVB 4PJDB 3S4SB 4TN9A 3QQ9C 5C71A 1P84J 4AL8L 5HGGS 1NDMA 1CDJA 5IHLB 1P7HL 3MUZ1 1EZVY 3LEYH 4P46A 4KHTH 1RHFA 4PS4L 2PW1A 2YUZA 3GI9H 4PRNA 3CFJB 2NY5L 1EO5A 2FGWL 5DMIL 2DM2A 1BWMA 2ARJA 2ZSVA 3BVNB 5AZ2H 4MLIA 4NZUL 4R26L 3Q48A 3HAEA 5E8OB 3LEXA 3IFNH 3P4OB 1GAFH 4QRQB 3PV7A 1QR1A 5D1ZD 5IVZB 3KR3L 4DTGL 2ITDB 3QXAA 2DBLH 4ODXB 1IAOA 4GKSA 4RWHA 2DTSA 1H8NA 3ZKSD 1INEH 3MLUH 1ZA6A 3I3EA 2X70B 1KEML 4LCWB 1OWWA 3SDDA 3ZT6A 3W2DL 1IL1A 5EU7C 5FK9A 4L5FL 4FTVB 4PJIE 4GBXB 3FKUS 3WUZA 5CJQL 2XZCL 4LDEB 5CGMA 3G5VA 3UTTB 4QOKE 4DZ8B 4QTIL 1EVUA 2PTUA 3KPPA 3MV11 4BZ1L 4AQ1B 2HH0L 4Q9RL 4LKCA 4AMKL 1SYSA 3VH8G 5E08L 4V1DB 4GMSH 1OW0A 3BKYL 5FHBH 1NCDH 2EKJA 2EDFA 4BFEA 1YEFH 3ZE0E 1U3YA 1KCSH 5HYJA 5JHLH 3MUGB 3WO4B 3W9DA 2NY2B 5GGVH 1I1CA 4BH7A 1F6AB 1TFHA 3IDGA 3IJYA 2AK4D 5EOCH 4PBVC 4DCQB 1ZLWK 5I1AB 4KPHL 4R4BB 1G7IA 4YZFE 1X4XA 1X5XA 3KPNA 3WXWH 5C9JB 3AC0A 3SDCB 2IGFL 5T1MB 3QUXD 5C0BE 3L5HA 3OKMA 1CFSA 4Z7UE 4HT1L 4PY8J 2XICA 4AH2B 3T2PA 3KYAA 3PP3K 1L0QA 1MI5E 3RJQB 3MZGB 4LAJH 4EDWH 1CD1B 1M4KA 1XGUB 2SEBA 4Y5XA 3NTCL 5D2NB 3IS0X 4GOSA 4MVBD 1QVOB 2FO4B 2XTJE 3TNNA 3VG9C 1AXSA 1EGJH 3BDBA 5IB3B 1V8HA 4P23A 3WXVL 5A43C 3BOVA 1FO0L 2GSGB 1F6FB 3HS0B 1J8KA 5DMJB 4PJEF 3EJYC 1UG9A 3S34H 1SJEA 2D2OA 2R0ZL 4DKEL 1FCCA 2WBJC 4NQTA 4ZUTB 1RIVL 5TE4L 4HK0B 4ZAKB 4RX4D 4P3DB 1BJ1J 3HN3A 1AHWA 1FL3B 3MSPA 4WHYG 1IC1A 1N3NA 4KK6D 3BZFB 2ARWA 2IPTH 4U6XB 5DS8A 3TFKD 2CGRH 2V9TA 3H2WA 3WFCH 4WIQA 4E42B 5DT1H 3TEUA 2EZ0D 2XKNB 5EN2A 1KT2A 1U2CA 2EIZB 2JJWA 3BKCL 3C6LC 2ZUWA 2HKFL 4HV8B 1ZV5A 5F7WC 1FH5L 1IQWL 5JW5B 3OR6B 2CK0L 3QAZC 4HGKC 1CICB 4GRLD 3DSNA 4MJIE 1T21A 1F42A 1RULL 2X1XR 4X0KA 5A2KH 5I1KH 4U05A 1XF4A 4F9PA 2MKLC 1A6VH 4HCRA 4MDJB 1I8MB 4XWGL 4TTGA 4KK9D 2FL5A 3C60A 2VXQH 1R3HA 2JIXA 3FFCD 3TO4C 2O5ZH 4WTZG 1QHPA 1A1NB 5C0ND 1D5BB 5H2BA 4NPYA 2A74A 5MEQB 2XXMB 3NCYP 5CFHA 1SJHA 3L3HB 3FJTA 4BJLA 4ZFGH 4M8QA 1OAQH 4CVXB 2DM7A 4YEEA 5IOPB 1K2DB 1T0PB 4HFWA 5CD3A 4JFFD 5A3IC 4D0BA 4Y1AD 4XCFH 4WHTA 2EYTB 3ECBB 5BOZG 4MSWB 3MRFA 3RA7H 1YMMB 4P4KC 3BEVA 4HZLB 2XACC 5CSBA 2AJXL 3QG6A 3VI4F 4HIEA 5FV2A 5GS2D 1FNGA 1J86A 2FO1A 2MQ3A 2F15A 2CO6B 3RWEB 1YECH 5EPMB 4QF1B 1AIFA 4WU7A 5FKPB 1YQVL 5IMLB 1H3PL 5K9QI 35C8L 3MFGB 2ZPKL 1FGVL 3CLFH 3L3DA 4XI5D 12E8L 5C0DB 4FQ1L 1S7TB 2HT2D 2G5RA 3EDFA 2XWTA 3B2VH 5TF1L 3O2VL 4PGBB 5C09A 3BZ4A 3VXQB 1XZ0A 4JGMA 1BVKB 3FOMA 4Q74A 3SDYH 3VFWA 2AEQH 4PRBB 4QXGL 1QHOA 3AAZA 4OZFH 4KJQD 1F3JA 4NQDB 4C4KO 5I8KL 3TIEA 1YUHA 2AQ2A 3O3AA 2AJVL 1KV3A 2YSSB 1BX2A 1KELH 4HJJL 4K7PH 1G0YR 4N5EA 4G8GA 1C5CL 1IQDA 2ERJB 3GSUA 4LPTA 5ESQB 4UUJB 3U4BL 3UC0H 1TCMA 3IAGC 2DMBA 3CU1A 1IGML 3AY4A 4D0CA 2NNAA 1KJVB 3BEWB 5C07E 1M05A 2QHRH 1S7QA 3BYTA 4G9DA 2V2XB 4PP1C 4JFQB 4WTXA 2CRMA 5CJ5A 3RRQA 1UJTA 4ZFOA 1X5JA 3FQWB 4G8EB 3VXPB 2ICES 2C7UA 3O6KH 1A7QL 4ELMA 4JQIL 4HXAL 5E6ID 1AGFB 1OHQA 4F3FA 2FD6H 3BAEH 4ZPVA 3GMRA 1TENA 2OR9H 5DD6A 1ZLVK 4FP8H 3T77B 1ZSDB 3I85A 1F58H 1CLOH 1I7ZA 1TITA 4UTBL 3KXFA 1G6RL 4MAYA 5J89A 5BS0A 4M9OA 4JFED 2CRYA 4XCCH 3OKYA 5IMOB 2VLLB 2JK5A 4CGTA 5F8RC 3QNXA 2CK2A 5JOPD 1YEKL 1BQHA 2V5YA 3R06A 3TT1H 1WFNA 5JOEA 2ZG3A 3ROOB 4OV5B 1JV5B 1N4XL 2ZSWB 1NCWL 4X6EA 5MENE 1Q0XH 3IFOA 3P11H 1KG0A 3RHWK 3IKCB 3TBYA 5DFVC 1OLLA 1INDL 1IGTB 1M7DB 3KLAA 1ZLUK 3V4PH 4R26H 1KLGB 3KYMB 1T04A 4S11A 3GK8L 4TUJB 4MNQA 2QEJA 3DI2B 1KPRA 2PO6A 4KUZH 4XVUD 3DX8B 4ZSOB 1I1AD 4WI7A 4UQ2A 3A6CH 5KJRH 4ODVH 1UA6L 2V2WA 4O2FB 4TUOB 2EIDA 4Z7VB 4QRRB 4OD3H 1J0JA 4YDVA 5AWNL 1MJ8L 2QV2A 4HXBH 3C5JA 3EOBB 5SX4I 5ICXA 2H1PL 1MHEB 5CD5D 1OP3K 2DKMA 3MOAH 5HYJE 1KIQA 2NY3D 2RR3A 4X9IA 4L4VB 3SCMC 5CJQH 5GS1B 3NN8A 4MDIA 5CJ8A 4JKKA 5FYJH 2DQEH 2CLZB 2E9JA 4GKNB 5SWZA 4BZ1H 2ZNXA 1FFPA 3UTQA 5F9DC 3DPBA 3MJ8B 4NN6B 1J0IA 1MREH 3U7WH 2CDFA 3MRRB 4W6WB 4XX1E 5D2LF 5GZOD 3NGBB 3MRIB 1J1XH 4XNUL 1F97A 5MHSD 5EBMA 5HD8D 4ZNCD 1DQJA 4XGZB 1IC5H 3TBVB 4XNYL 5KSAB 1C7TA 1W72L 1XH3B 3U4EB 1A6UH 1QFWI 3HFMH 4KPHH 4LSDA 4JN1L 4ERSL 3QULB 4FQIL 4U7SA 2VABA 3RWJA 2JJSC 4HKZB 4LIQL 4LNRB 4ODBD 3TZVA 1U8OA 3PABB 3FOLB 5H35A 5E8DL 2YXMA 1J88A 2HLAA 2ENYA 1DUZA 4FRWA 4QRPE 3DUUA 4M1CD 4P5TC 1OB1B 4HF5L 4APQD 2CKNA 4NFCA 3IF1B 1YA5A 4Q6IC 1YYML 5IB1A 5FOBB 4MXVE 5MI0B 1PY4A 4JFDD 1RI8A 1SYVA 1FBIL 3RDTA 5FCSH 4QGTA 4HWBA 4J3UA 4XVSH 1J8HA 3V6OA 3JWNC 3SDAA 4NGHL 1U92B 4JRXD 3IFPB 4IM8A 4JKLA 4U3HA 4DKEH 4POYA 5TE4H 5EU4B 3QIUB 1DN0B 5D1ZC 4OZFA 1JGEA 3P4NA 2HN7A 4RA0C 2LU4A 3QDJA 4Z7WB 4YWGL 3PWJA 1PZ5A 2D0GA 3GRWL 1OTTD 1OP5K 5IHBA 4YFEA 2HFGL 3PGCB 3O6LH 3FQNA 1GHFL 1UM4L 5IFAL 5F21B 3MV7D 3BKCH 2HKFH 1UJ3A 3WDHA 4NC2B 2BNQD 4DKFH 1FZMA 2DLFL 2JF1A 5M94B 5I8CA 3KPLA 4PRIA 3U30C 2VXUL 4O5LL 5FO7A 3LKPB 5T33H 3STZB 2LVEA 4NO5B 2M1KA 3KPSA 3TT3H 3PGDB 5MEPB 1HHJB 3WD5L 2HFFA 2XZZA 3LKRB 4YXHH 4MWFB 1A6ZB 2PYFA 1AQDA 2RCSL 3QFDA 4JM2B 5SX4H 1KTLA 4NQVA 4PJDA 4WUKL 5FYLL 3CXDL 4CUCA 1AC6A 5BV7B 4RAUA 3D39A 4U1HB 1MFCH 2HMID 4XVJL 3QPQC 5C09E 3RAJL 2ZJSL 5CZXD 3HI1A 1FNSL 3MA7B 3QRGH 1KIRB 2XZAH 2A73A 3SE8L 1YNTB 1FL5A 5IVZA 1KPUB 3X12B 3ZSTA 1ROWA 4ODXA 2N7BA 1F4XL 2KQMA 2RIKA 2YBRA 3CSYA 1EO8L 1YYLH 4J4PC 4G3YL 4UQ3B 1S7SB 2X70A 4G8GE 1QOKA 1QFWH 3TN0D 4QHNB 4FTVA 1JPSH 2LU7A 4GBXA 1AKJD 1UCTA 2EDHA 3KJ4C 4EUPA 4WHYH 5SX5K 3IDMB 2WV3A 3UTZA 3I9GL 1HN1A 4XNMA 3UTTA 4EI5B 4ELME 1UENA 2DQUL 2AJVH 1T7XA 1I3RB 4V1DA 3P2TA 2EDQA 4HJJH 3ZL4L 3T1WA 3PUCA 1YMHB 3HTLX 5SWSB 1C5CH 4FQXC 5JW4N 2EZ0C 2VN4A 1DSFH 1NC2D 3FT3B 1MRCL 1TJIL 1QR4A 3KJ6H 4W4OC 2IAMD 1GGUA 1IGMH 1OLZA 3S35H 3KXFE 4BZYA 5BS0E 3AUVA 2CKBL 3P4MB 3OHXB 1EHLH 3J8F7 3DVIA 3MRJA 4F15B 4GAFB 4KV5E 3WKML 1NBYA 1E4WH 4AH2A 3K8KA 3KPOA 4PY7B 1F4WL 2CKBB 3O9WA 5CUSH 3N85L 4EQ2A 5C0NC 3UP1A 4OLUL 5I8OL 3UTPD 1XGUA 3UAJD 1B6DA 1UH3A 2Q8BL 5CP3A 1QVOA 3FQRB 4NBZB 1NGWA 1EMTH 2FO4A 4MNQE 2X41A 1FSKB 5IB3A 5SWQB 4I5BB 4LFHD 4BH8B 5CZVL 1T83A 5HHOE 2FX8H 1ZT1A 4NWTL 3S96B 4UV4H 5CILH 2C1OA 4OFDA 2C4FU 2VR9A 1U3ZA 3BE1L 3FQXB 1JYWA 1NFKA 1QBML 3T3PF 3V0AC 4ZAKA 3SE4A 5EZIH 5EORH 4P3DA 1FFNB 3MLWL 1BM3L 1EPFA 1FO0A 3IXAB 1XGPA 5FXCH 1TJGH 5MP6L 4NN7C 4J8RB 3BFOA 3BGFC 3HE7B 2HT2C 2OI9B 3OKKA 4O2EA 2X4SB 4E42A 1K5NB 1ZT7A 5SWZE 4NNXB 5GGQL 4HV8A 2VR4A 4M7JL 3MROB 4TNWK 3DYPA 5T3ZL 1DLFL 3OR6A 4XHJD 5CLWA 3CIQA 1MCHA 4PJ7F 1GL4B 3CH1B 4XNZC 2H1PH 4C4KT 4KWUA 1VADB 1KTKE 1TZGL 4KKCC 5DVOA 1NBZB 3IVKB 3KLDA 5F9JA 2XA8L 1I8MA 3OQ3B 2X4QB 5I74C 1RUKL 5K59F 2ITCB 2NZ9D 3AB0B 3TJEL 4R4ND 1D5IH 3GJFB 4K94L 3FT2A 1BLNB 4X5WB 5D7IB 1C7SA 2BCKA 3ULVH 3U82B 5MEQA 1QLFB 1QSEB 1IM3A 4YFLI 4J1UB 3WS6A 4D9LH 2FJFB 1UM5L 2R15A 4Y4FA 4XNUH 1MCNA 4NKDB 3SJVD 4CVXA 5IOPA 3NH7H 1K2DA 5E6IC 2KUTA 2QR0A 4LRNH 2EYTA 3ECBA 3S37X 4M6NL 4Y2DA 4HZLA 4X6CA 1SBSH 3B2UC 1QRND 5HDBE 4AIOA 2YD3A 1WZLA 4HH8A 4X9GA 3DYOA 2JKXA 1J8HE 3V6OE 5KVFL 5GRUL 3P73A 4K3JL 2C26A 2VKWA 3PNWB 5FKPA 5CJOL 5EZJA 2R2EB 4M4RA 2ADGB 4NM8L 5GGUB 4AY0A 4IHOB 3M17A 2Z31D 1JYNA 5HHPA 4P9MH 5C0DA 3SKMB 1JGUL 3F7YB 1S7TA 4RMVA 4HF5H 1B2WL 3GSNL 2B1HL 5LXGH 3W81A 1ZTXL 1YYMH 1DR9A 2HVKB 3QDJE 5I15H 4MX7B 1FBIH 4MQ7A 1BVKA 1YDPB 4U1KB 3CJJA 1GC1C 2FIKA 1HYRC 4ZO7A 2YK1L 4NQDA 4ZFFB 1JN6A 4XPTL 4OCRL 2B39A 3BIKA 5B8CC 4L9LA 4ZUWB 2APVA 1N5YL 4GXUN 2LABA 2P42B 2GTZB 3BESR 3LN9A 4XVUC 4PRIE 2P8LB 1I1AC 5D1QD 3GSQB 3IGAB 1CZ8L 5K59E 5DJDB 4A2MA 1KJVA 1U58A 3EGSB 2CUHA 1AY1L 5C0AE 4FXKB 4L4TA 1A02N 2DQTH 2VXTL 2V2XA 3KPSE 1C5DB 2HFGH 3MRGB 1KF9B 5IKCB 1LDPL 3C5ZA 3FQWA 3C2AL 1I7RA 2X89D 1RK1A 2NY3C 3DUHA 1X6LA 1S9XA 2XWBA 4X4XA 5EWIH 1PG7W 1WGOA 3PDOB 1A14H 4PJDE 2DLFH 3Q1SH 4R8WL 3UJIL 3BSZH 3OGOE 4O5LH 5IEHB 2DQJL 5IT2L 2XA3A 5EU6B 3BIAX 5F1NA 4JREB 5F7EL 5I75C 2A9MH 3DV4A 5SV3A 3T65B 3VGAB 3CFKA 4XB7A 3K2UL 1RZJC 2FLRT 2BJML 5IMOA 1UFUA 4RGNE 3NFNB 4Z5RB 1ZAGA 5C70A 3QQ3A 3MNVB 5EO9A 5FYLH 4LDLB 1G6RA 5JO5A 5BO1L 1NBVL 1QLRB 3EO9H 2CIIB 3ROOA 1WWCA 2YD1A 5HHMD 3DX6B 4U7MA 3CFEA 1BJ8A 1FNSH 3ARFA 4FTVE 4IMLA 1IGTA 3HMWL 4O4YH 4OT1L 4G42B 3SE8H 1WZKA 4APQC 1IFHL 2X05A 3UTTE 2FX7H 3BPLC 1MHHA 3K1KC 5BZDB 4XMKL 4H20H 2XI9A 3LSOB 1Z5LA 5E2UL 1MRFL 3OJDB 4V1DE 1CL7L 1EO8H 3IJHB 1TTUA 3S5LB 3PHQB 3CFDB 5J6GA 3EOBA 4I9WD 3BRDA 2X4RA 4NC1C 3VXMD 2Z93B 1RFDL 2OMNA 2V5RA 4RFNB 2ZOKB 4BZ2L 4MZ2A 4YHYC 1P7QB 1XF2A 2YN3A 3UZVB 4I0PD 5DTFA 1R0AH 4GKNA 2CLZA 4HPYL 1P4BL 1WZ1H 1FNLA 4GKZB 2PKDA 1OTTC 1EUUA 3ZL4H 1R5WB 4YE4H 4MJID 4WW2A 3W39B 4Q9QH 1LHZA 3O8XA 3F7VB 4B0MM 2DD8L 4JO1H 5F6IC 1U3HC 4AEHH 1HQRB 5DD3L 5KSBB 4I18B 3CXHK 5CINL 3TBVA 3I50L 3CDFA 2CKBH 5F89B 3U4EA 1U95B 4IIQA 1IAKB 4X6CF 4KZEH 2YD5A 3RNKA 3I6LD 2BY1A 1Z2KA 2VIRA 1PQZB 3QCTL 1IE5A 2EICA 1K85A 1AGCB 2NXYB 3P4LA 4X4YB 1VERA 4CMMA 1W72A 3QCUH 3WDJA 1RU9H 4M6OL 3SHSA 5D70L 1D6EA 3O6FA 1OGAB 1OB1A 3VRIA 3OX8B 5DO2D 3UYOD 5FOBA 1I3GH 5JW3L 4EQ3A 3VXSD 3OJVC 3QH3B 4POZD 2Q8BH 1M1SA 5K9KA 4AM0B 4PR5B 2HMIC 3D9AL 4GXUM 1A6TB 4LKXB 2HT4D 5DQ9B 2BK8A 1BFOB 1U92A 5EH1A 5CZXC 3IRPX 4NWTH 4OAWA 4OLZL 5DI8A 1A7OL 1JK8B 3Q3GA 4ODHL 5D7SL 3V4UL 1SY6H 4HWEH 3BWAB 2CMRL 4JRYB 3MXVL 5FYKL 1G0DA 5EU4A 2J12B 1DN0A 4AEEA 2YZ8A 5E8EB 3OKLB 4N0UB 3ZE1E 4JANB 3RVTD 4KRNA 3L9RB 3OAZH 2ZCKH 1G7PB 1QSVA 3PGCA 1V7ML 4WFGD 5LCVL 2VL5B 2JCCB 4MA1C 1HINH 2XT1B 3F58L 1XGTB 1B0GA 3WIFB 5DHYB 3BXNA 1A4JB 4RGOL 4UDTA 1MY5A 5TQ0H 2BVOB 4GAYA 4KY1L 1NMBL 4PREB 5DJ8B 4HW6A 5HJ3A 3RVUD 2Z0BA 3GJFH 3EDKA 4D0DA 5DVNA 5J11C 4ISVB 4MCYA 3GM0A 3LKPA 1FP5A 5KVGH 2XA8H 1EDQA 3GIZH 3GKZA 5BCAA 1YMME 1RUKH 4NO5A 4JFYB 5MEPA 5DD0L 1FDLL 4OLXL 3TJEH 1KFAL 2B4CH 5DYOB 1A6ZA 3GSRB 4B5EA 3JTSA 4IRJB 3ZLQC 5HPMB 4IRSB 1A0QL 4L1HA 4JY4B 1X5LA 5GGTH 3ARSA 2BXZA 4U1HA 1XIWA 3U4AA 2CDEB 1S7VA 1CL7I 2O5XL 1TNMA 3ARGB 4P2OD 1T6WA 4OD2A 2F5BH 2VO5A 1XGRA 4JFXB 5I71C 4JPWH 5CBAB 5DD1L 1YNTA 5KVFH 5D72L 2G2RB 3UAJC 1BZ9A 3BHBB 4K3JH 4NQDE 4BUGA 1VSCA 3X12A 2XQYG 1YEIH 5EO0A 4G5ZH 4LCUB 1TCRA 3KPMB 3LKNB 2PW2A 3IFLL 4UQ3A 4GSDH 3V5KA 1JGUH 5H37G 5D7LA 5IVXB 2G75A 3WLBB 3MOBH 4XAKE 1R5VB 5MEND 1FIGH 4HKJB 2NW3B 4QHNA 4OI7A 3AVEA 4OQTL 3RTQD 3FB7A 2MPAL 4YAQB 3IT8D 4ZDHA 3V7AE 3CVHB 4CU6A 4Z7QF 4NHCL 1OSPL 2EYSB 3LVEA 4OBSA 1NGQH 1I3RA 1YC8A 1SMOA 1FNHA 1FORL 1PX4A 1MCEA 4H0IA 1N5YH 2OXGA 3QXDA 4JJ5A 1FYTA 1X7QB 2X4OB 3A0OA 1Z0NA 3QYCA 1A5FL 1HSAA 4WW2F 2PYEB 4XHJC 2UVEA 3BH9B 3OF6A 3CGTA 1X5AA 2KDGA 2AW2A 1UEYA 3ARDD 3OHXA 1DBJL 5J6HB 5DJ6A 4HUXA 1KIPB 2BOBB 3UTSB 4JQVA 5TPWH 5J9PB 3C6SB 1ZGLB 2Y1VA 4LCCA 1YJDC 4R8WH 2CKBA 3SE3A 1BFSA 2R1WB 1ACYL 4YQXL 1A22B 1HDMB 2X44D 2FYYA 1N0XH 2DQJH 3M1BA 3BX7C 5FGCB 4MS8C 2I9TB 3EOTH 5DJ0B 5F7EH 1F13A 2N4IA 4YHLH 3FQRA 5HI5C 2Y23A 1J0KA 2OX5A 1DBBH 2NY4B 5SWQA 4KTDH 3VWKA 3L3JA 4WO4B 4X8JB 4MMXC 1H3WM 4JCMA 3L5JA 1BF2A 4K9EC 1QA9A 5BQ7B 1RURL 4Z7VE 5E8PA 1J11A 2C3HA 5LWYL 3V5HA 2E3VA 1NBVH 4QRPD 5I16B 2CSPA 4C55A 3QZWG 1FFNA 4Y5VC 1R5IA 3RZCB 4OCXL 3LOWA 3R1GL 2I27N 3QUML 1OF2B 2IBZX 4HUVB 4NQED 4F7MA 3S36L 5DJYA 4PJBB 4U1LB 3HMWH 4WI8A 4LSPL 3NZHL 4OT1H 5JQ6H 2A38A 5L0QC 1MCRA 3HKFA 4LASL 4KK5D 4GJTB 5TQ2L 5E2UH 2E9WA 1MRFH 3DRQB 4WFHD 3MROA 1TVHA 1CL7H 1WBZA 2X9XA 3MJ6A 1ZEAL 3G9AB 1OPGL 4OCNC 3P30L 1I7TB 2P8MA 1CLZL 4YLQT 1IKNC 4O58L 3U83A 1VADA 3L3IA 1QACA 4UINL 3AM8C 4YDKL 1NBZA 1P7KB 3QEGL 4OM1L 3SPVA 1MCOH 2BY0A 2JLLA 3ULVE 3FO2B 1S9YB 4HSQA 3S6CA 5D1QC 3OXRA 3L3GA 3MUY1 4JZJC 3GJFA 3QB7C 4X5WA 3FHQA 4CL7A 2VMFA 1QSEA 4J1UA 3OSKA 5I1DB 2D3VA 3AS1A 2FHCA 2YKLH 4NKDA 2ADIB 2GJ6B 4LIQE 5DC4B 3V9FA 2F8OA 4IMKC 5CIPB 1CE6B 1KN4L 3NCJL 4G8FA 1ORQA 1I9RH 1WT5A 2WIIB 1G9MC 1YY8A 1WIUA 4U6HB 3OKEB 3VU2A 3QCTH 2W9EH 3PNWA 2Y6SD 5TFSL 4OIAA 1MVUB 2R2EA 5GRXG 4IHOA 4YX2L 5DC9B 5C3TA 3GSVB 1RZFH 1T7YA 2H26B 3PQYA 4G6ML 4QGYA 1J1PH 2YD7A 4DGVL 2DQDL 1ZHBB 1DEDA 3SY0A 4V3DB 4LCYB 2BSED 5JW3H 3CMOL 4O02H 4Z7WE 3PWUB 3ARRA 4KKNA 4J6RL 5BRZB 5HVHB 4MX7A 2J2ZA 3ISWA 5DK3A 1GXEA 4DN4H 3IDJB 4FQCL 5AYUH 3GSNA 4HUWB 1S5HB 4ZFFA 5KOMC 3TH2T 3SGKC 2J8UA 2HLFD 2LFGA 2XRAH 3QZWB 4XP4H 2K7PA 4ZUWA 5GJSH 1A1OB 1XMWA 1I7UA 3PE9A 5FYKH 5DLMH 3I2CL 1EHXA 4J23A 4ZTPH 3HZMB 1RJYA 3EO0A 3GSQA 2C9AA 3LB6D 4JHWH 5KANG 3QUXB 4HX1B 4FFYH 4WCYH 2APTA 3D48R 4GW5B 5DZNA 5D96B 1C5DA 2BERA 4H1LA 3MRGA 3NACL 1ODAA 5IKCA 1V7MH 3N1QC 2BX5A 3O4LD 3FTGA 2F74B 4KROD 1VEOA 2VLKA 4R97C 4BFGA 1X4ZA 2WY3A 2P45B 1DVFB 2VDNH 3FN9A 3PDOA 3OAUH 3LDBB 2Y5TB 4XH2A 1NMBH 2ICWB 3LPGA 5IW6B 3QJHA 3QWOB 4DQOL 2ESVA 1D9KC 4Y5YB 1BD2D 3FCTA 1HNGA 1ORSB 1LK3L 1VFAA 4D3CH 2A2QT 1AE6L 2F19H 5ITFB 4R6UA 2YD2A 3I02B 3EOAA 3QPXH 2VAAA 4CW1A 4ONGH 4YHIA 3ARXA 3T65A 3O3DA 5FYLE 1FE8L 2PCPA 3QUKB 5FOJA 5IQ9B 3SKNA 3CFBB 4JFHD 3GI8L 1FLRH 2F54D 4ALAL 2X4TB 3NFNA 3L95A 4K71B 2XKUA 4Z5RA 3EJZD 1NAML 3DHJA 1NGZB 3MNVA 1W0VB 4W70A 1A0QH 4LSRH 5JNYB 4AENB 2CIIA 2O5XH 3DX6A 4FQJH 4MD0B 3B9EA 2V9RA 2A83B 2E7MA 2B5IB 4LVNB 3EAKA 5I18L 3QT2A 3AU1B 2VTFA 2G60L 4QXUH 1BOGA 1MF2L 4X5LA 5HHOD 4JKMA 5CP7B 4AIZB 1PVHA 3K1DA 5BZDA 4R96A 2DI7A 2IANB 4NO0D 4POZC 1UB5B 1HKFA 2EE9A 3OL2A 4KJPD 4TSCH 4D9QE 3OJDA 3HB3D 1A3LL 3IFLH 1OQOA 3PHQA 1BIHA 3TCLB 3CVHH 3R8BB 3FFCB 3DXAB 4YNYA 1FYTE 4NKIH 1AO7A 2AJYL 1QUNA 3DOSA 4U1IB 1MAKA 2MPAH 1TJHL 3QO0B 4M43H 3B3IB 2X1PA 3SQBA 3V8OA 2KBGA 2XFXB 3KNBB 2FX9L 4JFFB 4P2YA 3BZEB 4KTEH 1FN4B 4HIHB 4L8SC 1PG7X 1VACB 4JPVL 2HRLA 3DO7B 4GKZA 4JO3H 1FORH 3MO1B 4YHPB 1X44A 3OG4B 1QSZA 3FO1B 2VISB 1A6AB 3F7VA 5HGDB 5J3HD 3TYFB 1IAMA 3AREA 3IAPA 1HYSC 4YPJA 1IGYA 2P43B 1OOAA 3C8HA 5E4EB 3G9VA 5DRNB 4HS6B 1IM9B 4O51B 2VXVL 1IAKA 4EVNB 1J0HA 4UIMB 1P6AB 5I6XC 1XF5A 2BMKB 3UYRL 2MQ0A 4QRTB 1TZHA 4KVCL 5F3BB 2DYPD 3VCLB 4M93B 4L29B 5DHXB 4ELKB 2FWOA 2PXYD 3V4VL 3BDYH 1WJ3A 1NGXB 4JHZA 4XCNB 1DFBL 2HA1A 4LLWB 3CNKA 1OGAA 3TA3C 1ACYH 3ZDYE 3TVMD 3OX8A 2P4AB 3G6AB 4CN1A 1DEEA 5CMAB 2Z35B 1M7XA 3V2AR 4XNXH 2BDNL 3LRHA 1HKLL 5ANMA 4AM0A 3TBTA 1T5WB 3AXLA 4P2OC 5DQ9A 5D5MB 2ICWI 4ONHB 3T2NL 3TO4A 1OTSD 2H45A 1KCUL 3BD3A 1AR2A 3E2HB 4QHKI 2OJZH 3KS0J 1T3FA 1RURH 1G9NH 5LWYH 5KVDH 4JRYA 2BY2A 2J8UF 4TOYL 2CR3A 4X7TA 3MLRL 4OQ1A 2CIKA 4N0UA 1ZANL 4OCXH 2R69L 1Q0YL 3L9RA 4GMTL 4OSUH 1KSRA 3VXTB 1JZ7A 1G7PA 1XCQA 1QPXA 2GKIA 1U41A 4P4KA 3LEVL 5FO9A 5C6TL 2EH7L 4LASH 4OZGB 1GGBL 4NWUL 2H3NA 1HHIB 1QSFB 3NAAL 2AV7B 1E6OL 1A4JA 4OCYH 2NPLX 4PJ5B 4MCZB 1XGYH 5JOFB 1QSEE 4Y16B 1JYVA 2BVPB 4Z7NF 2JB5H 3OKDB 3A6OA 1HXMB 4KKBD 3NFSH 2Y9RT 2HJFA 1GC1L 3S98A 3REVB 4JB9L 5KS9A 3L1OL 3O3EB 1OW0C 3QEGH 5C0AD 2CR6A 4XXCC 4QY8A 4UB0H 1CXIA 4KTYA 2VSDA 4YPGA 1C12A 2DI9A 5DYOA 3V5DB 1OGTA 2XKSA 5CIPH 3QDGA 1T7ZA 1DCLA 1GPOL 3CVIL 3THMH 4TYUA 2ZUVA 4JY4A 43C9A 4UTAH 3PQYE 4NCC2 1UWEH 2CDEA 2GJJA 5EIVA 4GRMB 1UACH 4N1CA 2LU3A 1HQ4A 4U6VH 4QHLB 1MFBL 5IB4B 4PV8A 3TPUB 4I0CC 5AD0A 5MEOA 3LD8B 4JFXA 4K8RD 4XPHH 5CBAA 1Q1JL 2G2RA 4LHUA 3OGCB 5FM4A 3GBML 5TFSH 1OWRM 3FZUD 1NQBA 5FM8A 3V0VA 2J8UE 2FATL 4LCUA 2DM4A 1UT9A 3KPMA 4IOSD 3LKNA 4YX2H 2Q1EA 3B9KD 1NCAL 1U8LB 4P23C 5IVXA 3H8NA 4LCWD 1K8DB 2IFFL 4HKJA 4L3EB 4X99A 3LMJL 4IBLT 2Y5EA 1NC4A 1JPGB 3I3BA 5DVMA 3VGEA 1JWMB 1FFRA 3NFPA 1FCGA 1ED3B 1AHWC 2GTWA 2VKXA 2VLKE 3X3FH 3GKWL 4Z7NE 4AT6A 1RV6X 3HZYA 4OQTA 1PKQB 1XR9A 2WP3T 5DMKA 3E6FB 4MAUL 3NPSB 4XPGL 2ESVE 4WWKB 3IJSB 3FFDA 2X4OA 5FYJD 1QYGH 2EECA 5GISH 5ADPL 5ALCH 3H6JA 3OPZL 5EU6E 3W5MA 2MMXA 2XN9B 1ZOXA 5JORA 1T20A 4HEME 3NACH 4P5KA 2LAAA 3OB0H 4IJ3B 4GW1A 1ZVSB 4NDMA 3UPRA 3MXWH 3SDCD 4IRZL 1OARL 2BOBA 4KRPB 5F88B 4ACPA 5J9PA 1RK0B 4PP2A 2WK2A 2RFXB 4G8IB 1N6QL 5JPNB 4S1RH 4X7EC 2QADB 4O00A 2A6JB 1LK3H 2R1WA 4U1SA 5GS0C 1KNOB 4QHUB 3QFJB 4MHHG 2I9TA 2NXZB 1MUJB 1QLEL 2R0KL 1HZHL 2VXSL 5IW1A 3D85A 4Q0XH 3SCMA 1FE8H 3E3QE 2QSQA 1CDBA 4PRHA 5JDSB 1A1MA 1UWXH 1CFNB 2A1WL 3PV6A 4WO4A 3A67L 4ALAH 3P0GB 4NRYB 3S8WA 5E7BA 2FBJH 1FL6B 2H32B 3PWLA 5BQ7A 3CCHB 1NLDL 2ZCLL 1P9MC 3VWJB 4N8PA 2GJZA 4MQXC 3ZDZE 4OJFL 4WU5A 5DSCB 2Y6SC 3T04D 2XG5A 2DIAA 3MV7B 5IK3A 1DQLL 4OLVL 1OF2A 1S7XB 5FM5M 2A9NL 3ZSSA 3W11D 5FB8A 4YC2C 5ID1B 2IWGA 2KZWA 5DMGC 3DUSB 4MA3B 4QT5B 2HKHH 3LHPH 1MWAL 1OL0A 4EI6A 4NUJB 4DN3H 1UC6A 3BP4B 2JJSA 4GT7A 1YZZA 4XP9L 3BPOB 2AJSH 1F4YL 3QUMA 1CICD 3J7HA 5CS7A 1I7TA 4HAGA 1UXSB 5D1XD 4XZUB 3MRBA 4UIKH 5I8EA 2I60L 1MWAB 4FQLH 1H3UA 3ERYA 1P7KA 3JV4A 5KS9F 5GRJH 3MV8B 5GS2H 3FO2A 2DDQL 4C83B 3UPCA 3LB6C 3BJ91 2DLGA 2X1QA 2VDPH 2BSSB 2FX9H 3AY4C 3OAYH 1DZBA 4ZD3L 1I8LA 2X4NB 3TPKA 1S7WA 1MQ8A 2HJKB 3PGFL 4M62L 4ODWB 4F57L 2QQNH 3D0LB 3RWFA 3V0WH 1QEWB 3U0PB 2WAHA 4OCWL 1OGAE 3ARYA 1HXYB 2EYRB 4YO0B 4Z76A 2CXKA 1CGXA 3MRCA 4MGXA 5D1ZA 5FYJU 5FHAH 1EJ6A 3HPJA 4LLUA 3CDGA 5EC2B 3BZDA 2O26U 3QUYD 1EEUA 1CE6A 4JM4L 1YMMD 4LARL 4JPKH 1H3TA 4TPRL 5K9JH 1L7IL 2KH2B 3DYMA 3ROLB 5IR1A 1VEMA 1U3JA 3EW3B 4X4MA 1WWAX 4ZOAA 4XWOD 1LO2H 2YA2A 4M5ZH 4U6HA 2OM5A 4NKOB 3TN0B 4MAYC 1G7MB 1I3VA 1MCQA 1R24B 1RJLA 4X6DA 5C8JB 1FC2D 4NQSB 1MFEL 4WDIA 3GSVA 3RNQB 4ZOBA 5DJXB 3RWGB 2H26A 4JRYE 4FZEL 1ZHBA 3WFBL 2DAVA 4YGVB 4DFHA 2IG2H 4N0UE 3EJZC 4LU5H 5FEBA 1Z3GH 1BEYL 3PWUA 3V6ZA 2V5SA 3MLSL 1EA9C 1CTOA 5E94A 1CGUA 3IDJA 4PGCB 4XP5H 4NOFA 2YPLB 5FYKE 1E0OB 5CSGA 1J87A 1RZ7L 2GT9B 3LIZH 2IAMB 3MNWB 3KWWA 1XR8B 1UADC 5JLZB 2AK4A 3LKQB 4Z6AT 2HRPH 1C16B 4X9FA 4K2UH 4TOYH 3G6DH 2ZG1A 4XAKD 4P2CG 2Q87A 1UVQB 1ZVYA 5KS9E 3QUXA 1HNFA 4KJPC 1PEWA 4HX1A 1PSKH 3HB3C 2DQGH 3H42L 4IEFB 1G7QA 1IGCL 5EBWB 3KYOA 5DGQA 2F74A 1U2HA 3HLAB 1T03L 3NAAH 4RWYH 3QDGE 5ACZA 5L9DL 1FAIL 1CXLA 4FA8A 1ES0B 1Z9SA 4MVBA 1JRHL 1C1EH 3QWOA 4Y5YA 5EFIA 1VFOA 5B22A 4JB9H 3Q6GH 3LRSA 3VE0B 5CEXB 5EA0H 4X6BB 4WFFE 4MD5B 1TPXC 1P2CB 4UAOB 5EOQL 5DGRA 1D5MB 4XAWL 4XP1H 5EC1A 3CC5B 3C8DA 3QUKA 1OD7A 3UJTH 5IV2B 3BPNB 2R9HC 4UT9L 4RX4A 1FGNL 1ZHKB 2Q7YB 1GGIL 5C0GB 3CPLB 5JNYA 5IMKA 3TFKA 1VENA 5IVXE 1G7JA 2MSPA 2C1PB 2VAJA 3BUTA 4HHAB 2PXYC 3DVGB 3EZ8A 2A83A 5GIRB 1GIGL 1NAMA 1FNFA 1YJDL 4WY7L 4GRLA 2NY1D 1Q1JH 1LP9B 1CLCA 2CLVB 3I75A 1SBBA 3GBMH 3IDUA 4EDXB 4PV9A 1BVZA 4K3DL 4QRRD 3RDTC 3CMGA 1KN2L 1QG3A 3V6OC 1EJOL 1TVDA 4YXKL 2Q20A 4PP8C 3FFCA 1EAPA 1OTSC 4GQPH 3LH2L 2H6PA 1A9EA 4AQOA 2FJGA 3S3JA 4NRXB 4L4VD 4K9EL 1B4JL 2P5ED 3SOBH 3QO0A 2X4PA 3B3IA 4NN5C 3R4DA 3TC9A 3TIDA 1NCUA 3SJVB 2FEEL 1A6WL 3KNBA 2F58L 4JFFA 4R3SA 2ATKB 2IPUK 2X1WL 3GKWH 4JGUA 4HIHA 4Y1AA 1VACA 1F8TL 5T1LD 1P4LA 4Z95L 4HQQL 3MO1A 4O2CB 2CUIA 3QHTC 4XPGH 3VXOA 4X80H 2DJ4A 5F7YC 4M61A 1IC4L 4PJ8B 4PJXA 8FABA 5LKNA 2BVEA 5GZND 3OPZH 4PGJA 5AAWA 5KSAD 2IH3A 4QTHA 5DRNA 3VXNA 5IUSA 2Z31B 3VFGH 4HS6A 4O51A 1UZ8B 1Q9KA 4JO4L 4B7LA 4EVNA 4UIMA 2FBOJ 3C8KB 5A16B 2BMKA 3MRNA 3T4YB 5F3BA 3VCLA 1J5OL 1P1ZB 4ELKA 5L88H 1NGXA 1N6QH 3HMXH 1SJVA 2V9QA 2CRIA 1WFTA 4X6DF 2WNGA 3RU8H 2YRPA 3T0VA 4M5YL 2H32H 2C3WA 2Z35A 2BSRA 3IDIB 1RJZA 5I1GH 2C4FT 3DTXA 4YHKL 3SEPA 4PJBE 1T5WA 3S88L 3KPRD 1LO3L 4IOFD 5ESAB 2OP4L 2A1WH 1PFCA 4U0QB 4DJMA 3HC0B 4RQQB 2YZ1A 1JGDB 1F6LL 3IU4L 4KQ3L 1HOCA 1UYWH 1NLDH 1ETZA 1IGFH 2W0PA 3W0WD 4PGEA 4U2ZA 5JXED 4RMTA 2VLME 4UBDC 1Z9OA 4OJFH 3QIUD 1G9ML 2Y36H 4RGNC 2XQBL 3O3BB 4XCEB 3LN4B 4DZBA 3VG0H 1ZS8A 4ZS6D 5E6IA 1DQLH 4HKBA 5BVJA 3IDYB 1HI6A 4I4WB 4OZIB 3U36B 2D7TL 2WWKO 3V6FA 1U91B 4WUUB 2JTDA 1MWAH 1WICA 2EDBA 5FUZL 1O0VA 2PTTA 1CR9L 1R3LA 1VDGA 4GBXC 4WVRA 1HHIA 2AGJH 4BSVB 3M45A 4OI8A 4I3RL 5HI4D 4N8VG 2R1YB 4PJGA 5JOFA 2AS5M 5CKGA 4YXLL 2BVPA 2VH5L 3L5XL 4AEIH 3U7YL 3MRLA 3F7QA 4JFEA 5TJWK 3STBA 4L1DA 2Y72A 4OB5L 4V3EB 3MBED 4LSVL 4P59H 2MHAB 3VFNB 1F02I 3O3EA 3X3GH 3HG1D 4YDLB 4RISL 1D7FA 1MFAH 3NIGE 1F3DH 4OD1L 4S1QL 5FGRA 5I17A 2DDQH 2BFVH 5TDOA 3QIWB 3K46A 4X4ME 3GNMH 3WO4C 1FAKT 2NY2C 1KCKA 3V5DA 4P48A 4HKXA 5IFHL 1MHPL 5HHMB 4I3GA 4JM2D 1J10A 3MYZA 4X6DE 4M62H 4F57H 3JWDL 5B8CA 4RMRA 4NNYA 3SDCC 4OZHA 4LF3B 1MAML 5TH2B 2IADA 5GSRA 5EBGA 1BAFH 2X2YA 1I1AA 1CGTA 4M9PA 2ICEA 4NZDA 3VD3A 1CFQA 4TPRH 2IQAB 5IB4A 3QP3A 3VFSA 1LK2B 3E1F1 3WFDH 3GBLA 3OGCA 1VPOL 3VXMB 3QEUA 5GRVL 3MX0A 3DETC 4U3CA 2G5BA 3RUGA 1I3UA 5GXBB 2FEEI 3MV9B 5C9KA 1RZIB 3RJDA 1RUQH 4EEEA 2I5YL 4FNLH 3MGAA 1T83C 4YFDB 2X10A 3SKUD 3WFBH 1JGVH 1MRDL 4I0PB 1T7VA 1EERB 4P9HH 4K23L 4FZ8L 2W0KA 2R2HB 3RGHA 1IEAB 1JWMA 4MNHA 4ZAKC 5FUOL 2Q6WA 4EI5D 4HPOH 1S7RB 3KPQB 3MJ9L 1UGNA 4GAGL 4KKLC 5DK0B 3E6FA 4F7CB 1G1YA 1U8HA 5SWSD 4ZFZB 3DX7A 2ARJQ 3IDXL 4L8CB 3DGGB 5D8JL 3NCMA 1WF5A 1IGCH 2WINA 1GH7A 2QTEA 5LGHH 1TXKA 5JR1H 4KMQA 4PJXF 4DWHA 5GGSY 5KSUB 1RAMA 1CGSL 2QLVB 4N8VB 1ZVSA 1JHLL 4APQA 1FVEA 1NCBL 4LCIL 3G08B 1FNEB 1FAIH 4YHZH 2JB6A 1S9VA 2AJZA 3B4NA 1RK0A 4JFDA 4MXWL 1NUDA 4G8IA 1JHKH 4U0RB 4JGJA 3PHOA 4S0UC 3AMLA 4WEBH 3B6SB 1BZ7B 4LPYA 1KNOA 4JRXA 4M02A 1KCLA 3WS6C 5IEKB 1FV1B 3ZTNL 3OTTA 1RIHL 4PG9B 1DDHB 1YPZF 2V2TA 2VITB 3MOQA 1QFHA 4UT9H 43CAB 5AZEL 2A6IA 4UV7H 1FL6A 2IANE 3BKMH 1WBYB 1GGIH 2BNUB 2IALA 3CSPA 3HRZA 2EE3A 2IPKB 3WLWD 4QYOB 1ZWIA 2NYYD 5C7XL 1IZKA 3FFCE 3BP6B 3DXAE 4R90L 3FAWA 1VB9A 4OF5A 4D2NA 3MV7A 2UUDH 1R3IL 4Y4KB 1S7XA 2V7NB 2D7NA 2BNQA 2VJXA 3HE7D 4MJ6A 2DMKA 4C56B 5ID1A 1F3RB 5F1IA 5DD5L 3DUSA 1F5WA 1PZUB 3S37H 3MFFA 4Y19B 5DUPL 4MMZC 4B41A 4NUJA 3G5XB 1QTYT 4JFFE 3E8UL 4NQXA 4Y1AE 4QXWA 3RWIB 2C3VB 3QO1B 2Q8AH 2OZ4L 4NJ9H 1FG2A 4N8CL 1EJOH 4XBGB 4TUKL 2HYMA 2FSEA 4YXKH 1UXSA 2RBLA 2DLIA 1Q9OA 4JQXC 5HVFB 5J7CC 5EBLB 4PJGF 4X9HA 4MD4B 1MWAA 1NDGA 4PJXE 1JI2A 2HT3D 4P57A 3MR9B 4PJFB 1WIPA 3UBXG 2ERJC 3HC3L 1VGKB 2BSSA 2F58H 3G5YA 3OV6A 1PLGL 3GO1L 1B0RB 2X4NA 4AG4L 4C57C 1NCCH 1CFVH 2HJKA 4ODUB 4P4RB 1NCNA 3E6HA 5BOPA 3D0LA 1FPTH 4LHQB 1QEWA 3U0PA 4JPIB 3X11A 1HXYA 32C2A 4DFIA 4YO0A 2P47B 1RMFL 4RBPH 3VDCA 1IC4H 3LKOB 6FABL 4OZHF 1MJUL 2HWZH 3MACL 3F8UB 3GHBH 2E7LA 1P6FA 4JO4H 5TE7L 1G1CA 3O41A 5DJ2A 2VQ1B 2IJ0C 5HGBA 3TN0A 1U93A 1R24A 3MNZA 3RTQB 1AKJA 2AJUH 4P3CL 4LLVA 1WLHA 4Z8FL 3MRQA 3FQUA 3RUGF 1PY9A 2BOCA 5EUOF 2CDGB 2AI0H 2NR6D 3QRFM 4XP6H 1J05B 3S3PA 3EKCA 1MLCA 2BVYA 2CQVA 4PGCA 2VDOH 3S88H 1KTDA 2YC1B 3BI9X 1NEZG 1NC2A 2GT9A 3QIBB 2P44B 1JIBA 2IAMA 2GSIB 3EYVA 1QSFE 4R7DA 5JLZA 4PJ5E 5K9OB 4PJGE 4E5XB 4NKQB 1C16A 4L3AA 3ARDB 4JFEE 1S3KH 2JELL 3M8OL 1UVQA 3TWCH 4U1JA 3ZHKA 1ADQH 1Z9MA 2COQA 4HIJA 2Y25A 5ADOL 2D7TH 1Q38A 2VOTA 3JWOH 1DQML 2DLEA 3OKOB 5EZLB 5JOPE 2UZIH 1PKOA 3ZKXB 3WUWG 1JYXA 2FZ3A 4LLMB 4K3GA 5FUZH 1CR9H 2WWMC 5GRZA 4NZTH 1BQLL 2VH5H 3BUYB 2YD9A 3LN5A 2VUYA 4OZHE 3UBXB 3VE0A 4JDTL 1HHGA 5CEXA 1IBGL 5ICZB 2EH8H 4NN6C 3CX2A 1D5MA 3NGBC 3VD9A 2DTMH 3CC5A 5I0DA 1BVLB 3K8LA 5I30L 2H9GA 1IAIH 1KIUA 5T1KA 3AS2A 5IV2A 1JP5A 3DBXB 4PJHB 4FABH 1DLHB 1C8PA 5EU5B 3MODL 1YEHH 1ZHKA 4P99A 3ULVC 3RUGE 5INCB 1JI1A 1HE7A 5DRZB 5C0GA 3JWDH 3OXSB 5DEFB 3VFUB 1S5IH 2C1PA 1QFWM 3T09A 4L3CB 3BD5A 2BVQA 4HHAA 4NHUA 4TSAL 1YN6B 1AH1A 4M7LL 1U8QB 4DEPB 3NCBB 2GFBA 1G7LB 4TNWF 5DUBB 4G9FB 4XCYB 1JUFB 1MCWW 2J5LB 4G6KL 2LVCA 2HTLD 4N9GA 3U48A 2CLVA 5MHSE 3VFOB 5GS0L 2GW5A 5AAMA 5MI0C 4EDXA 1S9WA 1CK0L 1S8DB 2YEZA 4JVPA 2O61B 4X9BA 3FN0H 1MQKL 4GRWB 1AXTH 2P49B 1VKXB 2QKIB 4IOFC 4RAHA 3DSFL 3CUPB 1KXQE 5JXAL 4FG6D 2VLRD 3OAZK 2X4UB 1FZKA 4K23H 4S0SD 1NEZB 3Q0HA 4UT7L 4FZ8H 1KB5L 1YNKH 3MGOB 1H15A 2XN9E 1UM6L 3ZDXF 4HC1H 1TETH 3GSWB 3QIUC 1P7QD 5EIQA 1UQSA 1I1FB 4HMCA 3SJVA 3LEYL 4F8TA 4KHTL 4ZS6C 1GGCH 3GI9L 2ATKA 1Y18B 2AXHA 2O5YL 2WWKT 4H26B 2R2BA 5AZ2L 4JFDE 4O2CA 5E1AB 4ZYKB 1QRNA 1OSZB 3G04A 3L6FB 3VDAA 1EH9A 1GAFL 3MMEA 4E41D 3W5NA 3R0NA 4LPXA 5ETUA 1IVLA 1Q9WB 4Y5VA 3JBG7 5HI4C 1Y0LB 2DBLL 2EE2A 5F9OL 4X5XB 1INEL 2Z31A 4XBEH 5B38B 1UZ8A 3HNSH 5FO8B 1LO4H 5A16A 4HS3B 3T4YA 3B8YA 3DNKA 1PAMA 1P1ZA 5KSVA 4YR6B 2NMSA 5C08B 1Q9LB 5E56A 1BOYA 5CSZB 5FUCE 4GS7B 4U6YB 1ZLWH 5JDJA 2APBA 4BQ6A 2W91A 4ZTOL 1HILB 1SMAA 2LQRA 3WIHH 2EDLA 1A7RH 2XY1A 5FF6B 1IKNA 3VD4A 3HE6B 2DLTA 3MV7E 4YK4B 3BQUB 4WEMB 3AM8A 4UILH 4QCIA 3U0TB 4GMSL 5FHBL 2BNQE 2E27L 1CFTA 1NCDL 1XIWC 2KPNA 3MLTB 3RL1A 3WEXB 1INQA 4ZFOL 5E24E 4FFVD 1YEFL 1P4IH 4PFEA 2V17H 5D1QA 1KCSL 1D5XB 5E5MB 3TBWB 5JHLL 1OAXH 3HC0A 4RQQA 4JZJA 4TTDD 4BKLA 3UBXI 1JWSB 1EEZA 3VXUB 5EOCL 4QWWD 4MQSB 2X89A 4XCEA 3LN4A 3WXWL 2FR4A 1CGYA 3MRKB 3TV3H 4KROB 1M7IA 3ZDXE 4I48B 4ZQKB 3U36A 4IMKA 2P5WD 5EUKA 4JO2H 1S9KC 2XYCA 1T6VN 4NO3B 4WEUD 4BFIB 4CADB 4EDWL 3GMQB 3D18B 3U7AA 5HGHB 1ADQA 2OZ4H 4N8CH 5C3LD 4EI5C 4TUKH 2QQLH 3P9LB 2DRUA 5B39B 1EGJL 3SQOH 2BNRD 3DIFB 3CDYA 2MHAA 3FRPG 4KJWD 4Z7UA 2WLYA 3S34L 1KACB 1AFVH 3HC3H 4F37K 2E7LE 3SKJH 4P2QB 1U8IA 3JTCA 3ZMRA 2VR5A 1RUPH 1XGQB 5HHMA 1YEEH 4IRJD 5DEGB 4N0FA 3RBGA 2NTFB 5MERA 3PP4H 4GG8B 2IPTL 1KJ3L 1PG7L 1FJ1B 2CGRL 2ICCA 3RPIB 2DQIH 4F15C 3WFCL 4OZ4B 3RX8A 5I1IH 3U6RB 3ARGD 1IMHC 2EDEA 2GY5A 3OB8A 4RRPA 4JQVC 4NO0B 5ISZD 4PRAB 1W8NA 1M6OB 4JZNB 5D4QA 1RZGB 4NM4H 5I1KL 3UJJL 5E00B 3VXMA 3A6BH 4O9HH 3RVVD 5GGSB 1N59B 4J3WA 4LLYB 5H94A 3LS5H 5DVKA 3FRUB 1A2YB 1RZIA 1CXKA 1FSKC 4Z8FH 5HVGB 4LBEB 3VWKC 4L4JA 5C0EB 2E8YA 5ILTH 4PUBH 1MCPL 4YEFA 1F4HA 3U46B 4NSKA 1CG9A 1FFOB 2I9LB 2NY7H 4HJGA 4XPBL 5HPOA 2I24N 2R2HA 5DDHB 4MJIA 1AQKH 1OAQL 5GSVB 4I2XB 4LSSH 3UTPE 4XCFL 1NBQA 3MA9H 3HE7C 3SO5A 5DK0A 2OI9C 1PJ9A 3VXRD 4F7CA 5CLTA 5IFJB 1K6QH 3KAAA 5JHDB 3ARBB 1YECL 1HH9A 4OUUB 1A3QA 4RIRA 1RZ8B 5TGBB 4ENED 3MJ9A 2PYED 3GMPA 4U1GB 5ADOH 4MJ5B 4R0LB 3WN5A 3OKNB 3FT4A 1G7HB 1BGXH 3GZKA 3CLFL 5D93B 4LAQH 3T0ED 3ZKMC 1RHHA 5DQJB 3TVMB 2HT3C 1NFDB 3PWNB 1FNEA 3H9SB 4KK8C 3UTSD 3VXSA 4M7LT 2X9YA 3AROA 3AB0C 2AEQL 3FB5B 2J88H 5HYQA 2M26A 1OVZA 1BZ7A 1URLA 5HHVL 4NHUE 1J12A 1T22B 1LO0H 1KELL 1N5AB 3P77A 4PG9A 1ZLVH 4K7PL 5I30H 3N50A 1DDHA 4TQEL 2YD8A 3NBNA 2B4CC 5E9DB 4JG1H 4PGDA 3UC0L 1LEIB 3WIHA 1WBYA 1FVDB 3BYYA 1BIIB 2QHRL 4NRZB 4WHCA 4U1NB 1AGBB 5EU3B 5IB5B 3TCXA 3V95A 1I8IB 2EXWD 3QDMB 1MPAL 2FJHA 1EXUA 5I66A 3DROA 4TSAH 1CXEA 3CK0L 4GRWH 4M7LH 2V7NA 5I1LB 2FD6L 5IQ7H 5A40E 3BRGC 3ZHDA 3TF7A 1A64A 1S78C 4G6KH 3O45A 1MJ7L 2NR6C 2OR9L 4YH6A 4FP8L 3SJVE 3VJ6B 4OTXH 3G5XA 2L0DA 3QHZH 1F58L 5I73C 5IJKA 5HVWA 1CK0H 1YEGL 4Z0XB 3O3UN 1MQKH 3QO1A 1YEDB 2YMXH 4RDQF 2NTSP 3DSFH 4J3SA 3REWB 4D9RD 1FRGH 5E6ZA 2VE6B 5FAAA 4M8VA 5KN5B 1LQVA 1UM6H 1WC7B 4KMLB 4CN4A 1OP3H 3TT1L 2OZ4A 1VGKA 4Z7UF 2EO1A 2R23B 2FH6A 3T08A 1GGYA 1EEYB 1D6VH 4P2OA 1Q0XL 3QEQD 2O5YH 1B0RA 3P11L 1MNUL 2ZZU