5SYMA

Cocrystal structure of the human acyl protein thioesterase 1 with an isoform-selective inhibitor, ml348
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
223
structure length
223
Chain Sequence
TPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-protein thioesterase 1
publication title Molecular Mechanism for Isoform-Selective Inhibition of Acyl Protein Thioesterases 1 and 2 (APT1 and APT2).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 76
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.1.2.-:
pdb deposition date 2016-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5symA00
5AKZA 3JW8A 2QJRA 2BKLA 3T52A 2QZPA 3FCXA 3L1IA 1YCDA 1XQWA 3TRDA 1EB8A 3S8YA 2GBFA 5EIEA 1MX5A 3FOBA 1PFQA 1CR6A 1SCIA 2BJHA 4OU5A 1R9MA 5CH3A 3OC0A 3PI6A 3F9CA 3WI7A 3RKSA 1X2EA 1LPPA 1NU6A 4PSUA 5D7BA 1DWOA 3H2GA 3KWFA 2H7XA 3WKAA 3FYUC 3M82A 1IUOA 4UUQA 2OAEA 3STXA 1JU4A 3Q8WA 2WJ6A 3KDAA 3WKBA 4U2FA 1ZD2P 2O7RA 3GBSA 1O6FA 4G4JA 4GDMA 3STTA 4OCZA 1TCAA 1L7QA 3V1MA 4IH4A 3I6ZA 4Q82A 4RE6A 3LP5A 2XUFA 3ESDA 1DWPA 3B5EA 4K5QA 2QOEA 2ES4A 1EDBA 1P0MA 2OCKA 3WA6A 3PDCA 3O4JA 4BZWA 1A88A 3QPCA 2WJ4A 5LZ4A 4CCYA 4W9RA 5K3EA 4KYVA 1N5RA 4GECA 3LLCA 3HC7A 3WLAA 4X6UA 4JEIA 2XUHA 5CT9A 4W1QA 3MGAA 4C4XA 4I4CA 3VDXA 1YB6A 1B41A 1FFDA 2J4CA 1XQYA 3FLAA 1ORVA 2JEYA 3QPDA 5AI0A 4ETWA 3A70A 2XUKA 3CXUA 4X6YA 4MXDA 4DLNA 1KU0A 1HBJA 2B61A 2BAGA 2OQVA 1MAHA 1EDDA 5HQ3A 1UOPA 1CV2A 2WIJA 4CIBA 4KE8A 5C8XA 2C7BA 5ALXA 4G9GA 1EXWA 1ZOIA 1XZJA 1ZIYA 1PJAA 1WB5A 4KRXA 2XMGA 2RHTA 1CUHA 3OURA 4H7DA 2GZRA 1CFJA 3FVRA 3C87A 3B12A 4DNQA 1HPLA 5ALZA 5AI8A 3AZOA 5FUMA 1WB6A 4AO8A 4YX9A 3GA7A 3FSGA 5HQ3B 2LIPA 4J03A 5DTIA 2O2GA 4QDTA 2IIVA 1XRLA 3HZOA 4B0OA 5BV7A 4H18A 4MWTA 2CB9A 1K8QA 4KE7A 4DM7A 1VXOA 2WM2A 1R3DA 5EHXA 5HK8A 1M33A 1XRRA 4UBOA 4BVLA 5ALHA 4EY8A 5JD6A 2XUIA 4BP9A 4KE6A 4C87A 4OB8A 2YASA 1JMYA 4B81A 4ARBA 3R41A 3CCCA 4Z49A 4TPKA 2Y2UA 4GI1A 1YR2A 3GROA 3NGMA 3S2ZA 3D2AA 2ZYRA 3I28A 1RP1A 4U2BA 3PFBA 2XMRA 1E8DA 4BVJA 5FLKA 4TVKA 5DTJA 2I78A 3QITA 2XE4A 3LIIA 4C4YA 4XX1A 4Q1VA 4P9NA 1VZ2A 5AJHA 1MU0A 2CMFA 3ILSA 5ESRA 3ZWQA 1UOOA 5AKHA 2HM7A 2XI4A 2D0DA 1N1MA 3SK0A 3LIPA 3C45A 2PSFA 2VT7A 4DNPA 2WFLA 3F67A 5FRDA 4G8CA 1EVEA 3UMJA 2XUAA 4DSAA 4AQDA 3WQHA 2BFNA 4P93A 1K4YA 5JASA 1O6GA 4DGQA 4J0GA 2GZSA 5CW2A 3FNBA 5ALRA 4YK7A 5LKAA 5EFZA 1CUWA 1XZAA 4A23A 1LPOA 4UHCA 5AM5A 1CLEA 5HF6A 5T4FA 4EY6A 3FSGD 1DTEA 2WFLB 2WG1A 3SWWA 4FLMA 3FCYA 2ZYIA 4AMYA 2HFJA 4AZ0A 2CBGA 3QYJA 2CJPA 5EI5A 1QIKA 3WK4A 3DQZA 3DCNA 1ORWA 4KR0A 4H35A 1ZIXA 3G0DA 3ICWA 4OYYA 1GQSA 2WU3A 2EEPA 4J0CA 3DYIA 5A71A 3WZMA 5IH7A 3IB3A 1CRLA 4U2EA 2XDWA 3JYHA 1YA8A 4DNFA 2ONCA 3G0BA 5FOQA 2Y2VA 2GBIA 1MX1A 5BWBA 2Q0XA 3R3VA 2VJBA 1UKAA 5AKGA 1UK7A 1FFAA 2C4HA 1WCYA 4FFWA 4A16A 1E3QA 3HJUA 3KWJA 5FV4A 2C5FA 4Y2QA 4W1RA 5AI6A 1X70A 3P2MA 1GPNA 3V1NA 1H2YA 3I6MA 1QFSA 4Y2JA 5AKIA 5DYYA 1UK8A 2WFZA 4H7FA 4X92A 5AKKA 4GWLA 4H7EA 1Q83A 3C8DA 3V48A 1XZFA 4AB1A 2RIPA 1H22A 1QIHA 4CCWA 5DJ5A 4WFKA 2WFMA 4G5XA 4P92A 4LXHA 4UFNA 4XWGA 4DTCA 4ROTA 5AM2A 4MYDA 4L9AA 2XMSA 1CEXA 3HYSA 4UHFA 5CRIA 1J07A 1EHYA 3C6YA 3QMWA 3I2IA 1QJ4A 1Z68A 5ALOA 2HA2A 3OG9A 1A8SA 4LXGA 1THTA 2JBWA 2G4LA 2BGRA 1H2XA 3WL8A 4Y2YA 1AZWA 1XROA 5DWDA 1EK2A 5AI5A 1SOMA 3OM8A 2XB6A 1J06A 1ZGCA 5EHQA 1CUBA 5ALDA 4FBMA 3WWCA 4DSZA 3D7RA 4Y2XA 2WTNA 4PQEA 1SFRA 4DMFA 1R50A 1N5MA 5FP0A 4LIPD 5E4YA 3C5VA 3H2IA 1CUXA 1DQYA 4J3JA 3NUZA 1QTIA 3G8YA 5ALEA 1UFOA 1C4XA 2OCLA 1G4HA 5LZ5A 3TEJA 5AKJA 2X76A 4CG3A 2HU7A 2WIDA 4OYLA 3FYUA 3EIOA 2DQZA 3WL5A 4CIAA 2HFKA 3A6ZA 4BC0A 4BCBA 4W1SA 4HZGA 4RPCA 2WTMA 1W52X 1ZI9A 2DHDA 1OILA 3FWHA 4IHAA 1WB4A 1EINA 4OPMA 5AOCA 2XQFA 2JGFA 2AJDA 3TJMA 3PFCA 2FX5A 3AUKA 3DNMA 3WMRA 3A2LA 3FYUB 4J0KA 3U0VA 5I7UA 1QIFA 1VA4A 2G5PA 3PUHA 4BB0A 4QA9A 4HVTA 2H7CA 4F5ZA 1BRTA 4QNNA 4G8BA 4Q3LA 2JGLA 1QIJA 1TK3A 3NOXA 3WKEA 4FNMA 5ALQA 1BCSA 5KBYA 3G0CA 2DSNA 4ITVA 1NU8A 2XQKA 4FNGA 3BIXA 2AJBA 1D07A 1DWQA 2ACEA 4U2DA 3VJLA 3AJAA 4P08A 3WK5A 2Z8XA 4GXNA 2XMCA 1ZD5A 5JYCA 2VF2A 1LPBB 1XZGA 2ORYA 3SX4A 1LPAB 1A7UA 1ZJ5A 1QZ3A 1YAJA 5AK5A 3L1JA 1HL7A 4Y2SA 3M81A 1LLFA 1CUAA 2BUAA 2HA3A 2Y6VA 3C70A 1LZLA 2QXTA 4N8SA 5EHNA 3EBLA 3WL7A 3H1BA 1NX9A 1AQLA 4UHDA 4W1PA 5ALTA 5E2IA 4HRYA 3WK7A 3E4DA 1MJ5A 3N0TA 2OAGA 3I2JA 2I3ZA 4K6HA 2B4KA 5HFNA 4LYDA 2BCEA 3H2JA 2QM0A 1FJ2A 3WK6A 3ANTA 1HKHA 3C6XA 1THGA 3DOIA 2Y1KA 2V97A 3A2MA 1E8NA 2IITA 2PUJA 4EBBA 1OCEA 2RHWA 4OSEA 1VJ5A 1VOTA 2OPHA 1QFMA 2QMQA 3DLTA 3STUA 4N5HX 4HXGA 4BDSA 1QO9A 1MTZA 5JARA 2GYVA 2PX6A 3R40A 4B82A 3R0VA 2DQYA 4PO3X 3I6YA 3F98A 2J3QA 1EX9A 1ISPA 2C58A 4MJ3A 2VAXA 3BWXA 3STYA 1ZGBA 2B9VA 4N5IX 4BRSA 1H23A 4ZV7A 4BE9A 1G42A 3V1LA 5K3DA 1XZIA 2XUGA 3AINA 1E5TA 3WL6A 1E89A 1RYYA 3D2BA 5D6OA 4I19A 4UBKA 3ZLVA 5T4EA 1XZKA 1AURA 3STVA 3D3NA 2O2IA 2DHEA 3C5WP 4XVCA 5LP1A 5ALJA 5AIBA 2BGNA 5CT5A 2OCIA 4MEBA 1A8UA 4X95A 3YASA 3QMVA 1GKLA 2VQ6A 1LNSA 1BE0A 4BZZA 3FYTA 4BATA 4FOLA 4OB6A 2XQGA 5DNWA 3HRHA 4U2GA 1MPXA 3BDIA 1BROA 2GYUA 2G5TA 5A7HA 5IKXA 5JAOA 4GHWA 3H04A 4JYPA 5E4JA 4CFSA 4WY5A 3H0CA 5ALMA 1UKCA 1LPNA 2R11A 2JF0A 2IX9A 2XLCA 3G9TA 1DX6A 4V2IA 3DD5A 5CXXA 4ZREA 4AO6A 5A7GA 1ODSA 2G63A 4EY7A 4ZWNA 1FSSA 4FLFA 3PF8A 3I1IA 1H2ZA 3IVMA 3ESCA 5EHZA 1USWA 3HSSA 1J1IA 3AIMA 2WILA 1CUVA 2VSQA 3VKFA 1QIMA 4B7ZA 1CQZA 1L7AA 1TIBA 1AC5A 2C0QA 4QEKA 5AO9A 2PSJA 5DNVA 3X3HA 2WUFA 4UHEA 1UZAA 3CCBA 4E11A 3TGLA 1MX9A 2PKYX 2ZJ7A 5AKLA 5K3FA 3ZI7A 2VAVA 2R8BA 5LIPA 1JJFA 3OPMA 4TGLA 1XLUA 4WCVA 4S0XA 4M0FA 1UK9A 4H7IA 4Y2PA 3MUNA 2XUPA 3R3XA 1XRPA 2VJAA 3RLIA 4BVKA 1XQXA 4WDQA 4U2CA 5CBKA 3VVLA 4FKBA 5K3FB 1Q0ZA 1BCRA 5LZ7A 4JH0A 4KAJA 4B85A 4I3FA 3DS8A 2HIHA 2PSDA 3HI4A 4QDXA 4ARAA 2PVSA 3ZPXA 2JGMA 1IZ8A 4YASA 3HLKA 3WWPA 4JYMA 2QT9A 5CURA 3RARA 2WUGA 5JAUA 1CIJA 2VA9A 3NWOA 4KE9A 3FAKA 5JALA 1W4LA 1JJBA 2NW6A 1LGYA 1XZCA 1UWCA 4F21A 1UT6A 2H9YA 3R3ZA 4O08A 2XUDA 3QM1A 3FVTA 3IURA 5HF9A 1CUIA 2DCMA 2O7VA 1XZBA 2QS9A 5AI4A 3ESAA 3KOOA 2PPLA 4FHZA 1XKTA 2O2HA 2FUKA 5ALKA 1LPSA 4FMPA 3V1KA 4G4GA 5D3ZA 3W06A 2XQIA 1ZI8A 3IBTA 1W1IA 3RM3A 2OGZA 4OU4A 4PV7A 4C01A 3W2TA 3C8HA 1DQZA 5FPQA 3WIBA 4FWBA 1GPKA 2D5LA 4DMHA 3VXKA 1QGED 2VJCA 1TRHA 5CT6A 2CUTA 1JJIA 3HACA 4M0EA 2Z3WA 1XLVA 3IDAA 3ESBA 3G02A 3STWA 4NS4A 5SYNA 5AIAA 3KXPA 4X71A 1DU4A 4Y2TA 2H7YA 4QLOA 4KACA 5LKRA 1W75A 1ODCA 2J3DA 3ZV7A 2VTVA 4X6XA 3I1YA 2WIKA 3AILA 3WWOA 3WJ2A 3HABA 5IVKA 4H7KA 1P0PA 2B20A 5ALPA 1GXSA 4J0DA 2HA5A 2I03A 4IO0A 4FTWA 4Q3KA 4WY8A 2VT6A 5KWIA 3LS2A 4EZIA 4X91A 1JI3A 3G0IA 4ZV9A 4WFIA 1R1DA 4MQLA 1IVYA 3EQ9A 1CUFA 3I2FA 5IVIA 4UHBA 1GT6A 2JGIA 4EHBA 5ALIA 5JANA 1RWQA 4OUKX 2PSHA 5I9IA 2WJ3A 1FFCA 5DYWA 1CUSA 2HL6A 4JNCA 4INZA 1W76A 3O95A 3H1AA 1YA4A 4GEGA 3OTQA 1Y7HA 3UUEA 2BUBA 4G8DA 4X93A 3MUOA 4C89A 1QLWA 3O4HA 5DNUA 1WPXA 4Q34A 1HLGA 3V9AA 4K6KA 4MQMA 3UUFA 1QOZA 5LLSA 2C0PA 2EDAA 1CUJA 2ZJ6A 4G9EA 1WM1A 3GZJA 5AM4A 3KD2A 4EY5A 2JGKA 1ZI6A 5ALWA 4Q05A 3GELA 2XQJA 3FLBA 4HS9A 5YASA 2GBCA 4HTAA 1MT3A 2FJ0A 4F60A 1GGVA 4X97A 1SCQA 4F0JA 2WKWA 5HF8A 1EB9A 4IH9A 1XZLA 2VJDA 2C5GA 4OB7A 3QPAA 4L3WA 5DYTA 3BDVA 4X90A 5LZ2A 3WK9A 3DJYA 4BCCA 1ODTC 5AKYA 3I2HA 4K6GA 5HKAA 4IQ4A 3D4LA 2ZYHA 1HQDA 3W05A 2HA4A 3O4IA 1IZ7A 4L72A 2Z8ZA 5JAPA 3A2NA 4HXFB 4ZXFA 4Y7DA 4AMZA 3W9UA 4E46A 5H3HA 2PSEA 1IUPA 1CUUA 1OXMA 3IUJA 1J2EA 3EQ7A 3IUNA 1F0NA 1EI9A 5AK6A 1BN7A 5ALYA 1GKKA 5EIHA 4BCDA 1S8OA 3KSRA 1XLWA 2Z5GA 1QIGA 4GW3A 3BF8A 3D2CA 4RNCA 1JFRA 1PV1A 4IH1A 1YAHA 1BS9A 1E66A 4MEAA 4DIUA 4BYMA 4FDMA 4B9EA 1QONA 1UKBA 5T4HA 1U2EA 5IVHA 4CG2A 5ISMA 3PE6A 2WQZA 2V96A 3WWEA 1WHSA 5EGNA 4EY4A 5JZSA 3EQ8A 2JGJA 4AN0A 2QR5A 1IMJA 4PW0A 3IIIA 2CEKA 4FBLA 2OG1A 4N8EA 1YB7A 1TCCA 2OCGA 4BTVA 1CUYA 2WIFA 3G0GA 1ETHA 1ACJA 5JIBA 1ZD3A 4H77A 3BXPA 4Q3OA 1K6EA 1LBTA 1XZDA 1DX4A 5FKJA 2DR0A 5AP9A 5HKBA 1BN6A 1CPYA 1YASA 2AJCA 1SC9A 7YASA 4EUSA 5K3AA 4QDZA 5HK9A 3R3YA 4E14A 3BJMA 3I2KA 2YXPX 4EB0A 3D0KA 1YSCA 4UFOA 5HZGA 5AOAA 1GZ7A 1TKRA 3R3WA 3Q0TA 2ECFA 1KEZA 3WWDA 1UK6A 4J0IA 5AKXA 1AGYA 2WUEA 4UHHA 2WLSA 1EH5A 2ROQA 1EA5A 3FBWA 5A6VA 2WHRA 5F4ZA 1AUOA 3N2ZB 2XLBA 2I3DA 1KU6A 1U4NA 4OD0A 2WSLA 3BF7A 4J0HA 1MNAA 3G9XA 4D9JA 1XZHA 1W6RA 2HRRA 4MWSA 4Y2VA 4PNZA 2HU8A 3B3QA 2HU5A 3ANSA 2HDWA 1FFEA 1MAAA 4AO7A 3BJRA 5AKEA 3CN9A 5EIAA 3QZUA 4CI9A 2ZJFA 4YPVA 2ZYSA 1JT2A 4JUIA 3WKCA 1F6WA 4HRXA 2H1IA 1LBSA 3K2IA 4UBMA 1VE7A 4J7AA 4MYSA 2PM8A 3PUIA 5A2GA 4LXIA 1L7RA 2HHAA 1E8MA 4HXEB 4WJLA 2HRQA 1ZJ4A 5KREA 4A5SA 4CCYB 5C8ZA 1BU8A 4DNOA 4DYHA 3G9ZA 1TCBA 5JD4A 4L0CA 1XZMA 4GBGA 2HA7A 3H18A 1GQRA 4E15A 1CUZA 3HEAA 1WPRA 3AIOA 3F8SA 1EVQA 2XMDA 5CT8A 3DEAA 4N8DA 4WDRA 5LYYA 2QUBA 1BEEA 1P0QA 2RAUA 4NMWA 3O4GA 4X00A 5AK4A 2CKMA 2WHPA 2W6CX 5DLPA 4PF1A 1CUCA 5C7YA 5SYMA 5AH0A 1QIEA 1DT5A 4Y9SA 4C4ZA 5JADA 5AM1A 3VJMA 4B0PA 1EDEA 3GUUA 5LZ9A 1VZ3A 4AX4A 4XIIA 3PICA 3G9UA 5AICA 4EA6A 2XUOA 2PU5A 5HFAA 3D5EA 3AZPA 1CUEA 4AN1A 1UXOA 1ZICA 3AZQA 3T4UA 3O9MA 2WHPB 3IUMA 1R88A 4KEAA 4KAFA 1DT3A 4C6HA 1VE6A 3H2HA 1VXRA 2QXUA 5T4BA 2K2QB 5JZ9A 5I8PA 4LKOA 1EK1A 4KJXA 2OQIA 2E3JA 2ZSHA 4CG1A 2DHCA 5JZBA 1MO2A 2WUDA 3ZLUA 3K9BA 2VATA 4J0JA 1TQHA 2XMZA 1P0IA 1G66A 1IUNA 3WJ1A 3DL4A 3WK8A 2X8BA 5CXUA 5C81A 4G1FA 5ALFA 3BIWA 4UBNA 4BAUA 4BTLA 3I2GA 1Q84A 1VA5A 5ALSA 3C43A 4DMCA 1HDEA 5FXMA 1C7JA 4KRYA 2GYWA 3ED1A 1VKHA 5KWJA 4FLEA 1G5FA 2QVBA 1XRMA 1AKNA 2YYSA 3VJKA 3R3UA 5IVDA 1F0PA 4PSCA 5AHXA 3QH4A 2AJLI 1F8UA 4B9AA 5AOBA 3DKKA 5CTAA 2GBGA 2HA6A 4X85A 2X5XA 3G7NA 5HCUA 1Q0RA 4RE5A 1T4MA 1WHTA 3AFIA 4UBJA 2RI6A 5CH5A 4B84A 5AM3A 1DINA 1K63A 3EF3A 2WG2A 4H0CA 3H17A 2QJWA 2Y6UA 2HADA 1FFBA 4ZI5A 1I6WA 1XZEA 3MVEA 3DYVA 5BOVA 1XRNA 1CVLA 2VEOA 5ALGA 3H2KA 3HXKA 6YASA 3AIKA 2RGUA 3W9BA 5ALVA 4GLBA 2W22A 2P8SA 3E3AA 3IUQA 2WU4A 4BBZA 1XKLA 4BAZA 3QVMA 4UPDA 5ALLA 2HA0A 2EDCA 1XRQA 5E4TA 3BE8A 1B6GA 3E0XA 4B6GA 3VVMA 2PL5A 2ACKA 2Z3ZA 3QBJA 2OGSA 1AX9A 2PUHA 3DKRA 4HAIA 2XUQA 2JGEA 5J3JA 1XQVA 1GPLA 4QWWA 1WOMA 3M3DA 1JU3A 1MNQA 3C6BA 3WYDA 4FFVA 3CN7A 2OGTA 4B80A 5K3CA 2XUJA 2BUCA 5HF5A 4C88A 4Y2RA 1QTRA 1H2WA 2ZSIA 1YS2X 3L1HA 1A8QA 1QIDA 2YH2A 2V9ZA 4WFJA 3O9VA 1JMKC 4W63A 1ZD4A 3ICVA 3O0DA 4UBLA 2WIGA 4BP8A 1SCKA 3WYNA 4QDUA 1QO7A 2PU7A 1AMNA 1U8EA 3SC2A 2WG0A 3JWEA 4QE3A 4DMKA 3W04A 1XFDA 1CUGA 1TAHA 5AM0A 2JIDA 4B83A 4NZZA 3QMMA 4ZRDA 4KAAA 1CQWA 2V98A 3D59A 4UBIA 2DFPA 1Y37A 4NVRA 3GFFA 5AI9A 5K3BA 4RGYA 1R4ZA 3DDUA 2PBLA 2QUAA 3OOSA 4H7HA 3WA7A 2WHQA 4BE4A 3ZLTA 3BL8A 4QLAA 3RK4A 5A7FA 3WZLA 5JD5A 5FDFA 1UOQA 4K2AA 4AZ3A 4LYEA 1VLQA 1X2BA 5JAHA 5K5EA 2AJ8A 3M83A 4M0MA 1YS1X 2QKYA 3LCRA 4BAGA 1U65A 5FPPA 3WIOA 4X3CA 3K6KA 5AK3A 2CZQA 5CT4A 4UFPA 2AXEA 3C6ZA 1LPMA 3FLEA 5C8VA 5ALUA 2XMBA 3F97A 4BRZA 1LZKA 2XMQA 2QTBA 1MN6A 3F96A 1N8SA 2UZ0A 4BDTA 3IULA 1CUDA 1ACLA 4X94A 5CMLA 5BWCA 4X7BA 2OXEA 2OLEA 4QDOA 3WKDA 5D3KA 4H7JA 4PSDA 1T2NA 4XJVA 2ZVDA 2JEZA 2QRUA 5A62A 4Y2UA 4AXBA 5JATA 4QZVA 5CH8A 5LZ8A 4QWMA 1C7IA 3DL7A 5ALNA 1Y7IA 4G4IA 4BC1A 3E1GA 1R9NA 1JKMA 1K5PA 3PF9A 2RONA 3VISA 3DOHA 1BEZA 3IA2A 2XT0A 4ZGBA 2J4FA 3H19A 4LHEA 2FJPA 1QE3A 3U1TA 1QIIA
chains in the Genus database with same CATH superfamily
3OHPA 4RXMA 2IYXA 1ZCJA 1KJWA 4YBZA 4W9NC 4CMKA 1L5ZA 4EA9A 1X77A 2SICE 4ZTBA 3QKSB 3T52A 2QZPA 4V1CI 3OMWA 3BTVA 3C7AA 4U7HA 1FNCA 4GT1A 3U1BA 3BX1A 1Z74A 3K8OE 1E2KA 2IZ6A 4BO2A 1ISRA 4YRBA 2P41A 1J8VA 3FOBA 1CR6A 2FWMX 2VBIA 4E7PA 2O8NA 2JZCA 4JVNA 3SAJA 1A5AB 3NCTA 1ZNYA 1P4RA 2SHKA 1FZQA 1WE2A 4J1TC 4L22A 2A59A 1AOXA 3ZQJA 3JQ8A 2HMAA 3D6VA 4LRQA 4D46A 1PEDA 4WGFA 1YZ3A 1X2EA 1C1XB 1W5SA 3M5PA 5C37A 3CGWA 4IGAA 4KDCA 3TXYA 4G0VA 2WTEA 4X63A 3E9MA 2PS3A 1AKVA 1RXSA 2V0NA 1JS1X 2G88A 3PJDA 4D82A 1F5NA 1TF5A 2UKDA 4MS1A 4E3WA 2X13A 5AVKA 5CA1B 5EJ6A 1TTQB 2BVNA 3O31A 4D43A 3N0XA 1QYVA 2JFNA 3Q3CA 2I3AA 3MWDB 1YZTA 3STXA 2XRZA 4IICA 2D6FA 1AKEA 1DIBA 2WJ6A 5H4HA 1NN1A 4U2FA 2O7RA 3R0QA 3WGHA 2DTEA 2Q2WA 3I9OA 5DLDA 5FWYA 5KQSA 1MRNA 4UVDA 3VC1A 4EEZA 4X44A 3STTA 2BEUA 4XCQA 5LB4A 2OBNA 3NMUF 2NZVG 1TL7C 2Y1LA 2B35A 3QLUA 3V1MA 4D3SA 5IJ0A 5LWHA 1GCAA 4J3NA 1J90A 2AYZA 2CVZA 3GIDA 3S5JA 4Q82A 1J2RA 3ZEAA 1PT9A 3VU8A 1JDJA 2Q1UA 2XUFA 4KXWA 2DKOA 2H1FA 2EYQA 5FBQB 5I01A 3HXMA 2F9LA 1K8RA 3I32A 4UHJA 3MCVA 2QX4A 3CNOA 4JX9A 2BP7B 2QRMA 2ES4A 2EXXA 1ZH0A 3V7UA 3WMEA 1EMDA 3EFBA 4OBXA 1RM5A 3UTCA 2F3SA 2A58A 2ZJ1A 4UUOA 4MVWA 2J9ZB 3WA6A 5KTNA 4G23A 4EQZA 1ONOA 1NVMB 3AR2A 3ZWNA 3AUFA 2P78A 4PFSA 3E70C 4YCBA 3L0DA 3RUHA 2GEDA 1X7XB 1WB9A 2P2CA 2PVCA 1RQPA 2HQSA 5C52B 2HJSA 4KBYA 4MUBA 5C35A 3TG8A 3ITNA 2PLRA 3VKWA 4TKVB 1N5RA 2ZE8A 3LLCA 3INTA 3DAPA 3ND8A 1T91A 2F64A 3R0IA 4G5FA 3WLAA 4X6UA 1JHVA 1MQAA 2CLHB 4JEIA 4AKGA 4F3RA 3EB9A 1ZX1A 2ZXUA 2CYCA 3DZDA 3DBLB 3IAM1 5AVYA 4C4XA 3V8EA 2V0CA 4LPSA 1IL0A 4OA5A 1GRNA 1KJNA 2BDEA 1B41A 1SPXA 1FFDA 1K7YA 2XNKA 3DKIA 4NNPA 1AMOA 2Q1WA 4QGAA 4F92B 3H5IA 2JEYA 1QM5A 2IW1A 1N0UA 2VBCA 2ILTA 2QV0A 4WLVA 3W5BA 4I8IA 3CVXA 3RADC 3BGDA 3I34X 5AI0A 4MYUA 2KWIA 4D97A 1E4EA 1JAYA 2QLNA 4RLSA 3W2GA 3Q2OA 1SU7A 3X1DA 1H5NA 1KVRA 3T5BA 3HCCA 3MGKA 3DE3X 1RPJA 2XY4A 2W2LD 5E1BA 4X6YA 4JV5B 5DZSA 2ZBRA 3GLHE 3KSZO 4DLNA 4N7JA 5I9SA 3ABIA 3DT8A 3VHLB 2GPAA 2W93A 1ZIOA 4JJ8A 1NBMA 2JGRA 2IHJA 1MIOA 4PVDA 1P1RA 2HMTA 2VDUE 3DM5A 3KKEA 1UPCA 3QE2A 4RKFA 1IBCA 2E82A 2OWEA 3EIXA 3M89A 5PNTA 4C14A 2QF7A 2QVGA 3AR4A 2WIJA 1FUUA 2BBTA 3I72A 3WRYA 4FMCB 1KPHA 1M5TA 5KNLA 3WIDA 1Q92A 5H82A 3DWIA 1AZSC 2RI1A 4FDAA 4OHWA 2ZT7A 1XZJA 5IJWA 2ZJ8A 5KIAA 3GD5A 1Y1SA 3ZV5A 3K0BA 4IEFB 5G4LA 2GASA 121PA 4KRXA 1HLPA 1TTPB 4GFDA 4YMIA 2H1RA 2BZ0A 1X15A 4Q7EA 4G0WA 1AIPA 4JGGA 5U4XA 1G2OA 3GRZA 1U6IA 2R4UA 5DWQA 3N53A 5JEDA 4D1YA 2GZRA 4DPMA 3KYBA 2ZAGA 2BFDB 3N0WA 4Q1EA 3COZA 4NCBA 4LE0A 4UEWA 1DKRA 5J2TB 3ICPA 1KQOA 1B93A 2CUNA 2YMLA 4ISCA 3DAHA 4YIKA 4DNQA 1XPUA 3QXXA 2GPYA 4FW9A 1S2IA 3T3HA 1I6LA 4Y0VA 5HS4A 4QG3A 3TCNA 2AFVA 1OLSA 1LI5A 1ZVJA 2HEIA 2ZSAA 4AO8A 4YX9A 1WBBA 2OYCA 1NZFA 4U7DA 1JP7A 1UP4A 3ZIAD 4WZ6A 4QG7A 4DM3A 3FOAA 2NO5A 3KQTA 5DTIA 3TR6A 2GVDC 4LKRA 2QR2A 1D5CA 3ILHA 5DLEA 5KOJA 2HBRA 2CLIB 3FMPB 3HJTA 2R1VA 2EG5A 4ZCQA 3R3JA 5EE1A 1QG0A 1XRLA 5LQAA 2X6QA 5BV7A 1Z4MA 4MJXA 2CB9A 1MR3F 3TPCA 1V1MA 3KXDA 1PTJC 2NO1A 4QPJC 3P2KA 4CYMA 4DEXA 2O20A 3OZEA 1JKFA 4GZ5A 4PHFA 1KJYA 1JAXA 1L7NA 3BT7A 3EFHA 1ORTA 3RNLA 1JQDA 1GR1A 2XRMA 3DAOA 4PWZA 5D5HA 2I4OA 3RC7A 1MJFA 4E32A 3REQA 4EYGA 1ZD9A 5EHXA 2IEYA 1ZMRA 3R6DA 4RMHA 5D3QA 4AJKA 5LBIA 1Z0KA 2I6SA 3FF1A 4MI9A 3D6MA 3MQFA 1YKFA 2GCGA 4EY8A 1Z0FA 2JCYA 4YQYA 4RMIA 4J1NA 4KXVA 5JD6A 4OQ4A 3OESA 1OAKA 3A3PA 1KI4A 2F00A 4BP9A 3A25A 3O3CA 4M76B 4M87A 2DLNA 2AOUA 2WDPA 2A7XA 4DEVA 4GI7A 5JVDA 2GPBA 1SKYE 4YV7A 3AUUA 2GAJA 4OB8A 2YASA 1KTVA 4RKEA 2CMHA 3VTFA 4QJ3A 3HVRA 1TYCA 4ALLA 3FVQA 3RTEA 1T26A 2P6PA 3ZW7A 3EHDA 1GKUB 3EXG1 2MMCA 4EAAA 4F9FA 3AUTA 3CCCA 3GNSA 3ZD8A 2IYTA 4FILA 4C5BA 4CUKA 4Z49A 2QSZA 5IHXA 4M1WA 4OM7A 4UM9B 5I9TA 4M1MA 5CFZA 3S2ZA 3CZ4A 3D4IA 2G8LA 1ICEA 3OCUA 4GKBA 4BO3A 3B5IA 4DJFC 1G7TA 1D1PA 3VRHA 4CM4B 2ZBVA 4RHCA 4HX9A 3U44A 3C4VA 1U8AA 5FA5A 5KOHB 1OTXA 3PFBA 3QI7A 4AKTA 2P2LA 2P2NA 5IT5A 4ZQBA 2O4CA 5FLKA 2P79A 2QXYA 1P81A 2AFIE 3DO8A 3WL3A 3TKAA 1E3IA 1Y89A 4I5DA 3T9BA 3UJAA 4V0KA 4I9HA 1VJTA 2SECE 3ILVA 2J0VA 1P1KA 1U80A 4Q1VA 4RX1A 3W4KA 3WRWA 5HBRA 2V7GA 3QTLA 3JY6A 1DC6A 2G67A 1GAWA 4ZCMA 5HUJA 1WDLA 3EG5A 1YBVA 5G02A 5T7BA 4ENVA 1ORRA 3ILSA 3SZMA 5MF6A 4W5QA 2O14A 2HW8A 1UOOA 4DC9A 2ZI5A 4KLRA 3A58B 4RFSB 1KY2A 1CEQA 1DCFA 1NBMD 1O4VA 1RHUA 2D0DA 2QMUA 2UVPB 3QJYA 4GZLA 1PWZA 4XLTA 4A73A 1FXWA 1I5OA 3BEDA 3LM8A 3G2NA 4UDYX 4WNAA 4XLZA 1KZGB 4FZRA 4QUIA 3IAS1 2PL1A 1J0EA 2WAMA 4G8CA 3LZCA 2YIMA 5JNVA 4J49A 2JIOA 1W7AA 3WWYA 1NE7A 2ID8A 5TJ9A 1LJUA 2QK4A 3FFWA 2Y1FA 4R5HA 4AZTA 3D3JA 4D4IA 4CE6A 2GAIA 3T5PA 3DTTA 3KR1A 2FLWA 2ZBPA 3VH1A 3WBJA 1V5FA 2OHOA 3T8YA 1Y7PA 1YR9A 3SQMA 5JASA 3DW3X 3L7MA 4RMGA 4WUVA 2E49A 2BEJA 4C3UA 1JDUA 4DGQA 4X84A 3CUTA 4HWSA 5BSMA 1QAMA 3KEGA 1HDRA 4PLVA 5I7VA 2OD9A 3JRXA 3PD0A 1UFVA 4FE4A 1GARA 4MX8A 3KJFA 3FNIA 3CUUA 4IDDA 5E3JA 2VRBA 2HR1A 1NJFA 4BNLA 1WMDA 3D4NA 3D1JA 3JQEA 2WT8A 1XZAA 3C41J 4JJEA 5LQSA 1GITA 4HUQA 5BMVB 5CDFA 2ENUA 1XN4A 4UHCA 5AM5A 2M9MA 3X1YA 2VH2A 3MYYA 3IQHX 3ONNA 5LOVF 4JFAA 3WISA 4DQ0A 4EY6A 3DAFA 3K09A 1DTEA 2BTQB 4FLMA 1NY6A 3A3NA 2VPXA 4DA8A 1FUYB 3L41A 4GOND 3RVLA 2YYAA 4YJ3A 4PN7A 2MCFA 2CBGA 2GN4A 2NO9A 1M67A 3FRJA 5T3YA 4W6QA 1IZ0A 1M5UA 1YGYA 2ZPTX 5EI5A 4YRGA 4KQMA 4QYIB 1ZGJA 1L4KA 1T2AA 1BMQA 4FFPA 3WK4A 3EC7A 4UVHA 4O4LB 3OPYA 4P4GA 3INNA 1X1RA 4V1CB 4JSYA 4V0NA 4NPCA 4DBLC 5H70A 4PZCA 1XNRB 2OHFA 4HJXA 3LTNC 3DCNA 2HLDA 3UO8B 4KR0A 2POCA 4FSHA 1WZ2A 4BN4A 1U3TA 3FNGA 3IL2A 4ALKA 4J4BA 3HKEA 3ICWA 4NZYA 1XEWX 4OYYA 2ZCVA 2FX3A 3UJPA 3L4BC 5A4IS 1KH2A 2CHVA 1UBTS 4LHSA 3GGGA 4M7RA 4RZHA 4XQEA 3C1OA 5KNDH 2DECA 2P0EA 4L28A 3FHCB 4P4SA 4OGKA 4QHYA 4BQQA 2R6AA 2I34A 2JPDA 2XCIA 3KTAB 1JIUA 3VU1A 4XWKA 5IJZA 1C7RA 2AN4A 4Z2AA 1MF7A 2G77B 2MR5A 3F90A 2IJGX 3IPYA 4MUJA 3F3YA 1CRLA 3DLPX 4ZOBA 5LC1A 3HR8A 2XDWA 3M6WA 1F38A 2EFJA 4I4TA 4C5AA 3QK7A 5A5DA 1Z73A 1S8FA 3GP3A 3HP1A 1B43A 1TYBE 2QN3A 4BFWA 5FOQA 5AJXA 3NS7A 4DV6B 4Z4GA 1AK1A 1MVOA 3S6JA 3D8UA 1PGNA 3QKWA 4JVLA 2G72A 2REQB 4JA2A 3ZDXB 5BN3A 3Q4GA 1GAXA 2COKA 2YRFA 5AVRA 2VAMA 1RQ2A 1AKYA 4FQ8A 5BWBA 5LLDA 1Z6GA 4BJ3A 4Z1MD 1KMHA 3GG9A 1YVRA 2OAP1 1PF7E 2H4HA 5GY7A 1SD2A 2RDMA 1DIHA 5JT1A 2CNDA 1KEPA 3GIWA 4Z54A 2C4HA 4WLOA 3B6KA 1YJAA 2FEMA 3LBYA 4HPXB 4A16A 2ODWA 4DSNA 1I7SB 5ILOA 1YONA 4FFBB 2QP3A 5EZYB 3D7MA 2V6IA 3M6AA 3BFKA 3I9NA 5FUBA 1TFRA 1P4JA 2GJ4A 2VTBA 1G17A 1X70A 1ZRMA 4AULA 2P9GA 3X43A 2F6RA 4JELA 2H4FA 5BOSB 4C7OB 4JLMA 3OZGA 4ILKA 1OTYA 1Z6YA 1VMKA 4C4TA 1QFSA 1E79D 3P9RA 2ZI3A 3UNXA 1A77A 4IIBA 4OAOA 3G2OA 4LZWA 3SR0A 3L7CA 5ARCA 3SJ7A 3EUAA 3VX3A 1LQ2A 3NIBA 4LDAA 4U2KA 2X0DA 5LP6C 1JGTA 4IIJF 1UK8A 4L8FA 4N5LA 2G4VA 2P2GA 3BFVA 3I5AA 3OE7A 4PU0A 4RXTA 3LLSA 4MV4A 4CODB 1VPEA 2NU8A 1QWOA 1M1YA 3C1AA 1FFWA 2PTGA 3I9MA 2V5AA 1S0UA 4AB1A 3DP9A 2RIPA 2G82A 5BWMA 1LSSA 5E9AA 1Z5WA 5KAPA 4CCWA 4I2VA 4L4SA 4NYMR 2RKBA 3UJDA 4GGOA 4D56A 3LHIA 4QVIA 1M2OB 4RD3A 2WFMA 3ECCA 4G5XA 4G01B 1NLMA 3VR5A 4V38A 3B48A 5G4KB 4CM7A 4Q48A 4DTCA 5EEGA 4MI6A 1A8IA 5AM2A 4G36A 2BLLA 1GWNA 1D5WA 3GLGB 4OM8A 3AR8A 2YHBA 4HEA1 5EN4A 3GH3A 4KX5A 4TTPA 3EZYA 2YKGA 3ROZA 1Z17A 4E0BA 1B0UA 2BWJA 4LECA 1EHYA 3P9PA 1EFHA 1Z68A 2HSWA 3E3NA 2AR0A 4YAWA 2FLKA 4DLWA 1YZVA 5D6NA 4AWXA 3BFPA 3EUEA 3LQ4A 3CUYA 2IHTA 1DBWA 4XYMA 4ZARA 3WR5A 3KBOA 3IOCA 3B5JA 3TMKA 4YP0A 1TEXA 3EGWA 3CLUC 2LVBA 3PQFA 3WL8A 4Y2YA 4A9AA 3ADPA 3TSZA 5JS6A 1P5FA 1YGPA 2PRJA 3BBPA 4JLOA 2F17A 4X1OA 1SOMA 3JQ9A 3ZVNA 2DH6A 5K51A 3VU9B 2ADMA 2XB6A 1HNXB 4MLPA 1J06A 1E5XA 2NU7B 3JALB 4NY1A 1G41A 3BHIA 3HDQA 1XXHE 4IBOA 4RA9B 2BTEA 1WDKA 4DSZA 1CU1A 2NADA 2WJJA 2JFBA 4HYYA 4IVQA 3LCVB 4L02A 4AKIA 4L8WB 1SFRA 1NA5A 4OMUA 4DMFA 5CDGA 4U8HA 3VNQA 4OHBA 4YGXB 4ZC1A 4AUEA 5A4KA 1R50A 1DIOB 2R6JA 2NAFA 3CX8A 3GAFA 4HGPA 4KGDA 3DT6A 4AW9A 4BLPA 2ZRCA 5LP6F 1AQJA 2XWQA 2QJOA 1IIBA 2JZNA 1EQ2A 2WD9A 1AA6A 4F1JA 3EEOA 3NPAA 1AG9A 1ZH8A 4MRMB 1CULC 4O2AA 3PUJA 1D0VA 1WF3A 4DKJA 2GZ3A 3AEXA 1P4HA 3EAFA 1K6MA 1P6UA 3GEEA 3MQ4A 1LK7A 3H2IA 3U3JA 5BN4A 3NUZA 1QTIA 2Z04A 3DB2A 5IULC 1FTGA 2ISSD 1T9KA 1CR4A 3ORQA 1UFOA 5C7IO 1I1QB 3P2EA 1MB0A 3MBIA 3L77A 3VPSA 5MGBA 1JH9A 3I5UA 3EXHA 5LZ5A 4EYOA 3ZHOA 1ISGA 4G09A 4HAYA 4HX2A 4BV2A 1R2QA 1QYWA 1X0XA 5A5VA 2HU7A 1II8A 4OYLA 2W6QA 1V5GA 2CNWA 4UOQA 1G1AA 3NC0C 3IP5A 4TMFA 2FSUA 3KQSA 3WL5A 1PQ4A 5EMHA 4LOLA 3RYIB 2HFKA 3DHVA 4ATNA 1ZOLA 4IJUA 4CIAA 1PL8A 5K09A 2H1OA 3P27A 5TGZA 3GFGA 1YRHA 4BCBA 3N2EA 3ANLA 5EGSA 4LRTB 4WFQA 3VNSA 3ZGXA 5L3SB 2FZ4A 1VCMA 1UPTA 4KOEC 3ZE1B 4ER5A 4QYXA 1JSLA 1NSYA 1XZNA 4EX7A 2D5IA 5HJEA 2H06A 3SQDA 2R7MA 2C98A 2JRLA 4HZGA 1TNDA 2FN4A 2WTMA 5FUYA 1W52X 1ZI9A 1JFSA 1D7AA 5CDSA 3KQUA 4E5YA 4OYHA 3TWOA 5E7MA 5T41A 2E55A 3CH4B 4F3NA 1EINA 2H29A 5DT9A 4OLAA 1ZM9A 3QE3A 3CZMA 1QDEA 3OE7D 1E77A 1VPTA 4CPDA 3W8EA 5K0FA 3MTGA 2YJZA 3TJMA 5M04A 1H8EA 4J6FA 4KQKA 4MRPA 2FX5A 4BLWA 3U6KA 4AJ1A 5K9ZA 3RHTA 4S2EA 2PMKA 1OJLA 5A4AA 3DNMA 1DKMA 3NHSA 3UENA 4ZVUA 3DOUA 3WMRA 3QBEA 1SJ9A 3FYUB 4FEGA 2I66A 1E3EA 4JLSA 1UAAA 1CVRA 4BB0A 1VA4A 3N8DA 2LRHA 4G0ZA 3VR5D 3BSFA 2WFAA 5AWFC 1Q1EA 1TPZA 4RZSA 5CB0A 6REQA 3G5AA 4R68A 3J80A 3ZBUA 4PQGA 4D57A 4QNNA 5FX2A 3IQWA 3TW8A 4DRXA 2P2SA 2BZSA 3PB3A 3H5VA 3NOXA 2G5CA 3B1VA 1O7JA 3GRRA 4FNMA 5ALQA 2NUAB 3TR5A 1KQGA 4ITVA 2DSNA 2PG3A 1NU8A 4K46A 5G0WA 5HOEA 4AJJA 3TEFA 2F8SA 1KY4A 1L8LA 3FE2A 3R20A 1DUVG 1NMEA 1JDSA 1Y8AA 4R7ZA 1N2BA 3WO0A 4IV0A 3RRYA 1GRVA 4HDMB 4F38A 4U2DA 3AJAA 4G5RA 2ZYAA 5BSWA 4GXNA 1E2GA 4BU1A 4A26A 2G9NA 1AK9A 1EAMA 3GHHA 3NU1A 4WD3A 1P33A 3ZXIA 2W43A 1ZD5A 2D62A 1H42A 5BXQC 1WW2A 1BHJA 5HJ5A 5F98A 2PUTA 2VF2A 1ZL2A 1Z39A 1LPBB 1CZNA 3F6CA 4HFJA 1KTIA 5IN4A 1R0ZA 2FOIA 1GTG1 1CW2B 2FCRA 4AU1A 3CLHA 3HBMA 4A0QA 1MG5A 3PIIA 1ZJ5A 3UKJA 2B2XA 2OT3B 3QHAA 1SKUA 3HY4A 3L1JA 3KELA 3T9AA 1PGJA 1T24A 2RHMA 2W4MA 3EN0A 4ZT2A 3KAPA 3M81A 5CXSA 2RAVA 4HDNB 2EKQA 3WB0A 2P9TA 3UGTA 2Y6VA 3C70A 1LZLA 4XGNA 4DLLA 2C2GA 2IK8A 3HXLA 3W3ZB 3AW9A 4D74A 5HNKA 1N3BA 3TLKA 3C4QA 2QXTA 5D7NA 1UBKS 5H4GA 5EHNA 3WDSA 3EBLA 2GCNA 2JJ8A 2JG3A 3KK0A 3Q6NA 3VYTB 1G2PA 3WGZA 1AQLA 4MQFB 3VPGA 4W1PA 5E2IA 3NM6B 3R8XA 3WNQA 3UMGA 4BO0A 4HRYA 3IDOA 5AVSA 1IATA 4G26A 3E4DA 1D04A 4KZPA 1PDOA 2HXSA 5B6PA 2B7LA 3GDWA 4NJOA 4OQYA 1ESNA 1VJCA 4YRQA 4XR4A 3U56A 2ZYTX 3L05A 1DHTA 4GZMA 3U4QB 4CWAA 1EQUA 4J29A 4EO9A 2CZCA 2D0PB 2OLJA 2AN3A 4PO9A 4DIDA 4B4KA 4WLNA 2B4KA 4ND4A 3HTXA 5JO9A 2YNMC 2PZEA 3H9GA 4UVIA 3H2JA 3R0JA 4XUDA 1TU0A 2QM0A 2EFDB 1CJVC 2CNWD 4WKCA 5DHPA 4AJHA 1QORA 2FNAA 2HHCA 2ZYWX 3CEPB 3HA2A 4EB6A 2CHEA 4Z4EA 3GJ5A 1B42A 2R60A 2X86A 2XNHA 3A2MA 3JQFA 3IQZA 1E8NA 4OQDA 5J58A 3ZDDA 4CNBA 3DLAA 4YRKA 3ET5A 4US0R 1H6AA 4EBBA 1OH6A 4GICA 4DJDC 4XH9B 1QH8B 1T0JB 1D7OA 1P2BA 1GU0A 3ONFA 1N8TA 4DMRA 5H5JA 2FPOA 4ND7A 1SUEA 1RMYA 3DHWC 1MQSA 3ER9A 2XNDA 3QFTA 1I1OA 3P5SA 2PWBA 1BC5A 2B37A 5AJWA 1Y4SA 3N2KA 2I2CA 3ZJ4A 2JASA 5AVJA 4CM6A 2NMVA 2PX6A 4LG1A 1V8FA 4HEQA 3R0VA 5SV2A 5IP5A 2FWRA 2JEOA 2ORWA 3E53A 3KJIA 3WXMA 2ERXA 2F7SA 4BBJA 2DQYA 1ZCZA 3I6YA 3KZNA 1M2VB 4U9UA 4JSTA 3URMA 5KYXB 3BL6A 1SZJG 2ZXEA 4GYJA 5C1PA 1D3AA 2IPXA 5DU2A 1USGA 3BJEA 4URUR 4YJKA 2ZVJA 4JC4A 3BIJA 3UMFA 3A28A 2ZS7A 1Z6QA 4GC5A 2UZ4A 3F73A 4CLOB 3KEMA 4X66B 1QCCA 2JHPA 2B9VA 4KXUA 1D1TA 2Z4SA 5AYVA 1GPDG 1Y81A 1RRPA 1X74A 4ZV7A 4C4OA 3OIDA 2I4LA 4OLFA 3DE2X 1E2BA 1XZIA 2VZLA 4G6ZA 3VHQA 2O9JA 4F5DA 3AJEA 1HF3A 1T2EA 3UFBA 1LI4A 1A9OA 1W2HA 3AR6A 1M7GA 5ERXA 3UMYA 5DN6D 1PVDA 1XD9A 1EXMA 1RBQA 4XM1A 3DZ8A 4QYWA 1Y8CA 3EDCA 3H8WA 3ZWKA 1RQRA 1ADJA 1P7VA 2WJPA 4ENWA 1OASA 4MI1A 2A92A 2OUIA 1EUYA 1SCUA 3W7VA 4YIHA 1VMEA 3TTTA 3QLVA 1O3YA 3ZLVA 3GN1A 4EEKA 1YZNA 1XZKA 1AURA 3C3DA 3CT4A 1OR8A 3U61B 2Z56A 4A1OA 1P80A 2BI4A 3D3NA 1BXKA 2O2IA 3GUCA 4XVCA 5EHGA 3TQSA 4YCMA 4UD6A 5B3JC 5LD2B 3EUFA 2H65A 4R1MA 4UEOA 2OCIA 3OBBA 4M0UA 4B7AA 1RLIA 4WK0B 4HFRA 1IZZA 4CN8A 1SXJA 2HV9A 3A1FA 1NHWA 4CKCB 1HLFA 4QPDA 4CKEB 2Z1MA 4JCCA 1HRDA 2HCFA 4DILA 4JODA 3MBOA 4QHTA 1GKLA 3TSOA 4D8VA 4FOOA 1U1CA 3RTBA 1DDGA 3B3JA 3FYTA 3B13B 3L0PA 2G36A 1N3YA 2YVLA 2B4QA 1KNQA 1I3OA 4M0PA 4MLZA 5HOQA 4Q00A 2EWMA 4U2GA 3RSOA 1TVKA 4LTMA 5BV8A 1JZSA 4K9DA 1TO2E 1Z56C 1BROA 4KB5A 2DETA 4RFLA 1OIVA 2ZQ5A 5IKXA 5KPDA 2PX0A 3DMNA 5DMHA 2IYEA 3ESXA 4KXQA 4R1OA 4BO1A 1R5OA 2Q07A 1L8AA 4CFSA 2BE7A 3O38A 1RZUA 1AHNA 3NWBA 4FHDA 4MITA 3K0FA 4ND8B 4IYJA 4WY5A 3W2IA 3ESQA 1DV1A 2QTFA 3PA8A 4LJ6A 3U4GA 1DS6A 2QD5A 1OFHA 5DNCA 4PC3A 1NV9A 2XLCA 1SHLA 1HZZC 4L75A 2B7BA 1UBUS 3X1WA 1FEZA 5CXXA 3LOUA 4MVCA 4ZAXA 5I9MA 4UNNA 5SZJA 2IUFA 4ZREA 3WE7A 5A7GA 2CLLB 3HE3A 2PD6A 4M7OA 1MRZA 3AESA 4ZWNA 2ETVA 4RANA 3K0SA 1SN7A 1JA0A 4URVR 1S3GA 3M5WA 2PR2A 4WZBE 4EX6A 2A35A 4GO1A 1J99A 1N57A 1CYDA 2GHRA 1JBKA 2VXCA 3PEFA 4PO1A 1NY5A 4ARZA 2YOHA 2H8KA 2Q21A 1KC3A 1BWSA 1RKBA 2A78A 2JCGA 3LJKA 2IA5A 4MO9A 3W5AA 3H1GA 4ZODA 4X64B 2CXPA 4PYNA 2FPPB 3OA0A 1ZW1A 3FM9A 3HSSA 1J1IA 1XA0A 3NRBA 3EGXA 3RCBA 2PKCA 4CG0A 3AM5A 3FRIA 3LG2A 1JIVA 4LA4A 4B4DA 1WUYA 1CQZA 1L7AA 1G9TA 1THZA 2GD6A 3GEBA 1V2HE 2C0QA 4MGHA 4O3MA 5DNVA 3Q12A 4BNYA 1XTSA 2F8LA 2FR1A 3BSYA 3ORFA 3ZJUA 2G7MC 5FPKA 4NR0A 4H1HA 2VJPA 4M1YA 1E1QA 1NVXQ 2C77A 2C4NA 4AKSA 4D4KA 1WUKS 1RC1A 1U0OC 3FIJA 3MRVA 3R74A 5K3FA 3S7TA 6PFKA 1R5NA 1D8AA 3FHTA 5I9BA 3ZI7A 1XEWY 4UXHA 2ZTSA 3SC6A 4EJSA 2BGJA 4L85A 1A9SA 2R8BA 5MN5A 1RABA 4U5XA 4AJ4A 5K8TA 3EIUA 1JA1A 1HQKA 2DZDA 3K0AB 2QVZX 3OPMA 4TGLA 2IU0A 1YS7A 3C7TA 1UK9A 4NEGA 4KSBA 1K7SN 3DE4X 4LGCA 2BONA 1MJNA 1XDUA 3C14C 4W99A 4Y2PA 4XM0A 1HYHA 2QMYA 3FDIA 3V8BA 3DE5X 3WLJA 4C6SA 4RIEA 2FR0A 3IMGA 2QJTA 2C5EA 3WMFA 2I4RA 2VJAA 1P5HA 3N8NA 1CJSA 3A6DA 3S44A 4BJ1A 2VWHA 3I83A 5DBGA 3U80A 4ZOEA 1WZUA 2B4YA 2C4KA 1YCGA 1GNTA 1JR2A 4R2WA 3UK7A 4O33A 5J1TB 3IV7A 4RDXA 2ODQA 3CR7A 2G28A 3FPHA 1E2HA 1JNXX 1KMMA 2WTAA 4B75A 3IMKA 3VVLA 1QH9A 4JP2A 1L5VA 3CNEA 3KTFA 3SDSA 2WR8A 3M9WA 4OXRA 4DPLA 4ZU1X 4XFKA 1JB9A 2BZ1A 5JWRA 1U0BB 5LZ7A 4IMRA 4TRNA 1UM9A 2Z1NA 4YALA 1SXJD 3H5NA 3LQ2A 4A36A 1U9CA 1QCDA 2OZLB 3LGSA 3OTHA 3ESZA 4QPNA 1T6ZA 1WCWA 3CWCA 1B3BA 4FSDA 2O8EA 1OBFO 4I3FA 4I9NA 2EHJA 2PL3A 2GUWA 4LOAA 4YH1A 2RHOA 1DBRA 1YZQA 1CHDA 1X1DA 3UT5B 2X8LA 7MDHA 1A82A 1SG0A 3HI4A 2ZI9A 3CMCO 3E5RA 1JAZA 5DP1A 1JFVA 4ARAA 2PVSA 2UV8A 3N05A 2P27A 3UKOA 1G1MA 4Y9UA 3RASA 4K3UA 4NLLA 1PNTA 1CZRA 1SVNA 3KSBC 4XWWA 3LWNA 1EZ1A 4WXMA 5TLSA 2BMFA 2IHNA 2QORA 3NT4A 1EVKA 4HX5A 4ML3A 1ZIPA 2IQIA 2VA9A 4KLNA 1V7CA 5HBGA 2QVLA 4FDVA 4DHEA 4TZ6A 2B1GA 3JQQA 2CLDX 5CLJA 2NW6A 3FSEA 4Q9LA 2JFPA 4BQIA 3SZ3A 2WEKA 4P31A 4G1MB 1TQDA 3MYRA 4O5OA 4R6WA 4XWAA 1J0CA 1UWCA 3T3IA 4F21A 3COVA 4F8JA 3AL2A 4PZLA 1P2GA 1FPMA 3G1UA 4C21A 1IQUA 2XUDA 2D59A 4P58A 5CM8B 1WSDA 3IURA 5I7OA 1S3FA 1FK8A 1NYRA 1YTLA 2QX6A 4J9UE 1E2MA 3Q2IA 2EWVA 2W8ZA 2YWFA 3KOWA 3L0IB 5FL3A 1WP9A 5HEKA 1J0AA 1CUIA 2DCMA 4BMXA 1T4BA 3EWIA 2HF8A 1WRBA 4N5NA 5AI4A 1BMDA 4JB8A 3TX6A 1YV9A 1MKYA 3KOOA 2CLSA 3MWYW 2G70A 1MVLA 2P75A 1XKTA 2C2MA 2FZ5A 2O2HA 4M53A 5CU7A 2EBUA 5ALKA 1LPSA 4FMPA 1PK9A 3I2YX 1OZAA 2EFGA 4KI7A 3RYHA 3DAYA 1G8GA 3INRA 4K9PA 4HF7A 4JEUA 3EW9A 4MH0R 1ZC4A 1SRRA 2FMUA 1IWOA 3W90A 4RTQA 3IC5A 3AOGA 4OOEA 1H4VB 2OZKA 2NYAA 1VDZA 2V3WA 2GF2A 2OGZA 1PK7A 2NVUA 5AUPB 4OU4A 1HFWA 4QREA 5E6RB 1HY3A 5BV1A 1Y6RA 3VBCA 4E70A 2Q5OA 4PV7A 2BH2A 1A7JA 2OO5C 4JDUA 1ZHOA 2AX3A 2OFXA 1DQZA 2OXRA 1J8QA 2ZJ2A 3IA7A 3QA3E 5HCNA 5IFKA 1RHMA 4WNIA 5FWAA 4G07A 5EE9A 1P29A 2O6HA 1AKWA 4XUCA 2JVJA 4BNMA 1GPKA 2CBZA 5TE9A 3VXKA 2GJAA 2HRDA 5FOWA 1TF7A 2X9QA 2J45A 2QRLA 4GOXA 2VG8A 4M0EA 3N58A 3KUUA 4RUKA 1XDWA 4IKOA 4LY3A 3D6TB 2WM3A 1ENZA 1O4WA 1O6BA 2DBRA 2XTAA 3B9QA 3F7NA 5J1SB 1M76A 1JR3E 3FPEA 1XI2A 4NS4A 4QYTA 3D3WA 3OTWA 4C3VA 2FUG6 3CZ9A 3OKFA 1XVTA 4MSUA 4KTTE 3RKRA 4IJWA 3BXOA 1I8TA 2P1RA 4GXQA 4Y2TA 1VGQA 4YJ2B 5F9MA 3HB0A 1XQ1A 3D5QA 4ZGWA 1W75A 2B34A 3VSAA 3HJNA 2C31A 1E6CA 2AG5A 2YY5A 1W30A 2O6LA 4NCXA 3AEQA 2NG1A 3GFRA 1PQPA 3FJ1A 3D6NB 3AILA 5DI9A 5IW8A 2VSFA 4LJ8A 1OFTA 4TMKA 1FNDA 2BE9A 4MQ5A 3TW4A 3U4AA 4H7KA 1R64A 2I7VA 1P0PA 4LYYA 3RIMA 2VN8A 4GD3Q 2FW6A 1N3LA 4L4UA 3PEUA 4IJVA 1D6NA 1CIPA 4MYTA 4RO0A 1T5TA 4S1VA 2FB9A 3TZHA 2EJCA 2GN2A 3B2QA 1KAEA 4K9NA 2IV3A 4DC1A 3GAMA 2X1HA 1FTQA 4Q3KA 5FNVA 5FWXA 2FR8A 3GG2A 3NBMA 5G1OA 2AZ4A 1FBNA 4UMDA 5TB5A 3AP2A 4PBSA 1ESDA 4CEJB 2AUNA 4CU2A 4ABTA 2X0NA 2ZRAA 3KPYA 4INJA 1SCJA 4B43A 3CW8X 4WCFC 2EHDA 2IT1A 3D0RA 3QVUA 1JI3A 4PC6A 3NTXA 5G1PA 3TL3A 3V6LA 4CBVA 4R2LA 3UOGA 5BSKA 1QVZA 1M2KA 4XUGB 1U3WA 3D7SA 3AYXB 3ROMA 2BFFA 4IRXA 4MQLA 1IVYA 1CCWA 2N3ZA 4PEVA 5LDGA 4PGHA 1ABBA 2BFBB 2Z5FA 3P4UA 2AC2A 1AZTA 3I2FA 1WY5A 3SBEA 2IPOA 3V32A 4EMTA 1GT6A 2P90A 3P7MA 4GOOD 1SO8A 5LMCA 5ALIA 2GN8A 2G9VA 1QYCA 2QAIA 4BRUA 1GXSB 1PL0A 2NSDA 3IAAA 3GEMA 3ILXA 4Z53A 1P17A 4I1SA 4YCCA 3D1VA 4OFXA 1EESA 3NJ4A 3D1LA 3H6HA 5AVOA 2W2OA 1YNSA 4FPXA 3OZIA 3LT0A 3ZU3A 2YWEA 1F2TB 4HBZA 1E9EA 2NZYA 3NBUA 4R9VA 3QHQA 3HJAA 4JNCA 4BASA 3IUSA 2VDJA 3G2KA 1W76A 1I24A 1YI0A 3MS2A 4GPAA 2W2TA 1H0SA 1HLDA 2QMHA 2FW7A 3A6GA 4L07A 4GEGA 4ZYUA 3AR3A 1QTNA 1DE0A 3E2IA 3JZFA 3PR2B 4F45A 4AWBA 2DT8A 4TVSA 4B3TB 1B7GO 4X93A 4ENQA 4IZIA 3QQ5A 5FL7A 1GEGA 3FN4A 2HSGA 4JOCA 4FB5A 5G2OA 4EHIA 5U4QA 1QLWA 4YEDA 3ZW9A 4W5TA 4OMCA 2DUNA 1IM2A 1WPXA 3C3AA 4QATA 4I50B 1JHQA 1Y9AA 5GP1A 3V9AA 4DA7A 4K6KA 4U3JA 5KYWB 2WWIA 4FX5A 1I3NA 1M1UA 2JFXA 2JH3A 3K2EA 1GSHA 1NPDA 1G16A 1JDTA 4Q3CA 4MW2A 4E5UA 3EW7A 4UQPA 4UEKA 1K3UB 1YL7A 2GNOA 2PZJA 2EDAA 3E82A 4GLJA 4KFUA 2YWDA 1JWAB 4LHWA 1K5GA 3ZV3A 1RPAA 4QXMA 4GLLA 1IBKB 3EVEA 3ERCA 3GZJA 1O94A 3I37X 3LXRA 4NQZA 4D9KA 1ONSA 2JGKA 4RABA 4V0QA 5ED4A 4HDKA 5ALWA 1J42A 1CXZA 1ENOA 1E64A 1IUKA 1VHQA 3PE3A 2Q45A 2SCUB 1EP1B 2J7PA 2XQJA 3AQIA 1JLLB 2VHWA 3FLBA 4QASA 4O1MA 4HY3A 3JYOA 3KVRA 2LIVA 4HS9A 4LJYA 2VI5A 3WGLA 5K1ZA 2HH9A 3JR7A 1ZUD1 1UWVA 1WQ4A 2P65A 4HGNA 1RPTA 1X1BA 3W9SA 5JNTA 3K4PA 3QBDA 3U3KA 4F60A 5LU8A 2HUNA 1YRAA 4X97A 3I42A 4YV1A 2V0GA 1ODIA 2W6NA 2WKWA 4LNUA 1RD4A 4RV4A 2PRIA 2WABA 1EB9A 4G85A 4KN8A 1R4MA 5IBRA 5BSVA 1XZLA 2XYGA 2X5JO 1JB1A 2Q0HA 4HUJA 1YJCA 2MWMA 4OB7A 3ENZA 5G0TA 3WYBA 3OTIA 3KVOA 4YLEA 5DYTA 1Z2PX 2QY9A 3BDVA 4U0KA 5ENZA 5LXTA 4KQ6A 1XDZA 1CK4A 3GPCA 3WTBA 3DJYA 3WLMA 5EZ5A 2AB0A 2JA2A 4HQ6A 3WDLA 4K6GA 5C8YA 5L95A 1H5UA 1M1XB 2B1JA 3P0RA 2AN5A 4M9QA 4UTXA 3RW9A 8ABPA 2QI9C 3O8QA 4PYRA 4CHGA 1P7PA 4M83A 1XVAA 1IZ7A 4CNQA 4L72A 5EKDA 5JAPA 1JIXA 5CFMA 2GSWA 4WERA 3A2NA 4DUYB 1Q0HA 1V1RB 4HXFB 4MQUA 1F51E 4AMZA 1DTWA 1OH8A 2X40A 16PKA 4P86A 3RWBA 1FFYA 4FIZA 3VV2A 3ROFA 4KQHA 4MCJA 3GOQA 3RVSA 4F3YA 1HDGO 1OA1A 2I3GA 2QD1A 3BWEA 5H3HA 3HGTA 2FW8A 4LJ5A 4O4IF 4YCJA 5TPWA 2RMKA 4CIXA 4OAPA 3RABA 3SZOA 3WGGA 2DHRA 5L7WA 2FDCA 3NHRA 3IUJA 1J2EA 4QQNA 3DDNA 2IYQA 3OPNA 4NMLA 3IUNA 3RC2A 4C0SA 1W25A 1MGPA 2Y77A 5CB4A 3FFBA 3SE7A 4NZOA 3CLVA 4JUDX 2LDXA 2OBMA 1E2QA 2AGVA 4ZO8A 5AK6A 3UWOA 1F9EA 4GQIA 5FOXA 1M0EA 2HWXA 4ZQGA 3TOXA 1TUEA 3AETA 2QDXA 3SYMA 4CT0A 2IYFA 3F2IA 4ZJZA 1DXQA 4KIWA 3BF8A 4EPXA 2EZTA 3G0OA 2ZOSA 3N6RA 4RNCA 3F9RA 4GKVA 1DXOA 1G19A 3SQLA 2H18A 2WYOA 4BVFA 3A7DA 3DCJA 1SAYA 1YAHA 3W6PA 4GMFA 1LSOA 1E66A 3VTKA 4BB6A 5K0GA 4DIUA 1WETA 4PZAA 3MRTA 3SG0A 4B73A 3GRAA 4MVJF 3EX7C 3R9KA 2GJ9A 1UKBA 2WNHA 5AD1A 5CYGA 5T4HA 1FS6A 2BFMA 3HCEA 5GMOA 2CL5A 3LUJA 4BMVA 5FL7D 2A1TS 2PWYA 4R6XA 1E2UA 1KOFA 4AD8A 5EIFA 2Q8NA 1R4NB 3ORYA 2JVIA 2WUWE 4BZQA 1T4DA 5IYZB 1NMXA 2YOGA 4WAUA 1G5PA 1P74A 2RG7A 5BRAA 4DR1B 3R5XA 3F3SA 5NULA 5F7OA 3NKVA 2IDKA 4KLAA 4QFBA 4DGSA 1T4CB 3D3KA 4NHOA 3O8BA 2FWJA 4LZOA 4L27A 4JT8A 3O75A 5JHGB 1SQFA 1UXIA 3U7RA 1G5HA 1W581 4WESA 3OT1A 2QI9F 3MUEA 4ME6A 3IIIA 1I80A 3LVRE 1UPXA 1U2QA 2CEKA 1Z2CA 1O94D 2OG1A 1U04A 4JEHA 1QC5A 1HE8B 1YB7A 2DWCA 4O2BA 4R0VA 4NMHA 2ECOA 2ACVA 2J7PD 2PYZA 1B14A 5IJAA 1ACJA 5KU7A 1ZGZA 3MRXA 1G9SA 4K9OA 3W5UA 2BM1A 4H77A 4DWOA 4KO4S 2FRXA 3LPNA 4CL0A 2P9ZA 2OLKA 4KHPB 3V2GA 2W6IA 3F0TA 4FGSA 1GN9A 1DX4A 1X80A 4OFWA 1M66A 4ZDKA 2E21A 2D1YA 1MPTA 2CC2A 2A9QA 3QNUA 2CWWA 2V6BA 3IJEB 3FNEA 2PGJA 3OEYA 4JLVA 5HKBA 3HXOA 2IDJA 1S8AA 4PPFA 3B8EA 4DAEA 2Y0PA 2QBYA 1BYUA 1N0WA 5FHRA 1SC9A 4QECA 2OD2A 3QVVA 1JYFA 7YASA 4IJMA 4OKIA 3NTLA 3O92A 3EEIA 3GLFA 3H5LA 1MAWA 1NRJB 4L08A 4H27A 1PZGA 1UP7A 1E1CA 2KW5A 3EWAA 1CD5A 3PPWA 4G2NA 4JBWA 5ERYA 1BU5A 2I4NA 1JHDA 4ABYA 5ADUS 4C29A 2Z4RA 3W9YA 2WJZB 3D0KA 5CP8A 1PWHA 1SA0A 1DKNA 1YSCA 4UFOA 5HZGA 4KG7A 3ZZNA 2HJ9A 1KKLA 2L69A 2Z6VA 5CDHA 5JDCC 4URZR 1JLHA 5EPEA 3O26A 4YJFA 2Q1YA 1GUFA 1RQXA 1ULZA 3FD8A 4O2LA 2R7AA 3SJZA 1FPQA 3PQ7A 4GMKA 4N3AA 2IVFA 1QGDA 2SKEA 3KS9A 3HYTA 2WP0A 3BB1A 3T3OA 3AF0A 3ICQB 5BUCA 4QQFA 4ZO7A 3NNDA 1LEHA 3F6EX 1RCFA 3GBVA 3WWDA 2J41A 2BFEA 1UC4B 2WUEA 4KQ1A 1K3FA 5HMMA 4ALNA 3CRRA 2O0HA 3IKTA 4UHHA 4NQRA 1EH5A 3PWSA 2P7IA 5EJIA 4BEBA 4ES6A 5HR5A 1MQ9A 1V95A 3FBWA 2GLUA 4AS1A 1Y3BE 3TO5A 2I7CA 1GG8A 3PPVA 3QXJA 1ZD1A 4ZD6A 3SS9X 2KLHA 4PHHA 5DGIA 2VDWB 4TMTA 5DHSA 1GUZA 2W42A 1KU6A 2K7ZA 1OUMA 2OKCA 4L9SA 1VJ1A 4PYKA 4M38A 1TRKA 2A0KA 2CNBA 4JUBA 2WSLA 4P7JA 3T7KA 3KQHA 5HIIA 3GJQA 1FLDA 1I7LA 1JHMA 2PAAA 2IPLA 3QIAA 3MMPA 3GU3A 1DEKA 4ERXA 1KVUA 1GAJA 3ST7A 1UBMS 1N5JA 4TV9A 1XNQB 2I67A 1IY1A 3P26A 3DBHB 3ZUPA 4FW8A 3IO3A 1YT5A 1ZU5A 2H1WA 3A1SA 4R01A 2WE8A 1TJPB 5CEJA 4HAUA 1RWKA 7REQA 3OQIB 2ZFUA 4UTOA 2P6UA 2G71A 2HU8A 3B3QA 4HZUA 2HU5A 3ANSA 4R1UA 5LMUB 1KQPA 1MUUA 2VSOA 3HFGA 4GGPA 4Q4HA 2CHFA 3K31A 3RBVA 4PFJA 3IAHA 2RG1A 4N0DA 2Z09A 4FFSA 3L40A 5DEOA 5BSFA 3EXFA 2C1XA 3TTVA 3JU3A 4U7PB 4ARCA 2G9QA 2VA8A 3MG9A 3MZ0A 5FUVA 2AYYA 3RJMA 3GCZA 5PGMA 3C7DB 1H94A 4R1QA 3J81A 4B5KA 1NBAA 1XJQA 2BFCB 1HT3A 1GZ5A 2J5KA 4O29A 2QMEA 5T57A 2JDIA 4OI0A 5JV5A 1RYMA 4JUIA 1DHRA 2OO3A 4PNPA 1G60A 1ZXLA 4MR8A 4YAFA 3TAHA 1ZH2A 1JE1A 1EUCA 3PDHA 4FEEA 4M86A 2ACWA 3DL0A 3KDPA 3THRA 4JXXA 2LKDA 1DKLA 2IOFK 2AMJA 4F3KA 5DMXA 1FP4A 1OD6A 2A9FA 4MYSA 2WYUA 4TZKA 3ZHBA 4FR2A 4CMJA 1M6EX 5BVHB 5FLXA 2OBYA 1QKIA 2IEIA 1CBUA 2AH5A 3P52A 1UFQA 1VCOA 3HWX1 4MDFA 2I1WA 5GVSA 3DYBA 4PBTA 4ZAGA 2BI8A 4HZIA 2H6EA 1PFUA 2QY6A 4GQBA 1E8MA 1K0UA 1AXGA 5CGZA 2XXAB 1Y3DE 2EJVA 3UAYA 1F0KA 3PGLA 5F52A 1NBWB 3W5JA 2EU8A 4EPVA 2HRQA 4PC1A 4JSRA 3VNRA 1CB7A 3K0HA 4IDAA 4L5IA 4REQB 2IUUA 4A5SA 4DR5B 3K70D 2FE1A 1NC3A 2EKLA 3PGKA 4DYHA 3BQMB 1U7WA 1KYVA 2YICA 4JQYA 5JD4A 2UU9B 4Q9HA 1W4BA 1NONA 4L0CA 3S40A 1Z15A 3RS9A 2VWGA 1XZMA 3PKJA 2WAYA 3DBRA 1L5HB 3WL4A 4DCOA 4D9MA 2AI2A 1Y5RA 4OHCA 4BX0A 3PUYA 3ZNNA 4YMLA 5D86A 3Q88A 4I55F 1CUZA 1L8QA 2GX6A 4PRLA 5GGYA 4J4HA 3TTSA 4E15A 1EVQA 1R8XA 2FRDC 1Y4DE 3I12A 1V3TA 2ZRFA 5T6BA 3ZE0B 3NHMA 2JCBA 3FGZA 2CSUA 3PR3A 3LECA 3F3KA 4NH0A 4RY2A 4J8PA 4D9IA 5JQWA 3GLHA 3DEZA 2J48A 4YP6A 4ILEA 4TXLA 3LXUX 4CFYA 3AEUB 1E6UA 1KP9A 3OE1A 1BE6A 4P34A 1W34A 3B85A 2LP4Y 3PYLA 2IFTA 1Z36A 2BH9A 3NYQA 1TI7A 1TQ4A 4MW4A 3O4GA 4N03A 4NMWA 4YJHA 1VGRA 3UZUA 4AY6A 5DVZA 4X00A 3HKBA 4KFRA 2CKMA 5HX7A 3F1LA 4RHXA 3UN1A 4EJ0A 3KYCB 3VR2D 2VFAA 1FVFA 2QN1A 3ROGA 3SIRA 5JH7B 2ODPA 1KWKA 4EG6A 1BRMA 3DFKA 4RULA 4ZV4A 5AESA 1CUCA 3I9FA 1XSEA 2PUGA 2Z2JA 4FS8A 3K6RA 4V0SA 4TV8A 1GPWB 4Y9SA 2O8DA 2WWHA 2PZ8A 4JY7A 2QUHA 1XP5A 1NXVA 1UMBA 3DVAA 3BB3A 3NBKA 1VKNA 3GUUA 3CUWA 1JEQA 1Q12A 2HYIC 4E94A 4AX4A 4QPZA 2VXYA 4PANA 1D1SA 2GXQA 3JS5A 2QGFA 1S89A 3PUXA 5DOVA 2LDBA 5AICA 1X7DA 2ZRPA 3RG8A 4UNQA 1RYFA 1I0ZA 1TK2A 1ID1A 2XUOA 2PU5A 2EL9A 3AH8A 4XJSA 3ABZA 4Y6QA 2BHRA 4G84A 4MQBA 1NGSA 3GRYA 3WFZA 1EVJA 4X41A 5LD2C 2Q50A 3ZCVA 1AGPA 1LBHA 2BFAA 1IC6A 2UVDA 3GFQA 4MKGA 4NESA 4R2KA 3UIEA 1RXVA 1U1EA 1UXOA 4CEHA 2XVYA 4RKRA 4MR9B 4KH0A 3O93A 1UJBA 4C6TA 4H2DA 3CNLA 1COZA 4RL4A 1GNLA 3JZAA 1NC1A 4GXRA 4AYWA 1K8XB 2Y93A 5KYYB 5AOVA 2GN6A 4KEAA 1GN8A 1I2BA 3AJ8A 3TSCA 3V2IA 2PH5A 1PJ4A 1U3GA 3M2PA 1O1YA 3MSXA 1S1CA 3QLUC 4WCDA 5FORA 4B2YA 4EVSA 4YPFA 1U8XX 4NENB 3IMFA 5TMDA 3F78A 2JDID 4NPAA 2JFYA 3OQHA 2CMKA 1WVGA 2RGDA 2XGOA 3NGXA 4FFMA 5JZ9A 1NYQA 2NGRA 3EIHA 2OHIA 1HDOA 3CCFA 4PYQA 2J5BA 2UZ3A 2FUNB 3K1ZA 4FYYA 4OK3A 4DLPA 4KAXA 2OQIA 5FTNA 2KMLA 1WXGA 2PZBA 2UZIR 5D5QA 5GZ6A 2J3HA 3NEJA 1RLJA 3SQOA 3FOEC 2XWSA 2QUZA 1P4AA 3QFSA 1M75A 4JQCA 2DG2A 4YV2A 5M3BA 5JZBA 1QMPA 1IK4A 4YRZA 2QTCA 4L50A 1TZCA 5KDDA 1SBCA 1DIGA 1JNYA 3HP7A 3O7WA 4H3HB 2J6CA 3K9BA 3KEQA 3U5ZB 4MWEA 2W6JA 4H4DA 4RVHA 1P18A 3I39X 2P68A 2YV4A 4BO9A 5LJIA 3L7KA 1O0BA 3LX4A 5CNMA 3TLJA 3TOSA 4AYTA 4EBFA 5EQJB 1UAYA 1VYVA 2XMZA 5CFQA 1P0IA 3QKRA 4WTOA 1GTRA 3PXDA 4NYJQ 5EYPB 5FBWB 3TLXA 1HE5A 3WJ1A 3NORA 1Y1RA 1TJ5A 1W0JA 2VK8A 4RFVA 2AW3A 2EBHX 2OG2A 1ZESA 2WJAA 2FZWA 2J0QA 4D44A 3EAGA 3ENWA 2RK4A 3CKKA 4KQIA 4LOHA 3HY3A 3OZSA 1M0SA 2X8BA 4WVLA 2ZPUA 4DLVA 1WW3A 5TQ2A 2JB9A 3DVSX 5GGXA 2X5KO 4JXZA 1T0UA 4LI0A 4LHYA 3ZXXA 2ZUVA 1PWYE 2ZUSA 2ZTUA 1SG6A 1SVMA 2FW1A 2WWFA 5B1DA 2ZPAA 3GCXA 1G6KA 2JJYA 2A88A 4TT3A 1Q84A 2B5VA 2JIRA 1UJMA 1JIQA 3D4OA 3IIMA 3BS4A 3JAMA 2CLKB 2XVZA 3BD8A 5EWJA 3UWPA 3O1LA 5ALSA 3LPLA 3C43A 4ZTZB 4PGGA 1YVUA 4DMCA 1IEQA 4WKOA 1MW8X 1A9RA 1DAGA 2HLPA 3DFUA 4EPTA 1WG8A 1C3OA 1KGDA 4X0EA 4QQRA 2I2BA 1G5FA 2HK8A 1Y8QB 1GTVA 3RJTA 4EYSA 1KY5A 3N7UA 3RRFA 3WRYC 5TRTA 4JB3A 4BNZA 4HTFB 4TYWA 5LYJA 3DXXA 3FOWA 3R09A 1RU3A 3QH4A 4WXEA 1R0BA 1GFIA 1M6YA 3C3YA 3A7EA 1GP2A 3F7MA 3WG9A 1K08A 3V80A 4CTKA 1QFXA 4O6VA 4PZDA 2P91A 4G0NA 2JHCA 3DKKA 4XAQA 2VLBA 1ZJ6A 2GBGA 3SM3A 3RVRA 2X5XA 3JQRA 1X8JA 1P9OA 1Q0RA 4RE5A 4GLFA 4UBJA 1TYAE 3C24A 4ZI7B 1JBEA 5CH5A 4TKMA 1JYSA 2VQ3A 3FNQA 5AM3A 1DINA 1LDGA 1W2WB 2CHGA 2Q5JA 2WG2A 3H8VA 1S8NA 3ND5A 4GR9A 1SUFA 2C2BA 4B48A 3UGJA 3P2IA 1PI3A 3DEYX 4Z4FA 1JV2B 5IX8A 4RKWA 1SOVA 2Z2XA 4A4DA 3K30A 1FYWA 1AT1A 4UE6A 4ZZ1A 5KQPA 1E7WA 1TQ2A 1YBAA 4J2TA 4Q21A 2HADA 1AH2A 5GINE 2IYAA 4CLRB 4MV0A 5CVVA 1V3VA 5BOVA 1KZ1A 3PXUA 3Q40A 1XRNA 2VTKA 1Q7TA 2ZG6A 3AWDA 4W7HA 3SIXA 5KOYA 1EEHA 1ZK3A 3EGDB 3LP6A 4QGHA 4RHEA 1G8KA 4F9GA 1CVLA 1IBLB 2BGKA 2E6KA 5IDQA 3Q5GA 3AIIA 5LQNA 1UMKA 2X41A 4B1FA 1VRCA 4YJ3B 5M7EA 5ILGA 3UW3A 5L9AA 2YY6A 4ARSA 5FO1A 4AJIA 1J20A 2P8SA 2WF8A 4D80A 1F4PA 2LTAA 2WU4A 2CT8A 3KIPA 5JZVA 4GBMA 3N6VA 4E5DA 3U7IA 4ZHQA 1ZDMA 4IIFA 4PX2A 3EEQA 1Y9DA 2B99A 3S55A 1R8QA 5AVWA 1WXHA 2Z2ZA 1NN3A 4LF4B 3TZBA 4KMSA 2HK6A 4B3JA 1UQUA 2QTHA 1KFEB 3OLCX 4S0ZA 3CLKA 1CS0B 4YI3A 4PLGA 5D85A 4I6EA 4YY3B 1TADA 3ZCTA 1SBHA 4UKDA 4BUZA 2PL5A 1L5WA 1DDOA 4JENA 5FLYA 4QM6A 3KYDB 1FU7A 1FQKA 1U9ZA 1OXXK 4JJGA 1W0JD 2OILA 1CKEA 1W4AA 1Q2XA 5JNRA 5JS8A 1UMDB 2PUHA 1CQXA 3IDSA 4UDNA 3C39A 1GU1A 1K88A 2JIZA 4GRDA 1JHAA 1KI9A 1YZUA 3CKLA 4HAIA 3RUFA 3PC3A 2WB2A 4PGAA 3TYXA 3UT0A 4N76A 4C0JA 4I4TB 3GUHA 1EK0A 3D8BA 3M3DA 1BVUA 1L4YA 1N9GA 1JU3A 4KL8S 1MNQA 5P21A 3C6BA 4CMIB 4Z4HA 5BUQA 3IOEA 3K2QA 3QELB 4FJ0A 3WYDA 1JKJA 1I13A 1O8CA 2HWYA 1G8JA 4TT3D 2XGJA 2AVDA 4LOIA 2OQRA 2CDNA 4C0XA 5B37A 4AMBA 5KYNA 5KVAA 4LDPA 2EZUA 5FI3A 4FN4A 1EHIA 2BUCA 4MUHA 4MV3A 5C8DA 4ONEA 4C4SA 4HGYA 3EZNA 1JPUA 4US1R 1ZO8A 2P62A 1H2WA 2W2NA 3IPRA 4MPRA 4B6OA 3AKDA 1BNCA 4A0FA 1Z63A 2ZSIA 5KJ6A 1YS2X 3OCVA 1CLUA 4HYQA 5MHTA 3TLEA 4X20A 1YDGA 3H11A 4OJYA 2AEEA 4RTRA 1D0IA 3R7DA 3UAWA 3ICEA 2O48X 4AUKA 1SHUX 3T5GA 3GUYA 2YH2A 4CMGA 1MJGA 3O9VA 3JQAA 4DPKA 2ODBA 3DZHA 4ISBA 4AMGA 4EEXA 5LJLA 2AYXA 4BB5A 5CAEB 4XE5A 1WQ1R 2C92A 1FF9A 3EWNA 3FDFA 3I45A 3O0DA 1W0CA 4KPUB 4UBLA 5F4BA 3NIDB 3M4ZA 3OEWA 4F85A 1VRVA 3UHFA 2PUFA 2PQ0A 4UJ3A 1ZEJA 2PU7A 2Q2NA 4U1RA 5GWXA 5CDTA 3FTEA 2X14A 5DGTA 3PD1A 4OHOA 3I62A 2H1HA 2Y27A 1LWOA 1XTBA 5JVDF 4AY3A 4DMKA 2OAQ1 4LNHA 1CUGA 1Q50A 4KGZA 3BB4A 4ZOLA 4NABA 4QRDA 3ID6C 1ZKMA 2JIDA 2GR9A 2A2ZA 1NNI1 2OVFA 3GDGA 4KVZA 4Y6SA 3KVYA 3UM9A 3T7DA 3RV3A 4NZZA 4M9CA 1G3QA 2PQ2A 3K09C 4PG8A 4H08A 1IN7A 1T36A 1U5BB 5BN5A 2XNJA 4FIDA 1JXMA 2NV6A 3JWJA 3ZW8A 3RVPA 3DW1X 3VYUB 2P0AA 3D59A 3K1AA 4UBIA 3W0LB 1L7PA 1RWMA 3FROA 4KGVA 1TGYA 1KO5A 3RTCA 3JVUA 4MPDA 3TD6A 4DT1B 2NSHA 2P3LA 2CXOA 1FC0A 2O57A 4I9FA 4A8JA 1XK7A 5TQ0A 4PN3A 3JASB 2GK3A 1XTIA 4EK9A 3L84A 4UCQA 3SF8A 1V11B 4MOWA 4DG5A 4GR5A 3RF7A 1L7XA 3I0MA 4PSAA 4QU8A 4FUQA 2X2EA 4I0WB 4PRYA 3NDPA 3OZWA 1VYUA 3P9NA 4F2GA 3EPLA 1IK6A 1SM4A 4J9VA 2GPNA 3RGWS 2EFEB 3ZLTA 4EY3A 4C0HA 4L78A 1YZKA 3ZY4A 4ALMA 3WWZA 4BMNA 1MW9X 2PSSA 4OFBA 4CM3A 4Z8YA 3ZC3A 3AONB 1BKDR 2XITA 2ZUCA 2B6NA 3DNPA 5MN6A 1H93A 4YRRA 1UOQA 4ODIA 1FXWF 1A95A 2OVBA 3D8HA 3FGPA 2CXQA 3VNBA 1NBEA 2FG5A 2QRQA 4I1IA 1SGWA 1YULA 4LYEA 4Z3DA 1F7VA 1VLQA 1X2BA 2ZBFA 4IP0A 2J0EA 1QHHB 1MVNA 3T7CA 5HJ2A 4BNKA 3GVCA 1MDBA 4PZPA 5K5EA 2AJ8A 4BJHB 3M83A 2E85A 5TEWA 4M0MA 3QUAA 3NAMA 1WD7A 2BYTA 2COUA 3GJRA 4FX2A 1UWKA 3CWQA 1AV6A 4ETMA 2VJLA 1PJ3A 4IPTA 3QXHA 4QBIA 5BO5A 3BXFA 5LU9A 2GF9A 2ID4A 2INGX 2JIZD 3D8TA 4RJIA 3W2HA 3H9EO 3VHRA 1F3OA 5BT9A 1Q0UA 2B5WA 1U0SY 4ZA2A 4KDRA 3RAGA 3IXMA 3K5IA 4FYWA 5J40A 2VP9A 1XD8A 2CZQA 2OM2A 1VL1A 1WZEA 2HHLA 1RHJA 3KZMA 4Q7JB 2V6MA 2VDQB 4YDQA 2PPVA 4AURA 2AXEA 2CHUA 3C6ZA 1LPMA 3DZFA 4IVNA 3OZRA 4XM2A 1JSXA 1EPUA 4LGYA 4CM9A 5HIAA 2E2WA 1P45A 4PHTA 2FX2A 2ZRGA 4Q3BA 3SJUA 4HDSA 1X8LA 3F97A 1LZKA 1G8FA 4C2TA 3CC8A 1TYZA 4PAOA 1NW7A 2QN2A 3FOZA 1NT2A 1QFYA 3F96A 3OWOA 1N8SA 4PYIA 1U1FA 4PLZA 4Z9XA 5A3VA 4BDTA 1HDZA 1VL0A 4B7CA 4AYXA 3AGQA 1KS2A 2VYVA 3E58A 4GOJA 4B45A 5BPFA 2CMGA 4LWQA 4QT4A 4ND5A 1DJNA 1S9HA 1NOJA 1Q6ZA 1W36D 2CK3A 4X60A 4N5DA 2H2FA 1KJIA 2I4MA 3ESYA 2OLEA 2A5LA 2WIAA 3LKBA 3PNSA 3A6PC 2DPXA 3TI9A 3TZQA 4EVRA 2W6ZA 5BR1A 1X7WB 1GPBA 2P4EA 4JLPA 2CFCA 1KIAA 1DX9A 4H7JA 4R2IA 5L4SA 5DBFA 4FXPA 2PO7A 4K9QA 1T2NA 2DLDA 3HU5A 4NJEB 3RU9A 2ZVDA 1U81A 1R6DA 3WO1A 4RY8A 1UXGA 6NULA 3M1LA 3ETJA