5SWZE

Crystal structure of np1-b17 tcr-h2db-np complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
240
structure length
240
Chain Sequence
b'TVKQNPRYKLARVGKPVNLICSQTMNHDTMYWYQKKPNQAPKLLLFYYDKILNREADTFEKFQSSRPNNSFCSLYIGSAGLEYSAMYLCASSRDLGRDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
molecule tags Immune system
source organism Mus musculus
publication title Reversed T Cell Receptor Docking on a Major Histocompatibility Class I Complex Limits Involvement in the Immune Response.
pubmed doi rcsb
total genus 48
structure length 240
sequence length 240
chains with identical sequence J, O, T
ec nomenclature
pdb deposition date 2016-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swzE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5swzE01
3T3PE 4OFIA 1YEJL 3WIFA 3LKSB 1C5BH 1K4CA 3D5OF 2R0WH 3ULVL 4NC1C 1BZ9B 1JMXA 3MLSL 5D7SH 2W9DH 4FXKB 1OCWL 3ZTJH 5DYOB 1OPGH 3MRCA 1Z2KA 4Z18A 3B3IA 5JXEC 4QY8B 3WNLA 3RWIA 5EC2B 2VXVL 3B6SA 5IJKA 4Y5VB 4JKMA 3VXNB 4PRBA 4IRZL 4MJ2A 2JF1A 5CKAA 2BSTB 4ELMB 1LEKA 3K3QA 1XFPA 5FF6A 5LWYH 4LLUB 4E42A 1F8TH 3RNQB 4LHQB 1WZLA 3MX0A 1IC1A 3BZFA 3C5ZC 2VLRE 3LPFA 4K71B 4JJ5B 4WRLA 3R8QA 1QSEA 5E2TL 3FZUD 1KCSH 5EU3B 3V4UH 2DQCL 4K3HA 4YO0B 3C2AL 1T03L 5MERA 3FONB 3VJ6A 1FLRH 1DUZB 1S7UB 1HXMB 4LLDA 1NGQL 4PY7A 4WO4C 3VGHA 2R2HB 3WJJC 1IM9B 1PKOA 3S37X 3RL1A 4QRQB 4WY7L 1NL0H 1NGYA 2Z31D 5FV1L 3G04B 3BQUD 1I1AB 4PRIE 2BXYA 5IOPA 4IMLA 4U1HB 3HE7B 2IFFL 1RUPH 4XPTH 3Q5OA 3C60A 2VDML 1KCKA 35C8H 4IIQA 3UTPE 2F8OA 5IHBA 4QRSA 2CJUH 3HI5H 4PTUB 1KJMB 3BE1L 4X5XA 2DQDH 4PV9A 5ITFB 3PDOB 4EXKA 1F2XK 3CFIC 3GZKA 3VXMA 2VZVA 3MRDA 2X40A 2VAAB 4QTIL 3QNZB 4L29A 3OHXB 1A6TA 4PG2A 4N8VG 5F7NC 3V4VL 4DAGH 1HCVA 4NRZA 4N90D 3A67L 5HYIA 3S5LA 2UZIH 1N6VA 4OTXH 3JV5A 4R90L 2KBGA 2EC8A 4I5BA 4NQEB 1CT8A 2HT3D 5C2BL 5CJXA 1RZGA 4LQ1A 4NNXA 1YPZF 4N9OB 4XAKE 4HUNB 3BGAA 1TJGH 4JFHD 3PIQA 4EKXA 1FYTB 1TVBA 2OM5A 5FYLL 3KYMA 3RIAF 3U7WL 5ICZA 2DM2A 1AD0B 1VHPA 4TVPL 4IDJH 2Z4QB 3RWFA 1Q1JL 1MSPA 1FYTD 2VZ1A 3AM8C 3NA4A 1A0QL 3LKQB 3MLWH 4G9FB 5FK9A 3HMWL 4NFDA 5E00A 1W0VA 3LN4A 4GMSL 1S7SB 2I60H 4MD4B 1ZSDA 2JK5A 5E08L 3MNZB 4KK6C 3DO3A 4MZ3A 4N0UE 3B2UC 3TIDA 1RU9L 5IR1B 2DD8H 5C9JB 2Q6WB 2UZXB 3ARDA 4PJFF 5C08D 4XNQB 1NLDH 1R5WB 1A21A 3DYPA 2WW8A 3WCYA 1QR4A 1BBJA 1VFBA 4YUEH 3U0WL 8FABA 5DK3A 5IWLA 4UINL 3GHBH 3QQ4A 4H20L 3QUXC 3VI3E 2X4PA 1U8NA 1ZA3A 4KK9C 1SVCP 3D3VD 4XCEA 2XNAB 3OKMA 3RY6A 1A64A 4LP5A 4S1QH 3DX6B 2EDKA 3LDBB 1KFAH 4PG9A 5TFSH 1F2QA 2X41A 3CFEB 1MAML 5CWSB 4D0BA 3TA3C 5INCB 1EEUA 5FGRA 4F3FB 2APXA 5C0RL 2IQAB 4XCNB 1EZVX 3WLBB 5H94A 1QFUH 2Q87A 3MCLH 1WJ3A 3MQIA 2DRUA 4WTXA 5IVXE 1F58H 3JWOL 4MA3A 3RY5A 2BSED 2X9YA 4NDMA 4KI1A 1RUAL 3FQRB 4FZEL 1H3VA 4L4VE 2DQHH 5FKPB 3AS2A 3KGRA 1UVQB 3CXHJ 4FTVD 1I7UA 1QD0A 1YNKH 2CMRH 2R4SH 4GJTB 1QFOA 4M93B 2EC9U 4YR6B 1TQCC 4PJ7E 3ZDZE 4KI5E 4C59B 4JFOA 2ARWA 3PGCA 3LQZA 2KKQA 4WTZG 4Y19E 1HZHL 1MY5A 3L3JB 2KPNA 4FFVC 5A43C 3U2SB 2ATKB 4YEFA 3CC5B 4NFCA 5DVMA 2BP3A 2OCFD 4JB9H 3KR3L 4OLYH 2R1XB 12E8L 2YUXA 4OZ4A 5DQDH 2YBRB 4G80A 1FGNH 5L6YH 2W0KA 1FL6B 1CZ8H 2Z93B 4QXTA 3TJHD 1A8JH 3JVGA 3U9PH 4UTAH 1CBVH 3HZMA 2AJUH 3H9SA 5A2JH 4ELMF 5D7KE 4MQ7A 1KTDB 4X4YA 4S1SH 1NDMB 2PR4L 4X6CF 1MEXH 4XC1L 3SCMB 4FQIL 2ATPB 1VDGA 2R23A 5MP6H 2WUBH 5IVZA 1C16A 3CFBB 3WIHH 3VXMD 3FB8A 3TN0D 3AU1A 2VUYA 1A9EA 4PGBA 4PJGB 4IOIB 3KXFA 3KG5A 4MWFB 4YEEA 4EDXA 4PRIB 5IMMA 4IDLA 5K59F 1T20A 4U6YB 4R8WL 5HHXH 1ZVHA 4XVJH 2FGWL 1KSRA 4X9HA 3HE6C 5I8OL 4L8SA 5JQHC 2VLJD 4GUPA 2IALB 3GSWA 3O3BB 3KNBB 1MI5B 3HG1A 4GT7A 2BY2A 2HJFA 3LKRA 3AREA 1DFBH 3MRHA 1WWCA 1NGXB 3RPIA 4APQB 3ARDC 1CFVH 1CVRA 1C16B 1MWAL 4J6RL 4P5TB 5EZJA 2EYTB 2PXYD 1FE8H 2VN4A 2YSSA 32C2A 4N1CA 3FB7A 1YEHH 5BMFL 3JUZA 1ZGLA 4DUVA 1K3ZA 4UDTA 4YK4C 5SX4H 5FO9B 2IAMD 3FFCA 4JHWL 4BSWA 1EDQA 1NCNA 4JR9L 5IFHH 5B8CB 4I18C 4B5EA 4YIQB 1JNHB 1CI5A 4WU5B 1RZ7L 3DOSA 1IGJA 5HHMD 3HTLX 2H8PB 4L29B 3TM6A 4J23A 4PD4K 5EFIA 2E6JA 4TVPE 4JVPA 1X3DA 2P8PB 1BQLH 2VL5A 4LSSL 1JHLH 4XPGL 3RZCA 2DF3A 1VSCA 3AVEA 4PJ5D 5CP3H 3GKWL 1NBVL 4J3TA 4LRIC 4EN3C 1WK0A 5ICYB 2YPKB 4CMMA 4MS8D 1R5IB 1A7RH 3PHOB 4JFQA 1I4FB 2F54A 3WXVL 4V1DE 5CCKH 3VCLB 2DKMA 1E4WH 3FB5A 1XCQB 3ABZA 2AK4D 2XWBB 2GHWB 4UBDC 1OTSC 4ZUSA 4M62H 1FAIL 1NJ9B 3FTGA 3HRPA 3RP1A 4MVBC 2W9LA 5TDPA 3VXPA 4UV4L 5TDOB 3UZEA 1A7PH 3OKMB 4GW5A 2FIKA 4YXKL 3BRDA 3HNVL 3GBMH 5C3LD 3ARPA 5GGRB 5AUMB 4WGWB 4KHTL 2H26B 4F8QA 4L4VD 4NZRH 5GRUH 4WV1A 3OG6B 4QHUA 3C08H 1F4YL 3O9WC 5E8DL 2PW1B 1JWSB 1G9NL 2E7MA 3TWCH 3ROOB 1C5CH 1PLGL 1E6OH 2AK1H 2P5WD 3PWVA 3MFGB 4EN3B 1LO3L 3WIHL 5FF6B 4OD1H 4BZ2L 1KIPB 5E99H 4AENA 1VEOA 4YFDB 4YHML 4NCC2 3B9VA 5I16A 3HZKA 4CBPA 4F80A 1U3HC 3QI9A 3IFPB 4GAJL 1OM3H 4NO2B 4CNIB 4G9FA 3RVXC 1KV3A 4GSDL 4MAYD 3GIVA 2C1OA 3F5WA 3LN9A 5C3TA 1F5WA 1N2RA 1QSFE 3RWCB 4H1LG 3V4VH 3WN5C 2P8PA 4OLXL 5JPNB 3MACL 4HZAA 3IXAB 3I75A 3T0XA 1IAMA 2VB5A 1BIIB 3P0YL 2H2PD 3S3PA 3KDMB 3CIQA 4ONGH 4N5EC 2GJ6D 3OX8B 5DRXA 3WNKA 5IVXB 1NMCB 5KVEL 2E7LA 3PWJA 1FORL 1MCDA 2XZAL 5DR5L 1FPTL 2VLJE 3VA2C 4RGOL 3DROA 3LQMA 5BW7A 2HJLA 4ZAKD 5LCVH 3VU2A 5L88H 5ALCH 3CFJA 1KN2L 3L3DB 4MA1C 5JPNA 3SDAA 3MOAL 5EIVA 5BZWB 3MZTA 4I2XE 2VQ1A 4HZLA 3BO8B 4OQ1A 1AGCA 4X0KB 1TJHH 4M1DL 5I18L 25C8L 2NY2B 2YSSB 1LO4L 3PQYA 2A73A 5ID0B 2YA2A 1EBAA 1EX0A 3DMMC 5AZ2L 5C0AA 5JO5A 2QV2A 2HFFA 3OG4B 4J4PA 5J1TC 2NR6C 3T2PA 4WEBH 4P2OD 1U8LB 4ZSOE 2HJFB 1YYLL 4HGWA 4OCWL 5DT1L 3EHBD 4ZTPH 5I9QC 3GMMB 4JQXA 1T7ZA 1P1ZA 4H26B 1TIUA 1XF4B 2AV7A 4JM2C 1F3JA 2GJZB 3PWVB 4Y4FB 1A6WH 3L3IA 3MLRH 5TE6L 3L3KA 1GGUA 3EO1B 4G6JL 3GRWH 4LBEB 4JZOB 1V5JA 2OR8A 4HXAL 2IAMA 3FFCD 1ZHLA 1KFAL 1NAMB 5TFSL 1HYSD 4OLUH 4P2RD 2EYRB 1TMCB 3T0BA 2IH3A 2OZ4A 1FG9C 1OP3K 4OCMC 2ATPA 1AO7B 2X4RA 3LCYA 5BV7C 4C54A 1D9KB 4HKJB 3AROA 2QQLL 2D7PA 3NABH 5D5MB 4XGZB 2DS4A 4RMRA 2C3XA 5KSBA 1SJHB 3PGDA 3RNQA 1Z9LA 3QUXB 3ARFD 1S9KC 1U3JA 5I1AB 1QSVA 2NY1C 5DHYA 2B4CC 3ARED 4AZ8A 4O58L 1I8IB 4ZS6C 2NYYC 3E3QE 3PQYD 3L3GB 3DSFH 1CR9L 4PJFB 2GI7A 2DBLH 4P46C 1WC7B 4ZFZB 4Y2DB 2FEDC 1YNKL 4KGLA 5JUEL 1JGUH 3ZE2E 3MRKA 4OCLC 4KKAC 1EAPA 5E9DB 3BSZL 3TVMD 4QNPE 2CD0A 3QYCA 2OR9L 1YY8A 1JNJA 1RZKL 5TPWH 4U49A 4XI5D 4KFZC 3QR2A 2A83A 4ZFOA 1T0MB 5IB4B 1LP9F 4WI6A 5LQBL 3WSQL 3GJEB 3V4PH 1DBMH 1F97A 1CE6B 3VRJA 1UVQA 2HT4C 2PTVA 4U1GB 2P45B 5D93C 3L7EA 4Y4FC 3HC4L 2NXYB 2AJ3B 4K3JH 4MA3B 2BNRD 1OAZH 3H9SD 1LK2A 4PYGA 4UU9B 2DIAA 5E6ZA 1JN6B 2QTEA 3OBAA 5JDSA 3WN5A 5C92A 2Q7YA 5C08E 1KPVB 3L6FA 4UT6H 4XC1H 4WW1B 1NMAL 4XCFL 1G9NC 3X11A 3QI9D 2VERN 1K9TA 5T3XE 5KVFH 2E7LC 3CK0L 4XZUB 4RX4D 5ID1A 4HHAB 2R2EB 5IHUH 1U8KB 3IDJA 4Y7MA 3CGTA 3KLAB 1K5NA 15C8L 2AJVH 4HBQA 5JIPA 4FFWD 3W9DA 4OJFL 2DWDA 2KZ1B 2RJMA 3BQUC 4O2CB 4IMKC 2R0KH 4LEOA 2V5RA 1YC8A 2AGJL 3B9EA 1M7IA 2XI9A 3BE1H 2I9TB 4KGJA 1JRHL 3BGMB 4MS8C 5AZ2H 3S4SG 2IPTH 1R5WA 1JPSH 4JFFD 1A1NA 4PGJA 2DKSA 1XR9B 4LKXA 4BSVA 1IM3B 1ZS8A 1Z9MA 2BNRE 5BQ7B 5HI3C 3U36A 4U3XA 3RU8L 3OKEA 5DJXB 4XHQA 4U6XA 2DWDB 3O6MH 3GJFK 4GO6B 3BX7C 3QCVL 1A4JA 1LQSR 4ODXB 3KLAA 1BBDL 4K8RD 5JZ7C 3PABA 3D0VB 1RJZB 1A7QL 3FT3A 5HYJD 1MRDH 1NDMA 3ZMRA 2CLRA 3N1PC 3W0WA 3L5HA 5ICZB 2WIIA 2MTPA 3QO0B 2AW2A 3GMLA 4C57C 4OZHA 4PJGF 1QFUL 2HT3C 2XKNB 3HLAB 4Z77B 1FNEB 3VFVA 1R5VA 1Q8MA 1X5AA 4P57B 3ARZA 1X4ZA 1PQZB 1ZT4A 2CIKA 3VE0B 5JOFA 3PWUA 2VDKL 4RFNB 4JEGB 3V6FB 3QNYA 1WEJH 1NLDL 2DQFA 4XP4H 1NBVH 4YR6A 2NXYD 4GS7B 2DQFB 3W9EA 5IQ7H 3OAUL 1QRNE 4PRPB 2YR3A 1EAPB 1N59B 3MRLB 3X13B 3Q6GH 3T0EC 3MV8B 3MYJB 4PJDB 3FQRA 4BH8B 5J56B 3ULUD 2BVOB 2XWJB 4EUPB 5DDHA 2MCG1 3S96A 3D39E 5DHYB 3I50H 1N4XL 5GGVH 1B4JL 1MAMH 1IARB 5DRNA 3U7YL 5T1KB 5INCA 2MQCA 3MLPA 3VXSA 3R4DA 2Z31C 1I7ZA 2YRPA 1NC2B 3BD4A 4Z78B 3MCLL 4PRDA 4KHTH 3GSOB 1I9IH 1BECA 5B38G 1JF6A 4C83B 1KEGH 1NAMA 5C86A 1IKNA 3EYOB 4LSPL 4XMLL 5ADOH 4MHHI 3VXOB 3MLYH 5H37G 5D8JL 3D39B 2AK1L 1GZQB 4DJMA 3EYUH 3RL2B 2JCCE 4OD2B 3UJIL 5J13C 3U36B 2GK0B 4OFKA 4QYOA 2IFGA 1UJ3C 2HAZA 3EFFA 3ZTJG 1JVKA 3QDJB 4EXPX 2VDNH 3FQTB 5C8JA 5D7IF 1PDKA 2ENSA 5LGJA 3U0PB 1UCTA 4QHLB 3O3AA 2IPUG 2GJ6E 2HG5A 4OZGB 5ESQA 5EB9A 2F74A 2WWMD 3EAKA 2JK5B 1N5AB 3N9GH 3DYOA 4YNYA 1CDIA 1OWRM 3AMLA 3DVNA 5EIQA 3QZWB 1M05B 5IEKA 3SKJL 4UV7H 2GSIA 2XKSA 4IM8A 3NACL 2P1YA 1QSFD 1EUUA 1ZVSA 2P24B 3QCVH 5JR1H 1UH4A 3LKSA 3HCVB 1AGBA 3QSKB 4JDTL 3AUVA 4JFEE 3SDAB 3WFEL 2JELH 2VO5A 4QLRA 5DXWA 2Y7QA 1INDL 1IFHH 3P0GB 5BV7L 4KZEL 1CK0H 1D6EA 2EDDA 4GLRH 3RPKA 3ES6A 4M6AA 3WEXB 3FOMB 5ADPL 1JFQH 5M94B 1KPUA 5CEYB 5C0EA 3UPRB 1MOEA 5ITBL 1EHNA 1EHLH 4NYLB 3U7AA 1DQDH 5E2UL 1YQVH 1CDYA 5DJCB 4L3EA 3OJDA 3EZJB 3VXQB 4FTVA 2O5ZL 3VWKA 5SWSB 3P4OB 1E4KC 3P11L 5D5ME 3MRMB 3DMMB 4LPTA 4DKAA 2X4OA 3RWCA 2ZOKA 4JQIH 2X05A 5C0IB 1NCWL 4YPGA 3ARYA 5F9WC 4NBZB 1SMAA 3LSOA 3TT3L 2K7PA 2FJHB 4K7FB 3ECBB 5I1CL 5I74C 2B5IB 4KMTH 1I1CA 2FJFB 4KU1A 1J88A 4UDUB 3CH1B 5F3HA 5IQ7L 3V95A 3MRQA 4IHOB 5TQ2L 5C9KA 3U0PA 2NY0B 4M6NH 3NIDF 5C8JB 4PLNC 5L7XL 3HRZB 5TGBA 1HNFA 2FHFA 5IFHL 1I8LC 3GMRA 1BZ7B 3O6KH 4FNLL 3VG0L 4BQ6A 2O5YH 1I3GL 3JWDC 2P5EE 5L8JB 2HFEB 4OLWH 3SQBA 3BP5B 5C0AE 1NANH 2BFVL 2I26N 1U6AL 5L2KE 1RIUH 1CGUA 5IEHA 5MHSD 3TESA 1G7QA 5E8DH 4N1EA 2EE6A 1I9IL 4NNYA 1ZXQA 1CLYL 4UNUA 4DW2L 1KJ2B 4X6BA 2MNUA 1DE4A 2VDLL 1P1ZB 3G6DH 1P7QD 1JNNL 1OQXA 4OBRA 4PREB 4NKOA 1LEKB 4MNGA 5E99L 4DN4L 2BRQA 4XNXH 1MJUH 3IDNB 1JIBA 2B20A 1Q0XL 1U91A 2CSPA 4RX4A 5C0DB 2ED8A 1HHIA 1DEEB 2DLIA 5C0AB 2FJHA 2KH2B 3LDBC 2CDGA 3OJVC 4FXKA 4DFIA 1Q72H 1XZ0A 4JDVA 5A2LH 2J5LC 3UC0L 3DBXA 1WZKA 1XT5A 3KVQA 1FL5A 5C70A 5I2IA 2BNUB 3PHSA 3MO1A 2E9JA 3P4OA 1SBBA 1SBSH 4PJCA 3WS3B 2DMBA 2VNCA 3E6HA 4CVUA 3RTQD 4NYLA 3VXTB 4HKZB 1X5LA 4MX7A 1Z9SA 1ADQH 2EDBA 5JOFB 4CUCA 5HDLA 1INEL 3LPGA 3QIWA 1FPTH 5F72S 1LEIA 3HLAA 4QOKE 4Z77A 4ZD3H 1RJYA 1U3ZA 5DUBA 4ZUWA 4YDKH 3C5JA 1ACYL 4EUPH 1T1WA 3HCVA 3WDIA 1E6JL 2OQJA 1IEAB 2YPLA 5DVLA 5D2NA 5FGSA 5SV4A 2AJVL 2D3VA 1HKLH 2DYPA 1GAFH 4M3JA 4GG6B 3NMEA 4GRWB 4MXVE 2IEPA 5ESVB 1DJSA 2CKBB 5F6HI 3SKMA 1LEGB 2IANB 3OMZA 2DQUL 2NY7H 1DZBA 3AMKA 3AREC 2HG5B 5I76A 5KTEL 4GUPB 1IM3A 2YXMA 2Z8RA 2C9AA 1HNGA 1VEMA 3SCMC 3MACH 2GSGA 4LU5H 1CD9B 3V0AC 4G6MH 4E5XA 2PW1A 4Z8FH 1F8TL 3DI2B 3STLA 1DN2A 3LS4H 2DI9A 3VD3A 4PJHB 2VC2H 1RK0B 4PJ8A 5C0CE 5AAMA 2AJYH 4N0CD 5DRZB 5ACLA 4MD0A 3TYFB 4Z7QE 3UTZB 4NO0D 3ZYOA 1Z3GL 5C09A 4WUUA 4P2OA 1JGVL 4HX1B 4CN1A 2VISA 3HE7C 4OLWL 4RAVA 4FQXC 4M8VA 5HDBE 1LP9B 4UU9A 4M6MH 5FHAL 4FXLA 1ZT1A 4OCYH 4PJAF 3CX5K 3LQAH 1AY1H 3RKPA 2NY2D 2R29H 3Q2CA 1EVUA 1I7TA 2WK2A 2OX5A 4IBLT 4M5ZL 4WO4B 2YEZA 1REIA 2L0DA 3W9EB 4YDJA 2FSEA 1MVFA 4J3SA 1O7SA 2AJZB 4D9QD 2MHAA 3MLRL 4JFED 4PIRF 3MBEB 1Q72L 4OB5L 4D9LH 1FO0L 1WTLA 4HXAH 4NQED 4XNMA 2Z31B 4FQHA 2HVKA 4Y2DA 4TNVF 4ODTH 4P57A 5I6XB 4RQQA 4HG4K 5LGKA 4TYUA 4P48A 3WLBA 2HTKC 2AXFB 3SDCC 3U1SH 4BSWB 1ZLUK 3V8OA 1MCPH 3W5NA 3VWJA 5IQ9A 4UT6L 3O81A 1LNUB 4TTDD 4AM0B 3GSUA 2WIIB 4KDVA 3GSNA 5E8OB 4RNRA 5LJYH 1EFXB 2IAND 2OLDA 2YOCA 5E1AB 5GS1B 1TJIH 4X8JA 3D18B 5IHLB 2Q3ZA 3RWEB 4RFOH 5IW3A 1RVFH 2D31A 1FYTE 2X4PB 4TVPH 5GSRB 2XG5A 4APQA 5I8EA 5DMIL 4R9HA 3RPIB 5B3NA 3LMJL 2R1WA 5J3HD 3BWAA 3VXME 5IMOA 3OKEB 3RDTA 1D7FA 5D7JC 2APFA 1I9JH 1GXEA 3H7LA 3L3IB 4L4VA 3OKNA 1KNOB 2W38A 5LQBH 1G1CA 5D2LB 2IH1A 4X4XB 3O8XC 4PRHE 3HKFA 5ESAB 1G7IB 1L9MA 1AIFA 5GSVB 2J7LA 1URLA 4NC2B 3GKZA 4N90E 2VSDA 4JZNB 4X6FA 3RVUC 2AXJA 3KPMB 3MXVH 4MD5A 2CKBA 1JV5B 5INDB 1J7VR 4N0FA 5EZIL 3ET9F 4XVTH 4WHTA 1KYOK 3MXWH 1HDMA 5HHPA 4WIQA 3VXRE 3WKNA 4HUXA 3CSGA 5LXGH 3UTPD 1FL6A 1Z5LA 1T80A 1S7XA 5L8KB 4U33A 2ZNWA 2HJLB 4HJGB 2IC2A 4JFXB 1P7KB 1A47A 1DL7H 1YQVL 1MCJA 2R0WL 2HVKB 2EH7H 3S5LB 1M71B 4P46D 2ZCKL 4OM0H 3U2SA 4JRYB 5I0ZA 1MQKH 4NGHH 1WUNT 5DJYA 4ODUB 4KXZI 4F7EA 4KZDL 3BPCB 4PJCB 1I1FB 3LQAL 5CZXD 2Y5TB 1OAKH 5DJ0A 4X5XB 4TUKL 1AQDA 1S7RB 4YBQC 3X3GL 4DOHE 1Z0NA 1I7TB 4WO4A 3O6ML 4QRSB 4UOJA 3B9KB 4NQDA 3LS5L 1HOCA 3BP6B 2FIRT 3PXHA 1AFVH 4HT1H 3RJQB 5HYJE 2JJSA 3L3GA 4U7MA 3KJ6H 3UJTH 4M6NL 4PJIF 3HB3D 2WLYA 5DD3H 2DTMH 1OSPL 5C6PB 2PXYA 1I8KB 3GJFA 3G5YB 5GZOD 2H2SC 1FGNL 4KROC 2C3WA 1T6WA 4XCCL 5D5MA 4FFWC 4ODHL 4Q2ZA 1IM9A 2Y6SD 3JBG7 2V17H 1FVCB 1N64H 2PR4H 5E70A 3G5XA 5GHWL 2EICA 2F15A 2WV3A 1XGYH 2VJXA 3NTCL 3KPOA 4IRSA 5HPMB 2AXGB 3B8SA 1WEJL 4Y16D 1G6RL 3INUL 4CJ1A 4P3DB 2KUTA 3ALWA 1RUPL 4NQXA 4XPTL 4NO3A 5E5MB 3RNKB 4YGVA 3TN0A 1CE1H 4R0LB 1FFOB 3T3ME 1XGUA 3D1MC 5IFAH 1XCQA 2VDRH 5JHDB 3Q6GL 5BVPL 3F12A 4KK8D 3BWUC 4U1JB 4QWWC 3UDWC 3E8UH 2OJEB 4JGUA 1S7SA 5D7JA 2BRRL 4D8PA 2P5EA 3WDJA 1EXUB 2WWKT 5GS3A 3PQYB 1PAMA 1S9WB 1B0WA 5A16B 4PRNA 4GRLC 5H2BA 1TTUA 3S98A 1DANT 4S1DC 5E4EB 5BXFA 3HAEH 4MAUL 3ZKMC 2G5RA 5CGYC 4I2XB 5EBWB 2FBJL 1ORQB 3CFCL 2ITDB 1I85C 3T4YA 3TEUA 3ROLA 3W11C 3BEWA 3LEYH 3MUJA 4GMTH 1J0YA 3WEXA 5FYJE 5LAXB 3N85L 5IBTL 2OP4H 1HI6B 1A6TB 4KV5F 1IAOA 4O2FA 5KVDH 3DRQA 3P0VH 3WS6C 1OY3B 4PB0H 4GBXB 2JB6A 3WFHB 3S7GA 2A77H 3P4MB 4ZS7L 1JTPA 1MCWM 5HHOD 5T33H 5D4QA 1RU9H 4ZG1A 2A9MH 3OF6A 1NBQA 2J6EH 3MGTA 1HYRC 3PDGA 1Q9LA 1NEZA 3BN9C 3HMXA 1RULL 1XZ0B 4NWTH 4X7TA 5EOTB 4ONHB 1T1XA 4IIQB 2RFXA 1HWHB 2VQUA 2OL3A 4KAQH 1UXSB 4Z5RA 3VD9A 4Z7NE 1MI5E 3JV6A 4YFLF 3R0NA 5HD8C 5AWNH 3FQUA 4Q74A 5TE4L 3OSKA 5J6GB 3H6JA 4QF1B 1L0XA 3CVIH 5F7YC 1NLBH 2EEAA 2RCSH 3S35X 5E5MA 3RNKA 1CXFA 4OCNC 3RL1B 2CR6A 4L4JA 4XBEL 1FNFA 1ZK9A 2ICWJ 4M61A 5IEHB 1CCZA 5EWIH 3KJ4B 3CXDL 4LSRH 3VGFA 4OI8A 5F89A 4WJ5A 2BFVH 1YUHA 3EIFA 4GW5B 2V2TB 1MWAA 1WZ1L 4CAGA 5A40E 3W39A 1FVCA 2B1HH 4HFWA 1TTFA 3TIEA 4NWUL 2B39A 5TDOA 5DD6A 3MRGA 5I8CB 4G8IA 1WAAE 3HZMB 5TH2B 1E28B 2XKUA 3MUZ1 5BS0E 1OVZA 1JTTA 5GZNC 4CMHC 5IG7B 1QFWM 3CCHB 3WFCL 2IWGA 4XB7A 3T08A 4DEPC 4FXGB 3T4AB 4HDIA 3VCLA 2F5AL 5DDHB 3EO0B 4RQQB 3C5SA 4C56A 1B0GA 4RAUA 5K33A 2Q76B 2DQTL 3G6AB 1CF8H 1GGTA 4JG0L 4LAQL 3B9KA 3PP4L 4NQDB 3CZJA 2X4NB 3DPBA 5ERWB 3O11A 2CO7B 4TRPH 1UZ6F 1AQDB 4DZBA 2F5BH 1Q9KA 4DZ8B 3KR3H 3O6KL 3LRGA 4GRWE 1MNUL 4OLXH 4NIKB 1IGMH 1KXVC 3U9PL 4P23A 4V1DB 5HDQH 2QR0B 3LRSA 4IRJA 2XA3A 3ELAT 5KVEH 1XH3A 1RUML 1E27B 5MP6L 3IU4L 1EO8H 3WO4B 1JPGB 4EI6A 1YEKL 4WCYL 4X6DB 1ZHBA 3OXRA 1U58B 3KS0J 2EKJA 1C12B 3LEYL 4U1SB 4HX1A 4ALAH 4BUGA 4LVEA 3CDFA 4M7LT 1CXKA 3VDBA 4QXUH 2DQJL 1T1ZB 2VLMD 1ZA3B 3V0WL 3U46B 3VFRB 3FT4B 1RK0A 5GGQL 1T89C 5FYLD 4GBXC 5EU4B 5EC1B 3MJ7B 3ORJA 4Z76B 2QSCH 4MQSB 4LCIH 1AQKL 2PO6C 2ZUXA 4G42A 3PWLB 3F6LA 1ZANL 4QTIH 4OF3A 5JHDE 4JFYA 4M4RA 3RBGA 2EDRA 3EGSA 4L1HA 4ZTPL 5BZDA 1J8HB 4OI9A 3VGEA 3MUGA 5IVNA 4KRPC 2Z8VC 1GZPA 4E41B 3DV4A 4JJHA 3RVUD 2JIXB 1IGCL 2NZ9C 3BP4B 2YWYA 4ORGA 3MBED 4PUBH 1E0OB 5DMGD 5C1MB 3MROA 1S7TA 4PLKC 3VFTB 2R23B 2ITCB 5ID1B 5I66A 4XRCA 3S36H 4Z78A 1MFCL 4OLUL 5GS1A 4P5TC 3C6LC 4YFEA 2EDOA 4JLRA 2F19H 4XCYA 1LE9B 4XVSH 1YEDB 2Z92B 4Y1AB 3VGGA 4KI5C 1B2WL 1V3MA 4GAFB 4M6ML 2XPGA 3AXLA 1OAXL 4FS0A 1LD9B 4FQCL 4AEHH 4G6AD 5T5FL 1JGEA 4KMLB 2G75B 1FH5H 4WW2C 1QSEE 2ATKA 3PWPA 5KTEH 1T5WB 4ISVB 4L8DA 2O61B 4NRYB 3DURA 2V7HB 2BMKB 5FO7A 3BZ4A 5HBBA 2ZWLT 4JGMA 1J11A 3PDOA 4S10A 3WXVH 2HMID 3BPNB 1Q9KB 4G6ML 5DJDB 1WQVT 1N7MH 1QHPA 3M17A 3RY6C 4WV1C 3SDDD 5HVFB 4M62L 3P9LA 5ANME 3TZVA 2DTML 1RUKL 3AXLB 4JPVL 2EIBA 3KYKH 2ADJB 4LPWA 1FYHB 4Y5YC 5AYQA 4BH7A 4FXGA 3D69B 4AIOA 5FEBA 3FAWA 1K85A 1DLFH 4QNPF 2X7LB 5T1MB 4JZJB 5FUOL 2RQ8A 2Q8AH 1FP5A 1PY4A 1U3HA 3CFEA 2XFXA 4P23C 1F3DH 3IDGA 5JDJA 4YHKH 3I6LE 3L9RA 1SEQH 3UPCA 5EU7E 4RFOL 1C5CL 1PLGH 2DQIL 3IDYC 3ARGC 1KB5A 4HSQA 2VDQH 1WBZB 2E3VA 5EA0H 5KAQG 5A2IH 1S7UA 1NCBL 5FUCC 5MENB 2IAMB 4ALAL 3QEGH 3QXDB 2EDTA 1SY6A 3ZYJA 3MNWB 5DJAA 5A2KH 3GMRB 4LKXB 4NUGH 4OZFA 1PEWA 5ANMB 3EW3B 5IK3B 3V0WH 1AGEA 1T66D 3H0TA 2EDYA 2CH8A 3L95B 2P47B 2NX5E 5D7KD 2BOCA 4ONFH 1KOAA 4CKVX 3EYVA 4R2GD 2CRMA 4CRPA 3UP1A 4HQQH 2HFFB 3EZ8A 4JY5L 4K7FA 3C2SA 3W81A 2LTQC 1EGJH 5DUMH 1T1XB 3T8XB 3W0WD 2A73B 4YPGB 3EUUA 4I77H 4HV8A 5ETUA 3NIFE 3OGOE 3R1GH 3DMMA 3BYYA 4YDVA 5GJTL 2CLZB 1CIUA 3C5JB 2JB6B 1F6AB 1EK3A 4F33A 4ZYKA 1D5ZB 5D7LB 4GKZB 1Q9OB 3EDEA 4X5WB 1IRAY 3O8XB 3GSVA 4LVNB 3DIFA 2DQEH 1ZTXL 5GGRY 4QTHB 4F7PB 3RDTD 1U93B 3GJFH 2A77L 3S5LG 3T77A 2OJZH 4LGPB 4RWYH 5MI0B 1X9QA 1F42A 1KC5L 3VRLE 2FEEL 1BQHG 4YXHH 1JGDB 3MO1B 2C7UB 5DMKA 5EUOA 3X12B 2N1KA 2XICA 2X4NA 2MFNA 4J6RH 3IDYB 3SDCD 4WW2A 5J6HB 1LHZA 3HZYA 3OAUH 1DQJA 4M7LL 4F15B 4DN3H 4N0UA 4J3WA 3OR6A 4YHOH 1S3KH 4X6EB 2EDHA 4LL9A 1SJEA 1BP3B 5HHVH 3QH3B 1OAUL 4NN7B 3RGVB 3N0PB 5F7MC 2X09A 1A14L 4LSTL 1B4JH 2NXYC 2R0LH 5IK3A 4JANB 2XYCA 3ROOA 1SHMA 1U92A 5EU6A 1U36A 3T2QA 1MWAB 4ZFGL 2H26A 1I1YB 4EUPG 2AXHA 3IU3A 3U48A 1TZGL 4JFEA 4M6OH 1XGQA 1AD9B 1EMTL 2XTLA 5JQ6L 4YO0A 1A1MA 4C83A 3QJHB 2JJVA 3U0TA 2Q3AA 3DUHA 1NSNH 5F97E 2H3NB 4JJ5A 3INUH 1U8JB 1NC2A 1TPXC 4PP1C 1JI1A 2DBLL 4Y4FA 3DVIA 4RFEB 5E8EA 3ARGA 4JZJA 5E6IB 3DXAA 3MV9A 5EZOH 4EOWL 4LLUA 3ZDZF 2KQNA 1KELL 3M1BA 4UTBH 3IETA 3FO2A 2VDRL 4HWBA 5CD5D 2DQTH 1BAFH 4Y5XA 4NKMA 5IB3B 3ZO0A 3KJ6L 3PHOA 2KZWA 1ZWIB 4WHCA 3PE9A 2EXYC 4XXCA 4NUJA 2HN7B 4HBCL 4DQOH 1J8HD 4RSVA 1F4XH 3QIUD 1F11A 3O4LB 2RBLA 4Y19A 1J0KA 3KXFE 4DGIL 1RY7B 4HUVA 5DTFA 3DURB 3VWJC 2BOBA 4GQ9H 3T77B 2Z35B 5HHQA 3DROB 2EECA 4AIZB 4PJFE 5KSAD 1FIGL 4K7PH 4KKNA 2FRGP 3KPLB 3NGBC 5CUSL 1MCRA 3BEVB 3OZ9H 1XGRA 4LSQL 2FL5A 1QVOB 5HDBF 1CXIA 4MGXA 1D5ZA 5D7LA 2XOTA 3N1FC 3MCKB 4ZO7A 4UDTB 5H2BB 3ALXA 1J0HA 1P4BL 4J4PD 2D0GA 4TQEL 4GMSH 2E9IA 1QRKA 3EOAB 3TBVA 1W72L 3QO1B 2V5SA 5ILTL 4D8PB 2B2XL 4CGTA 3FN3A 4M7JL 3WD5H 3WYRA 2A6DB 1YY9C 4XPBL 5LGJB 1P53A 1ULVA 6FABH 5EOCJ 2W0LA 4MZ2A 1FFOA 2B7DT 1BBDH 3CDGA 1P4LB 3FQTA 3QIWD 2H1PL 2H2SD 2XZQL 2JLLA 2XZZA 2BERA 4QHUB 5D1QB 2QHRL 4Y4KA 3RTQA 1ZGLM 4G8GD 3FB8B 2BNQB 3CSBA 5DMGC 5GGRA 3U4EA 5GS0L 4PGDB 1ZAGA 5E6ID 4PJEE 4J2XA 1KB5B 3VGDA 1V05A 2H2PC 2WBJB 4KUZH 3V5KB 5I71B 4R4ND 4PGEA 3RBSA 1F4WH 3FTGB 4C56D 1NH6A 3VXSB 9CGTA 1J05A 3OL2A 2XXCB 5D7SL 2ZOLA 2J6EL 5KVGH 1JE6A 3V2AR 1PD6A 2VLKA 4ERSL 1JF5A 4JQXC 1LK2B 4P4KD 4JO4L 5KN5B 1FCGA 2FEEI 3IF1A 1P7QA 3UAJC 3QFJE 4A6YL 1NC4B 4GG8B 4JRXE 4L1DA 4LLQB 3MRLA 3PP4H 2NY6B 4XPHL 5KVMC 4OQTA 3CMGA 3HPLB 4X6CE 4JCLA 2QSQA 4JHZA 1NLBL 2NNAA 3RZCB 3AB0C 4M5YL 1FNGA 1W8NA 4XMKL 2OL3H 4FQQB 3QQ3A 3TLRA 4PJ9B 4ZFFB 3T1WA 2PXYC 2YEZB 1JWUB 4Z7WE 5L2KA 1WIUA 2W9EH 3C2AH 4ISVA 1MFEL 4YGAB 4G6KL 4MJID 3VE0A 2OMBA 4IJ3B 3RA7L 1IGYB 2VXUL 3SE3C 3C9NB 1FG2A 5HTSA 1BIHA 1DLFL 1WT5A 3VMNA 5C0BB 3HN3A 1PVHA 1XGPA 4O9HH 1S7XB 3V6OE 5IVXF 4X7SH 4MXQD 2AAVA 4RAVB 1DBJL 1P2CB 4WEUD 3MLYL 3L3OB 1AGDA 1SJHA 2CK2A 2BCKB 2B1AL 2YC1A 3OF6D 2UZYB 2EYSB 1LDPH 4P2QD 3DO7A 1LDSA 5GPRA 5BRZD 5EZLA 2OTWB 4Y16B 3RGVD 3VWKD 1CU4H 4UT7L 2GCYB 3B9DA 2CJUL 5AD0B 1FV1A 1S78D 4OM1H 5GSVA 1VFBB 3FRPA 3ARBC 3O6FA 1AI1L 3OXSA 4YDLB 1CICC 1U3YA 1ZE3C 3BUYA 4ONFL 3UJJH 2HRPH 3T04D 5BVJA 2JTDA 4XNUH 4Z7UA 4C4KT 1NKRA 4QXGH 3QULB 4GXUN 5C07D 5EDXA 2Q6WA 5CP3A 5IT2L 4IOIA 4QOKA 2QSVA 1H3UA 2VXSL 3JV6B 4L9LC 1FE8L 3H9HB 1ZSDB 2UVFA 4UOW0 3VWKC 2E27L 4G9FE 1OT2A 4X5LA 4G7VH 3O3EA 5HI4D 4GG6A 5IMKA 2NZIA 3RWHB 1UWXK 3KPQA 3RWFB 5JA8B 5CILH 3RWEA 2HT4D 1FFQA 4PJCF 2YC1B 5D2NB 2D03L 3IFNH 5DSCB 5ADPH 3GSNB 4XPFL 1FVDA 3GSQB 4DKFL 1CFSB 3HS0B 3L1OH 3BH9A 4L8BA 4ODSL 5E2JA 5MEND 1DQDL 5E2UH 3ZKSD 5IJKC 1MCOL 4NNXB 3L3DA 3DX9A 2N56A 4HIEB 2IBZX 3UEZA 2A6JB 2R2BA 3HG1D 3MLSH 1HILA 3IFLL 1R3LA 4EEEA 2WAHA 3SE8L 3SY0B 3QXWA 3C8DA 3QG7H 4JQIL 2Z91B 3HMXL 1INQA 1IGFH 5F7UA 5DJZB 1MVUA 4P99A 1K8DA 2UWEF 1XCTB 4XPGH 4OGYL 4I2XA 4KVNL 3FRUB 4OV5A 2F8XC 3G9VA 4Y19B 2DJUA 4JHAL 1A7RL 3SDYH 3ZE1E 5I1HH 4L3CA 1FAKT 4AG4L 1AR1C 3QWOB 3HPLA 3CLFL 3G6AA 5C09E 2K3TA 1A7NL 1DEEA 5DC0A 1P7QB 5AYUL 2R9HD 1HCFX 5T3XH 2FX7H 3KYKL 4U1HA 3SJVB 3IDUA 1ZEAH 3SOBH 1UENA 5D1ZA 1GGBH 1ED3B 4R2GC 2VZ3A 1KLGB 1K2DA 2O5XH 1G7PB 4LEXH 1MFDH 4EDWL 4HKXB 1FNSH 1W72B 1T4KB 4BELD 4P2OB 4ZFGH 4PS4H 3MRGB 2Q8BH 1RIUL 4ZAKC 1D9KA 5KOVC 3MOQA 5EUOE 3A0OA 1WT5C 3VFUB 4HW6A 2DQIH 1OGAD 1NANI 4JO3H 1YNLL 4PGDA 1DBJH 3QHZH 4Y1AD 3ULUH 4MNHA 3G6DL 1BHGA 4PJHA 4ZOBA 1IBGH 2IGFH 1I1YA 2NX5D 3ZT6A 3ALPA 5CJOH 3BXNA 5DMIH 1BPVA 3OJMB 5KSBE 5MI0C 2BVPA 5FYKD 1A6UL 2WZPD 1LILA 3ZT7A 3QPXL 4FQLL 3UYRH 4ELME 2D7TL 2QADC 1IL1B 4Y89A 1LP9E 3GMMA 3DVFA 1J1XL 1UA6H 4C58B 4L4TD 4KKAD 4P2CG 5I76B 4Y1AE 1AXSB 2IBZY 4HF5H 4U4BA 4FP8L 1HIMH 1KUMA 1Z6JT 1YY9D 3TNNB 3MJGX 3SKMB 12E8H 1IEBB 4XNUL 3HR5B 5JMOC 5KANG 4JFDD 1HOCB 2YUVA 3CH8A 3IFOB 1A6ZB 1AGCB 4PTTA 1S7RA 2IPKA 4LIQE 4WI4A 5EU7C 5CEZE 3PIQB 4HPOH 2XTJE 3VXQA 4CVWA 4Z7UF 3JTSA 2LQRA 3CU7A 1AE6H 3ULVC 5CUSH 1XCTA 4JE4B 2NY0D 2FL5B 4IDJL 2UY6A 1TCRB 5E94B 3IDXL 3QIWB 3PWNB 1H9VA 1IGJB 2FECI 3L5WB 3I85A 1TCRA 3KWWB 5E94A 1ZHNA 4HKZA 4MX7B 3TBWB 4Z95H 2Q20A 5C08A 5DQ9A 2R56L 4XBPB 3DX9B 4KTDH 3IXAA 5CJBA 3ARUA 1MJ7H 1ZV5A 4NGHL 4GW4B 3F62A 3NCYS 4NFBA 1O7VA 3LKNB 2ZSWB 5J0BA 2VLKD 3FB7B 5JW3L 1XIWC 1GHFL 3OKKA 3VD7A 3C8KB 2P5EB 5HHOB 4P3WA 3RIFF 3U4BL 1FRGL 2BY0A 1U91B 3GHBL 2FDBP 3LKRB 1F6FB 4QOKB 5T1LD 4QHLA 4QRRD 1G7IA 3LS4L 1ZLVH 5ESAA 3ESVF 2VXTL 3FFDB 4X6CB 5D96B 2X70A 4CADB 1OP5H 5B3JF 1A6PA 3BKJH 1S9YA 4X80H 4PRIA 4P3DA 3LRHA 3LB6D 4WTWA 4XCCH 4XHJD 4G6FB 4LEXL 5K9KA 4CDHA 4HWZA 3NABL 5I8EB 3VDAA 3QWRA 4YHPA 2X4TB 5FUZH 1WBZA 3MLVL 3DO7B 1RFDH 2VN7A 4TSAH 4AYFA 3ESUF 1RZIA 2VQTA 5EULV 1KTDA 4X4YB 4QGTA 4RGNE 3VXPB 2CMRL 4AM0A 1T4KA 1F90L 1HHHA 2Z9TA 1QUNA 5FYLE 5IBUG 4Z7QF 2AXFA 1R3IH 2V5YA 1RSFA 4KKCD 3W82A 4OZ4B 4R4NC 5FB8A 4S0SD 3FB6A 4QCIB 1WZMA 2YN5A 5DYOA 4JFZL 5D7LD 5HI3D 4CMMB 3EJYD 5BV7B 4PJEA 1CGYA 3KLDA 4JN1L 4JM2F 1IC7H 4LMQI 1DSFH 1X4YA 3M45A 4Y8DC 3TZVC 3EYFB 3WHXA 1AKJD 3FJTA 5I1IH 3OGCB 1QRNA 2B0SH 1BVKB 2FO4B 1Q38A 3SBWC 2BNRB 1OAZL 1YECL 3A6BL 4ODUA 5C6TH 1QEWA 4L8DB 1TZGH 5E7BA 2X9XA 4UQ3A 3K8MA 2Z0BA 2ADFL 4X7SL 1RMFH 1TJIL 4JRWA 2ZNXA 2OYPA 1NSNL 1YMMB 4X83A 4NQTA 1AHWC 2GUOB 4RAHA 3N85H 2BNQD 2CR3A 5IBTH 1IAIL 1F6AA 3NFSH 4GRLD 5KVDL 4D0BB 4XCYB 1U2HA 1DANU 1KELH 4UTBL 1P4BH 5DSCA 2P8MA 2NXZC 5EOCL 4XRCB 5F7FA 3EKCA 5DEGA 1W72H 3IRPX 3BT2L 5GRVK 1QBAA 2OSLB 1YN7B 3K4DA 5JLZB 5F88B 3MRBB 1DFBL 3BP4A 1RULH 4WWKD 1I1AD 1NGXA 2IBBA 3I3DA 4NP4H 3IGAB 4U7KA 5BS0D 5M95B 2XQYG 4DQOL 1YMME 5IW6A 3UZQA 5D1QA 1P5VA 1IKFL 2XG4A 3KNBA 3BMWA 3QWRD 4JM4H 2XN9B 3QPQC 2FWOB 5LVEA 1WBXA 3MRNA 1RQ5A 4N8CL 2M1KA 4L5FL 2OZ4L 3U4BH 5J9PA 2IPUK 1INEH 4P49A 2GJ6A 4XH2B 3WFBL 3OB0K 2RCSL 5ACZA 4G42B 4F7CB 1GYAA 2ZCLH 3MNWA 1AO7D 5D6DA 3BH8A 4UNVA 3QEUA 3X3FH 2ZJSL 1A7BA 1ZT7A 4F37K 1MRFH 3GK8L 3BKJL 5EZLB 5FK9B 1RUQH 3EO9H 4LFHG 3OPZL 1I3VA 4M48L 1IC5H 4XWGH 3WBDA 4WI2A 1U8PA 1DQQA 4KUCD 3BKCH 4MAYA 3ETBF 3G6JF 3ULVF 4XP9H 5T1MA 4NWUH 2HYMA 3RUGB 4H1LB 5DRNB 3GIZH 4YHZL 1RFDL 4QRPE 3I6GA 2H32H 7CGTA 1JN6A 2BJML 4MXQC 1BWWA 1E4XH 5ISZA 5I73C 4G5ZL 3BEVA 4PJHF 4OGYH 1QFWL 2AJ3A 3WO3B 5FGBA 3ARWA 5HYSB 4XNMB 2R0ZL 5FM5O 1ROWA 3O9WB 5F6IC 3RKDD 1NCCH 1RZFL 2FLBT 4PP2A 1CE6A 5DD1H 2WIMA 3MRDB 4M5YH 5E2VL 2I27N 4FMFA 4YX2L 4ZFOB 4LPXA 5TE6H 3P30H 5CZXC 3SHSA 2M8XA 3S37H 3TBTB 1MLCB 3MLTA 4W68A 4MCZA 1MJ8L 3O9WA 4HLZH 3UTSE 5T3ZH 1NC4A 4GG8A 5EOQH 3FB6B 4AEIL 4FQXA 4C56B 4KJQC 5J11C 1A4KA 4X7FC 5D6CA 3QXAA 4EDWH 4JFDA 2P43B 5I17B 4V2CB 1I1AA 4KWUA 5CLWA 4OKVB 5IG7A 3IETB 1PX4A 1KIUA 2NY6C 5I74B 2PN5A 4MAYB 4AK1A 3TJEL 4OQTL 2AQ1A 2X89D 1NGPH 3LOWA 1YNLH 1FNLA 5FO8A 3QJHA 2EDQA 4TTGA 1HQ4A 4GRLA 1MIML 4XC3H 4CVXA 2Q7NA 4L3ED 3DVGB 3BSZH 2HTLD 2W65A 4Y5XC 3RVWC 4DK3A 5DJXA 3KYOB 3UYRL 2V9RA 4XMKH 3WLWD 2BRRH 3RHWF 1MCSA 2BY1A 2VABA 3KPPB 4YQXH 3WSQH 4JDZB 1X7QA 1WCQA 2DLFH 4I18B 5I30L 1IAKB 2BSTA 3SKOA 1MFEH 5IW6B 5T1DH 3HB3C 1U3HD 2FJFA 5DJ2B 5D1QC 3VXRB 1LEGA 5KSAC 2CDFA 3S34L 2QADD 5CILL 1D5IH 4BZ1H 4X9IA 4APQC 1EAJA 1MFCH 4KZEH 1U58A 3RHWK 5BZWA 1NQBA 2AEPL 5HY9A 3VWKB 1PY9A 3CX2A 5DUBB 2AK4B 5KW9H 2GUOA 4X6DE 4I5BB 3CAFA 4XWGL 3OAZH 1LO4H 3LIZL 2M2DA 4A2MA 2A6KA 3IXTA 3ES6B 1TFHA 3P11H 4GAGL 4WWID 3MV8E 1QEWB 4J1UB 4Q9BA 1KJVA 3L5JA 2NY5C 4H88L 2APTA 5D1XD 1QRNB 4PRPE 5BXFB 4G5ZH 2CLZA 4OF7A 1XR8A 4OSUH 5D2NE 2JB5L 1N5YH 1HH9B 1QQDB 5F44A 2BNUA 1NCCL 4RZCB 4WU7B 4AMKH 3RVTC 4WUUE 2GSIB 3D3VB 4P4RB 1N7ML 3IFOA 3PV7A 4LSUL 3C60B 4RA3A 3H7BA 4GFTB 1B6DA 4Y4KC 4JO1L 4U1JA 1RAMA 3U30C 2I07B 2Y6SC 5LXGL 1A7OL 1DQLL 2V2WA 4XPAL 1OP5K 4PREA 3I9GH 3V79C 5AAWA 2QQLH 3DXAB 3MV9B 1FZJB 2AEQH 2VABB 5TQ0H 4AEIH 4DCQB 1EJ6A 2EEDA 4HFWB 5C07A 5J7CC 2HLAA 3ARBD 2Y36H 5JPMA 2NZ9D 3KPOB 1MEXL 3RWDA 3GSRA 1BX2A 1F4AA 4HWEL 5F89B 4PJ9C 5FDWA 1ZHLB 3NPSC 1WLHA 1G9MH 1BX2B 3CJJA 3TH4T 1NKOA 1CD1B 1ZHKA 3LB6C 4XP4L 1JGUL 5FO8B 4KK8C 2CIIB 2OR9H 1HHJB 2PW2B 3VFSB 2VOTA 4LAQH 5HXMA 2LFGA 5I17A 4NN6B 4HGWB 2DIJA 1IAIM 2VDOH 3UC0H 2FEDD 2XWJA 1UYWH 1BGXL 4QRPD 2Y5EA 1OLZA 4NOBA 5E9DE 5EOTA 1MLBA 3RVXD 4OZIB 3U7YH 4HKBA 5FAAA 3L5XH 3M17B 4K3DL 2XQBH 5EUOB 3X12A 4L3CB 2ID5A 5D7IE 5DJ0B 1LO2L 3ISWA 4GBXA 4NZUH 3T0VA 5EPMA 4NN5C 5DJCA 5DQ9B 2VR9A 1RHHB 3IDIB 1HHGB 1KCRL 4LHUA 5KS9A 3IDXH 4OF8A 5HYSA 5I1GH 3NZHL 2OXHA 3KPSD 1IAIH 4X5WA 3F7PC 4D0CA 1RZ7H 4NM8H 5ISZB 1BJ1J 1KGCD 4U3HA 4P9HL 3S35H 3WNPA 3JWDH 2R0KL 5EO9B 3HUJB 4KTYA 3QI9C 1GAFL 5JXAL 4HS3B 5CD3B 5HVHB 3W0WB 3ARBA 3O6FC 3QG6B 2BSSB 3DLQR 3BP7A 4LCIL 1U8PB 4HIXH 2CRZA 3S4SA 4GAYA 4G8FB 4JKLA 4NQSA 5SWSD 4AIXA 1T7VA 5CHNB 3C09C 4X4ME 5K9QI 4JAMA 5FIEA 1KLUA 4ORGB 3G5VB 4JM4L 3W5MA 1AKJB 1GSMA 3HZKB 4WFGE 3QNXB 1FSKB 3K46A 5CMAB 2BZDA 4NPYB 1KTRL 1RZ8A 4A6YB 5I1DA 1A7QH 1XF2B 1BOGB 1FHGA 4OIBA 5D2LA 3AFLA 5I6XC 3UTSB 3C09B 3TN0B 4U6YA 4G8GB 5DMJB 1AGEB 3H0TB 1PGRB 1I1RA 4X80L 4F9PA 2FWOA 1INDH 1IFHL 1DBBL 4KPHH 5E8NB 2DJSA 1KJ3H 3MUHL 4N68A 4TULH 4UUJA 4Z7VF 3I9GL 1N0XH 1K5NB 2GAZB 5F88A 1C5BL 5GGSB 4FABH 2HKFL 2R56H 4NQDE 4M6OL 1MCKA 4JRYE 4UNTA 5LGHH 1F58L 3JWOH 3C5ZA 1UH3A 3NA9L 4TOYH 1WCBA 4XAWL 2CO6B 4G8EA 3UO1L 5CGMA 3DTXA 5D7LE 1HKFA 5JW3H 1JPGA 2NTSP 1RZJL 4OLEA 3D69A 2XTJB 2ZKHH 1XGPB 2ORBL 3UBXB 3S96B 4M7KL 4BK5A 3C6SA 4K23L 3WJJA 5GGTA 1MUJB 3QDJD 2Z31A 5JIIA 5TQ2H 4FQ1H 2VH5L 4NHCL 3AGVA 2JE8A 4UIMB 4PBVC 4TSBL 3ZKND 3QQ9D 4D9LL 3WFDH 5DJDA 2C3VB 5DGRA 1MCCA 3GBNH 4QOKD 1PX3A 3VG0H 4LSRL 3TNMA 2G60L 3BDYL 2DAVA 2QADB 3E2HC 3QIUB 5EUKA 4PP2B 5FKPA 3ZYZA 1QBMH 3GO1H 4HIJA 1I8MB 4KJQD 5HJ3A 3HNSH 1JMZA 2Y23A 2VMFA 3C6SB 1FLTX 1XF3A 3DXAE 3MV9E 4XMLH 3UTTE 4HS8L 2V2XA 2YD8A 2JJUA 4H8WL 4ZOAA 3QEGL 4DN4H 1FVDB 1MCEA 1RIVH 2X44D 5I8CA 4P2QA 1HYSC 4WFGD 5DI8B 3VI4F 3KPTA 2XQYK 4NM8L 3V5DB 2CQVA 2MOVA 4R26L 3W39B 2LE9A 5HHXL 3MROB 1AC0A 3ARGD 1E4JA 4YHPB 3RGHA 3JUYA 5HVHC 3SDAD 3F7RA 3HZVB 3QCTH 2FNBA 3MODL 2BDNH 4ZNCD 2GTZA 3OKOB 4U6XB 4Q0XH 4NOFA 1MPAH 3P3YA 4HG4J 3L3KB 3MUGB 4HQQL 1WWBX 3SDDC 4K94H 4IRJC 3MRRA 1T66C 2DDQL 2HKHL 3OKNB 4JFYB 1FCCA 5EU6D 4O4YL 5B39B 2XRAH 5HDQL 3FFDA 4X6CA 1CTOA 1HSBA 3JTTA 1MIEL 4NPYA 4A6YA 5I1DB 1UQSA 2GTZB 4OIIL 2PYEA 1S5IH 4WCYH 3MXWL 1W0VB 5D2LF 5GSRA 4JR9H 3U4AA 3OKKB 1J1OH 3IDJB 2R2EA 2DYPB 2P4AB 2NCMA 2C1PB 2MJWA 5ITBH 2AVGA 4MQ7B 3Q0HA 3MCKA 5IIEA 2OJZL 5ENWB 2A2QT 2R1XA 5KJRH 1OP9A 5HSFA 3FO0H 2I9LA 4MNQB 5E4IA 4KZDH 1QYGL 4HIJB 3CLEL 3O4LD 3PWNA 3O45A 1A3LH 3CC5A 5FXCH 3QDJE 1TITA 3IDIA 1G7HA 2ZG3A 2JB5H 5JUEH 3QIBD 4NSKB 3R0MA 3GJEA 3MTRA 1J87A 2AEWA 2EDNA 4XP6L 1U8HB 2ZUQC 2YN3A 5I19L 5DS8B 3S37L 3EYFA 3WHXB 2VH5H 4HJ0D 4MB5A 3SJVD 4UIMA 4TSBH 3CDCA 3BGFB 1DQLH 1MUJA 3PNWA 3MMEA 5KN5A 4LKCA 2AV1B 5BCAA 4IMLB 4FFYL 2VXUH 1YNTA 2NPLX 2RGSA 1QLRB 3W11D 3G04A 3P77B 4M03A 2YRZA 4YHYB 4G8EB 1U95A 3OTTA 4D9RD 4FZEH 4RCAA 1TLKA 1G0DA 1Q94B 3HC0B 1EEZA 4F7MA 4K8RC 2QBWA 2H3NA 5FHAH 1AH1A 3TH2T 3DETD 3LPWA 4TPRH 2OBGA 1YUHB 5AG8A 3PXJA 3HAEA 1OQOA 2P7TB 2HFEA 2BNQA 1TXKA 1H3PL 4M5ZH 3NPZB 4B41A 4JKWA 15C8H 1G0XA 4LBEA 3R8BB 1YQ2A 2HP4A 4OF0A 4PRPD 3T0EA 2NY4B 5F70A 4OM1L 2MCPH 3B5GA 3GB7A 1SYSB 1K3IA 4U31A 3UTQB 1S9VB 4YE4H 1FO0H 2IPTL 1G7JB 5DK2A 3GHEL 4HUUA 4QXGL 3DX8B 1YJDC 4RWHA 1AKJA 4S2SB 1JJUA 3SJVA 5SX5K 3WUWB 4YZFF 2ZG1A 3MJ9A 3B3IB 2J8UF 2E27H 4KKBD 5D2NC 5DQJB 1YEFH 1KJ2L 5CEZL 1FORH 3SEPA 3PJSA 3QG6A 1U9KA 4HZLB 4G43B 4ZUTA 3GDBA 5ECJE 3HUJA 1R6VA 2YPVL 4FOMA 2IFFH 5FOBA 4L3EB 3SE9L 1RVFL 1EFQA 4XBPA 5C0JA 1QFHA 5FKAA 1G7HB 3L1OL 4ODSH 1L7IL 3GM0A 1FC2D 1MIMH 2FLRT 4HFUL 3P0VL 1CG9A 1P6FA 3KPRA 3QUZD 4U6VL 4R0LC 3MRJB 2WBJC 2XXMB 5I1EL 4NRZB 3KDMA 4E0RA 3P73A 3CFDB 3SE8H 2FATL 4Z0BH 7FABL 5EBWA 3VH8A 4EI5B 1BF8A 3QPQD 2ZPKH 4FQJH 5DD0H 3CNKA 2V5TA 3CLEH 4OCWH 1FIEA 2LU4A 1EH9A 1AR2A 4LVHC 4WHTB 4AMKL 5C0BD 3NFNA 5DFWH 3QUMA 1OTUD 2J3SA 3IS0X 4CNIA 5IEKB 5IGXL 5INDA 1DDHB 3TPKA 3GSXB 1NFIA 3QUZC 1HHIB 4O51B 4OLVH 2ESVD 3NN8A 3HE7A 3VXUE 4NKDA 4QRRA 1S78C 3QEHB 4K9EH 5LG1A 4MCYB 4NO0A 1M7DA 5I1KH 4Q9QH 4M3KB 1A7NH 1UQSB 5JHDA 1I3RA 4XPAH 5B22A 5FYKH 1KIPA 2IH1B 3PGFH 1DE4B 2YD1A 4MNGE 2NY6D 5T1LB 5FCSH 1JCKA 2BVPB 3D9AL 4F37F 5C7XL 3RVWD 5HGDA 4PY7B 5BOPA 1X44A 4MJIE 1A1OB 5SX5H 4U0QB 4L3AA 2B1HL 4HWEH 3CD4A 3DVGA 3BP5A 3J7HA 5KBNC 4BK4A 3HAEB 4I3GA 5KZCD 4JVUA 1HINL 2EE2A 3BUTA 3QHZL 3VDCA 4ZNEE 3TT1L 2EYSA 1CR9H 3VFMA 5C71A 4JO4H 3QCUH 1TZIA 3FOLB 3E3QC 5E1AA 1EFXA 4X8XA 5DLMH 3FHQA 2YUWA 4EZMA 5TF0A 43C9A 5B3JE 4ZUSB 4YUEL 3U0WH 4XPHH 4YBLB 1T04A 1UWGH 4HMDA 4DEPB 1J18A 4K3GA 5CFHA 4MDJB 3OV6A 1FC1A 2JJTA 2BHZA 4FQHB 2X4SA 2F5BL 2EO1A 3D3VA 4P4RA 5DFTA 1EO5A 4CW1A 4K3DH 4G6KH 3TGXA 5IBLC 4NT6A 3LQZB 3PGCB 5DS8A 4FQQA 2UWEB 2VL5B 4JHBA 4F2MB 4ZPTA 3LD8C 3N50A 1Y0LB 1AR1D 4I0PD 3GO1L 4LIQH 4MQXC 5CBEA 4ELKB 3PV6B 3U83A 3O45B 3ZDYE 2HH0L 1S8DA 5HGBB 4PRAB 4HJGA 4K3EL 4MMZC 5CINH 2AQ3A 4R96A 2FB4L 3OB8A 1LP9A 5CP7A 2Z92A 4Y1AA 5DHXB 1BAFL 1FZMA 3EJJX 3BFOA 3GSQA 1NFKA 1YMMD 1A6AA 1CDGA 4XXCC 3WS3A 4LDOB 4DWHA 1N6QH 3HUJF 2VDOL 5DRWA 5BW7C 1GOHA 1UYWL 1JPSL 4QXWA 3PQYE 4RDQG 4HMEA 2RIKA 4NN5B 2YA1A 1ZT7B 3TT3H 1DBKL 3RGVC 4WI5A 4K2UL 3TC9A 5DJ2A 2IJ0C 3EYVB 4U1KA 2A1WH 4DGIH 2HKHH 1A3RH 3IAGC 3QJFA 2BHYA 5K9OA 2ZUYA 4LP4A 4KJYB 4GQ9L 4WWKB 5E5RB 1UXWA 4Z7UB 2D0FA 5E8PA 3O8XD 1KNOA 3KPPA 3HE6D 4OLVL 4BFIB 1OD7A 3CFCH 4KJYA 1L9NA 5CSGA 4P2RE 4ZFOL 3OZ9L 3WUZA 4O02H 5DWUL 1RZ8B 5F7WC 3E2HB 2VITB 3QIUC 3OKOA 3OKDA 4FNLH 1X5IA 2P46B 5B39G 2O5YL 3EYOA 1HQ4B 3U46A 5JMRA 3ZT5A 5IVZB 2ICEB 3OB0H 4R4FH 4PRDB 3MBXH 3PWPD 4NQSB 4TQEH 1GGIH 3D18A 1DLHB 1CLOH 4NKIL 4FG6D 4R97C 3ZKXB 1HEZA 1GGYA 4ZO9A 1OTSD 5TDNA 2CXGA 4M7JH 2IAMC 3HAEG 3FO0L 1FZOA 1PYWB 2VDLH 4TUKH 3B43A 4LF3A 3VXUD 4NNPL 5GGUA 4MJ4A 4LHUD 4BH7B 3QUMH 4YHIA 5J12C 1Q0XH 1DQTA 3LRSB 2QR0A 2V9QA 2GEEA 5C0BE 4PBWD 2MQ0A 1TPXB 3ULUF 5SWZD 2WWKO 3RTQC 2XT1B 3CVHL 1RK1A 3WFDL 3VXMB 3NIDE 3U30B 4DGYH 5CKGA 2CGRH 5FO7B 3GMNB 1KIRA 2GFBA 3QNYB 1BQHA 2DKUA 4ODHH 4CW1B 2O5XL 4V2BA 4JDVB 3NVQA 2CUMA 3CFKB 3QFDB 1TVHA 2OK0H 3A6CL 5FB8B 3O6FD 4YHIB 1FNEA 3VFVB 5SWZA 5LGHL 4HDIB 1ES0A 1N8ZB 2HLFC 3AS1A 3MJ8A 1MFNA 2VYRE 4YXLL 3NPSB 5K9QG 5GZOC 1T1YB 8CGTA 2VXQL 1SEQL 3JWNC 4NQEE 4LNVA 3ULUL 5I15L 5BRZA 5D8JH 4YDKL 5HDOA 1DUYB 4M43L 1T0NB 1E6JH 3HNTL 4FQ2L 1FDLL 4D9QE 5I66B 2CPCA 3JXAA 5BVPH 5HVWA 4UMGA 3LD8B 4NUGL 4PLOB 3U4EB 4MLSA 3AAZA 1XGTA 4UUJB 3DV4B 3JSSA 3WIHA 5KOMC 1CGXA 2P5WE 4NP4L 3C60C 5CEXB 1ZOXA 4JANA 3Q48A 1EHXA 2V5MA 3CDGB 3S36X 3BGMA 1RZKC 2ESVA 1XF2A 3B9AA 4W4OA 1IM9D 1JF1B 3P4NA 2A6DA 2Y06L 1EGJL 4H25A 3VXSD 4HIHA 4YPJA 4G7YH 4HS8H 4Z7NF 5KVFL 1A2YB 5BOZG 3EOYG 3FZUC 2AJSL 1XIWA 3KPNA 4YJZL 3O2WL 1IC5L 1C7SA 2VL4A 4WO4D 4EVNB 3KPSB 4XP9L 3HMWH 1T7XA 2O5ZH 2HTKD 4OZHE 1YMMA 1BD2D 3GRWA 3O6LH 4DVRH 1CICA 2AGJH 3CDYA 1KEML 2JKXA 4NZDA 3L5WA 1EEYB 2J88L 5CZKA 1N6UA 1WIPA 4UQ3B 3SJVE 2BDNL 5HHQB 3VRJB 4M1CD 4PBXA 2BVEA 4ZYKB 3H3KA 4F33B 5FOBB 3KPSA 3IKCA 1T0MA 3E1F1 5DZNA 2GTWB 4M8QB 3RVVD 4WHYH 3QUYC 4XXDA 4NT6B 1IT9L 4YBQD 4P59H 1IGCH 4ZXBA 1S3KL 3JWOC 3V5HA 3O2DA 2VXTH 4HEME 4WWKC 4U3CA 2A0LD 3HI6L 3K7UA 4ODBD 2CGRL 3TCXA 3ZTNH 4DKFH 5JW4Q 4PJEF 2FX9L 2VAJA 3F12B 43CAB 3AB0B 3M1BB 1VACA 3QFJA 3QUXA 1W0YT 3QRFM 1TJHL 4M1DH 5I18H 1R24A 5FGCB 2PW2A 4B7IA 5ISZE 2E7BA 3MOBL 4QRQA 4RMWA 4ZOEA 5E56A 4OUOA 4WW2F 4ZTOH 3QDGE 4WV1B 4X9GA 3TJEH 1KTLA 2X1QA 1JNNH 2BVQA 5FDYA 2GK2A 4PJDF 1MCQA 2ZP0T 4XC3L 1G7MA 3T09A 3RJDA 1NUGA 5SWSE 2JJSC 1SJXA 1IE5A 2QJDA 1I7RB 1NCAL 4XP1L 3QFJB 4QHMA 2PXYB 1IKNC 1MF2L 1YEIL 2VSCA 3FB5B 3FQUB 3GSNL 1KCSL 1ED3A 1JGLL 3QXAB 4GH7B 1S7QA 5GRWA 1WBYB 1I4FA 5CAYB 4PRHB 2B0SL 4BH8A 1UJ3A 5FYKU 2FZ3B 2OS7A 1AGFA 3UTOA 4JPIB 4AH2B 2BX5A 1NEZB 1ADQL 3IB4A 4W4OC 1HH9A 1D5IL 1QQDA 3BDBA 4GKSA 3GMNA 1KEGL 4JO2L 4KROD 4FQIH 3TYGL 2V7HA 1GGCL 3DHJA 2HH0H 3SE9H 1VENA 5IKCA 3ULUE 5ISZD 2AEPH 3CSYA 4JCMA 5C0ND 4QXUL 5F8RC 1UKTA 5LAXA 4Y4FD 2CIKB 4O2EA 3V0VB 3WJLA 4W6WB 5DRXB 2VLRA 4NC0B 2DM3A 4LCYA 5K93A 4HH9B 3K80A 2H6PB 1J1PL 4X9BA 1P9MC 1UWEH 4IRSD 3SGDH 5C0JB 5FM4A 3IVKA 4TUOA 4AL8H 4KKCC 5IIEB 1N6QL 4DKEH 4FTVE 4N0YL 1G9EA 4NC1E 3VGAB 4JN2A 1OTTD 4K2UH 4DAGL 1A6ZA 1N5YL 3RI5K 3QUYB 4KJPC 4P5TA 3QRGL 1NDGA 3C6LA 3O3EB 4L8SC 3UPAA 1ACZA 1BVLB 3OKDB 3MRHB 1IT9H 2QHLA 5CEZH 3E6FB 4RMSA 1IAKA 3DETC 5TF1L 3JTTB 2X9WA 4S0TD 4W6YB 4BSVB 1S9VA 5DWUH 1ZLSH 1O0VA 5BS0A 1FGVH 2YPVH 4MSWB 5IHUL 1FFRA 4NQDD 4WWKA 2I9TA 4HAFA 1G7LB 3O2VH 4HIIA 5IBLD 5F93C 3TF7C 5HVGB 4H5SA 4ZUUB 4U1KB 2FR4B 4U1LA 5F71A 1R3HB 3NAAL 2Q86A 3T0ED 1SEBA 3FT4A 2Y36L 2A9NL 1CLOL 3HI1B 4NKIH 4TUJB 5TE7H 5E08H 5JZ7D 1XGYL 2HFTA 1JRHH 3TT1H 4I3RH 5FOJA 3QCUL 4Z7WF 4YDIL 5L8LB 1DUYA 5TDPB 5FA3B 2EDWA 1L0YA 3GSUB 1GHFH 3V6BR 2R0ZH 3G5YA 1HXYA 2J8HA 1T1YA 3EFDL 3SDXB 5F1KC 4KKBC 3VRIB 2X89A 2NY5H 3DUUA 2X4UA 5HJ3B 3I2CH 3DWTA 1S8DB 3P9LB 2ZUUA 3CFKA 3QFDA 2UUDK 4X4MA 5IF0B 1BFSA 1FLRL 3OR7A 4UBDD 5L6YL 4ZFFA 1BQHB 3K81A 4KY1L 5I1JL 5FYJU 5DZLA 2YD7A 1NC4D 4DVBB 4PJHE 1U8OB 3O3DB 4MB4A 1T83A 4F2MA 1X4XA 2XQBL 1KGCE 3BZ4B 5C7XH 1FNGB 1RK1B 3THMH 4JPWL 1X5XA 2FSEB 2DLGA 1U6AH 5C0RH 4S1SL 1KTKE 3BGFC 3T65B 1J8KA 4NZRL 2VDQL 5EA0L 5GRUL 3QXVA 1T3FB 3PP3H 4MNQA 3IF1B 2DQHL 3BW9B 3WL9B 1R5VB 2EEBA 3CVHB 2NXZD 1FBIL 4ETQB 3K0WA 2OP4L 3FFCB 3SDXA 3NIFF 1LDPL 1FDLH 1KXQE 5BO1H 2W07A 2FH8A 3T3MF 1HEZB 2DN7A 4YHMH 2EO9A 1H0DB 1VADA 1UJTA 5DD6B 3MLXL 1IZJA 1J1PH 4WEMB 3RQ3A 2M26A 4FG6C 1NAML 1C1EH 4MD0B 2V2TA 4ESKA 3B5TA 3QQ4B 3QDAA 4HWZB 1A4JB 2J8OA 4KKLC 4JB9L 2A6IA 4MXWH 4N0YH 5DHVA 1CFVL 3NOIA 3SBWA 1A1OA 3VFNB 2ZSVB 5EO0B 1OLLA 3ZSTA 3BZEA 2VRAA 4LARL 2OTUB 5D71H 5T1LA 3WLWC 1P4LA 4GKNB 4X9FA 1ZLUH 5E8PB 1T20B 1MRCH 3MJ9H 3P2TA 2NW2A 2OTUA 2D9QB 3REWB 3JV4A 3BJLA 4MCYA 4NO0B 4UB0H 3QAZB 3HZVA 1FO0A 2EDFA 3MPCA 3IFNL 5ESVA 3PWPE 1VFUA 1Q9WB 4JAMB 2O26U 5KW9L 2XA8H 3LKQA 3O2WH 4R4FL 3SCMA 1YJDL 2VZOA 2W0PA 4RNRB 3BO8A 3H9SB 4OFYA 2ZUTA 2ZCKH 4OM0L 3X11B 4ZPVB 4DVRL 5IWLC 4XBGA 3QBTB 2HLFD 4PRHD 3LY6A 4EI6B 5IQ9B 3L3HA 1R3KB 2DIBA 1D6VH 3P73B 4PJXA 1RZJH 2FD6L 3C9NA 4GBXD 1GL4B 3SGJC 5D2LE 4P2OC 3U9UA 5CS7A 5L2KB 3QFJD 1FFNB 4NZJA 1N3NB 5EUOF 5J13B 3MBEA 5F7KC 5AZEL 1EJOH 1YYML 4JFOB 4BM7A 2HT2D 4Q9CA 1G6RB 3M8OL 1ZA6A 3O11B 3UBXG 5DD3L 1H8SA 3NZ8A 2AABH 4JHWH 3D2UB 5IF0A 3ZL4L 3EYSH 2WMPA 4M48H 3BDYH 1UB6A 2UUDH 3WUWA 4RAUB 4OFPA 4U1IB 4WDIA 1T83C 4U2ZA 1CS6A 1NUFA 2VR5A 1J5OL 1YEEH 3BMVA 4OF6A 1T04B 3LEVL 4G8GE 1OARL 4QHMB 1JYVA 3UMTA 1EO8L 1SYSA 2XWTA 2EXWC 4G8IB 3N1MC 3T2NL 1SYVA 3GMOB 5JHLH 1UH2A 4NNPH 4Y2DC 3DSFL 4P3CL 1GPOH 2VLJA 2R2HA 4POZD 3BXNB 2IH3B 2QQKH 3HI1A 4KJWC 4ODWA 4TUJA 1XGQB 3PUCA 1QP1A 3P30L 1Y18A 1E4WL 5D1QD 3BIKB 3MFFB 2VTFA 3WE6A 3QT2A 4Q0XL 2ZUWA 1B4RA 1KCVL 4Y5YA 2V7NA 2KDGA 4BJLA 3D85A 4QRUB 3SGKA 3HC4H 3ULSA 2I5YH 3S9DB 3CH1A 2IQ9H 3WHE0 4BKLB 1MIEH 3C8HA 3D48R 1V7ML 1UXSA 5CZVH 3D85D 1FNAA 1BJ1H 4G9DB 1UB6B 2ARJQ 4O9HL 4OQTH 1F6LL 4KDTA 1ITBB 3NFNB 4KQ4H 4LASL 4LSQH 4NJAL 5D1XA 5D96C 4XCFH 5ID0A 1CDHA 4NM4H 1K4DA 3BPLB 2JCCB 1DN0A 4XNXL 4HS3A 3BDXA 5SWSA 3LMJH 4OD1L 5DEZA 3MRIA 2MQ3A 1C8PA 5KSBF 1EPFA 1CT8B 4PJIE 4Z7VA 2H6PA 3UTSD 1T7WA 2H8PA 5L0QB 2A9ML 2Z91A 1J8HE 3UTTB 4PJ5E 4X7CC 1NAKH 3T4YB 5T5FH 3QNZA 5GRYA 4UT9H 3JTSB 5C0NC 4HLZG 4KAQL 2R69H 1V3KA 3Q3GA 1K4DB 2DBJA 4PRNB 5IT2H 4GRMB 3O4LE 5EZIH 4HUWA 5LWYL 4OLZL 3MGOA 4NUJB 1OWWA 3VGAC 1PSKH 3RWHA 3SQOL 4CN4A 3IFPA 4H0GA 2R8SL 3I6LD 4M1GL 1J10A 4MJ5A 3IKKA 1IGTB 5C0DA 3Q6FA 3VFOA 5F1OB 1X6NA 5F9AC 1K8IB 4YC2C 1C08B 3ULSB 4MNGB 4FHBD 4KUZL 1N0XL 4FFYH 2V9TA 5I1LA 3QEQE 3H3BC 4FABL 1BFTA 2FHBA 3QIBB 4QYOB 1NCTA 3BZEB 2FECL 1WWAX 2NTFA 4KK5D 2A9NH 5TE7L 3O0RL 5FUCE 5KVGL 4GG6F 1A9EB 4PGBB 2LVEA 5AD0A 4LCUB 3ZHDA 1H3XA 1A1MB 4FZ8L 1AO7E 1TETH 3D2UD 5F9OH 4BQCA 1BD2B 5JHLL 2G9HA 5B21A 2EIZB 2VLJB 2AKRB 4M7KH 3IDGB 1EEZB 1T0NA 1LO0H 3EOTH 1RZKH 3CUPB 4P2RB 2K9UA 2XWTB 1A6WL 4FQXD 2XACC 1OF2B 5FGCE 2AS5M 2Y72A 3O9WD 2I07A 2AJYL 1DBML 4U0RB 4X6EA 1A7PL 4MA7L 1HSAB 1JYWA 3R06B 5F3BB 4KY1H 1OTTC 1TVHB 2X4QB 4JY5H 1OSZA 3SGKC 4B50A 5D7JD 1MLCA 4WGVB 3BI9X 3OAYH 1P6AB 5C2BH 1JYXA 4OUUB 3FAXA 3OKLA 3UTTD 4RISL 1QBLH 3OJDB 4M1CC 1KACB 4D9RE 4NRYA 1EEQA 1CFBA 5IESH 3WUWG 3KLHD 2F8VA 1G6RH 4AT6A 5C0EB 3UPRA 5I0DA 4N8VB 2A6KB 4YHYC 3NFSL 1C5DB 1EZVY 4FA8A 4YIQA 1CE1L 2YA0A 1R3LB 1ZT1B 3QDMB 1CICB 3BESR 2J8UE 3PP3K 3F7YB 5JIKA 1T21A 2A74B 5I9QB 4LF3B 4R7DB 5IJVB 3C60D 3FO1B 4XBGB 2VKXA 4L9LA 5I75B 1I85A 1Z0MA 5F96H 4HUMB 4L4TE 4MNQD 1BGXH 1XF1A 1G84A 4PLKD 1PG7L 3V5KA 5J1AB 4ODTL 1NFDB 2ZUQB 3MA9L 3SDAC 3H9HA 4XTRC 4G7VL 3BAEL 3VI4E 4DN3L 1BEYH 1SY6L 4UINH 1MI5A 3HG1B 2BOCB 4Q9QL 3GMQB 5JW4N 3QUZB 4WFHE 4X4XA 4JO2H 2IADA 4U1NB 5BZDB 1X7QB 3SDXE 3BRGC 1JUFA 5FYKL 1NMCC 1WBXB 3MRNB 4N1HB 4P5KA 1Z9OA 4CN6A 2ZJSH 3ARDB 3CXHK 1MFAL 1UWXH 4LVHB 2I24N 4EDXB 5J57B 3D39A 3BWAB 3TIDB 3FRPG 5EC1A 5D9SA 1YEJH 1EHLL 3MRBA 2D31B 4KTDL 2H9GA 5E7FA 5FECA 3QO1A 5DRWB 3UYPA 4QRTB 1OAXH 2J5LB 1OCWH 1AD0A 2MWCA 4OGAD 4DKEL 2BJMH 3MJ6A 3L3OA 3J8F7 1JBJA 3GI9H 4X6DA 1M6OB 4IRZH 5I1HL 2Z93A 4EOWH 2PO6D 5D1ZC 2BY3A 4ETQA 3D6GA 1UZ8B 5MEPA 1XF3B 1U8MB 4LCYB 1FG2B 3MV8A 3MYJA 1MHHB 1VB9A 4XBEH 4ZAKA 1N4XH 5GGVL 5J4MA 5EWIL 4HCRH 5KSAB 5IB4A 4KJPD 5IB1B 4MJIA 4MA7H 5EH1A 5MHSE 2CDEB 4PV9B 1KJMA 4UAOB 5EOQL 1ZLVK 2CKBL 3AS3A 4P5TD 2EH7L 4JFFA 1AGFB 2FZ3A 3H9YA 4WY7H 3SKUD 1I8LA 3R06A 4PJXE 4MDIB 1R0AL 4O58H 4BFGA 1W2KT 3NCMA 1KPRA 4MDJA 3VMOA 3DXAD 3MV9D 4I3RL 4OFYD 1FBIH 3EYUL 3JV0A 4MLIA 4G9FD 3I6GB 4ACPA 2Z8SA 1LGVA 1UKQA 4JG1L 4BYHA 5IW1B 4Y4HD 3VFSA 1H3PH 5TH2A 1H5BB 4HK0A 1XMWA 5KSBB 3DV6B 4HGKC 1RZIB 5E9DD 3OAYK 2QKIB 2AKRA 1NBYB 4XCEB 4PV8A 2FGWH 2ITCA 4WFHD 4LMQE 4PLJD 3N1GC 5F8QC 1AD9A 2EH8L 5D9SB 4JN1H 1GRWA 2FR4A 3STLB 1N26A 1DVFC 4P4KB 4F7CA 1KCVH 4POZC 3EO1A 1JPST 3CU1A 3ARXA 4DCQA 2GSGB 4NHUA 5DUML 4Z7OF 4G8GA 1A3RL 1ADQA 1R24B 5LBSL 2IQ9L 2BSRB 4Y4KD 3HFML 3HR6A 1M7IB 3BOVA 5GHWH 1PZUB 1X5JA 5FYJD 3WNNA 3F7VB 3QH3A 2P42B 5C9JA 3QQ9C 4JQVC 3W9DB 3Q6FB 1CK0L 4Z5RB 4QWWD 3G5VA 5C2UB 1I3UA 4R97B 3VFRA 1L7TH 3RIFK 3EYQD 4TSCL 5J6HA 2Z4QA 1FVEA 4YLQT 4Q6YA 3V5HB 3BHBA 4J8RB 4IS6A 4PGZA 5BO1L 3LEXA 4R26H 3V52H 1G0YR 1ND0A 5DMKB 5CD3A 3KYMB 4R7NB 4S1DD 5GGQH 1KPVA 5IVOA 5E2WL 2FATH 5IM7B 3LHPH 1RZGB 4HC1H 1LVEA 3RX5A 1D6VL 3QIBC 3DSNA 4R96B 3VXSE 1WISA 2Y4SA 1RI8A 3N9GL 4HXBL 5KAQF 3BPLC 2R2CA 4HS6A 4WUUD 1UADC 1IKFH 4LOUC 2DM7A 3OHXA 2D7MA 1BIIA 4EJ1C 5GISH 2Y7QB 4LARH 5AZEH 1BVKA 1AHWB 4OUUA 5GIRA 3ZE0E 4QT5A 4I4WA 4H20H 2DWEA 2JCCA 3MV8D 3LV3B 4WI8A 1XIWB 1VESA 2X6MA 4CU6A 4JFHE 1GOFA 3K1DA 4Z7VE 2CDFB 3EO9L 1P69B 1BM3H 4Y4HB 1Z3GH 4MYWB 5GRJL 5FFLA 4F7TB 2J8UB 3MLVH 1WITA 3SKOB 5I1AA 1VERA 4C4KO 1GC1C 4NO3B 3C08L 4NHUB 3NIGF 5J1SC 1IVLA 3T0EB 5CEXA 1JWSA 3DRTA 1L4IA 3QUKB 4OCYL 1GPOL 1TZIB 4POUB 3VFMB 1E6OL 4M02A 2EXYD 1JL8A 5B4MD 2AXGA 5DLML 1MJUL 1KBGH 1BD2A 1R3IL 1HXMA 4LLDB 1XGTB 5GRVL 2W59A 4YWGL 3UYOD 3VXOA 3UCRA 2DOCA 2FIKB 5I19H 4LFHD 1CDJA 2GT9A 1YEGL 1DR9A 4F7MB 3DRTB 4QEGA 4DFHA 2F53B 1VFOA 4YFLI 4IOFD 2F9BT 4QGYA 3TFKD 1H8OA 2VE6B 3P77A 4N5UA 4HBCH 5DUPL 3KAAA 4O5LL 4L3EE 2I5YL 4OKVA 4NN6C 3MRQB 4IHOA 1MY7A 2ILLA 2GITB 4HPYL 5JORB 4H1LH 3L5XL 1NCDH 4P2QE 4KRPB 2VXSH 3TZVB 3CMOH 3GI8H 3LN5B 3LSOB 4JFFB 1R3JB 3LEVH 4HUWB 3GNMH 1HH6A 2XZAH 5C0FA 5CSBA 3MLTB 1KT2B 1ZA6B 2X4OB 5HHMB 4Z6AT 1XR8B 2ZZUT 4MVBD 4QT5B 5L88L 1L7TL 4LNRB 3FN0H 3SDCA 1AXTH 5JOEA 4PP1D 1MVUB 3S35L 2P5WA 4G3YL 1MCFA 3UTTA 4HS6B 1JNHA 4CVZA 2EKSA 2DJ4A 3QG7L 3FO9A 2J88H 2ESVE 2AQ2A 4JFPB 4NRXB 4EVNA 1CDCA 4KHXL 5KSVA 5KZCB 1NBZB 3G6JE 3ULVE 4R7NA 1P4IH 3PDDA 1JZ5A 5F7DB 2A1WL 4LLYA 3NCFB 4LVNC 5JR1L 3BISA 5JIHA 5EO1B 5A16A 1RJZA 4N0FB 3DMMD 3SQOH 1RUMH 3CLFH 4YZFE 4HIHB 5GJTH 3U79A 1N5AA 4XNZB 5T3XD 1RJLA 5FYLH 1FFPB 4ZD3L 1FSKC 4AQOA 2VITA 4QO1A 4DK6A 1JF1A 5DK0B 1CDUA 1QR1A 3IAQA 4Y5YB 4R0LA 4HUKB 3MLWL 1A0QH 1F13A 1S7WA 1BM3L 3QDJA 4L4VB 1JHKH 1KENL 2IADB 4U1NA 4L4TA 3QJFB 5K9OB 2COQA 5I1EH 4U7SA 1CXLA 4LEOB 3O6FB 5E1HB 4YHZH 1HKLL 2PYEE 3RL2A 4LCWA 3VFNA 1GZQA 3MJ7A 2W65B 2VZUA 4N5ED 4EI5D 2P7TA 2ZCHL 2IMNA 4TOYL 1NAKL 1J0IA 1JHLL 2NY7L 5L9DH 2P48B 3MV7B 1CL7L 5ALBH 1RD6A 4HHAA 5F1IA 4F9LC 4LLMA 5EG6C 1SYVB 3GMOA 1B9ZA 3DV6A 3U6RA 1U95B 2HT2C 1LK3H 1ODAA 4I3SL 3ARFC 4Y8AA 1ZHBB 4QHNA 4W4NA 4OLZH 4P23D 1NGWB 5I1KL 1YDPB 3MJ8B 2I25N 4PUBL 1TZHA 1FZKA 4DGYL 4PJBA 2HVJB 3PNWB 1HIML 1T3F