5SWZE

Crystal structure of np1-b17 tcr-h2db-np complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
240
structure length
240
Chain Sequence
TVKQNPRYKLARVGKPVNLICSQTMNHDTMYWYQKKPNQAPKLLLFYYDKILNREADTFEKFQSSRPNNSFCSLYIGSAGLEYSAMYLCASSRDLGRDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversed T Cell Receptor Docking on a Major Histocompatibility Class I Complex Limits Involvement in the Immune Response.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 48
structure length 240
sequence length 240
chains with identical sequence J, O, T
ec nomenclature
pdb deposition date 2016-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swzE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swzE01
1KGCD 1P69B 2Q7NA 4U1GC 2W0LA 4XX1E 5IT2H 3PJSA 5BS0D 4O00A 5TQ0H 1KENL 1E6JH 3ZYJA 2VIRA 2FO1A 2ZOKA 3O2DL 4LAQL 4H1LH 4KXZH 5K33A 1NAML 1UH2A 5TH2A 1GGIH 3BO8A 1PBYA 3V4VL 5IFJA 3U7WH 5LBSL 2ZNXA 4ELME 1JFQH 4R90L 4MAYD 3VGAB 5ITBH 5FUZL 5EBLA 3BOVA 3STBA 4QRRD 5DUMH 1QYGH 1X4XA 1C5BL 4TNWF 3NCJH 2VDPH 4GBXD 4O9HH 4PRID 2ADJA 1NAMH 4J12A 5JR1L 4WW2B 3FN0L 3VXRD 4M00A 3TZVB 1N26A 4OKVA 2X4PB 1KPRA 3VXNA 3ZL4H 1EXUB 1XGTB 1UA6L 1OWWA 3ARRA 3DVIA 1NCWL 1JN6A 2EH7L 1V05A 3WUWG 4FXKA 4E41A 1QFWM 4BFIA 1U42A 4M5YL 3S4SA 2PNDA 3VI3E 4P9HH 1P84K 1JGLH 2CLRA 3IDXL 3WFBL 1T6VN 3WNOA 1T4KB 3T8XA 5DJCB 5DGQA 2DI8A 3B9AA 1RAMA 1JRHI 3REVB 4X4ME 4K94C 1B3JA 4LLWB 1YMHA 4XRCA 2FX9H 4WUUE 1A4KB 5T1MA 4G6MH 3QDHA 5IFAL 3U48A 1KSRA 3SGJA 3JWDH 3HE6B 5AG9A 2YUWA 4HZAA 1NBYB 2FH6A 2DQUL 4BH7B 4QEGA 5DMGC 1RJZB 4PJCB 3MLTB 1LEKB 3RIFF 5B3JF 4LHUA 1TIUA 5ALCL 4U3CA 1T5WB 4UDTB 1HSAA 3MLUH 3TBSA 3VRJB 4ZUTB 5T3ZL 1Z2KA 1GAFL 2DMCA 5E24E 3B5TA 5SWZB 2EE9A 1RVFH 4L3EA 4OGAD 1HNGA 2X4NA 4P4RA 5A40E 1GOHA 1I3RB 3C8KA 5C08D 8FABA 1T5XB 4N0UE 1MCQA 1DCLA 1R0AL 2GK2A 3CLFH 1NMAL 2R56H 4D2NA 2X41A 1LK2A 3HUJE 5IQ9A 4HWZB 1RZKH 2NNAA 3QUMH 5CEZE 4I3RH 4ZTPL 2VH5L 2VXUH 2AK4A 3EZJB 1JF1B 1U93A 3V2AR 5IOPA 3R8QA 4BA8A 1AQDB 4ZNEE 1FC1A 3DHMA 1DUYA 2I07A 1I9IL 2DKSA 4FQXA 4M5ZL 1F6FB 3PUCA 5KVMC 2ZUXA 3HI5L 2D0GA 4OZHF 1I8MA 4QYOA 2K7PA 4N68A 3LRSB 4YHYB 2JELL 5KZCD 3U46A 2ENYA 4FHBD 5FYJH 2HLAA 2ARJA 1BLNB 2Q3ZA 2A0LD 5KSUA 4DJMA 4XP1L 1C12A 5SWQA 4LSSL 1U0QA 1A1MA 1W0VA 5SWSA 2EDWA 2BK8A 3PWUB 4O51A 1Q9WB 3KS0J 3I6KA 3D85A 3PDOA 2OZ4L 3DOSA 1OWRM 1RULH 3W81A 5EORL 2H32H 3Q6GL 1VB9A 5MEPB 1N5YL 1QHOA 2M26A 1ZKAA 5D1ZB 3JSSA 5CBEB 3TBWB 1A4KA 5C1MB 1WAAA 5C6PB 3TA3C 3ULVD 2NY0C 3O4LE 4FFZH 4DKEH 2YA0A 3QYCA 3WIHL 1R3JA 5E4EC 4AMKL 3BEWB 3FFCA 3NFPB 2GTZB 3TBYB 4M8VA 5GGVH 3LSOA 1WFNA 2Z8VC 4LP5A 3D48R 2AJYL 3V5KA 3GMRA 3H42L 3MRKA 4N0FA 3AM8A 4BZ2L 1T5WA 3QIBA 5FYLE 3ULVL 3Q0HA 2EO9A 3HAEA 4JN2B 4NQCE 1K3ZA 1S7WA 2BXZA 2FNBA 3EO0A 5HHNA 1MLCA 2CGRL 4WI5A 2VLKB 2X4UA 4RAVA 2X1WL 3ZE0E 1U8KB 2HT2C 4PG2A 1XF5A 5JW4R 3S3PA 3ZTNH 3WSQL 4GKSA 1FNEB 1ZOXA 3RNKB 1U92B 1NCUA 4YBQC 4EN3C 3HAEB 4JRXE 2APVA 4RIRA 2P5EE 5IB2A 4FABL 5F7UA 1ND0B 3ULVF 2VITA 4POYA 1S7TA 3A67H 3L5HA 4R97C 2J3SA 5I30L 3QIWC 3SQOH 2H41A 3S36H 5IBLC 3EOAA 4NM4H 5L88L 1K8DB 3G5XB 3PJSB 1JZ7A 1JGVL 1D5IH 1EBPA 1GGCL 4HPOH 1IFHL 1FCGA 1MEXL 1UWEH 5EIIA 4MS8C 4N5ED 3IETA 1E6JL 2VAAB 1MVUB 2X9XA 5H2BB 5HYQB 5DEZA 4R0LA 3QI9B 4PTUB 4LIQL 3H9SB 3O6FD 3P73A 4F37K 4PS4H 4XPFL 4R90H 3HUJF 4KUCD 2DBLH 3VFMB 2FWOB 3RNQB 1A4JA 3D2UD 1JTOA 1MEXH 1UWEL 2EDDA 2YD7A 1E4XI 5SWZA 1IM9B 4UDUA 5IM7B 2DQJL 1QQDA 4D9LH 2R1YB 3O3AB 1S3KL 5JR1H 1CXEA 1CFNB 3WNMA 3ARED 4P2RD 5IEKB 2R8SL 1P4IH 3GBNL 1NDGA 2MWCA 1MREL 3FFCD 1BAFH 2G60L 5EO9A 1SEBA 4HJGB 4HIXL 1KJ2A 2OR9L 1OAXL 3QDMD 4G80B 4LGRB 4P5MA 3C2SA 3D6GA 4MQ7B 3K0WA 3ARYA 4YO0A 5I1LA 4MB5A 3GDBA 3MYZA 1S9VB 4PB9H 4M5YH 5FECA 4X0KB 1F2XK 4R4ND 4HFWA 1FVDA 3PHSA 3I84A 1JZ6A 3PQYA 2VXSH 2IFFH 2Z0BA 3E8UL 4MWFB 4LCCA 4LEXH 2GUOA 3C5JB 2UWEA 1SYVB 5IFJB 2J8UA 2VLRE 1XH3A 2B0SL 1J05A 3LH2L 3IFOA 3QDGD 3GKWL 3SBWA 1PSKH 3N1PC 5E5RB 4GG6F 1HYSD 5DJ0A 3U7YL 3NFNB 1NPUA 4ONOA 4D0CB 4RX4D 4Z5RB 4OLYL 3ZDZF 1MVFA 3OKYA 2JCCE 2H8PA 2WIMA 3QUMB 1AHWB 1ETZB 1Q9OA 1K85A 2EDQA 4U2YA 4OKDA 1QO3A 4FTVA 3TZVA 1ERNA 4NQEB 3L3IA 5FF6A 5T1DL 3CPLA 4F7EB 3EFDL 1HHKA 1ED3B 2BOCA 1KEMH 3ZKNC 3BPLB 2MHAA 1QSVA 1GGYA 3SGDH 2YSSA 1Q0XH 1GZQA 4FXGB 3GSXA 2KPNA 3OHXA 5JOFB 3WO4B 5F89A 2VQ1A 4ZOBA 3TT1H 2CK0L 2P8MB 3QDME 4OD2B 2JK5B 3KAAA 1MCJA 3C60C 4F7MA 5LQBH 4P48A 4GG8A 1LQSR 3ALWA 5L6YH 2ZSWB 3TC9A 4TSCL 1XGRB 4XMLH 1DFBH 2VN7A 4NO2A 3EYFB 4ODVL 3STLB 3WO4C 5JIIA 3KPRE 1U8NB 4NZTL 4HEME 1K9TA 4OM1L 3GUTB 1WK0A 3BDYL 5JDJA 4LSUL 2IPKA 5IW1A 4HXBL 1DP0A 3MV7B 3BRFA 1NKOA 4X4ZA 2VZUA 4GRWE 2AK4E 3NBNA 3TT1L 1X7QA 1AKJD 4PRPE 1V7MH 5INDA 1KACB 4JFDD 4KAQH 4M6NL 3RWCA 4OFYA 2VYRE 4A2LA 3P77A 1MLBA 2GT9A 1TNNA 4XHJD 3TBVA 4YFLF 1YEIH 4MD5B 5DD6B 2WP3T 3OKNB 4BFBD 4X6FB 2CMRH 4FG6C 2FZ3B 5BV7B 4HH9A 2FH8A 5FIEA 5F6IC 3KS0H 2X4NB 5I19L 4JANB 5D6DC 5CLTA 1NMCC 3VFWB 1EAJA 5JUEL 4CRPA 3VFOA 1A64A 5D72H 3SE3A 1LEIB 1FYHB 4HUXB 2BZDA 3A6CH 4JRYB 1KV3A 3F12B 3MNVB 1NBZB 4LNRB 3P9MB 4GUPA 3UX9B 5GGUB 3FQTB 3IFNH 3S5LB 3MLXL 2YN5A 1OSPH 4NFBA 3AAZB 4Y1AE 3CK0L 3ULSA 5DQDL 5L8KB 3QG6A 1FNGB 2EC9U 2JCCB 5CEYA 1ZLVH 3UCRA 5EU5B 5ISZD 5HHVH 1VENA 3SY0A 1T2QL 4UIKL 2ESVD 3TO4A 1G7QB 3LPGA 2ITDA 4JN2A 1TPXC 3FT2B 3KPRB 4NQXB 4FQ1H 1CE1H 2X5PA 3NIFF 2VLRB 3TV3H 3PGFH 2OCFD 4PREA 3IF1B 1KIUA 3BE1L 1J8HA 4ALAH 2YC1A 3IDUA 2HA1A 4PJAE 2DQIH 1HCFX 5C6WH 4X6DE 1K4CB 2V2XB 3G6JA 3G6AA 4M7JL 1G6RL 1B4JL 3PWPE 2XZCL 2E9IA 2JJTC 3S3SA 4XBGA 1JWMB 2O26U 5HGHB 3FQUB 4MQ7A 5HYJB 3EIFA 5C0CD 3KXFE 4JLRA 3MO1B 4ALAL 1MWAH 4NQVA 4P23B 1WWWX 2GKIA 2KH2B 2EYSA 4IRJB 5C0JB 3FQRA 5J8OA 2CDEA 3OB8A 1VGEH 2B4CC 1JGUL 4PGZA 3BQUB 3RIAF 3IFPA 2ZCLL 4XZUB 5I30H 1IAOB 4YJZL 5F7HA 1JGVH 1Z0MA 2QL1A 4JZNA 3KPQA 2XQYK 4OV5A 5CHNA 3SOBH 3NTCL 4TSBL 3BP4B 2HJKA 2W0KA 3DX6B 2FDBP 4FZ8H 1A7QL 4NC1E 5F6HJ 4EI6B 3GSRB 3NMEA 1RFDL 2R0WL 4HZLB 4LIQE 2VIRB 4MQTB 1RZIA 4XP5H 2X05A 2XWTB 3UC0H 1XF3B 2YPLB 2XT1B 4Z78A 3QH3A 3AS1A 1T04A 4LF3B 4UUJB 4FZEL 2FJGA 4W4OA 2ZUYA 2R4RH 3VFNA 4MA3A 3F5WB 3GSVB 5DVNA 4DGVL 4JKKA 5I66A 4J2XA 2RCSL 2SEBA 4DKFH 4HJJL 4P2RA 2OQJA 3P30L 1R24B 3DNKA 3BUYB 1VFBB 1Z9SA 2QQLH 4UIMA 4WNQA 4I0PD 4L4VA 4UTAH 4HKJA 4OJFL 4S1SH 3GBNH 1FSKB 1SJEA 3STLA 2LTQC 4MCZA 4OLXH 4OV5B 5E2UL 4S0SD 2VC2L 4CMMA 2HMID 3RAJL 4FQCL 5JHLL 3B43A 1G7QA 2IQ9L 4JZJC 4TVPE 5F9WB 4BFEA 2R1WA 1XF1A 2HH0L 5E70A 5GZOC 2E6PA 1MVUA 5GZNC 1ZGLB 1NSNH 5F9AC 2IFFL 3BESR 4YHLL 1OM3H 1QBMH 5D96C 3MFFB 2P24B 2JF1A 3BH9B 4PRIA 2N4IA 2AJSH 2H32B 5KJRL 5A2LH 4L8BB 4JDZB 3GI8L 3H6JA 4QXUH 4Z5RA 1DVFD 2EE6A 4Y5XB 2JB6B 2QHRH 4ORZC 2ICCA 4Y2DC 3T77B 1X6LA 2D7TH 5GS0C 2KUTA 3FQWB 4HFUL 4L4TB 3MGAA 3MRNB 4GH7B 4FP8L 4Q9RH 3RKDC 4BH7A 3K4AA 5C09E 2DICA 3X13A 3L7FB 1ZVHA 4WHTB 1F97A 4PLKC 1XIWB 1P7QD 1LO0L 2QEJA 4LKCA 2Z35B 3OXRB 5D7JC 3X3GH 1I7TB 3SKOA 3RY4A 1KPVA 1NANI 1KXTB 4YUEH 1K5NA 2DLFL 5E4IA 5C0AD 2MOVA 3TIEA 3WFCH 3MA7A 5IVNA 1FO0B 4AZ8A 1MRCL 5C70A 3SCMD 2BX5A 4CL7A 1BP3B 4WU5A 5L0QB 2LE9A 5CP3H 5JIPA 3O11A 2G2RB 4N1HB 2RHEA 1ZANL 5LAXB 1KCSL 4OZIB 3IS1X 3FT4B 4NOFA 2W9DL 4NRXB 1RZ7H 5DHVH 5KSBB 3C08H 3L95B 4H8WH 3DURB 2Q76B 3H9SD 3O6FB 4OLZL 3QPXH 3ARFD 2B8OT 4ZD3H 4P3DB 4Y89A 3QJFB 3DO7B 5HHOA 4PTUA 4WWKD 4MHHG 2A6IB 2IBZX 3OKNA 3SDAD 4K7PH 4WY7L 1MRCH 1O5DT 3U36A 2QQQA 5ICXB 1KC5H 2HJFA 4KK8C 1AH1A 3AB0B 1MLCB 2CR3A 2PTTB 2YS4A 4IDLA 5L7XH 1S5IL 1AGEA 1VERA 2VLJE 1RZ7L 4P3DA 1X6NA 3IFLH 3MRJB 1L7TH 2NY6B 1EK3A 3MLYL 3FRUA 2I60H 2X4QA 5DFTA 5IEKA 4O2EA 1TITA 5ICXA 2DQTL 2FIKB 1BHGA 5DQJA 4RFEB 2WBWB 3VXPA 4RIRB 3F7RA 1HHHA 4X5WA 3HKFA 3RWJB 1YYMH 4J4PD 3CVHL 4QGTA 3MFGB 4LRIC 2YPLD 4U1HA 3M07A 4X4YA 2FIRT 4IRSC 1NGWB 3WN5A 1TJIL 4LLVB 5DQDH 2XTJB 3LKOA 3NIDE 1X5ZA 3ZT5A 1RZJC 2MCPL 3TO4B 4I2XB 5AD0B 4JY6B 4K55A 2B7DT 5ID0B 2R15A 1T2QH 4GRLC 4I5BB 4O58L 2EIDA 5EB9A 4EOWH 1I1YB 1PZ5A 4WHTA 1INQB 3D25B 5ENWB 1IEAA 3IDJA 2IGFH 3FONB 3G6JE 3MACH 4KTEH 2VLME 2E8YA 2BNQA 3WNPA 5D7LB 1EO8L 3PIQA 4M7JH 4HH8A 5IG7A 2P5EB 4DKDC 5IB1A 2XZCH 3VFVA 4NP4H 4F8QA 1FZMB 5F3HB 4BQBA 4NNYB 2W1NA 4LPYA 2FR4A 1T89C 4ZOEA 3FO9B 4RNRB 2FX8L 1K3IA 4S1QH 1HHJB 4UT9H 1IC5H 4RBPH 5C7XL 4OBRA 4L9LB 3GK8H 3P4NB 4MVBD 5I1LB 1B0GB 2VLJA 4J7RA 5GJTL 3L3KA 3BGMA 3VFPA 3P4LA 4XVTH 1LHZA 2APXA 1Q9WA 1J0JA 1U3HA 5ISZB 3ZTJH 3MUGB 4JO3H 1DBKL 2WNGA 4Z7OF 4G8GE 12E8H 3DXAB 4P2QE 5B39A 3MV7A 1E6OH 2OSLB 3D3VB 3HN3A 3OR6A 4ZUWB 1JI2A 1YMMD 2QQKL 4X6DB 3RFZC 1Q9LA 3BZ4A 1X5IA 5FGRA 4DZ8B 4J3WA 3PWPB 3P4OB 2DL9A 3FO2B 4DEPC 2Q20A 5I1KL 4HGKC 3IXAB 2AJZA 4LSVL 4YHIB 4EIGB 4WO4B 5FCSH 1KBGL 1RURH 5MEQA 4OQTA 4MCYB 2OL3B 3LB6C 5ICZA 1K4DA 3QIUD 5F1IA 4OJFH 2ZCKH 5FYKH 1T7ZA 4PJEE 3O6KH 2QQKH 2DD8L 4JPKH 4MXQC 3SO5A 4AH2B 2VE6B 4PP2B 2R2HB 4MGXA 1FYTD 1EDQA 1IAIM 1G7HA 2XKUA 4PJBB 1A6ZB 5A16B 1Y0LA 3KYNB 1C8PA 1L7IL 1O7VA 2YK1H 3PV6A 3QRFM 1K6QL 3FZUC 1XGRA 3QP3A 4H25B 4IJ3C 5HI3C 4D0DB 2FSEB 4UV7L 1FFNA 1FAIL 4LSTL 3MR9B 5HGBB 5F70A 3CCHB 3OKOB 3QIWA 4HUVB 1S7VA 4YE4H 5MEOA 2IADA 1JTPA 1NGQL 3QWRA 1I75A 4LCWD 2DRUA 2JJSC 1S7UA 1QRND 5LGHL 1D5ZB 4JFEA 3TLRA 1HI6B 4X0KA 1D9KB 4XBPB 1MAJA 1CDCA 3WIFB 1R3IH 2AQ3A 1DE4B 4JFFD 1FO0H 4TN9A 4ODXB 5CILH 4YK4C 1KEGH 1MCKA 2MPAL 3AUVA 1FLRL 5D1XA 4XCNA 2LU4A 3P11H 1KXVC 2CLRB 5C0NC 4WTZG 1F11B 1JMZA 1JNJA 4POUB 2VNCA 3PV6B 4QTIL 4DTGL 4PV8B 4TULH 5EBMA 4NHUA 1QR1B 5CSZA 2NXYD 5ESAA 1UKTA 4G5ZH 1NBVL 3KPNB 2VQTA 2NX5E 2Q1EA 1JI1A 4PGEB 1I4FA 2EXWD 3QUYB 4JREB 1KTDA 2AI0L 4QXTB 1KEGL 3SDYL 5IHUH 2UZXB 2C3GA 1BWWA 1AR2A 3NVQA 3S5LA 3B83A 5E9DA 1YEFL 3CSBA 1MRDH 1ZA6B 3D69B 3HLAA 2KQMA 2CH8A 3QFJA 1LO3L 5DC9B 4DK3A 5HY9A 3NN8A 3R1GH 2NXYB 3FQXA 2AI0H 4PGCB 3O6LL 3HB3D 2VLJD 5SWZE 2PYFA 4OF0A 2VDNL 1KC5L 2GCYB 4U6TA 4V1DE 1QSFE 4U1KB 3BWAB 1FAKT 3RDTA 2DIJA 4ZXBB 1UENA 5C0BA 4HWEL 2DWDB 1NBQA 1G9MC 1HKLH 1K2DB 2RFXA 3CNKA 1F5WA 5F6IB 5KVFH 5JXEA 4PJIF 1TTUA 1IGML 2F53D 3G5YB 3MJGX 3O6LH 1OTSC 4ERSL 3OKMB 1MJ8L 4H0IA 5E95B 4DCQA 1BJ1H 3MLZL 1AGFB 5E08H 3EO0B 2ZSVA 2Z31D 4OLWH 4F8TA 4IMKC 3MBEC 2HT4D 4PRNA 1QSED 3JTSB 2XWJB 3QI9D 4P59L 4MNQA 4YDVA 5DFVD 5IESH 4OZFA 5GGSY 4X6DA 5EZJA 1NGYB 3MRCA 4NO0A 5CMAA 3L95A 3V0VA 4ERSH 1AFVL 3BT2L 5FYKD 1F90H 3ALPA 2DQDH 5IW6A 1YEKH 3RI5F 4YQXL 4NN6C 4PJAB 5TFSL 5CWSA 3N1FC 3BKMH 2D0FA 4Z0BH 2R2CA 4DVBB 2P5WD 1QVOB 1EFXD 5E8NB 3JV4A 4UT7H 1ODAA 2ED8A 3HE6A 1KPRB 1A9EA 1KB5L 4KTEL 4GKOA 3U4BH 1RZ8A 5A2FA 3GJFH 4JCLA 1CDBA 5DMIH 4OFKA 1YPZF 3FCTA 3HZYA 4LKXA 3TJEH 5CGMA 5K9OB 3MLRH 1N59B 2V2XA 3G6JB 3ARGB 3HRZA 1G9NH 4L3CB 2Z35A 3OXRA 1BBJB 2JKXA 3BKML 5JIKA 4YBHA 3JUYA 1N6UA 1F8TH 3O2WH 1WF5A 5F9DC 3O8XA 4ONGH 3O3UN 5DJCA 1LEGB 5DI8A 2VLKD 5K9QG 3NFNA 1LMKA 4GKNA 5KVGL 3T8XB 1RIHL 1XCQA 3O41B 4F7CA 5DXWA 1R5VA 4MNHB 5H8DA 2V6HA 3V8OA 4Y5XC 1U3HD 5DQ9A 3OJMB 1PG7W 3VW3H 3FOMA 1LVEA 5JHDA 1FZKA 2X4RA 1HSBB 2DQFB 2YD3A 4TUJB 3ZYOA 2ZUQB 5D5MB 1DBAL 4XVSL 2EDRA 4LBEB 1I1YA 1DUYB 43C9B 3ZO0A 4KKLD 1HNFA 4LHQB 4ZO6A 1YY9D 1H3UA 4TOYH 5J7CC 3KPOB 3IU3A 3HPJB 4PJDF 4HZLA 4JRYA 5M95B 3QPQD 3OX8A 2C1OB 4OCXH 2UUDH 4X7FC 5F1NB 2FB4L 2CPCA 1I8IB 1MFAH 2VDKL 5C0RL 3KPQB 1PJ9A 3IGAB 5SWSB 4QOKE 1ES0A 5D7LD 4YHOH 2P4AB 2YXFA 1OCWH 4U6HB 4XTRC 4Y7MA 4BZ1H 1TJHL 1I7UA 4L8SC 1AQKH 3IDMB 4OCYL 4JG0L 4AK1A 1NLBL 1HHIB 3O6KL 5D7KD 3JV6A 2ZUTA 5JMOC 4M4RA 2P5WB 2DMKA 4HD9A 2A77H 3WJJA 5FOBA 5DD1H 1P6FA 4JFPB 5TQ2H 3OF6D 3ARDD 4QXGH 4BQ9A 2VAJA 5F9OH 3LEVH 2VDKH 3W0WE 5MHSE 2R2BA 4Y4HA 4ZNCD 3C6SB 4HAFA 3HLAB 2XTJD 5F7KC 3SKOB 5HYIA 2H6PB 1K4CA 1JYNA 3DARA 3N9GL 5C2UB 1CD1A 5EO0B 1INEH 3JV6B 3BISA 1T1WB 5DO2C 1UKSA 4G9FA 4Z7UF 3T2NL 5TPWH 1MF2H 3C8DA 4OD1H 4P49A 3GB7A 3QHZH 4KV5E 3W0WD 4OF8A 4ZSOA 3REVA 5IMMA 1HH6B 4ZDHB 4YE4L 1ES0B 1RUML 1NGQH 4RQQA 2AXGB 1YY8A 1FL3B 3RWEA 1FNHA 3C8HA 5B4MD 3MV8E 4U3XA 4DW2H 1MELA 5DD3L 3NCEB 5D1QA 3ROLB 3F65A 4ODSH 5J6HA 5JNYB 4LDLB 4YDIH 1P5VA 4J6RL 1MCPL 1QRNA 5JW4N 4XNUH 3QEQD 5E6ID 4GW1A 2XYCA 3BKCH 1YECL 3G5ZA 3QCTH 5F88B 1OTTD 1QA9A 1DSFL 3UPCA 3GSWA 2V2WA 2X4RB 2VO5A 3RI5K 1MFCH 3MRRB 3NACL 3PV7A 4X4MA 1X4ZA 1NBVH 9CGTA 3ZSTA 3RWIA 5F3BA 3OKEA 3ABZA 1I1CA 5EIQA 4R3SA 1FFPA 3GM0A 3FB6A 4HIJB 1OLLA 4GQ9H 1E4WL 1T20B 2AABL 5LWYL 4RZCB 5GIRB 1U2HA 3TIDB 4PJ7E 5HGBA 3V5KB 3LS5H 3DBXA 2E9WA 4NT6A 3QIBD 2CLVA 5IK3B 2AERT 2XXCB 3DRQB 4MD4A 3ALXA 3LKQA 1FCCA 3R1GL 1XT5A 2GW5A 4M02A 3VD7A 5IGXL 3GRWH 3VCLA 2AABH 5IBTH 1A2YB 1IAKA 1BBJA 3OAYK 5J1SC 4PB0H 1KLGB 3L5WA 1J8HE 1ZSDA 5GGUA 1HEZA 2Y36L 3T3PE 4PJ8D 1I1AD 2P48B 5EU6A 1ITCA 5SX5H 1AIFA 4DGYH 5KSUB 4DN3L 3H7LA 1IL1B 3HI6L 5DSCB 1YN7B 2YUXA 3B3IA 5T1LA 5IM7A 4WFGD 2BOBA 3VDCA 4Q9QL 4ISVA 3UZQA 4NZJA 3S37L 3NZ8B 4U7SA 1Z5LA 1CCZA 1EMTL 3DV6B 5IGXH 4YXLH 3DYMA 2CKNA 4ZS6C 3WUWA 3W2DH 3UZVB 2PETA 4LLQB 2J6EL 4LLYB 4D94A 4AENB 1KTRL 3GB7B 3KPMA 4EXPX 3VXUB 4RA0C 2PW2A 5IHBA 1G7LB 1I9RL 5GGTH 5AYUH 1QLEL 1P1ZB 3FB5B 3MV9E 4JQVC 2VAAA 3DGCR 2OQJB 4YHPB 5DJ2A 1UACH 1MLBB 5ANMB 1UG9A 4LDEB 3C5ZC 4NBZB 4U1SA 2UZIL 4TUKL 5SX5K 4G7VH 1YMMA 1PKOA 4BKLA 3RU8H 4XNXL 4Y0GA 2C3HA 4LVEA 4NQCA 3QEQA 5E6IA 3K7UA 2D3VA 4UDUB 3SE9H 1NUGA 3AGVA 2CLZB 1W8NA 3QWRD 3RVWC 1OY3B 4JRWA 5K93A 2ZP0T 4Y5YC 2C3VA 4JM2D 2X7LB 2ATKB 4GRMB 4ETQA 1URLA 2DKUA 5C0BB 3MNWB 3DX7A 2WIIA 3NCYP 2GJ6D 4WO4C 3OKEB 2VUOA 4NUJB 5T3ZE 4I18B 1UQSB 4Y4FB 1IAOA 5SX4I 4TVPH 5I0DA 1K8IA 4NYLA 2CJUL 3UTPE 1WAAE 1LE5B 1ED3A 1YNLH 3W0WB 3AAZA 2AGJH 3WHE0 4DAGL 1RSFA 1AY1H 1S7QA 4Y4KC 2YEZB 1BJMA 1BQUA 3GI9H 1XCTB 1C7TA 3IS0X 5HYEA 1N5AA 4RMSA 3MYJA 4PGEA 3U7AA 2YPLA 3V4UL 1E4KC 4LK4A 4RGOH 4W6XB 3WS3A 4O9HL 4P57B 1BM3H 1YY8B 3FN0H 5JDSA 4C83B 2HJLA 1YZZA 1JPFA 2FATH 4AG4L 1GHFH 5FB8A 25C8H 2D7NA 5ADOL 3GI9L 3NCBB 4UZGA 5HY9B 2IH3B 1A14H 1DQTA 3REWB 1BF8A 1FL5B 2J4WL 5D71H 1X5LA 3MBXL 3GSOB 4LCCC 1PY9A 4IOFC 5IMLA 4MD0A 4FXLA 3HZYB 3EDEA 2NY0D 1FO0A 4KK9C 1KYOK 2YEZA 3E6FB 5GJSL 1QA9B 1KLUA 4Y88A 3BEVB 3MRGA 4MJIA 1OCWL 2WBKA 5K9JL 4RFOH 3NH7H 3DETC 2FATL 5E03A 1ZGLA 2HRPL 3TZVC 3BKYL 4JO2L 1OLZA 3M8OL 1D9KA 3V4PH 2IPUG 3ARSA 4CW1B 3MRPB 3UTTA 5CJQL 2NY3C 3G6DL 3K4ZA 4NWTL 2YPVL 3BSZH 1DQQA 4PYHA 2XQBH 5EUOF 2P43B 4NNPL 5FUOH 5HHOB 3QNZB 1EJ6A 3TH3T 3M17A 3OSKA 3L6FB 2YUZA 2MQ0A 4XCNB 1OT1A 2KQNA 1J10A 4G6AD 5AAMA 2AJVL 1XGUA 4CKVX 5KZCB 5I8KH 4JHAL 6FABH 5A3ID 4RFNC 4UOJA 2APBA 1FVDB 5CUSH 3UTTB 1ZS8B 5KBNC 5EOCJ 1GAFH 4X7SL 1MF2L 5F1IB 4R0LB 4OCSL 1KN2L 4PJIE 4OGAC 1MUJB 4OZGE 3OAZK 1A3LH 2V17L 2AW2A 3BKJL 1CT8B 3HAEG 5F71A 3KLAB 4I0CC 5GISH 3O81A 1JWMA 3QDJB 4Z95L 3W0WA 2WV3A 4OFIA 5JNYA 1E4KA 2G9HB 1L0QA 2H3NB 5I76A 5JPNA 2BCKA 3SE8H 3T2OA 4GAJL 1SYSA 2GTWA 3TYFA 3AROA 3S36X 4XNUL 1DVFA 1S5HA 3U1SL 3GNMH 1YECH 2VISB 3L3OB 4M5ZH 5FV1L 3SO3B 4X8JB 4LCUA 4R0LC 2G5BA 3WLBA 1MCWM 5DC4B 1MFCL 1PLGL 2MHAB 4N0CD 4GLRI 3SDAB 4E41E 4R4BB 1XF5B 2FHCA 4APQA 1D6VH 5IQ7L 3SE8L 1DBBH 1NMBL 1QSEB 3CLEL 1C5CL 2Y5TA 1BPVA 4K3EL 3I6KB 4JM4H 3WFDL 1EA9C 4LL9A 4JFYB 3EHBC 2X44D 3O8XC 2Z8WC 5EG6C 3P0GB 3B2VH 3AC0A 2NZIA 1JVKA 4QXTA 4RRPG 1G0DA 2AJXH 4PJGF 4PRBA 3MLWL 3QXAB 2DJ4A 4L3EB 5EZLB 4APQB 3LV3A 4F9LA 5IMOB 4XCFL 4RWYL 2BNRB 5IHZB 4Z7WA 4ONFH 3EGSB 3AM8C 1N64L 1UZ8A 4PJ8A 2ICWJ 2OJEB 1JIBA 3L3OA 4MWFA 3ZYIA 2LVEA 2PN5A 2CUIA 3K1KC 4Z0XB 1KJ3L 3L3HB 1TCRB 1B4RA 3WJLA 4PTTB 2VLJB 4EN3A 2BP3A 2I5YH 3S96B 2EDEA 4U31A 2UWEF 3GSWB 5C0IA 1VFBA 4ZYKB 4M4PA 4HCRL 4MVBC 3H42H 3GMLA 4XRCB 1N64H 4L4TD 1EMTH 4MJ4A 3LKOB 3ULVH 2RFXB 1CTNA 3ARVA 1Z9MA 3LEXB 1V7NH 4GBXB 4X7DC 3CH1A 3WHE1 2AEQL 4L8SA 2L7JA 3O3AA 3OTTA 4FFVC 2ICWB 3ZHLA 5C0AB 4HHAA 5DZLA 1CFNA 2Y6SD 1OQOA 5ETUA 2EE2A 1ZT4B 3C9NA 2EDJA 1WEJH 2BVTA 1UH3A 3K2UL 3V8CA 4XPBH 1UCBL 1U8LB 2OI9B 2FX7L 1CG9B 5D1XB 3C60A 2I9LB 1I1AB 4LPTA 4P4KB 3ESUF 3RDTD 3DHJA 3S5LG 5HSFA 1V7NL 2O93L 1MRFH 1JF5A 4M7LT 4XAWL 2LQRA 3PXJA 5C0EA 3OG4B 1BX2A 5DJDA 1A3QA 2NY2D 4GAYB 3SE9L 4J3SA 4JJ5A 2W65B 1HEZB 4P4KC 5I66B 4AQOA 5LBSH 5B8CA 1DDHB 2AKRB 3RZWA 2Y9RT 2MQ3A 4LBEA 5FUZH 3QO1A 1ZEAH 5FAAA 1QRNB 1NCCH 3QNZA 2FSEA 3UBXB 4X5WB 2NPLX 1SHMA 3THMH 4F37F 4ZFZB 4M03A 1TXKA 5DMJB 1Y6MR 5I8EB 5C0BE 2Q8BH 3UTOA 4F33B 3BIAX 3I6LD 3BX7C 5DHVA 2W91A 3GM8A 2AGJL 4DAGH 2J5LB 3FZUD 2OSLA 3IGAA 4QYOB 4YHML 4OZ4B 4NRYB 3SKMA 1UA6H 2DBLL 3ZDXF 2EDXA 2AK4D 4WW1B 1MNUH 2BC4A 4PJEB 3ZE2E 1FL6B 1K5NB 3V4UH 2HP4A 4OFPA 3ZZ1A 3VH8A 4RGOL 1A47A 4MNQD 3BDXA 4UB0L 1OL0A 3PWLB 2NW2A 3RGVD 2RB8A 4L3EE 4PJXA 3X17A 5C0AE 2GFBA 1P7KB 2XQYG 4QLRA 4ENED 2BFVL 1U6AL 4P5TD 5LGKA 4GSDH 5JW5B 4OZFG 2G60H 3AVEA 2WAHA 3A6OA 4JFFA 1RZJH 3D87B 4U6YA 3ZMRA 4EZMA 3DRQA 5ICYB 2ILLA 2V5MA 4LSRL 2J4WH 3RGHA 1D3CA 1TQCC 1CFVH 1EAPB 1NCBH 4KGLA 4KVNH 3BZEA 4TRPL 3I9GH 1J8HD 4Y4KA 3VGEA 5C0CB 1UKQA 4XVUC 1G7HB 2N1KA 1SYVA 1J18A 3KR3H 5I9QB 3PL6A 4RGMB 4KH2A 4JPVL 1LP9B 1U8QA 4BFIB 3N1QC 3D0LA 5BMFH 4G42A 1MSPA 2ESVA 2W9EL 2VWEC 2AV7A 4P9HC 3W9EA 4AY0A 1GIGH 5D2LF 2MNUA 3V4PL 1H5BA 4M43L 4NN7C 1UWGL 3K3QA 4X6FA 4HK3N 1X4YA 4OBSA 3MTRA 1BFSA 4FRWA 2BY1A 4OM0L 2J8OA 5TE6H 3RWGB 1CFVL 2OK0L 4HWZA 5DS8A 3GKZA 3UJIL 1JGLL 2VLRD 2CRMA 3U9PH 2G5RA 5FF6B 4YBLB 1CLZH 5E8NA 3UJJL 5EC1A 2IADB 4CMMB 1NFIB 4I0KA 1NMAH 1CTOA 4DQOH 2ZUVA 3RY6A 5SWQB 4J8RB 4QF1A 5T1LD 4G8FB 5TGBA 6FABL 1UZ8B 2YRLA 3QUML 4GW4B 3VMNA 4RISH 1LEIA 4RGMC 3T4AB 1NKRA 1S9KC 1U8OA 4U1GB 2ZCHH 4NQCB 4HUWB 5DJAA 4F57L 1NFIA 3OJDA 2WLYA 2YZ8A 1N0LA 4JRYD 1JGDB 3KYOB 3GSVA 3M1BA 1INQA 3D25A 4K7PY 3TBWA 4DQOL 5DK0B 1S7SB 4K3GA 2XN9E 3RPIA 1I7ZB 3SKJL 2JELH 2IBGA 3ECBA 1WBYB 3MLUL 4ODVH 2ADJB 4K23L 1N2RA 4PGJA 2WQ8A 1RK1B 2F74B 1RUPH 3DRTA 1KLGA 3L5WB 4MB4A 1RVFL 5I15H 3T2QA 4XCCH 1IGYB 5IB3B 3BN9D 1EH9A 2NY7L 4LSQL 1VKXB 1MI5E 5CJBA 4U1HB 1JZ5A 4R7NB 5DRNA 4NN5C 4ODUA 5JQ6L 4H25A 2EIBA 3SKJH 4YEEA 1KYOJ 4H0HB 1NAKL 3WV0A 3HS0A 4NC1C 2ZOKB 2VH5H 2NY0B 3DX9B 2VXUL 1RPQA 3LKRB 1QEWA 2ICEB 1R3KA 4EJ1C 1WZ1H 4MLIA 2I9TB 4ZUWA 3MSPA 4WGWB 4AEIH 5E6ZA 4M48H 5E7BA 3QUZB 2DWEB 3X11A 1H3TA 2YUVA 1I9IH 3MLPA 2CDGA 4DKEL 4WFGE 4G8GA 3HI5H 1BFOB 1MJUH 2HFFA 1DE4A 4OF7A 5JUEH 3MJ9A 2NY6D 4YNYA 5EZIH 3VXOB 3GRWA 1QZ1A 2W0PA 1IGJB 1BZ9B 1R5IB 5IF0B 2RJMA 2GJ6A 2DJSA 2HMIC 5T5NG 2HJKB 3DX6A 1TCRA 2ERJC 4M9OA 2A1WL 4R26H 2BNRE 5I1AA 3EOAB 3NIFE 4NHUB 1QR1A 5GZND 1BJ8A 5IK3A 1AKJB 2OZ4H 1ZXQA 4CW1A 4PJBA 3Q6GH 4UIKH 1FRGL 1HWHB 4D9QD 1J87A 4M6OH 3SDXA 3BMVA 4X4XA 5JXEC 4G8IB 1SM3L 4RSVA 3DVGA 4GBXC 4R26L 3GIZH 5I2IA 3V6OA 5DRZA 5I1JH 1RI8A 2BMKA 4F58H 5TDPA 1CICC 5FYJD 5GS0H 4J3VA 4TYUA 2E7LC 1CGUA 4Y1AD 5INCA 5I16B 1FRGH 1UCBH 5HHNB 2O61A 2A73A 1CBVL 1R3HB 1HYRC 4C57C 4DEPB 3DURA 2ZPKL 1KOAA 5MERB 1XIWD 4MQXC 5DZOA 3F12A 3MNVA 4PJ8B 4C83A 5JDSB 4XAWH 5CCKL 1MWAL 3HNSL 4NWUL 3RDTB 3QR2A 1L0YA 1NCDL 1LP9F 15C8H 4XTRD 4KKAC 3BMWA 4W4NA 2YD2A 2MSPA 1FYTA 1J1PH 1BQLH 1M05A 5BQ7A 3P4MA 3BGFC 1OAYL 4KRLB 2YMXH 4NO3B 1C08A 4PRIB 2COQA 1NFDB 3MRFA 1XEDA 4GKZB 3HZVA 4U1IA 4AH2A 4M7KL 3VGDA 4G9FB 1VGKA 2OP4L 1A7QH 4I9WD 2OJZH 4MB3A 1FQ9C 3RWGA 5CCKH 1IBGL 3GSOA 3G5VB 1H3WM 2FRGP 1N7ML 3MRDB 4FQJL 15C8L 1FVEA 1TJGL 3CXDH 1MJ7L 1P4IL 5EIIB 1ZTXH 1EVUA 2ZZUT 5GHWH 2HFFB 1BAFL 3X13B 5IKCA 4NO3A 5ITBL 2D2OA 1TTGA 1MNUL 2VXQH 2XG4A 5DUML 4UILL 4XNQB 3S34L 3AXLB 4Y5VC 4R4FH 5HGDB 3B9VA 1FFNB 1WIPA 5D5ME 1P4BL 2YZ1A 2XNAB 3Q48A 4FQJH 1N7MH 3FFCB 3NFPA 2EYRA 1AD9B 1U91A 3AREB 1O7SA 2FYYB 3CVIH 4JFFB 2BFVH 3ARBD 2F54E 4UAOB 4N1EA 5T1KD 5J9PA 5JOFA 3F6IA 3AS3A 1JPTL 5DRWB 1JZ4A 1UGNA 4S11A 2XFXA 3VWKC 4R4FL 3D2UB 4LCYB 3JWOC 5DC0A 1CE6A 2DKMA 3EBAA 5KN5A 4EN3B 3IDXH 3SDCA 3WFBH 3RWDB 1G9MH 4XVJL 2AP2A 3S3JA 5HHPA 4PTTA 1OP5K 1A7NL 3DO7A 1MCIA 1J86A 5F3HA 4IRSB 3RL1A 2ADGA 3BP7B 1JPFB 5KTEL 5JW4Q 1HKFA 4OD2A 3FQWA 2AJSL 1JPTH 4OM0H 2ITDB 5TE6L 2OK0H 2DJUA 3U9PL 2HT3D 4ZPTB 4Z7QE 3IDYB 1CLZL 4L8SB 1BIHA 1QFWI 3L3GA 2R2HA 5E4EB 1QKZH 4E9LA 2NTSP 2GJJA 4PJXB 3N85H 4XMLL 2NX5D 5HI5C 1CF8H 1WCBA 4J3XA 1IT9L 5TE4H 1WSST 4HIHA 4OGYH 3QUZD 3TA3B 5E2JA 5D7JB 1UFUA 1RZ8B 3V5HA 3R4DA 4K9EC 1MHPH 1XGPB 1NGWA 5EC2B 4OAWB 4YK4B 5DEGB 4NZRL 4P46C 4I3GA 3QUXB 1G7MB 1EIBA 4OCWH 1R0AH 2FGZA 4M6NH 3WFHA 5DVMA 4YHZH 1IRAY 1RUQL 3BJ91 2I25N 4ZXBA 3QZWG 1MCFA 1Z3GH 3OL2A 2DI7A 4Z7WB 1IKNC 5MENA 1B2WH 5HHOD 4YXKL 5CEYB 2VXTH 4C56D 3AXLA 5E8PA 1DANU 3FMGL 3WDHA 1LWRA 1PW3A 3ZHKA 1S9WB 1F3RB 3LY6A 4O02L 3QCUL 5GXBB 2ZOLB 3AU1B 4O2CB 4C56A 1RQ5A 3I6LE 1RUQH 4MDIB 4DOHE 1AGBB 5SWSD 1G1CA 4TSCH 3L5XH 5DJXA 1U3ZA 5MEQB 5H2BA 3A6CL 4F80A 2NW3A 4F7PB 3BD5A 4G6KH 3DSNA 5D1ZD 5EU7E 1Q0YL 3BDYH 3EOBA 3BW9B 4AEIL 5BS0A 4F15C 5KG9B 4WI8A 2AXGA 5L7XL 2P5ED 3ARGD 2FWOA 1ZHNA 3SE3C 2ZJSH 1MQKH 1P9MC 2JB5L 2VR5A 4NSKA 2EIEA 4Z7VA 5EORH 2H2SD 2B2XL 1YN7A 4HF5L 4OTXH 5EZLA 5FGBA 4P23A 2CIKB 4KJWC 3KPOA 4LCIL 2CDEB 4OFDA 3F7PC 4XPGH 1U3HB 1Q0YH 2IH1B 4MS8D 1CE1L 5JA8B 1HYSC 4TSAL 4L4VD 1I8KB 5FA3B 4XBGB 4C59B 1J11A 1ZLVK 5HI4C 3TO4D 3K74B 1P1ZA 4AMKH 1AJ7L 3KXFA 3RPKA 1Y6KR 5GGVL 3HC4L 1G7LA 2K3TA 4ZOAA 3S96A 3QUXC 4QRQB 1T0NB 1SMAA 2AJYH 2B2XH 4PG9A 4YHNA 3KGRA 3BZDA 3IDMA 3P0YH 5B22A 3QISA 1QG3A 3HE6C 5DVLA 4XPGL 1KJMB 1CDGA 1TTFA 2D7OA 3G08B 4RA3A 3JTTB 4WFHD 1XGPA 4QY8A 1QBAA 3JV5A 4F58L 3JWOL 1F13A 4K2UL 3MRQA 4OCLC 4P5TA 4NO5B 3ARBB 4NUGH 1R24A 3BUYA 2MCG1 3WJJC 4P23C 2Y4SA 2D03H 5CZKA 3WD5L 2X9YA 3B5HA 3SOBL 4PJDB 1AE6L 3NGBC 4RRPA 3S37X 3DX8B 4K94L 2FJGB 5BJTB 3QO0A 1LILA 3IT8D 4PLNC 2QLVB 1G84A 2FO4B 4TUOA 3JWOH 1LE5A 4K7FA 5ELIA 4WV1C 3GSNA 1A6TA 1NEZA 2AEPL 4QRSB 5DVKA 5FGSA 2NY3D 1BQLL 5B21A 4HKBB 1M7XA 1WIOA 1S7VB 3WUWB 2X4OA 3O9WD 1OTUC 3PDGA 3UPAA 1UM6L 2DMBA 5EA0H 1GZPA 1I8MB 4JANA 4F7MB 3PGDA 5J12C 3WUZA 3S9DB 3SCMB 4WTZA 2F53B 5F8QC 5LVEA 1ORQA 4PLJD 4NN7B 1A9BB 5DJZA 3T1WA 4K7FB 5A3IC 1MJ7H 5TJWK 4KJPD 2NY4B 1IKNA 5ITFB 5FO8A 4P5MB 2C4XA 1P7QB 3S34H 3VI4E 3ZKND 1CFBA 3QH3B 1NC4A 4Q0XL 3X3FL 1HINL 1X5KA 2R69H 1CK0L 3GMNA 4KHTL 1RURL 3CC5A 1UJ3A 1DR9A 2ZUUA 4NT6B 2HTLC 2R8SH 3VFGH 1IGFH 2AQ2A 5FV2A 3CVIL 3MCKA 1ZHLB 4LPWA 3ZT6A 3KJ4C 2FBJH 4XCEA 1OTSD 1HK6A 4RNRA 2PTVA 1JMXA 1GH7A 1D6EB 4OD3L 2ZG1A 2R0KH 4KRPD 4UINL 2F58H 3AB0C 2WINA 4LSPL 4X83A 3QCVL 1MCDA 3L3KB 4IDJH 3U2SA 4IRZL 2HT4C 1CK0H 3O9WB 1H8SA 4LKXB 2R0LH 4MD5A 1IKFH 5GSRB 3BPNB 4XC1L 3NAAH 5ACZB 3DXAA 1UXWA 5D70H 5HVGB 4LSTH 3QUYC 4PRAB 4PY8J 1BFTA 2OBGA 4AM0A 4JLRB 5E2UH 4MYWB 3I6GB 4WVRA 3UXFA 2C1PB 1FV1B 3SDXB 4NQDE 3R06A 3IAGC 2HVKB 5IJVA 4ODHL 4OLUH 3VRJA 3B2UC 1E27B 3NAAL 4D0BA 5FB8B 3QQ4B 4O4YH 1ZHNB 1DZBA 5DA0B 3QIUB 3LS4L 2L0DA 1QBML 3CSGA 2PXYC 4P2YA 3VE0A 3EOTH 1IT9H 3F58H 5DA4A 5I16A 3MLSH 4OKVB 3VH8G 1T03H 4AEEA 2VDLL 3AFLA 4I13B 1ZANH 3ULUD 3C5ZB 3SY0B 3TWCH 2PYEE 4ODHH 4OLUL 4NZRH 1LDPL 4AM0B 3DUSB 4WUUB 1FGNL 2DTML 1GJIA 5L6YL 5C07B 4LFHD 5F1SA 3LKPA 4WFEE 3TN0D 4L8DB 3TF7C 1QBBA 3WFEH 1VPOH 5JW3L 5D6CB 1WZLA 2VR9A 1U8JA 1T03L 5CWSB 3ARDB 3KPMB 2VDLH 1XGUB 4I0PC 4BH8A 1WTLA 3QA3A 2ZWLT 2QBWA 3BQUD 4YUEL 4O02H 1I8IA 1YEGL 2F53E 1IC1A 3QDJD 5D8JH 5E5MA 3VFTA 2X4TA 1KTLB 4UOW1 3QEUA 4TTDD 3QPQC 4F7PA 3GSXB 1KLFA 1P2CA 2HKHL 5B8CB 3IRPX 3CDFA 2HG5B 3WS6C 2DF3A 1YYML 5FUCC 3PDOB 3OG6B 1S9VA 4NKDA 1OAQL 4OB5L 3OKMA 2WBJA 1AGCB 1YEGH 2GSGA 5EU6E 5AUMB 3MXWH 1IEHA 4JJHA 4WY7H 1JNHA 3E6HA 3LHPH 1JGEB 4LCIH 1UQSA 2D7QA 1KFAH 1S7RA 4OT1H 3QT2A 3CMGA 4ODWA 2V9QA 3MLXH 4M3JA 2NYYD 1W0YT 3C5JA 1S5IH 3R8BB 4MXWH 4CU6A 2JJSA 3MBED 3MV9B 2X89A 3MACL 4M1CD 1VA9A 5JA9A 4Y16A 3RJQB 3RWDA 2VZSA 4OLVH 1HQ4A 1FN4A 1EO8H 5CD3A 5HHVL 1CN4A 1WWAX 3P9LB 4PJEF 3P0YL 4M93B 5E2WL 1F3DH 3L3IB 3LHPL 4HBCL 3DROB 1EJOL 5IV2A 3WXWH 5MEOB 5D7JD 3TA3D 3QJHA 5HYJA 3ULVC 4U1IB 3BE1H 1MCSA 4LLWA 1GC1L 1FIGH 2IWGA 5ESVA 2DIAA 4UT7L 4PGBB 1IC7L 1TJIH 1C12B 3L5JA 2NQCA 1MCHA 3QAZC 4K2UH 4BK4A 5C7XH 1OARH 2VKWA 1A6UH 2H1PL 1G6RH 4ZPVB 1KB5B 1AC6A 3FO0L 5TDOB 4O2FB 3MLRL 4LMQE 1QRNE 4NO2B 4MA8L 3RUGE 1J1OH 4F9PC 4PJAF 1MIEL 3ZYZA 2R9HC 2DAVA 5CP7A 1U95B 1MCBA 1DQJA 3QUXA 3RNKA 4W68A 1QHPA 4B5EA 3VA6A 4GRWF 1ZT7B 5EO0A 1OB1A 1ZA3A 2C9AA 2H1PH 4PJGE 3ILPB 1U3HC 4R4BA 1QLFB 1UM6H 4YBQD 4EN3D 3SGEI 8CGTA 8FABB 1TQCB 4U1MA 1KNOB 1KGCE 1MCLA 4Y4FD 4G9FE 4ZFFB 4EKXA 4NHCL 1XR9A 1DQLL 1TVHA 1S5HB 1R5WA 3QIWB 2XACC 4FFYL 4PJCE 2E9JA 1MAMH 4NKOA 3RVTD 4HV8A 1DUZB 1FFRA 1QOKA 4PJHA 3IU4H 4YXHL 3H2WA 5DVOA 5E8OA 2XY2A 4BSWA 1IAII 5IBLD 1FE8L 4ZXBD 5B39B 3HG1B 3IKKA 4PV9B 2A9NH 5CLWA 4KY1L 4XWOD 4XVTL 2DN7A 2Q6WB 1U58A 4Z76B 4WWKB 4JFYA 1CT8A 1H15B 4X5XA 1A7RL 5D93B 3UAJC 1ZWIA 4JPIB 12E8L 4JG1H 4BELD 5C71A 1MHEA 3ARGA 4L3CA 1OB1B 4I5BA 1ZA3B 3G5VA 3MGOB 3O6FC 1NLBH 1IGFL 4FNLH 4ZNEA 1MCNA 2EICA 1S7UB 3C6SA 2F54B 4ZS6D 2BSTB 2C4FU 4KKBD 2A9NL 5ADPH 1FZOA 5ACMA 2Q6WA 4AIXA 4DUWA 4LSPH 1DVFB 4G9FD 1I4FB 1OGAE 3SDDD 4OZIF 4IRZH 4PJ9D 2FEDD 3LKSB 2P5EA 1KBGH 3PGCA 3LDBB 4MAYA 2HH0H 5DQJB 1DLFH 3BP5B 2F53A 1AO7D 3SKUD 5TGBB 5ESQB 5GGRY 1BOGB 3T2NH 4HHAB 4Z7NE 5CILL 4GW4A 1OM3L 1DQML 1NGYA 1QBLH 3ARXA 3MRCB 3QHZL 2DD8H 5DUBB 5KJRH 4WFFE 1T0PB 3TCLA 4HS3B 1Y6NR 4NKDB 4QXUL 3QWOB 2G75B 2EEAA 4JM2C 4G5ZL 4Y1AB 4LU5H 4NQVB 1DLFL 2F15A 4JHWH 3AMKA 4Y16C 2GAZA 2UY6A 4NOBA 4LARH 4LRNH 2VJXA 4APQD 3QIBB 1ZVSA 1IM9D 3EOTL 4NN6B 4X8XA 4XNZC 1V8HA 4LCWB 3QCTL 1Z9OA 2P46B 4KJYB 1BOYA 2BVUA 5LCVH 4MA7L 3X3GL 5CJ5A 1LE9A 1QQDB 3U46B 1ZHKA 3NCFB 1J12A 5IG7B 2VZVA 3DTXA 1F58H 4JDZA 4HG4J 4M6MH 1LEKA 3H3KA 5F72S 1KLUB 5H37H 5C9JB 1DDHA 2AKRA 3MOAH 4YR6A 3CDGA 1MFEH 3INUH 3WIHA 5INCB 3KPSB 2CRIA 1A6VH 4QTIH 5L9DH 4LLAA 3IJSA 4HWEH 1H15A 1CD0A 3EO9L 3VG0H 4OLZH 3Q5YA 3QPXL 4KKNA 7FABH 3GZKA 3QIUC 3DXAE 4G8GB 5D8JL 5DJYB 3MNWA 4WTWA 3G5XA 5AWNH 5AZ2H 1C7SA 4IRJD 4K7PL 1M4KA 4PJXF 1UM5L 4MQXD 1N6QL 1MFEL 4WHYH 3UTSA 3MRLB 5A16A 3VXPB 1B6UA 3SJVE 2J88L 1LO5A 3CC5B 5CIPA 5T3XH 4PY8I 5BVPL 5IIEB 3DETD 32C2A 5DDHA 4XPHH 5BO1H 3KYKL 5DJYA 4X7EC 3UTTD 5DRXB 3S37H 4Z7QF 4RMVA 3FTGA 1S7XA 1PQZA 1HE7A 3BPOC 5DJ8B 4PRDB 4XNMA 4YBLC 2J7LA 3MBEB 2DQTH 2E8ZA 3KYMA 3MV9D 4N0YH 5FXCH 2NXZC 2DQGL 5TFSH 2X4UB 4RAVB 1D5ZA 4G6AC 4JFEB 2XWBA 5IEHB 5CJOH 5DRZB 3KPRD 5EFIB 3EYFA 3QBTB 3RQ3A 3TO2B 4XPHL 4DOHB 4OZIE 3OZ9L 1HKLL 4FN0A 4Y2OA 5CINL 2R39A 1HSBA 2DQFA 3AREC 4TUKH 3QXDA 2IPKB 5IW1B 2DLIA 3RU8L 2Q3AA 5IB1B 3QXUA 4NQSA 4QO1A 4PPTA 3G9VA 4QRUA 4O58H 3MXVH 3NCCB 1C5DB 2WWMC 5CEXB 4IIQA 5E08L 3V0VB 4PGBA 1RK0A 3UTTE 3DV4B 1DBJH 5F44A 3X12A 1YEHH 4GBXA 5I1GH 2GFBB 5IJKA 1SY6H 4NKQB 5T1LB 1NGPH 5EC1B 3FQUA 1RIHH 2H2PC 4L9LA 5IF0A 1AQDA 2Y7QB 2YA2A 1IC4H 3H0TA 2E7LA 5GRUH 4HUKB 1X3DA 1J1OL 4AIOA 4KQ4L 3D18A 4MMXC 4RBPK 4XWGH 3BIKA 1YMHB 2OJEA 3UTSE 3F62A 3STZA 5ID1B 4C58B 4AIZA 4S1QL 1SJVA 3OR7A 3GSQA 1OP3K 4D9RE 1KB5H 3QG7H 3FT4A 1IC5L 1PDKA 3PL6B 3BP5A 4OUUB 3QXAA 3VU2A 4QCIA 1BGXH 4LPCA 3UBXG 4HUNB 1JK8A 2APFA 3FQRB 3DGGA 2HYMA 3BIKB 4XWGL 4YHOL 3OV6A 2Y1VA 4LVNB 5FA4B 3QQ3B 4BZ1L 25C8L 1FGVL 4EXKA 3B4NA 1MAML 5ADOH 4YAQA 3OGOE 1CLYH 2MQCA 4FMKA 3QG7L 1TCMA 5HYSB 4YDKL 5ICZB 1U91B 4JM2B 4ZFGL 3TNMA 5JHDE 3GSRA 1I9JL 4I77H 1BVLA 4PJ7B 1DEEB 4FQQA 4U1NB 4X6BB 3QEUB 5TQ2L 1HHJA 2DLTA 1XGQB 2WMPA 3I85A 3CFDA 4LQ1A 5SV4A 1OAZL 3HR6A 4PJEA 3IF1A 5GJSH 4X8JA 3BRDA 4K9EL 3D39B 3UEZA 3X14A 4X99B 1PD6A 2RIKA 4JFDB 5BW7A 4IJ3B 2A83A 1SJHB 3N9GH 4OGXH 4M62L 4PG9B 4YHNB 3ZT7A 4HW6A 5D7IF 4U33A 3CDYA 5C2BH 5EN2B 3MRMB 3VXQB 2V2WB 3S88H 3WLWD 1AGBA 3VFMA 3U6RA 5KVEH 1IJ9A 1EEYA 5BZWA 3ZE2F 3ZKMC 5C9KA 3DRTB 4XXDB 4V2BA 1IQDA 3ARBA 1FNSH 5K9KA 4XBPA 3NABH 3LQZB 3DJ9A 3UJTH 3T0EA 1FAIH 3I50H 1GSMA 4KPHH 1MCPH 4B0MM 4JQXA 5DLMH 3D39A 4KZDL 3ARGC 4GG8B 3EDFA 3MRNA 4CN6A 1YEJL 1T3FA 5CEZH 4OAWA 5CSZB 2EZ0D 3U0TB 3ULUF 5GZOD 4NNXA 1CFSA 1FNSL 1U9KA 3KLDA 4P3CL 1HOCA 5TPWL 4X98A 4P2RB 4LCWA 3BEVA 1E4WH 2N7BA 3MRGB 4KPHL 1LK3H 4WFHE 3IDGA 1JCKA 5I73B 1FLRH 1EEYB 4X7TA 4WU7A 3O6ML 3ZE0F 4BJLA 2Y5TB 3HMXL 1CDIA 1PEWA 3FN3A 2EDKA 4Q9BA 3QI9C 4XMPL 4L9LC 2UZYB 1G9EA 1OAUH 1OP3H 1U8IA 4YZFF 4EUPB 4P3CH 3RKDD 4PJHE 3KHOA 3QDGA 3C87A 4YDIL 4JPWH 4P0DA 2OTUB 3MJ9L 5FYLD 3EHBD 3SO3C 2DLHA 3BD3A 1T4KA 3BHBA 3BP6A 4ODWB 3SQBA 5BS0B 5CZVL 4UT6H 3UTZB 3WS3B 3I75A 4X6BA 3O41A 3MLWH 4JGUA 3CGTA 4TPRH 4Y8AA 5K9OA 1VADA 4X80H 4Q9QH 2CR6A 1IQWL 3GGWB 1I1FA 4DFIA 3RZCC 3TVMC 4LOUC 3P9LA 4MD0B 2AEIT 4NBYB 1MCOH 1JWSA 2J88H 1JL8A 3JWNC 1MFDL 1PKQE 3WIIL 2QQNL 5I0ZA 5FYKE 3SCMA 1X44A 4UMGA 1XH3B 4NPYB 4U3HA 5DMGD 5KVFL 4JB9H 5DO2D 5IMKB 4OZFB 4JFZH 1MJ8H 2C3VB 1D7FA 1A7OH 1DQQB 4BQ6A 4L4VB 4KK8D 3BAEL 3PWNB 1QP1A 5EFIA 1A6WH 3BYYA 5HHOE 3H9SA 2YD8A 4PBXA 4XAKE 3O3EB 1A6AA 2J2ZA 4OZHE 2A6DA 4GMSL 2N7AA 4JFXA 5EOCL 1ACZA 3HCVA 2QQNH 4NQEA 4KKLC 2BDNH 4MDIA 1KCUH 4K3JH 5L2KD 4OIIH 3E0GA 1JGDA 4YXLL 2W65A 3W2DL 1HOCB 3QQ9C 1YEKL 3FB5A 35C8L 4HG4K 5FGCB 1WITA 5GRWA 1J1XH 1KN4H 1A5FH 1YNLL 2IH3A 4KMTL 4V1DD 4EQ2A 2A6JA 3MRLA 1AY1L 1G7PA 5C08E 5GIRA 2BSRA 1UACL 2ZKHH 1JYVA 3D3VD 1A7PL 1HH6A 4Y2DB 3FOLB 4I3SH 2EXYC 3SPVB 3DXAD 4U6VH 1RZGB 2F8VA 1J5OL 2CLZA 5ILTL 4WRLA 4PJHB 1U8JB 2O5YL 4GRLD 4U1JB 4BK5A 3THML 2R29H 4AJ0A 2GSIA 5IR1A 1J1XL 4QNPF 1TMCB 2YKLL 4ZFOB 2X4QB 1GGIL 3P77B 4I4WB 3VCLB 3BJLA 1T7XA 1LD9B 3FKUS 3RX7A 3F5WA 4TNWK 1PG7H 4HQQL 3TCXA 2WWKT 1GOGA 4LPUA 5BZDA 1AI1L 1QYGL 2P1YA 3G6AB 5DUPL 1GGBL 3MMEA 4JAMA 4IIQC 5GRJH 1ZT7A 3JVGC 1FZJB 4WI7A 5DWUH 1D5BB 3HC3L 3RTQC 4HLZH 3GHBL 1FNFA 3VE0B 2NY5L 1WZKA 1E28A 2K1MA 5DD5H 4XVSH 4C54A 3PWJB 3QB7C 4PJFF 1EHLL 4P2QB 1BFVH 4GSDL 1IGTA 5KG9A 5LGJA 1PG7L 1CLYL 1ZHLA 1RZJL 1I7RB 1LP9E 3E6HB 4NWTH 4HKXA 1WIUA 1GC1C 1EFXB 1I9JH 5EUKB 1D5BA 5GRJL 5TDPB 1FFOB 3UP1A 4KK5D 1KCLA 2VLKA 1LNUA 1EUUA 5LXGH 4IM8A 5EU3B 1MPAH 1UT9A 4Y4HB 1Q38A 3QG6B 1F45A 2OL3H 3NIGE 5C0DA 4QRRE 1FORL 2VXVH 3DVGB 1F2QA 5EBLB 2W38A 5J1AB 4JHAH 1QSEE 1XF3A 5GGVY 4XCYA 4M43H 1UWGH 4JDVB 4CJ1A 5JXED 2FLBT 1EBAA 3U36B 4C4KO 1KN2H 5C09B 4WWKC 3O3DB 2OYPA 1XR8A 1Y0LB 3JWDL 2EDOA 3KYNA 1YEDB 5J6GA 4WWID 4ETQB 5CKGA 5EZJB 3UJJH 3IB4A 4KVCH 1NUDA 2GYSA 2J8HA 3BQUC 3I02B 4Z95H 5ALCH 2UVEA 1DANT 3OX8B 2HRPH 2CIIB 2IPTH 5IJVB 1UXSB 3LKSA 5T3ZH 3W82A 5CBAB 5FUCE 1IEBA 2YPVH 3BSZL 3RVUC 3AU1A 1N4XL 2A74B 5FUOL 2FHBA 3NIGF 3RPIB 1YUHB 4MQSB 4KRNA 3O3BB 2P47B 1ZLUK 5F96L 3A0OA 3CLFL 4NQED 4KMQA 4TNVF 5DF0A 5FOBB 3C5ZA 1NMBH 2V5SA 5EO1A 1T22B 2V7NA 4ODSL 5H37G 4A6YA 2XNAA 2PW2B 3AS0A 3IXAA 3SDDA 1VEOA 2VABB 3MC0A 1FLTX 2WINB 1QRKA 1F4WH 3PWPA 4N8VB 3VXUD 4X9GA 4LSDA 1ULVA 3BN9C 3D18B 2VL4A 4PJCA 1FVCA 2D7PA 4M1CC 5KANI 4N9OB 5D7JA 2N56A 5F7FA 3T77A 2C7UA 1K4DB 4XPAH 4ONFL 2ZUWA 4PD4K 1OP5H 1NAKH 2GITB 5D2NC 1F42A 3ZLQC 4G3YH 1WZ1L 4KK6D 3EOYG 4FFWC 3V7MA 43C9A 1QFOA 1A2YA 4WGVB 3U1SH 4Y5VB 5C0ND 3VGHA 4D8PA 1A0QH 5FO8B 1KTDB 2YN3A 1ETZA 1Q9OB 3RVVC 3ULUL 4X6CE 3MRBB 2NY1B 3QDMB 5MENB 4TPRL 4RAHA 4QY8B 2NY6C 3TZVD 2HKFL 2MJWA 2X40A 3JTTA 4YWGH 4H20L 1JNLH 4WW2C 1QSFB 5D5MF 2BJMH 3UTQB 4G3YL 4Y2DA 1G6RA 3UO1L 2R9HD 4DVRH 4R96A 4BFGA 2P8MA 4WW2F 3MGTA 2CK2A 4FFZL 1FFPB 4NGHH 1HQRA 1XZ0B 3DIFA 3WIIH 5DURB 4TUOB 1D5XA 4MMZC 5BZDB 1G7JB 3MRHB 1HQ4B 3D0VA 4JB9L 5J3HD 4IOSD 3KLAA 1SEBB 2WBJC 3KG5A 4HJGA 1ADQH 4U1SB 5EOQL 3TCLB 1PEZA 1U8PB 4Z7UE 4PJBF 3LQMA 4OZ4A 3MNZB 5HDQH 4FQLL 4JFXB 3LKQB 4XP4H 5T33H 2CKBA 2DYPA 2BERA 3TYFB 3W11D 2WSKA 4D3CL 4EBQH 5IB2B 1I9RH 2FHFA 2QSCL 4PRPA 4K8RH 2JJUA 4GQPH 4HT1H 4E41B 1KCUL 4HCRH 2VISA 4XXCA 4JKLA 2X7LA 3VXUE 3GHEH 4RQQB 4MJ5A 3KPLB 4Z77B 1GPOH 4UTBH 1J9CT 4L9DA 1WV7T 1WT5C 3T0EB 3FT2A 3KPRA 1HCVA 4NQXA 3B3IB 1GGTA 1KIPB 1TQBC 3UZEA 3V79C 1WGOA 3LMJL 2ITCB 4FABH 4EBQL 3ROOA 4NN5B 3BVNB 4K8RL 4ZOCA 4XP6L 5JTWA 5F88A 3HFML 1A7PH 1OAYH 3ARTA 1TZIA 3B9KA 1MJJB 3KPLA 4HUVA 3IDGB 1J5OH 4H1LB 5IVZB 3TESA 2J5LC 1RJLB 4NJAL 3OF6A 3JUZA 2R29L 3O3DA 1JUFB 1OF2B 4ORGB 4Z7OE 3LMJH 4QRUB 2YKLH 4JFDA 4WJ5A 4EDXA 4GG6A 1FNAA 2FD6H 1NGXA 2EDNA 5D9SA 5HGDA 1CD9B 4PS4L 4WFED 4XPFH 1U92A 3L7EA 4X99A 2XICA 5D7SL 3MV7E 5DK2A 3F7VB 4UILH 1T83A 3QZWA 4LSRH 1P53A 2ZSVB 2PTTA 3ELAT 4P2OD 5BV7L 5DYOA 3TA3A 5AZEH 5HYJD 2PYED 2VDOH 3MLVH 5IMLB 5HPMB 2F5AH 2OL3A 5FECB 2JIXA 2LV4A 3GO1L 1P2CB 4JPIA 5DD5L 5MENE 1IMHC 3IVKB 5D6DA 3VXSD 4UOW0 1EHLH 3PQYE 1CL7I 1U58B 4Z76A 4YHMH 1MREH 3TP4A 1CYGA 3QUYA 4LVHB 3DO3A 3QFDB 1JZ8A 2KBGA 2VDRL 2QV2A 1QFWL 4H26B 4NJ9H 4OUOA 1I7TA 4MA1C 5D2NA 4RGNB 4ZS7L 3T0VA 5IFAH 4B50A 3MBXH 2X1PA 1FP5A 2E7CA 4OI7A 5IMOA 3HRPA 3TN0A 1YA5A 3TO4C 4NQDD 4GXVH 3MV8B 1N5AB 2Y6SC 5I75B 4ELKA 1KJMA 5ISZA 1MCCA 1JZ2A 1EFQA 1U6AH 1IM3A 1MOEA 5I8OL 3BKYH 1S78D 4P57A 5HHMD 1LD9A 3R0NA 2DLEA 5AEAA 1T83C 4GW5B 2ICES 3G6DH 4M7LH 3FB7A 3ARFA 5KS9B 1N59A 3LD8B 2XQBL 4P9HL 2BOCB 1H5BC 1RMFH 5CD3B 4OV6F 5BW7C 4NRZA 1DLHA 3VJ6B 4G7YH 2AJVH 4Z7WF 4OF5A 2NR6C 1JV5B 3RHWK 1YNKH 5I8OH 1N3NA 1YJDC 4CADA 4Y19E 5CIPB 1EUTA 3O9WA 3ZHDA 4X7SH 4YFLI 1Z0NA 4POZC 4ODUB 1T2JA 3RTQB 5I15L 2FEEL 3RGVB 2NMSA 4G8FA 1WBXA 3PHQA 4LRIA 4MNQB 3T4YA 2VE6A 2B4CH 3I6GA 3PP4H 2EDBA 2DQUH 1A6PA 1SJEB 4ZO8A 5F96H 1YN6B 2BVQA 2C1OA 2OMNA 4EQ3A 4MNGE 2AK4B 2IAND 5DD6A 1W72A 2F54A 3ARFB 4IMKA 5IQ9B 2W60A 2NXZD 4X7CC 3CFEB 1T7VA 4XP1H 4GAYA 3VH8B 4JRXB 1Q1JL 4LLMA 1QACA 5BRZE 2EDTA 1LO2H 3MCLL 5C9JA 1QFPA 5GPRA 4O5LH 2EECA 1HDMA 4UI2A 1C16B 1Z9LA 2X1OA 3QCUH 4KROD 4L8CB 4MLSA 2HFTA 4KAQL 1QUNA 4U2ZA 3TJHD 4ZFOL 1WJ3A 2QKIB 3EGSA 3QNYA 4WI2A 5ESQA 5EZIL 4PIRF 3VXSA 3BZEB 2GCYA 5D1QC 5L2KA 3DVNA 4CDGC 1NEZG 4I3RL 3CLEH 1OAKL 1NC4D 4JZOB 1DUZA 5GGQL 3JWDC 3RDTC 4FOMA 4D8PB 4P2OA 5IMKA 5I71C 4JZNB 2VRAA 3BH8B 3GSNH 1HDMB 4XP9L 4E42B 5C0CE 1B0RA 3I3DA 4H5SB 4UNTA 4U1MB 4P4KD 2JB5H 3QEHB 1FG2A 1UWXK 1CICA 5JQ6H 5C8JA 4NDMB 4ZTOL 5C0IB 2X89D 4MAUH 4HKXB 4S1RH 3VXRB 2I27N 2BJML 2Q86B 5I75C 1Q9KB 1TENA 4YGAB 3UO1H 5E5MB 4TUJA 4OF3A 1WVZA 2D0HA 4Y19A 1I85C 4XP9H 1H3XA 4G6FD 5ETUB 1HHGA 3QUYD 1OGTB 4ZTOH 4ACPA 3MV01 4WIQA 2JJTA 4OGZA 1XGYL 3ZTNL 4KUZH 3IAQA 2FBOJ 4CADB 1CVRA 1IGIH 2R4SH 4PUBL 1UC6A 2HLFC 2DQEH 4X9FA 1H8OA 2AEQH 4FQLH 5CJXA 5F3BB 4P46A 1JHTA 1ZGLM 5HPMA 4JJ5B 3TPUB 4NDMA 2F74A 3MRRA 1U8KA 3QAZB 1ZGLP 3A67L 2YBRA 5I1IH 1WBYA 3ZKXB 1X5HA 2IJ0C 1EV2E 3SQOL 1YN6A 2BNRD 2DQHH 2FX7H 1PYWA 3WE6B 1NUNB 5CKAA 4HC1H 4R9HA 3MJ8B 2Z92B 3UTQA 3PABB 5MP6H 2OJZL 3EYQC 3F7YA 5LG1A 5I8EA 3HMXA 5CD5C 1RIVL 2WQRA 4NKIL 5I1JL 5JW4M 2BRRL 1JJUA 4NCDA 4F33A 3TBSB 1WC7A 2Y07H 5I1IL 5B3NA 2AEPH 4Y4HC 3BPCB 3WSQH 3EYVA 4XXCC 3NGBB 1DJSA 5EA0L 2BSTA 1P84J 1CXHA 3F7QA 3D0VB 4MA3B 2FCBA 3IYLW 5EU3A 5CBEA 1L0XA 5E8PB 4MX7B 1QSEA 1A22B 1N0XL 1BZ9A 2YBRB 3U79A 2R0WH 1LK2B 2IFGA 4YNYB 4LVHC 1B90A 5KSAC 3UC0L 3LN9A 4JY6A 5E1AA 4KTDH 3CMOH 4AENA 1JFQL 4HIXH 4F2MA 1FPTL 1MQ8A 5DTFA 3EYOA 2XA8L 3B8YA 3RGVA 4GT7A 2BY0A 1V5JA 3GSUA 3OB0H 4LP4A 4M7KH 1MI5A 5HDOA 1XGQA 3ARWA 4Q0XH 3X3FH 1RHHB 3Q6FA 3NFSH 5B8CC 1EAPA 4L3AA 2F5AL 1U8HB 1DEEA 2R69L 4PYGA 1IBGH 3MRBA 4WTXA 3MYJB 2HRLA 4IOIA 4UTAL 4MSWA 2Q7YB 4HIHB 4KDTA 3WXVL 4PBWD 2CRYA 3C09C 3BH9A 5KSBF 2QR0B 2XN9B 1TVHB 1ZV5A 4CJ0A 1DN2A 1FPTH 4XC3L 2R0KL 3E6FA 4LLMB 5JHDD 1SEQH 3NA9L 3GKWH 4K8RD 3KJ6H 4PR5B 4QHLB 3S35H 3VA2C 1RZIB 3VWKA 4LLUA 1S3KH 2WUBL 4R96B 1FL5A 1FL6A 1BD2D 5E8EA 5FKPB 3ZDYE 1CICD 5CZXD 2ATKA 4GRMA 4YHLH 3L7FA 1FBIL 3E2HB 3VWJD 1OAXH 1BIIB 4F7TA 2VABA 3DTXB 2VZOA 2LFGA 3QRGH 4F15B 4R2GD 5DJ0B 4OIBA 4RFEA 4YH6A 1U8OB 5GRYA 3L3DB 1J05B 3ET9F 1AIFB 2QHRL 2X70B 4CU7A 1Y18B 5HHQA 4WI3A 1N3NB 4P3WA 3MO1A 2I24N 4FP8H 3EO1A 4K3HA 4RAUB 4HS6A 1J0ZA 4RISL 3WKML 1JPGB 4J1UA 1NBZA 5K59E 4QHLA 1SY6A 5L8JB 3MLSL 1N2RB 1IARB 3VG9C 3WNNA 5IHLB 1BJ1J 2A9ML 4NQSB 2ENSA 3WHXA 4Z7VB 4LPVA 2P45B 3H8NA 2B4CL 3PP4L 5HVHC 2DYPD 3FO1A 5GGRA 2OTPA 3VXSE 2DLFH 1B9ZA 6CGTA 4HDIB 3MV8A 2Z31A 4YLQT 4RMRA 2P8PA 4ZTPH 5TE4L 1VFAB 1EZVX 1FZJA 3I2CH 5BRZA 3TVMB 2CMRL 3QDJA 1AXTH 1A1OA 3IDIB 5I9QC 5IVZA 3MV7D 2A9MH 4XCCL 4KKCC 1GYAA 4HK0B 4YDVB 2ED7A 2W9DH 1CGXA 1PAMA 1ZVYA 1MCEA 5I19H 3HZKA 1NFDA 1NAMB 3MRFB 4GKZA 5IEHA 3V0AC 5C0BD 3C5SB 5FDYA 1BZ7A 1DFBL 4TTDC 3H7BB 1EFXA 1MHEB 1OAKH 1TLKA 3ROLA 3LD8C 4LKCB 3B9KD 3EZ8A 3HI1A 2DB8A 2PW1A 3S8WA 5KAQF 4CNIA 1L6ZA 3IFNL 4L1DA 2D9QB 5SWZD 1DQJB 2GIYA 4JHZA 2EC9T 1OSPL 3L6FA 4HSQA 3WN5B 2Z92A 3NOIA 1T21A 4X4YB 1AO7A 1V7ML 2Q8AL 3CSYA 3BZFB 4M1GL 2LU3A 1CFTA 2EXYD 3EJJX 4NPYA 4GXUN 4Y4KB 4JDVA 3OXSA 1GGUA 5A1AA 2VLLA 4MAUL 3W9DB 3QDMA 1KF9B 1N5YH 3QDGE 5HYSA 4G6KL 3DI3B 4F7EA 3BGFB 2XZZA 3CVHH 3OPZL 5FKAA 2WP3O 4JREC 2A1WH 5C07A 2DIBA 3SE4A 2ARWA 4HAGA 3V6OE 4KDTC 3WIHH 5ACZA 1T7YA 3N1GC 2E7BA 2DS4A 4Y5YB 4NUGL 1S7TB 1INDH 2BSSB 3VWJA 1XGYH 2XXMB 3ZKXC 2WW8A 4H0GA 3RP1A 3B9EA 4M6OL 2G5BB 3WMSA 1IGIL 4PREB 3QUZC 1UCTA 5DMYA 2X4TB 3B5GA 3O4LD 1FZMA 3T2PA 3GEWB 1G7MA 1GC1H 1KELL 1ZE3C 2J8UE 1NGXB 2VLRA 4O2FA 3OKDA 1IC7H 2UWEE 2LTQB 2BRQA 1IZKA 3LSOB 1E27A 1T22A 2V7NB 2AV1B 3WL9A 4MXVE 3HNTL 5DK3A 2MKWA 4NKMB 2ICWA 2GSGB 1HXYA 3JZ7A 3QHTC 5EU4B 1I3UA 1MWAB 1AGCA 2VSDA 1FZOB 4LDOB 3RUGF 4E0RA 3RY6C 4JM2F 4EEEA 3P0VL 1E0OB 1W8OA 5JZ7C 4WDIA 1H3GA 5IB4B 1RIVH 1ZT1B 3MZTA 3SEPA 1BOGA 2JCCF 3MRIB 1JHKH 5HDLA 1SJHA 2HLAB 1UZ6E 3QQNA 3VFWA 4MDJB 4FZEH 4Z7WE 1B4JH 3TPKA 3MV9A 1X5XA 2BHYA 5H35A 5DRNB 1OGAD 1MFBL 1W72L 4XNQA 4DZ8A 2KKQA 5GRVL 5F7WC 3WEXB 1RJCA 2QADD 2OP4H 2PW1B 1DBKH 4PRNB 3LZFH 4HKBA 4RMTA 5JXAL 4G43B 5KAQG 3QEQB 1Q94A 5E6IB 3UYRL 3U0PA 5GS2H 4UAOC 4XPTH 4LIQH 1FJ1A 3K81A 3EYUL 5F21B 5K9KB 3CMOL 4RAUA 1H3PL 4IRJC 4PP2A 5I8CA 3FJTA 4KY1H 5IROC 3PP3H 5J9PB 3BH8A 1W2KT 1FZKB 3VMOA 4TSBH 5FGCE 4IDJL 1JF1A 1A7RH 1U93B 3UAJD 3LZFL 1J8KA 3U0PB 5J6HB 4D9LL 2V5TA 3C2AH 1IKFL 5KVDL 1JBJA 1L9MA 2WUCH 4XPTL 5E5UB 4OFYD 2BXYA 4N0CC 1BQHB 1U95A 3KYAA 2OR9H 3RL1B 3M17B 1WWCA 4KKBC 4ONHA 5FDWB 2X9WA 4PGCA 3QQ4A 1TVBA 4OQTL 3NA9H 4V1DA 4Z7UA 3QHFH 5F93C 3LAFA 4LLUB 5IHZA 3IJSB 3V5DB 4PJ7A 1VDGA 2WUBH 4L8DA 2VERN 4Y19D 2E6JA 4PJIA 4UQ3A 4HJ0D 3ZDXE 3C5SA 3VFGL 4CAGA 4ZFFA 4PJDA 1FNLA 4JO1L 3QFJE 1WFOA 2JIXD 3FQNB 4KXZI 4P23D 3HHRB 2IF7A 3CFKA 5L8LB 2XKNA 4JFPA 2WWMD 2UY7A 3QHFL 2P42B 2VB5A 5EU4A 2EE3A 4WI4A 5ESAB 3GUTA 3U7YH 2PO6B 4E5XB 4M3KB 1H5BB 1OW0A 2R0LL 4M93C 3BP6B 1LDPH 1IGTB 3FO9A 5C86A 1QKZL 1NSNL 1OPGH 2VLMD 5J13C 1FGNH 2DTMH 2QSVA 4JO1H 4RDQG 3WDIA 1CFQA 4Z8FL 2H2SC 4LRNL 4M8QA 2DBJA 1GZPB 1PYWB 2Q87A 5HGAB 1I85A 1OTUD 5TDOA 1HHHB 4UBDC 3RWJA 3P11L 4OGYL 4ODTL 2Z9TA 1X5YA 1ZLWK 2QTEA 1ONQA 2AJ3B 1Q0XL 3S35X 3PWLA 1MHPL 4M7ZC 4TULL 4PJXE 2E27H 4HFUH 4FFVD 3RBSA 5HYJE 1F58L 4PJDE 5E2VH 2ZOLA 3UDWC 4OCWL 3ZSSA 4KU1A 4ZQKA 1RUAH 4K71B 4KGJA 4ZD3L 2NY1C 1B0RB 4Z7NF 4YHZL 3BPCA 2OM5A 3LS4H 4Z9KB 3KDMB 2XY1A 4ETYA 3DMMA 1A6VL 4YXKH 1MRDL 3RZCB 2EDHA 3TWCL 2NY4C 3TBTA 3FMGH 1WZMA 3OGCB 1U8MA 1NFDF 4RCAA 4X6CB 4Y19B 4KUCF 3NPZB 1QFUL 3VG0L 7FABL 4XCEB 1RUAL 2JK5A 2Y72A 3D5OF 5KSBA 3BO8B 3DSFL 2I60L 3MXWL 5ALBL 3TYGH 4CU8A 3FB6B 4HIJA 2GAZB 2VDQL 4PGDA 3H9HB 4N5EC 1YEIL 1AD0B 3L3JA 4Q7DA 1IQDB 4KRPC 3UBXA 2HFGL 2W60B 4IMLB 1T1ZA 4GAGL 3PXHA 1JHTB 2H6PA 4OI9A 1KCSH 2CUHA 1S9XB 5DJ8A 3O4OB 3U6RB 3CD4A 1AGEB 2Q8AH 3SGDI 4IEFB 2QR0A 4M1GH 3FAWA 4N9GA 5ERWB 1JK8B 1M1SA 1A9BA 3O9WC 5DJZB 1NDMB 3VXTB 4EOWL 2Z31B 3I3BA 3F7YB 3MLZH 3UYPA 1I9EA 5KSAA 1HXMA 5F7EL 2ERJB 1U8PA 2OR7A 5FOJA 3MPCA 1RV6X 3QULB 3A6BH 2D31B 1UB6B 2XG5A 5CINH 1EEZB 4HMDA 3BW9A 2QADB 1GOFA 4CVUA 4U1NA 1RK1A 1G0YR 3FCTB 2XZAH 2R2EA 4R6UA 1BZ7B 4CVXA 5I1DB 4FQ1L 3CU1A 4XBEH 4HS3A 1FDLH 5B38B 3PGFL 2YWYA 3L3HA 3ULUC 1KELH 4Z0XA 1PX4A 3H3PH 3GJFK 4EUPH 3D0LB 4G8IA 2CKBL 3QSKB 1BD2A 3VXQA 5TF0A 2BVPA 1CZ8L 3HNTH 2Y25A 2P8LA 4MNHA 4NKOB 2XZAL 3WD5H 3OR7B 5I74B 1G9NL 4HBCH 4Q6YA 2CXGA 4XBEL 3CH1B 3QDGB 4ZDHA 3CDCA 4JFQA 4NHCH 4K94H 3QXWA 4KDWA 3NA4A 3SKNB 3FO1B 3QFJD 3H3PL 4ISVB 3VFUB 2BNQE 5I17A 4NQDA 2NLJB 4QRRB 1S78C 1JHKL 3VXOA 3IU4L 1OGAA 2ZCLH 3SBWC 1CZ8H 2H26B 2H9GA 3HPJA 2D4DA 3VRLF 2D9CA 4L29A 1TQBB 3BN3B 4A6YL 4XH2A 1P7QA 3ILQD 3EYVB 1RJYB 3NZHL 5DJAB 4ZUSB 4YFDB 4DN4H 3CU7A 4D0CA 4A2MA 1CFSB 3MCKB 2Z4QB 4FNLL 4YDKH 5C08A 4FTVD 2X10A 5TH2B 3RBGA 5D7IA 2E3VA 1OVZA 4JY4A 4OCXL 1D9KD 5GJTH 2FB4H 5E2TH 3ME0A 4DGVH 4RZCA 3OAZH 3EYOB 4HJJH 4NCC1 4KQ3H 1QPXA 3SGKA 2IANB 3PQYB 1SYSB 2GTWB 2A74A 4DN4L 3BVNA 2K7QA 1Q72L 3VGAC 2YK1L 4MX7A 4Z78B 3D39D 4OZGA 4S1SL 4NQEE 2PKDA 3SGKC 3HE7B 2G75A 4MCYA 4HS6B 4LCYA 5TE7L 5D93C 3FTGB 1QBLL 5INDB 5EPMB 4GLRH 3S88L 3EO1B 1SBSL 2AAVA 4OD3H 3GMPB 4UQ2A 1M6OB 4EI5D 1MH5A 4IS6A 4LVOC 5JHLH 5EDXA 1UM4L 1X5AA 1FYTB 2YRPA 3ZKMD 2IQ9H 3NCMA 3OGCA 4JZOA 5HYFA 4JVWA 1NCAL 1CXKA 3LEYL 3VRLE 4XGZB 4XC1H 4EI5A 4LU5L 3CIQA 3RVWD 5DHYB 3OJVC 4O2EB 3PNWB 2AJUL 5TE7H 1T3FB 3QDAA 5BV7C 1YEEL 1M6OA 4JQIH 4WO4D 3CZFA 3KPPA 3VWKD 4HMCA 2OTWA 2IAMC 4FQQB 4S2SB 3SJVB 1GZQB 3KLSA 4FXGA 4DWHA 2VQUA 3VFPB 5D7KE 1YEJH 4MJIE 3HRZB 3RIFK 3LRHA 1F02I 1ZK9A 2ADFH 3PWPD 5FCUH 4OZGB 4ZUVB 2C3WA 4KZEH 3E2HC 2LVCA 2W07A 1S7WB 2AV1A 3WL9B 3BWUC 5E94A 2HN7A 4QOKD 5D7LE 4G42B 1LO4H 4AL8H 4NQDB 2ATPB 3HUJB 5K59F 4OF6A 1RD6A 4LHJB 4X4XB 2AV7B 1KIQA 1T1XA 5IBUB 1F4XL 2VL5A 3INUL 1BQHG 1G6RB 4NKMA 3BZ4B 1Q9LB 2DDQL 3AREA 3EJYC 1JHLL 2ICWI 1YEFH 2VZ1A 5EBMB 1LO0H 4I18C 4Y4FC 3WDJA 4PJ5B 1A02N 2EIZB 3RX8A 5HGGS 3RJDA 1T0MB 5FCUL 3MROA 5A43C 4KZEL 2E27L 5B3JE 4XMPH 3UTSB 1CFTB 4NZUL 4JHWL 1OAUL 3H9ZA 3KDMA 2C1PA 4J8RA 4QF1B 1I3VA 3ULSB 3VDAA 1WUNT 2NW2B 3RKPA 4R8WH