5SYMA

Cocrystal structure of the human acyl protein thioesterase 1 with an isoform-selective inhibitor, ml348
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
223
structure length
223
Chain Sequence
TPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism for Isoform-Selective Inhibition of Acyl Protein Thioesterases 1 and 2 (APT1 and APT2).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Acyl-protein thioesterase 1
total genus 76
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.1.2.-:
pdb deposition date 2016-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5symA00
3I2FA 3TGLA 3STTA 5K3FB 3WZMA 4N5HX 2JGEA 1HKHA 1CPYA 1MTZA 3DEAA 4IQ4A 3C8DA 2B61A 3PFBA 2OQVA 1IZ7A 2WHPB 1DQZA 2WSLA 4RNCA 1CQWA 2I3ZA 2PM8A 1TCAA 1S8OA 1DWQA 4OB7A 5EI5A 4BAUA 1CUUA 4WY8A 2WIDA 4HTAA 4EY6A 3FYUB 3BWXA 4KJXA 2FX5A 2O2IA 1XLWA 3W9BA 3V1NA 1UK6A 5IH7A 4QA9A 1JMYA 4GDMA 1FSSA 1WPRA 3DOHA 2AJCA 3WK7A 1VXRA 4AO8A 5EHNA 4BCDA 1EB8A 2ROQA 1C7JA 3G0GA 3R3UA 4GI1A 1FFDA 3DQZA 1J07A 5AK4A 1XZDA 2WIFA 4UBLA 3O4JA 4PSCA 2CZQA 2XUDA 5JASA 4AQDA 1IMJA 4KE7A 5LYYA 1H23A 4DMFA 4UHEA 3G9ZA 3OTQA 3NOXA 5AOCA 3BJRA 2WIGA 4W1SA 2C0QA 2DR0A 2ACEA 1R1DA 4EY5A 1DU4A 2CBGA 4LHEA 1EK2A 4H7FA 5A7HA 4U2BA 4P9NA 5K3FA 1CUGA 1GXSA 1MAHA 1GGVA 1ZOIA 1KU0A 2WG0A 4OYYA 4B6GA 1QLWA 4J0GA 4PF1A 1A88A 4G4IA 3S8YA 4BAZA 2DSNA 1J1IA 2ZSHA 5AO9A 4FLEA 4CG3A 3WWCA 1XZAA 1XZKA 1YAJA 4E15A 1YSCA 3QPDA 2RGUA 5A7GA 1EK1A 4IH1A 1TIBA 4Y2TA 4KE6A 4Y2PA 3L1HA 1TRHA 1XZGA 1SCKA 5HK8A 3WI7A 1BEZA 3D2AA 2LIPA 2HU5A 2Z3ZA 3O9VA 1F0NA 2BCEA 2XQJA 3H2GA 4BB0A 2OCGA 1XKLA 5D3KA 4KE8A 5FDFA 1VA4A 1XRNA 2HL6A 3KWJA 1ZJ4A 3WK4A 4C88A 2WLSA 4U2DA 4TGLA 5C7YA 4B81A 2HADA 5CXUA 1CUYA 5D6OA 1DWOA 5DNUA 4N8DA 3F98A 4AO6A 2HU7A 1YS1X 2PSFA 2PVSA 4HXEB 2H9YA 1DQYA 3DKKA 3I2JA 3JYHA 5HZGA 5AI0A 1BCSA 3G7NA 3R41A 1GQRA 2AXEA 3IUMA 4Q3OA 3GBSA 5CMLA 4BATA 4ZWNA 5AKLA 2OQIA 2WM2A 4WDQA 5AI8A 5AKXA 1KEZA 2PPLA 1VZ2A 4DTCA 1AUOA 5A7FA 3CCCA 2D5LA 5T4FA 3FLEA 4UFPA 4C6HA 3HSSA 4AB1A 5ALFA 2VJBA 1EB9A 5ALNA 4CIBA 5LZ4A 5E2IA 5HQ3B 5CH8A 4U2EA 3ESBA 3N2ZB 3I6YA 4OUKX 3FLBA 2VJCA 2XUGA 4B9EA 1EX9A 4F5ZA 3WIOA 3BF7A 3B5EA 2AJDA 1RP1A 5CH3A 4NMWA 3I2IA 2VTVA 1G42A 4LXGA 5IKXA 3EIOA 5ALMA 5C8VA 1EVQA 1QTIA 5AIBA 4G8CA 4UBKA 5ALDA 5AK6A 2HHAA 3ZLVA 3GA7A 3DS8A 1Y37A 3DLTA 4FTWA 3E0XA 2C5GA 1JMKC 5EIAA 2C7BA 3FNBA 4EB0A 4F0JA 3DYVA 2JEZA 4FBMA 4KE9A 2BAGA 5CURA 2J3QA 3G9XA 5YASA 3H17A 4GXNA 2BJHA 1ZD3A 3NUZA 2GYUA 2I78A 3DOIA 1E5TA 4L72A 4CFSA 2XLCA 4WY5A 1THTA 2FJ0A 1G4HA 5JANA 5CTAA 2X8BA 2ZVDA 4Y2RA 1BE0A 2AJ8A 2VA9A 3PE6A 1LPBB 1EDDA 4X85A 2G63A 3FCYA 2XT0A 4DM7A 5DNWA 4BZWA 3WYDA 3G02A 4YK7A 1MX9A 4HS9A 3WL8A 5IVHA 4OYLA 1U8EA 5HF8A 3G8YA 4EY8A 1GPNA 2W6CX 2R8BA 2QMQA 3PI6A 5ALVA 5JAOA 5CT4A 3BIWA 3D7RA 1MO2A 3C6BA 2WUEA 1LNSA 5EGNA 2RIPA 1AX9A 3IUQA 1UKCA 4CG1A 4GWLA 2GZSA 2ZYHA 1GZ7A 3AINA 2XMBA 1UOOA 3DL7A 3G9TA 3I6ZA 2H1IA 2XI4A 1AGYA 2VT6A 4E46A 3BF8A 5AK5A 3W04A 2WG2A 2X5XA 3HXKA 4MEBA 2JGMA 1U4NA 3SX4A 5ALOA 4Y2QA 2O7RA 1CUBA 1JT2A 1UXOA 4BYMA 5EHQA 5AIAA 4X71A 2AJLI 4QLAA 2QZPA 1IUPA 5EHXA 2Z5GA 1GPKA 2JGLA 2H7XA 1HDEA 4WFIA 2DHEA 4LKOA 3TJMA 3VXKA 3PUIA 1EDEA 2ES4A 5DYWA 2XMQA 2O2HA 4Y2XA 4FKBA 2CB9A 4AXBA 2O7VA 4WCVA 4PO3X 1O6FA 1XZFA 1UZAA 1QONA 3UUEA 4N8SA 4Y2UA 4OD0A 3EQ9A 4MWTA 5LKAA 2RAUA 4FLMA 3ESDA 3C6YA 2ORYA 3VVMA 3WL6A 4H18A 3ZV7A 4FNMA 3I2HA 4UBIA 5FP0A 4LXIA 4IO0A 1UFOA 2QUAA 3R3WA 1BROA 1U65A 3G0DA 5CT9A 4U2FA 4B82A 2J3DA 2PL5A 3HJUA 3H04A 4LYEA 3ANSA 3FVTA 2HA6A 4P92A 1YA8A 4GW3A 4LIPD 1BEEA 4N5IX 4G8DA 3VVLA 4KAFA 4FMPA 1E8NA 5I8PA 3O4HA 4DNPA 4AZ3A 3AILA 4G4GA 1XZBA 2XUFA 2NW6A 5ALWA 2YYSA 4FFWA 5LZ9A 3WK5A 3VDXA 2PSJA 2XUAA 4INZA 5AI5A 5HFAA 1CUJA 3R3VA 5ALZA 1USWA 1R9NA 3HABA 5T4BA 3EQ8A 2XB6A 4X00A 4M0FA 4BP9A 1B6GA 3AUKA 3R0VA 4DYHA 4KYVA 1K5PA 3C8HA 3DL4A 2ZJFA 1P0IA 3BJMA 3D5EA 4AZ0A 3D3NA 2Y6VA 3A2LA 1L7RA 3BL8A 4EA6A 1Q83A 5JIBA 5AKGA 3Q0TA 1WB5A 3E4DA 5ALLA 3MUOA 2ZYSA 1VZ3A 4YASA 3M81A 4LYDA 1AMNA 2GBCA 2PU5A 4UFNA 1WHSA 5C8XA 5CT5A 1A8UA 4N8EA 2ZSIA 3KWFA 4TVKA 2HDWA 2JGIA 4RGYA 1MNQA 1RYYA 2WTNA 4I19A 2QS9A 3WWEA 3STVA 2EDCA 2H7CA 1EVEA 2HA3A 4TPKA 5HCUA 3H2HA 4PV7A 5AI6A 1F0PA 3N0TA 2HA7A 4MJ3A 4PSDA 3WK9A 3W2TA 4EHBA 4UBJA 1XRRA 5D7BA 3QZUA 3WZLA 1R3DA 4FNGA 4B9AA 3GELA 4L3WA 4EY4A 5AK3A 5HFNA 4Y9SA 1N8SA 4O08A 3NGMA 3H19A 1IVYA 3W05A 3RKSA 2K2QB 1IUOA 3FSGD 3W06A 3FWHA 4ZV7A 4H7EA 4MWSA 4ARBA 4BTVA 1E89A 4UHHA 4DMKA 2AJBA 1H2YA 1NU6A 2Y2UA 1PJAA 5E4JA 4BC1A 4HAIA 1HL7A 4HVTA 5HF5A 5K3AA 4JUIA 2PSEA 3EBLA 4MYDA 4DNOA 1M33A 1VLQA 1QIEA 3ZWQA 2Z8XA 2WTMA 3H18A 4C4ZA 3D0KA 5KWIA 1CUSA 2OGTA 4QDTA 2VATA 1UOPA 5JAPA 1QIGA 5C8ZA 1ACLA 4C4YA 5AKEA 5CRIA 2ZYIA 5HQ3A 1G66A 4I4CA 5ALHA 4XJVA 1MPXA 2WG1A 1XFDA 3STXA 1VE6A 1GPLA 1A7UA 3F97A 1QO7A 1ZD2P 4AMZA 3A2MA 1YAHA 2DFPA 4UHCA 3M83A 2HM7A 3PDCA 3AZQA 4BCBA 2QM0A 3K2IA 4FHZA 3AFIA 3WWDA 4OB8A 3AIMA 1LZLA 4YX9A 2JGKA 4NVRA 2CUTA 1QIJA 1CUHA 2IX9A 2WKWA 1LPSA 1DT5A 3F9CA 4FLFA 1R4ZA 4NS4A 2BUBA 2ONCA 1ZGCA 2XQFA 1DX4A 4UHFA 1E66A 4GBGA 5JD4A 1YA4A 1IUNA 2VF2A 2XUPA 4U2CA 4B0PA 4G5XA 2QXTA 1LBTA 1YASA 2C0PA 5JALA 4GHWA 4EBBA 1R50A 4UBNA 2Y1KA 2QOEA 4AMYA 4KEAA 3IBTA 4X6UA 3UMJA 1F6WA 3F67A 3F8SA 3QH4A 1ZICA 2BFNA 4J0IA 2EDAA 1VXOA 1LLFA 3ANTA 5JZ9A 5T4EA 4IH9A 1ZI9A 5JAHA 3DJYA 1JFRA 2W22A 2XMCA 1E8MA 4P08A 1UK9A 1YR2A 4X6XA 4DMHA 1OXMA 5J3JA 3WJ1A 5JD6A 4JH0A 1CFJA 2UZ0A 4KRXA 2GYVA 1XROA 5BOVA 2VEOA 4X7BA 1P0MA 3AZOA 3L1JA 5EIEA 2YASA 3DYIA 3L1IA 3WA7A 1Q0RA 1Y7IA 4BCCA 1QFSA 4GEGA 4E11A 4DGQA 1EHYA 5LLSA 2WHRA 1FFAA 5HK9A 2HIHA 1WOMA 1CQZA 4UBMA 3HC7A 2VJAA 4DSZA 1XQVA 1IZ8A 4HXGA 1NU8A 3Q8WA 3STWA 1GQSA 4CIAA 2H7YA 3WL7A 2IITA 5ALPA 3AIOA 5AM4A 2HU8A 3IIIA 5AKZA 3KDAA 4QLOA 2VSQA 4FFVA 2HFKA 1P0PA 5DTJA 4OU4A 4K5QA 1UK7A 3H1AA 5LZ2A 1NX9A 1QIFA 4UFOA 4GLBA 3IA2A 5BWCA 5AJHA 1F8UA 4QE3A 4K6HA 1WPXA 5EHZA 1ISPA 2JBWA 3K6KA 2I3DA 2QR5A 2PX6A 3O0DA 3FYTA 3PUHA 1QIMA 2X76A 1EDBA 1K6EA 2D0DA 2EEPA 5EFZA 4BBZA 5ALXA 4YPVA 2C58A 3ZPXA 2WIJA 1YCDA 2GBIA 4J3JA 1W75A 4QZVA 3MUNA 3PICA 4X3CA 5A6VA 4UPDA 5KWJA 3WWOA 1QE3A 2WFMA 3VKFA 4FWBA 5ALUA 2DHCA 4ROTA 2WU4A 3ICWA 1XZIA 1MJ5A 2XDWA 1BN6A 3FCXA 4Q82A 3QBJA 1EH5A 3WMRA 4B83A 4M0MA 2V98A 4G9EA 1XLUA 2G5TA 3SK0A 3LCRA 3ED1A 2XQKA 1KU6A 1T2NA 3ZLUA 1CUZA 3BIXA 5ALEA 5FXMA 4OCZA 1H2ZA 1ORWA 2GYWA 1BS9A 3SC2A 2OXEA 4MEAA 2HA4A 2ACKA 3V48A 1I6WA 3A2NA 4H0CA 3I28A 5D3ZA 3QITA 5HKAA 1QO9A 3EQ7A 3B3QA 5K3EA 3QVMA 1E8DA 3IVMA 2PSDA 1AQLA 2IIVA 1W52X 4PSUA 1C4XA 4HRYA 3WK8A 3WL5A 4EUSA 5HF9A 4H7KA 4MYSA 3U0VA 4JNCA 4WFJA 4OPMA 2QJWA 4JYPA 1ODSA 3R3YA 1L7QA 2OAGA 4G9GA 1UKAA 2GBFA 2WQZA 2OG1A 3DDUA 5A2GA 4I3FA 5FOQA 5JZBA 1Q0ZA 2YH2A 5AKKA 2G4LA 4U2GA 3B12A 4E14A 1BU8A 2CJPA 3ILSA 4CCYA 1XZJA 3BE8A 1MT3A 5ALIA 4ZV9A 3WK6A 5DJ5A 4X6YA 4KAJA 1N5MA 2YXPX 4WJLA 5A71A 2VAXA 1FFCA 5IVDA 1FJ2A 1LPNA 2DQYA 2OCIA 4H7DA 4BDSA 3VISA 4DLNA 5T4HA 3H0CA 5AOAA 3MGAA 1ZIYA 1ZGBA 4PQEA 4J03A 3FBWA 4B7ZA 1CUCA 3DCNA 4D9JA 3HEAA 5CW2A 3KD2A 1VOTA 3IB3A 1C7IA 2I03A 3MVEA 3V1MA 5LP1A 3TRDA 2XQIA 4OB6A 3KOOA 2OLEA 1XRQA 1ZIXA 4AO7A 1P0QA 4G8BA 1CLEA 2VJDA 1XZEA 2O2GA 1ORVA 5LZ8A 1QJ4A 3BDVA 5E4YA 3OPMA 4FDMA 4ETWA 3H2JA 7YASA 1YB6A 1JU4A 1OILA 4GECA 1W1IA 4ARAA 4H7HA 1E3QA 1WB6A 1CUWA 2WFLA 4AN0A 3C45A 1ZD5A 3UUFA 2XQGA 5CBKA 5FV4A 1PV1A 1ODTC 1J2EA 2P8SA 4Y2YA 3VJLA 1R88A 1CUAA 1LZKA 3ZI7A 4XIIA 2WHPA 1DTEA 3WKDA 2QJRA 2V96A 3W9UA 3C87A 4PW0A 4KRYA 2FUKA 5I9IA 2GBGA 1BRTA 1FFEA 2G5PA 1QGED 2WUDA 1QFMA 4Q05A 4P93A 1W6RA 5DYYA 4W1PA 2JGFA 2WFZA 2OAEA 2XMZA 4HRXA 4IH4A 1Q84A 5AKHA 3A70A 5LZ5A 1AKNA 1FFBA 3FSGA 1AZWA 2DQZA 4XWGA 5AOBA 1D07A 2RI6A 2WJ3A 5AP9A 1AC5A 3IULA 3GUUA 3PFCA 3QPCA 3IUJA 1WM1A 5ALSA 1OCEA 1QOZA 5CT8A 2WIKA 5ALQA 2Y2VA 4CCWA 3WKCA 2OPHA 4H7JA 2XUHA 1LPPA 1UKBA 4DMCA 3O95A 3D4LA 1B41A 2WFLB 4Q3LA 5ISMA 3WIBA 3LLCA 5E4TA 4B0OA 2CKMA 3AJAA 2E3JA 4X93A 1DWPA 3VJKA 3V9AA 3WKBA 4JEIA 2DHDA 3D2CA 3GFFA 5CXXA 5JARA 4AX4A 1SOMA 1CRLA 2HRQA 3K9BA 2B4KA 2XUKA 1QIKA 5ALJA 4BAGA 4A16A 1XLVA 4QNNA 2PBLA 1HBJA 1HLGA 5LKRA 2BGNA 1CR6A 2OCLA 4X97A 1DINA 2B20A 3DNMA 4KACA 3HRHA 4UHBA 1Z68A 1VE7A 3D59A 4RPCA 3RM3A 5ALRA 4H35A 4B85A 1CUIA 1Y7HA 1LPAB 3V1KA 1VKHA 5AM1A 4EY7A 5AICA 5AM3A 3ESAA 4H77A 1XZHA 1L7AA 5CH5A 3VJMA 2VAVA 2RHWA 3C6ZA 5K3DA 3C43A 2QVBA 5EIHA 1VA5A 4ITVA 2QRUA 3HYSA 1LPMA 2HA5A 3G0IA 1UT6A 1K4YA 4X90A 2HA2A 4FOLA 3I1IA 2JF0A 3D2BA 3E1GA 4M0EA 1W4LA 2BKLA 3STUA 2BUCA 1CUVA 3O9MA 2ZYRA 1ZJ5A 3OM8A 3LIPA 3QYJA 3S2ZA 2OGSA 4X94A 5I7UA 5H3HA 3WA6A 3BXPA 1EI9A 1AURA 4PNZA 2PSHA 1MN6A 2OCKA 5KREA 2R11A 1JJBA 3AZPA 2XMDA 4MXDA 4ZRDA 5DWDA 5AHXA 3LS2A 5FRDA 1MAAA 3OG9A 4BRSA 4BRZA 4CG2A 2WU3A 3T52A 4X95A 3WJ2A 5DNVA 1TAHA 4QDXA 3C70A 1XRLA 4BVLA 3O4IA 1LGYA 1SFRA 4J0HA 1A8SA 3IUNA 1XQXA 5AM2A 3LIIA 3HZOA 4ZXFA 3WLAA 1YS2X 2XMRA 1JJIA 3DKRA 1XRPA 1H22A 1THGA 2QKYA 5IVKA 2PUHA 5DLPA 1SC9A 4IHAA 2XUJA 5A62A 4BE9A 2JIDA 2RHTA 3M3DA 3QMWA 3HLKA 3GZJA 4C4XA 2HA0A 2JEYA 1EINA 5K5EA 2Z8ZA 4J0CA 4ZGBA 4QWWA 4Y2VA 5ESRA 1DT3A 5AM0A 1DX6A 4Y2SA 4QEKA 2B9VA 2WJ4A 4OSEA 4BVKA 4C89A 5ALGA 4BTLA 1T4MA 4K6GA 2PKYX 4QDOA 3R40A 3RLIA 2GZRA 3DD5A 3QMVA 1W76A 2HFJA 1CV2A 4C87A 3I1YA 5JATA 3I2GA 5CT6A 1PFQA 1GT6A 2VT7A 1X2BA 3KXPA 5LIPA 3FYUC 1A8QA 3WQHA 3C6XA 4Y7DA 5F4ZA 1BCRA 4WDRA 4QDZA 5FUMA 1TCCA 5AKYA 5C81A 1TCBA 1ACJA 4J0JA 4RE5A 3WKAA 4KAAA 1X2EA 1JU3A 4XX1A 2XLBA 3FLAA 3T4UA 3M82A 1XZCA 5K3BA 4F21A 1J06A 2WUFA 3FOBA 4BDTA 4A5SA 2WUGA 2ZJ6A 1HPLA 4BVJA 4CCYB 4HZGA 4BC0A 3CN9A 3C5VA 3LP5A 3QPAA 2CEKA 3G0CA 3JWEA 3V1LA 4DIUA 1UWCA 1MX5A 1N5RA 4J7AA 4BE4A 4AN1A 4W63A 3ESCA 5ALYA 3PF9A 3WWPA 1UK8A 2QTBA 4H7IA 1WHTA 3RK4A 1K63A 1N1MA 4CI9A 3R3XA 1CVLA 2PUJA 2FJPA 2WHQA 4W1QA 3OURA 4L0CA 4W9RA 4QWMA 1QIHA 5AKIA 4DNQA 1MU0A 3QM1A 3G0BA 3X3HA 2Z3WA 3IURA 4C01A 3FYUA 1CUDA 1ZI6A 5FPPA 3CXUA 3H2KA 5FLKA 4EZIA 2JGJA 2C4HA 3P2MA 5BV7A 1ZI8A 3FAKA 1JJFA 5JADA 3A6ZA 2QUBA 1ETHA 6YASA 1VJ5A 4NZZA 5IVIA 3F96A 1WCYA 4XVCA 5JYCA 3YASA 4S0XA 1QIIA 1K8QA 3G9UA 4OU5A 4BZZA 3E3AA 3I2KA 3C5WP 1R9MA 5JAUA 3WYNA 4K6KA 1QIDA 1WB4A 5FPQA 1H2XA 3KSRA 4Y2JA 4X92A 3U1TA 1UOQA 4DSAA 4QDUA 2XE4A 5LZ7A 1TQHA 3H1BA 1CEXA 4LXHA 2QXUA 2WJ6A 2ECFA 2BUAA 1XQYA 3HACA 1GKLA 1TKRA 4UHDA 5FKJA 4B84A 4J0KA 4B80A 3HI4A 2OGZA 4FBLA 1RWQA 1XKTA 5SYMA 1SCQA 1X70A 1SCIA 1LBSA 2J4CA 4Q1VA 1XZLA 1XZMA 4BP8A 1U2EA 1XRMA 4MQMA 3I6MA 3TEJA 4UUQA 3R3ZA 1G5FA 2PU7A 4L9AA 4MQLA 2WILA 3NWOA 3EF3A 5BWBA 2QT9A 5KBYA 4Q3KA 4G1FA 3GROA 4K2AA 3IDAA 1EXWA 3RARA 3OC0A 4RE6A 4Z49A 2DCMA 2XUIA 3CCBA 2XMSA 1LPOA 4V2IA 1JI3A 5JD5A 3JW8A 1MX1A 2VQ6A 3BDIA 1HQDA 3WKEA 1YB7A 5AKJA 1MNAA 2ZJ7A 4X91A 5DYTA 2XUQA 4Q34A 3QMMA 2J4FA 2RONA 3ZLTA 4G4JA 2XMGA 3PF8A 5ALTA 3H2IA 5JZSA 5K3CA 1BN7A 1CUXA 1TK3A 5AH0A 3CN7A 4KR0A 1CUFA 3ICVA 4W1RA 3AIKA 1CIJA 1CUEA 1GKKA 3SWWA 4DNFA 5AI4A 2XUOA 1XQWA 5AM5A 1QZ3A 2V9ZA 1ODCA 2Q0XA 2V97A 1O6GA 1EA5A 4HXFB 3STYA 2HRRA 1QTRA 5HF6A 2CMFA 5AI9A 4ZREA 4JYMA 3FVRA 3OOSA 2BGRA 1H2WA 4WFKA 2Y6UA 5DTIA 1JKMA 4UBOA 2C5FA 5ALKA 3O4GA 4F60A 5SYNA 5HKBA 4J0DA 1ZD4A 4A23A 4ZI5A
chains in the Genus database with same CATH superfamily
3DKPA 4Y98A 1VHLA 2FFJA 1UOEA 4C21A 1KMHA 1LH0A 5KMGB 3CGGA 4BNZA 1DTSA 1OQAA 3PHCA 4YQZA 3ZXUB 4NCBA 2JGEA 4B2PA 4CF5A 3DEAA 1A9YA 1TT5A 2VYNA 1WNFA 2NUPA 3H7AA 4INJA 2AMYA 4KQCA 2B61A 5T3YA 3L0BA 3VPHA 1Z5WA 4BQEA 3AV0B 3TIIA 3BB3A 4LFBB 1DQZA 4I50B 3VC2A 1YDWA 3SICE 2WSLA 4KLNA 1TCUA 1RU3A 5CCEA 1CQWA 4GPIB 3C7KA 3L8ZA 4AF6A 2I3ZA 2FZEA 2PWBA 2ZWIA 5IWAB 1TCAA 2ABWA 2G04A 1QHGA 5EE3A 1EFLA 1Q1GA 1S8OA 4ILKA 1DWQA 3GEMA 2IZ6A 1LSSA 4JQOA 2P4SA 4N39A 4Q1DA 2GETA 3H0EA 3M5DA 3BGOS 4QUJA 4ZFNA 2XCRB 4WPGA 3QX7A 2BIFA 4QPJC 2I66A 3SFTA 1Y80A 1SQFA 4L78A 4PC6A 1M8FA 1E79D 4GP9A 3QI2A 4GQIA 3INRA 4MP3A 4CV2A 1QHSA 1I4EB 1TGVA 1JR3D 4EY6A 4JI4B 3BMOA 1DG1G 4MQBA 4HLDA 1QQ5A 3R8XA 5JYEA 1AXRA 2VNHA 2DWCA 1DS6A 3QLVC 4JXJA 3W9BA 2CFSA 2P68A 3UXHA 4M0LA 3C5CA 2VDWB 1U0RA 3CPJB 4RWEA 5CXQA 5IT4A 2WQ6A 1UBKS 1BXRB 2H1RA 4IJVA 5E7MA 2ZW9A 3DR3A 3HG7A 1NHWA 1UPTA 2G77B 1LLUA 3WYBA 3WMFA 5I9TA 5F3DA 3G5TA 5EUQB 3TCKA 3O91A 2FZ5A 1PJSA 3DOHA 1A96A 1PLKA 3WK7A 4JBXA 4KSCA 4AO8A 1F20A 4X84A 1BE6A 1RKXA 3BERA 5D5PA 1WMFA 3SOZA 3ONFA 1N2CE 5LP6C 1J07A 2VPYA 3PXAA 3KV1A 2CD9A 1PT5A 4NONA 1X7WB 2JRLA 4D96A 3L7NA 4CGZA 5F73A 2H65A 4FPXA 1DCFA 3DL0A 2XUDA 5CDFA 3GHHA 1BRMA 1R0SA 4L9SA 4ERXA 5JSHA 1M83A 1EAMA 4AQDA 1FL9A 4BL5A 2R6DA 4KSBA 5KVQA 1YE3A 4M7PA 3C74A 5LYYA 1H23A 3E9RA 2YHIA 3ITEA 5TB5A 4GKAA 1C8KA 1DKPA 4J16C 5T5QA 3FUVA 1MQAA 2IV7A 1HETA 1NXPA 4TLAA 1EP2B 2OCXA 2BSAA 3AR3A 3QEMB 4TMFA 3GLKA 1YR9A 4D99A 4DXHA 5BUQA 3FOFC 2X8LA 1R6DA 4JD5A 3U09A 4L6AA 2IY8A 4UTRA 1YQGA 3WGVA 2C0QA 3IEUA 2ACEA 3HV2A 4OHCA 1UM9B 1M73E 1R1DA 1DCMA 1WO8A 2ONZA 2A84A 4KWCA 4BQIA 1Y3DE 2CBGA 2AA3A 4ONEA 2P2LA 1NVXQ 1JV2B 1RE1A 1FUKA 3CE9A 3FF1A 4ZT4A 2VK1A 4D4JA 2FWNA 3HO6A 1KMHB 4CMIA 1FMCA 1CF2O 1TYDE 1ICIA 2JJ2A 4GYJA 5EERA 1FB5A 3AF2A 4O8CA 4OKIA 2NU7B 3L5KA 2O1XA 4FI3F 4RVGA 3U6BA 4PF1A 1I51A 2HRDA 5EMKA 4ZYVA 2BGLA 4X3PA 2J3LA 2DWUA 3P9QA 3ETCA 5E1BA 2XKKA 2ZCVA 2ZJ4A 1M1NA 4P4TA 2PV7A 3KR0A 1UIMA 3AY6A 4XVRA 3MXTA 1J1IA 4BV3A 3PNBA 4X63A 2NGRA 3F2VA 3X1WA 4FLEA 3BXZA 3KT6A 1B8OA 1X9IA 2P2CA 1U0OC 4YCJA 1E2UA 3BILA 2VZLA 4OHMA 3FYSA 3RWMB 2YJ3A 1YB1A 5IYZF 3SEZA 4GT1A 1ZY2A 3HDVA 4ZTBA 4E15A 3EODA 4WLOA 4AUMA 3QPDA 1P75A 3UGQA 2RGUA 5ABPA 2PQ0A 1NNI1 1OAAA 1JQ5A 4X8HA 2JA1A 3A9SA 1WXIA 2Z2KA 2ZYDA 3GJTA 4F2HA 4KE6A 2FUNB 3KALA 4I9FA 1LI7A 3IVXA 1TRHA 1E2GA 1L5WA 1OZ0A 1NVGA 3ZWVA 1Q12A 2ID8A 3WI7A 2BM9A 2XQVA 1BEZA 4ND4A 5TARA 2VXBA 4JUFA 4N0EA 2NU8A 3WRXA 4AJPA 2JLWA 1TVEA 4RORA 3LF2A 1F0NA 3ZHBA 3MNFA 3NAGA 2NZVG 2OBMA 1NJ5A 4HFJA 4EO4A 1GAXA 1T5DX 2OCGA 5D3KA 2IZ5A 1H4VB 3JQFC 4B3JA 1E1DA 4TV8F 3IQDB 4CIXA 4CQMA 5JR3A 3PT5A 5EXEA 1Z6QA 1ADBA 4XSHA 3VC3A 1PZEA 4R69A 3R7SA 2JW5A 3JR3A 5C46F 2YWDA 3AXTA 4HLQB 1Z56C 1IBLB 2IOQA 2H57A 2IYTA 4O6VA 1HDYA 3CLKA 2PRIA 3CVJA 3NTUA 4QTUB 2PUVA 1TW3A 3TRHA 5C7YA 4BFSA 3ELBA 1E0JA 3VPBA 5CXUA 5EKDA 4XYGA 1BC5A 4JDPA 1DWOA 1RIFA 3ANMA 1Q91A 1KK2A 2QVGA 1N57A 4HYTA 4TT8A 2UXBB 1HT1E 3HDHA 4OQMA 1EUDA 2XGGA 3F98A 1U3GA 1E9RA 1B1CA 1FSGA 3E84A 1YS1X 4CKBB 4CMEA 1GZ5A 2R6CA 4OHVA 1YCHA 1P7WA 1XD2A 4U8HA 2BZGA 1B8PA 4HXEB 5A4IS 2H9YA 4YCDA 4D8VA 1Z8DA 2ZPUA 3AEKA 2CL0X 3DE6X 4YO7A 1S1CA 3I2JA 3JYHA 4YV1A 5HZGA 3JQFA 5BXYA 1S2GA 2R1VA 2I7XA 5ERXA 3WDMA 2XV1A 3LBNA 4Y7CA 2FDCA 3GRVA 3THRA 2R8YA 3RVNA 3JZMA 3KUXA 1GQRA 3R41A 1II0A 2AXEA 2EFYA 5CNKA 1T0UA 3OLQA 3H2SA 4A26A 4HQ0A 1VBFA 1N1EA 1K1EA 4JEMA 4JIMA 5GONA 4YN3A 3R3JA 4UTXA 4WDQA 3O90A 5EQJB 5LXTF 3O5AA 2ZWVA 1OWNA 4KFRA 5TPWB 1FLVA 3MM4A 4HY3A 4H15A 3GLHE 2JAHA 4RF5A 1U3UA 4PPGA 2CDNA 4DTCA 1O5OA 2G1UA 1Z4IA 2P6PA 3L7DA 1II8B 2QXYA 1N5IA 2WRZA 3LTEA 3NTOA 2JLYA 2BOVA 3FLEA 2DEUA 1VPLA 3I09A 1N3LA 3COZA 1UEJA 1L6RA 1JVSA 1ABFA 1SHJA 1SCUB 1Y7PA 3DMRA 1N9ZA 3JAWB 2GEKA 1HZZA 1OW3B 1JPVA 2GF0A 2II6A 2W6NA 4MVJD 1EB9A 4OLHA 5JVDA 3KAJA 5ALNA 3TG8A 3C8UA 1KJNA 2QE6A 4FYWA 2SCUA 4P3OA 4FT2A 3FZGA 2HWKA 2BR3A 3X43A 2CLMB 4JMPA 4KWIA 3KQOA 5JE8A 5B4UA 3WB0A 5DM4A 1Y1TA 1A7AA 3QVOA 4C4RA 3TUJC 1FYDA 3RSGA 1G59A 3A4YA 4HNRA 1P0CA 4O1HA 2F1OA 3V1YA 4NE2A 2O5CA 2WD8A 3F6EX 5JHGB 1N3IA 5I8ZA 4H3HB 2Y1OA 3L07A 4PQFA 5E7JA 4BNNA 1OYWA 4NNJA 2VF4X 2X1VA 4EG0A 1SC1A 3NBQA 3IUYA 5LQAA 1P1FA 1RZUA 2A1UB 1EX9A 1LSUA 1Y34E 1T9DA 3HYRA 1UODA 3OAAA 4B9EA 4FEAA 3PYMA 4AJ2A 4OXRA 3BF7A 2VG8A 2ZI7A 1NVWQ 1QK4A 2AJDA 1Y7LA 1I2DA 2W6ZA 2VTVA 1R6TA 4UD6A 1C8BA 3TD6A 2PMKA 1WSAA 3K8QA 3KJFA 3AWDA 4W5RA 2QJTA 5K1ZA 3F7MA 3N2GA 4INAA 4OJQA 4UU8A 1YQXA 3JY6A 4LXGA 5IKXA 4FOTA 4EWLA 4L6IA 1Q7BA 3TJRA 5KTPA 4MV7A 2GTHA 2YIMA 3QBDA 3COSA 4QSHA 5D85A 1DWUA 4R3WA 4AJ1A 3HMQA 2EAUA 5ALDA 5KUTA 4D9FA 2NYAA 1DO8A 3IUEA 3U7JA 1PFKA 4ERNA 3EOAI 5K8TA 2ZCUA 1J2JA 1JFFB 1YONA 5AK6A 5JV5A 3KQTA 4KXYA 2X22A 3P2IA 4BNGA 4J90A 5LDDC 2PQ6A 3FX2A 4OQFA 4D6YA 1A76A 1GPAA 1S2LA 4A36A 4C7MA 5L45A 4FFLA 1YDFA 1DPGA 1U1IA 2C5GA 3QI7A 4L57A 2HDHA 4DN6A 4KDFA 4F4DA 3PJGA 2Q7XA 3JVIA 5CJPA 1JUDA 3AVOA 1A04A 4DARA 2NVBA 4DS3A 1GUAA 3DNFA 4EITA 2XGJA 1U3TA 2HO4A 2C7BA 3AJ9A 1MJNA 3CZCA 3E0QA 4LYFA 4LE1A 2P0YA 1M6WA 4EB0A 4GBED 2OFPA 3AF4A 4JQZA 4F8JA 2GH1A 1EWKA 3DYVA 3HZHA 4XZ3A 4HPXB 3SPXA 4YT4A 2IHNA 1YHYA 2VJQA 4KE9A 1ZK0A 2G25A 2IYLD 3A9RA 4JX8A 1XRSB 1HX7A 1XD2B 5HA5A 4EENA 3D31A 2QTHA 3FUXA 3G9XA 1B76A 2QM8A 4OO3A 4S1VA 5SY9A 3LW8A 3PQEA 4IILA 3ZJUA 4YAKA 2KM1A 4IXWA 4LMRA 3JCZA 4NPCA 1GTJ1 2I78A 2F3RA 1I0LA 3DOIA 3ZE9A 1E5TA 2PSSA 2ZEJA 4L72A 1YI0A 1G38A 1XU4A 2XLCA 5BPFA 1THTA 2IE8A 4DRXA 2JCVA 3BE6A 5HUHA 1PQ4A 2B2XA 5CG1A 2ZVDA 1T8PA 1YZFA 2PA0A 1TTTA 2XUZA 1I2AA 3QXCA 3WOHA 4TV9A 4ZPXA 3FNIA 2EZ4A 3BK1A 1MHPA 1PGOA 2QTFA 2ZR8A 1N2SA 2V8OA 1NE7A 3ESXA 4P53A 5CAEB 3GMSA 3DTTA 1R5BA 1KYQA 3HCEA 1L3CA 2FZGA 1C9EA 3H87A 4AF8A 1BDIA 4DM7A 5JPDA 3V8PA 1W2GA 2DHQA 5C7LO 3LXUX 4BZWA 2VCYA 1FYVA 1DBSA 3WL8A 2RCNA 1QCCA 3LXRA 2ZVJA 2D4AA 2AOVA 4OYLA 2WJIA 4IHJB 5JNLA 1XVIA 3W2HA 1DQRA 4MKRA 4KDRA 4MDYA 4QREA 5FO1A 5I5EA 5FR2A 2CJXA 5JXGA 2W0MA 4B31A 3EPPA 4NHOA 3DE2X 1R6UA 3L4BA 1J8FA 4X54A 1YVPA 3WAKA 2TS1A 4R2HA 3CE6A 2XNJA 3L5OA 2XIJA 4OHUA 4P7JA 1BVUA 4EB6A 2D2IA 2XBLA 5KSOA 5L3VA 2HI0A 3Q6NA 5C8YF 5DGTA 2P4HX 2C5BA 2YW2A 1MO2A 4A4DA 1RRCA 1UP7A 4RVDA 3ESZA 2XITA 5KYWA 3QF4B 2JFVA 2N9UA 2FFAA 1GPBA 3S99A 4EJSB 5HXAA 1WXWA 2YJ6A 2GCIA 1DKRA 4FZRA 4B17A 4CG1A 2WZBA 3ZE2B 4GWLA 2GZSA 5L8VA 1OH6A 3L7OA 1JH9A 2ZYHA 3B5IA 2X86A 1YR3A 1GZ7A 1NPTO 3R5FA 3TOSA 2HEIA 4Z7QB 2XMBA 1K7YA 2JH8A 3LT1A 4N4AA 4PQGA 2REBA 1IAQA 2ID4A 4RLFA 1SKMA 4D9BA 3A04A 4H4CA 3GP8A 3V5NA 2A0WA 1P3Y1 3AKEA 4BMYA 3PKZA 4A92A 1OUMA 4K9KA 1N6RA 2H1IA 4I36A 4C0JA 2B1GA 1U31A 1GAQA 5CJ2A 6NULA 3E27A 3FNGA 2YYYA 2G6TA 1L7XA 4ND8B 1AGYA 5EJ4A 1ZD1A 2QTZA 1F2TA 3BF8A 3I9OA 3Q9NA 3SNKA 3UT5B 2DG2A 2WG2A 3W7VA 5G40A 1JHQA 2OILA 1QWSA 4EARA 4IOKA 3EK2A 5AW6A 3U44B 2PMCA 3G8CA 1O95C 2D5AA 1H0HA 2FQWA 2FKNA 5U4QA 4ABYA 1TAQA 2YYZA 2B99A 1FSFA 2OEPA 3OEED 3OHPA 4WHMA 4Q7QA 4OMFG 4WT7A 4A6XA 1PJ2A 3MZ0A 4X71A 3RNLA 5FADA 1VG9B 3M6WA 2VDNB 3IAM1 2WWRA 3HEMA 3NASA 2H2GA 4LZLA 4M9XA 3L93A 2C2OA 2MYTA 1HE1C 2P6UA 4QLAA 5J5AA 1JTFA 1TUBA 1E9BA 3WS7A 4C6TB 2IUSA 2PHZA 3AWIA 2ZIUB 3JQ6A 5DI3B 4G67A 1E2LA 1V95A 1XQ9A 2CB0A 5A5VA 3T8YA 2NO0A 5ADVA 4D02A 2OORC 3F6RA 1RM5A 1D4FA 2DPXA 2JGLA 1M0EA 4LYHA 3WLHA 4LKOA 3TJMA 5LL6P 2MSWA 1YJ8A 4DRXB 1BNCA 5EWJB 2XMQA 3ONNA 4TSRA 5IM4F 3MT0A 2O2HA 3K0SA 1QH0A 4R7ZA 2VUHB 3VNRA 4AXBA 2O7VA 3SQNA 5M7EA 3FVQA 2GPAA 2UU9B 1X1EA 3NC0C 4MVJP 4GC9A 5BSMA 4E4TA 2WTUA 1HTWA 1HFEL 1UZAA 2JJ8A 3Q1LA 4N8SA 4RK5A 2F7SA 2IEAA 3GCWA 3T7SA 4Z99A 3ADOA 4FLMA 3WFJA 4UM7A 2BF7A 4G23A 3AIIA 2RHGB 3C6YA 2ORYA 1J2TA 5DK6A 2Q1TA 2V4UA 4KLAA 4FNMA 4LW8A 4ZYTA 5H81A 1Y1RA 4UCXA 1T4GA 1KZ4A 3A6GA 5ICCA 4Z51A 4LXIA 1LQ2A 3TWOA 3ZZTA 1GOTA 2QUAA 3PFFA 3VI4B 6AT1A 5E7QA 1BROA 1O8BA 4LVOA 2D3WA 1U65A 3BXXA 1KEVA 4ZAVA 4L22A 4BECA 4ECAA 4ZZ1A 4OQLA 4UDYX 4B82A 2XYRA 1OBHA 1YZYA 2C5LA 2VDUE 4OBBA 2W6QA 4B76A 4X8MA 4E2YA 3L7CA 3LCCA 1W5SA 2FOIA 1HXHA 3G5UA 3E53A 4RPGA 4E1AA 1GKYA 2VPXA 4YJ2A 1U2ZA 3ANSA 3G2PA 4NCJA 1EP1B 1SXHA 4Q1CA 1P7PA 4BNLA 4BUZA 2RHHA 4P38A 4EB6B 1NMSA 1U8CB 2I34A 2REOA 3AETB 3GARA 1FRQA 4C05A 5FD8A 3BHIA 1W4AA 1ZMXA 1B0UA 1AHNA 1BEEA 2WHYA 4N5IX 5K45A 4A6DA 4Y6RA 4G0QA 3HCBA 3TLYA 1N3YA 2Y0EA 1Y5IA 1DIAA 1DKQA 1GQQA 3HSYA 3OQIA 3Q10A 4UXIA 3PPXA 4LF5B 2DT8A 1Y6ZA 4PZZA 2PKRA 4XARA 4TVSA 4BQFA 4BN5A 4B5KA 4G4GA 3KWLA 4H27A 2QYTA 1XZBA 5LA6F 1EZZA 3IJ5A 5C1DA 3B8EA 3HB9A 1C8VB 4BNUA 3TNJA 5H4HA 1E6WA 5ALWA 5TVKA 2PUDA 3SC3A 3O93A 1D0VA 2YYSA 3KZOA 2VI5A 2IWHA 3WK5A 4RA6A 3ZDEA 5DVZA 2R62A 3L4BC 3MMXA 3OFVA 1CQXA 2IDJA 2HSJA 2Q2WA 4FOOA 4XDZA 5DT2A 5FUYA 5BRNA 3OQNA 4EZEA 4FHEA 1SVLA 4BVBA 1KMIY 3ZTTA 4UAGA 4ND8A 1USWA 5EXPA 1ISSA 1L9XA 1FFWA 3DCIA 1L5KA 3W9SA 4EL0A 2IPAB 4E5MA 1R9NA 2XVZA 3G5MA 2MHCA 3HABA 3PDHA 4RCVA 4I4LA 3ZWNA 3ILXA 5KI6A 2QT1A 2Q5QA 4QOIA 4F4JA 3GNSA 1JIVA 1NYQA 2C7RA 3Q3JB 4DYDA 4A8JB 1NXVA 4TM8A 3ND9A 1G9TA 4FCCA 3IMGA 3H05A 2PT7A 4D5EA 4M0FA 2CVQA 4MUNA 1U11A 4Y1RA 4MS4A 1V8OA 2ZUTA 3TRFA 2A9JA 2QN9A 3ABRB 1JXAA 1Z6XA 2PXXA 4LI0A 3M1YA 4N49A 2NZXA 2IF0A 4WWHA 3C8HA 2IXGA 3O9ZA 5L6LB 1YJCA 2WM3A 2VDPB 3HJBA 2XKBA 2J6BA 3MWKA 4HBGA 1GCOA 2PRJA 3OT1A 3R6DA 3SR4A 3PXGA 3A4TA 3PQ6A 1DBWA 4AN4A 2AG6A 3PYLA 1R74A 1WX1A 2CNKA 3PFHA 1ODLA 4J0FA 3D5EA 2PLWA 2FR8C 1HE5A 1UC9A 4G41A 4QBTA 3JR7A 1CRZA 1JBKA 2QJFA 4QGFA 4Y0NA 4QG3A 1A97A 1ENZA 3Q0TA 5JIBA 4I5DA 1Z5GA 4RADA 3E4DA 1RHQA 4IDAA 1M0TA 4C7OA 4PX2A 3D9QX 2ZYSA 3L18A 4J7XA 3DVQX 3Q85A 3H75A 2O06A 3GGGA 3DV9A 4Z1MA 4KXFB 5JSKA 2AFIB 2GBCA 4RJ2A 4AROA 2CDBA 3WDSA 1NFRA 4CRWB 4TYYA 1S0UA 5KCMA 3AHGA 4GDFA 3ECAA 4UFNA 1WU8A 2JIMA 1ULAA 1MEOA 3KSAC 4XR4A 1PX2A 5EMHA 4A8JC 5D6NA 1WHSA 3IIMA 2ERXA 3DMYA 3GEBA 3M4XA 5CT5A 3Q3GE 4YYEA 3L7IA 3C15C 3QUQA 4DWWA 4N8EA 2IPMA 4EDFA 4XJSA 3K5WA 5J40A 4TVKA 4BUCA 3O38A 2ZDHA 3Q5DA 5K0SA 5JS7A 5EWLA 4D3XA 4NBNA 221PA 4MQ5A 4RGYA 2VA8A 3JATA 4FWIB 3ITNA 5FJIA 5C2JB 3TAHA 4L8YA 2G76A 3OIWA 4LDQA 1U7HA 4IIYA 1L8LA 4NEQA 3O3MB 4P22A 4DQVA 2ZETA 1T91A 5B7NA 1EE9A 3SDZA 4DUZB 2DECA 2XSZA 3SM9A 3KKZA 2JI8A 2Y9PB 4HEQA 1KH2A 2WKRA 3SE7A 2GESA 4GZ6A 2HA3A 2JFQA 2Z30A 3RC3A 1MQSA 2A58A 2FRXA 4JJKA 3CEAA 5HCUA 3H2HA 3KYCA 2C84A 2KPOA 4YTEA 2GDJA 1GUYA 1F0PA 1PR4A 5K03A 4MJ3A 2W2KB 1D6JA 3RNOA 4EHBA 1Z2EA 1A9OA 1DV2A 5THXA 3GRPA 4BFXA 1OHHD 4R8KA 5EC8A 5G0SA 4AT1A 2J0QA 4M7WA 3ROXA 4Q19A 1T0HB 1T13A 1DEAA 1VCMA 2FE1A 4EQ6B 3GELA 1F7UA 4DSUA 3QU4A 1TKBA 1HEIA 1CJMA 5C35A 1L4FA 1EFKA 3OA2A 4LCBA 5SV2A 1P18A 2R3SA 1NN3A 4FFBB 3UAYA 2CLKB 2Q3DA 1DRKA 4UM9D 5FF9A 4JT8A 5HFNA 3Q1KA 3WWZA 3NGMA 2HK6A 1DBIA 1FDRA 4YEDA 5JC8A 2B36A 3I05A 4BEJA 5IANA 5CFZA 3HWX1 5DM70 2HYIC 4ZZ3A 3A26A 2YBEA 3W05A 1SKYB 2OAQ1 3UIEA 3FFXA 4EA7A 1IUOA 2G08A 3B9RA 3LBFA 3OX4A 1NN5A 4BMVA 1JBQA 4C04A 1QGAA 3KFVA 4G0PA 3T54A 2RGEA 2QD3A 3DE0X 5B36A 2IHTA 4J94A 5M2QA 2O8EA 2IKSA 2RGYA 4KRGA 3ZE0B 1AV6A 1CY6A 4G3XA 4RAOA 2GBPA 2LCIA 4G01B 1PJAA 2BI8A 1JALA 1UJBA 2RBGA 1WMDA 3FB1A 4YRSA 3SYLA 5HF5A 3A3KA 4Z9AA 2FLVA 3GWGA 4KQ6A 1QCYA 2PSEA 1U1DA 3QE3A 3EBLA 4FFRA 5GP1A 2A9OA 1YDEA 2PDAA 4HYQA 1M33A 3IDQA 2PX5A 4RSMA 4EYKA 3Q7TA 1UR5A 4ES6A 2P5SA 3J7TA 4HDMB 5DO9A 3ZWQA 2Q50A 3RFVA 1TYAE 2WTMA 1A71A 1C81A 3FGOA 4BVHA 1OI4A 2QRKA 5C0OE 4QTYA 2Q6OA 3ZWCA 4DEXA 4JSYA 4C4ZA 4CTMA 3ZX5A 1ZVQA 5B2FA 3OZIA 4FX2A 1G291 1K2WA 3AC0A 5IDVA 3WSWA 1I01A 2GEVA 2VATA 1CJCA 1PK9A 2GHTA 2W93A 3MS2A 1HZZC 2F00A 4UU0A 3IIJA 5DSZA 5AVJA 1P61B 2JNWA 2V5VA 3ABIA 3EIXA 2K2WA 2QVZX 1Z37A 3NBAA 4C4YA 2I4LA 3W5BA 5J2UB 2GN0A 4ZVQA 1O94C 2EIXA 4WZAE 2BVNA 3N53A 1KQGA 1O2DA 1ISGA 1U02A 1G66A 1MC5A 2I5PO 3DB2A 3QA9A 1JLLB 1CJKC 1HKUA 1QNFA 4YMSA 2D1TA 4V0KA 2C9OA 4L2IB 1UKEA 1FDOA 5EWLB 3VV3A 4O4IB 1UPAA 2PH1A 2WG1A 1XFDA 3STXA 4TVOA 1KPIA 4G0WA 1W85B 4FHFA 2JIZD 1VE6A 3FI9A 1K7EB 2FUG6 4G0XA 4LRYA 4HEJA 1E1YA 4TWJA 4ARUA 4DA9A 4NXNB 821PA 4QYXA 3F97A 2CBXA 3TZKA 4O4LF 3CONA 4EG7A 5JQGA 4YC7A 1IK4A 1TA9A 4MGIR 4AMZA 3J81k 3A2MA 2QSYA 3IE0A 1YAHA 2DFPA 4HEHA 4BKMA 2HM7A 1HNWB 4JOCA 1K7CA 2W00A 4QM6A 3PLAE 2BFCA 4MZDA 4O3MA 2MMCA 3K2IA 1Y6RA 4FHZA 3AFIA 3WWDA 2IZOA 4W9NC 4Z4GA 3ZW8A 5BWOA 1YB4A 1OA0A 2VDQB 1IXKA 4GU5A 4IIGA 3AFGA 3GFBA 2JGKA 2WPDD 1B73A 4KQ9A 5HCNA 5H8WA 2O3SA 4M7OA 4EA8A 3I5UA 1UT5A 4Q3AA 3AGPA 2WKWA 3UB3A 3BB4A 1NDUA 1NWCA 2JK1A 3F9CA 3UAOA 1RBZA 4P34A 1R4ZA 3EH2A 4NS4A 1N7HA 1Y1SA 4RESA 5JRDS 1NZDA 2BEJA 3PC2A 4W5WA 4URYR 1U0SY 1GDHA 1DX4A 2QLTA 4KMSA 1C4OA 2KBEA 1I1OA 3EVNA 3K53A 1RXUA 4HNTA 1VFNA 4I0WB 1SQ5A 4DMRA 4X1YA 3DJFA 5BQOA 5JC1A 1ZGGA 1C9KA 1E1LA 1XTBA 2XUPA 3W4JA 1E9EA 1JHXA 3JYPA 2Y1GA 1WSDA 1WABA 3BL6A 3TKLA 4FR0A 4B0PA 1NW4A 1MHTA 1P3JA 3QKRA 3A1EA 2QX9A 3H8JA 3Q9SA 1YASA 3WLQA 3GJ7A 2C0PA 1S2MA 4OJYA 3VDNB 2H11A 5JALA 4GHWA 3TR6A 4JT4A 1SPXA 1ZMRA 1Y8QA 1Q17A 2F67A 3VR5H 1WPGA 2FWRA 1ICEA 1X39A 2QOEA 3HP1A 1SHTX 3OJEA 4JK3A 2E37A 3HB7A 2I1WA 2D2VA 2ZDQA 3IBTA 4KEAA 4DV7B 2MTBA 2QG9A 3IVAA 3MRSA 3F9IA 4P86A 4ZIRA 3GCDA 5HKKA 3P45A 3F67A 4MVJG 4JGIA 4RKYA 5K0JA 1N8TA 1ZICA 3ZXIA 2HF9A 1ZA2A 1XP8A 2HQ1A 1K89A 1YBAA 2FVXA 2JB9A 1GUDA 4X9XA 4D41A 3GPLA 3ANTA 5F51A 2DUUA 3O21A 4LOHA 2EJWA 2JIRA 5JZ9A 5T4EA 2H1OA 4IH9A 3UPTA 1GTZA 2JL1A 4NG5A 1ZI9A 4BB6A 4RLQA 4EPYA 2R0QC 2RFLA 2WJAA 2JGNA 1KK1A 2Q4TA 1E8MA 4LV6A 4NPHA 4HEA1 5AW2A 3PJRA 1E2BA 2PO5A 5K20A 4X6XA 2FPSA 1GU0A 3VI3B 4ZQHA 3K5PA 1LRJA 1XELA 2XA9A 3U7EB 2HDOA 3JVDA 3ZCVA 2UZ0A 4QUBA 4HVCA 3W77A 4DLSA 1T9CA 4S0ZA 5KU7A 1GLGA 1KBZA 2WYWA 4K88A 3KPUA 1O1YA 1HL3A 2GJKA 2Q4BA 4I46A 1USVA 4W6ZA 3K6RA 3U3KA 4UC0A 1GL9B 2HGSA 1QGZA 4FD2A 2WM8A 5FT9A 3L1JA 2X8JA 2JAOA 3DYIA 3L1IA 4MMXB 1ZOOA 4R05A 4TL9A 1J00A 2ZUSA 3WYCA 4X66B 4B3TB 2C9YA 3C5EA 1VG0B 2QVYX 1IQ0A 3DFFA 3EB9A 3ODGA 3QWAA 4MUAA 4IHQA 4MUIA 4WLNA 5J58A 1Z26A 1PG5A 4KGZA 4YQEA 2QI9C 2FAXA 4QQ8A 4D9KA 4M7RA 2BMAA 3LUAA 4L07A 4E6PA 4S24A 2A86A 4IJ5A 1J1ZA 4LHXA 4GUDA 3U80A 4CQNA 1WOMA 1H1TA 3HC7A 4PCVA 3V6MA 4UDOA 1AHPA 3DT8A 1HORA 1IG3A 3GMIA 2FTKE 5K0TA 4MLZA 1H2RS 4QHTA 5DXFA 1NU8A 2PZGA 5EINA 4ZOBA 1NUQA 3R7LA 4CIAA 4LBZA 4RKQA 1HFJA 3E7XA 3ADBA 2I99A 1M1YB 5ALPA 2X9LA 3TW8A 3D6AA 2HC9A 4BBPA 4WUTA 2A5JA 1DHTA 1NTOA 2G0AA 3AIOA 3RKUA 2OGUA 3R6GA 2D5CA 1V26A 1SCUA 2IU6A 3IDZA 3WGNA 1EZ4A 4L5BA 4BNWA 4YT8A 3TTUA 3FDXA 2HU8A 5EUMA 4UEJA 1TIKA 1GPYA 3FJYA 5AKZA 2SCUB 5EKTA 1V71A 3SYKA 1NVMB 2L0XA 4AK9A 6PFKA 3VKWA 4EPWA 2FEXA 2ZRQA 1QGUB 2HFKA 3E9NA 1RXIA 5KYVA 3DEJA 2YKGA 3IP8A 1DFGA 2DU8A 4X1YB 1P81A 4MUEA 1DJQA 2GRJA 1TZKA 1H6AA 2VNAA 4EATA 1NX9A 1B0ZA 2G1KA 2EBUA 2CUNA 3BXEA 4OOEA 2AB0A 5F2EA 4JVOA 3REGA 1CZOA 3QNWA 4DIOA 1W88B 1FRZA 1LTKA 2R2AA 3Q0IA 4MVWA 4E5YA 1WW2A 2IXDA 2J9RA 5CDTA 4TL7A 1Y8QB 2C07A 2C2BA 2YMPA 2ZSKA 5BWCA 4CI0B 1YVRA 1E9DA 2GK4A 4LYGA 1PYOA 5DRYA 3V00A 5BNFA 3K70D 1IEXA 1JR6A 1X8KA 3H11A 1TM5E 3JQBC 4ZA2A 4N5NA 4C4AA 2RJ3A 3H5WA 4DM3A 3OTWA 2NXWA 3M6IA 2D7JA 4KHZA 2XOXA 3SHVA 3AX6A 4QLBA 2D74A 3EVTA 4PZUA 4QPZA 3M6LA 3DMGA 1OXSC 4RTNA 1FDUA 4R1UA 3TTSA 5EHZA 3PSHA 3H6HA 1RCFA 1PWYE 2EZ9A 5JFTA 1Y3IA 3IT3A 1M0SA 4QBIA 1H2HA 1NQAO 4C2AA 1OFHA 2I4TA 2PZBA 3FYTA 3O0DA 4M6WB 3ZDXB 3SVLA 5GONF 4RVCA 2WYIA 1E2KA 1A69A 1OC2A 2HCJB 2XDQB 2APJA 4LN1A 3T06B 2XZLA 1DV1A 1K08A 1S9DA 4EMTA 5A2QA 1ZC3A 3IXLA 3GNTA 4YPVA 3QP9A 3IT2A 3ACDA 2PLRA 4RGVA 4ZQCB 5EJ6A 1Y4ZA 4WGGA 1CVIA 3IUPA 2WIJA 3L0OA 3OZWA 1Q3HA 1W75A 4I1OA 4B1FA 2ZRNA 1ZESA 5AVSA 3NBXX 5CHYA 2DKOA 4I2VA 4IOLA 4GPBA 5KOJB 4ARZA 2E2WA 3RPEA 1XE3A 3UMVA 5ENVA 2RKWA 4IW3B 3PFKA 2NUAB 1AB6A 1CKEA 4KB5A 1L6IA 3EXFB 5HQTA 3FRJA 3AY0A 2KBFA 3WWOA 4NH4A 2WFMA 4C2TA 2NSDA 4P6VF 5ALUA 1OTHA 4LJ9A 4YCNA 3VH3A 3DC7A 4QQFA 5EP2A 4E2ZA 2DHCA 4OTZA 1GGHA 3NS7A 5F4BA 2GAIA 1LDGA 1LUAA 1WDKA 4JXKA 5I9NA 2RKOA 2Q5LA 3M6VA 1BN6A 4DDUA 3FCXA 3DE4X 4JNKA 4Q82A 3WRWA 1ZIDA 3KSMA 3LVRE 2M1ZA 1VJ1A 4NEGA 4YUVA 4BY9E 3KOXA 3N70A 5FQNA 3WGIA 1C7QA 4HR7A 2QN8A 4D0RA 1G8KA 2GASA 3SK0A 2FW0A 5FL3A 4IFBA 1G18A 2WAXA 2ZIZA 9LDBA 1RXYA 5KU1A 1CTQA 1GG9A 1SVIA 1Q0HA 4E5NA 4KUGA 2VWQA 4NJEB 4Q4JB 3WGQA 4CF6A 3VYRB 3WJ7A 5KNDD 4U7PB 1WW8A 1NAIA 4DUPA 2H4WA 2QYSA 2ZLBA 4B3BA 1ORWA 3UJCA 4QRIA 1SHKA 2GYWA 1MD9A 1Q74A 2BGIA 1GCGA 1BS9A 2D5BA 3S2YA 3SC2A 1NBEA 3DBOB 5AVRA 2B34A 4TZ0A 3A3NA 3E9EA 2W6JA 4TZTA 4MUMA 5HJEA 2DSTA 5E95A 4B33A 3MMZA 2R87A 3A2NA 1P6XA 2PXCA 2R00A 3X2EA 4A8JA 2EGHA 2H17A 2AMLA 2BV3A 1L5OA 3I28A 4R2WA 3MCVA 1YUNA 5DHAA 3L8CA 4UUNA 3ST7A 3HJRA 3FUCA 4MS4B 4LSMA 2MYPA 2WZDA 3P9YA 5K3EA 1KS9A 4BMZA 1SVMA 3QVMA 2E4ZA 4OXQA 1E8DA 3L8DA 2A9KA 4PZ0A 2YCLA 4QGBA 3DDNA 2IIVA 1BIFA 1RHUA 3KZXA 3UAZA 3ID6C 3I30X 1WCIA 4K2HA 3ZY2A 4CMBA 3R3SA 1PTKA 4BMPB 4B4DA 1TCVA 3DDZX 5DNEA 5HF9A 1RAFA 3P27A 2EZUA 5PNTA 2YC4C 4B75A 2KE5A 3VNSA 4N54A 3DOJA 5BR1A 1XNRB 2HBQA 5DT9A 1QX4A 4LOAA 2JK0A 3B1JA 2JC3A 3W6OA 3ZIUA 10MHA 2FZLA 1BXRA 1PU2A 2WNSA 3ZI0A 5FTWA 3EGIA 3RS2A 3QE9Y 3H4VA 4JL6A 1SRQA 4NR0A 3LZCA 4G9GA 4ETIA 3CH6A 4DCGA 1UKAA 2GBFA 2WQZA 3KNZA 1J49A 1JXOA 2OENG 2DE0X 1LBQA 3A9TA 5F77A 5HEKA 3VR2A 4PHTA 4EEXA 1QH8B 2OQ2A 5L3RA 3ORRA 3PU6A 5JZBA 4YREA 1Q0ZA 2IKQA 1RSZA 2YH2A 3LXMA 2GTIA 3OFSA 1ZH6A 1ZQ9A 4LA4A 4RMHA 2WJHA 4J1QA 2VNIA 3KEOA 1KZ1A 1NL3A 1X9GA 1EE1A 2QN1A 3AB7A 3GGPA 2ZVPX 3I45A 3V80A 1YS4A 4NDNE 2WIBA 4PVCA 1YRLA 3VGPA 3ILSA 1UQTA 4RBNA 1XZJA 4TSKA 4Q03A 4DCPA 4BX3A 5GAJA 2GD6A 1UJ4A 1XT6A 4R41A 3SDSA 2ESRA 1OREA 1AQJA 3G0HA 4ZV9A 2ZYWX 2OBBA 1F3OA 3NYQA 5EPOA 2WTAA 3WK6A 3OZ7A 3DMDA 3S2EA 4OI2A 1PL8A 2BFFB 1KYTA 3VTAA 3EXFA 4U0KA 1PK8A 3VSEA 1NP3A 2YXPX 4WJLA 3CFYA 3ZX4A 3DXZA 4NL4H 3VU1A 1AMUA 3RU3A 2B78A 1LB1B 3F5SA 1H65A 2CYCA 4RELA 3LQ1A 3RYFA 1JEEA 1AZLA 1KOFA 1KFKB 2ZTUA 2VAXA 4ZCQA 4A8HA 5LQUA 2CNLA 4ZU3A 2I71A 3EWSA 2AQ8A 3COPA 2NZ2A 4FFOA 2RMKA 4OLJA 1AGPA 3C7DB 1GTSA 5CDSA 1NJ6A 5KYKA 4XUDA 4C3OB 2HUPA 4NDZA 3W5VA 5E2BA 4XR9A 4KGXA 4EGSA 2Q3LA 3RTDA 3NCTA 3CVYA 4P5EA 3ZQJA 2GKSA 3CMMA 3FCCA 4DLWA 4J03A 5CFQA 1P1BA 4I4IA 5AJWA 3AW8A 3T1QA 2NU7A 4YI5A 3L7LA 2XB8A 4Z3KA 2GB4A 4H3VA 3SY8A 3ESRA 3T12A 3NC4A 1OXBB 3H4IA 1BJKA 3HBJA 4OI4A 5HX7A 4QNRA 1G7SA 1VOTA 4GSKA 2V59A 3IB3A 2OD7A 3SC2B 3RYCA 5SZIA 5A1TA 3I5XA 1DIHA 2J46A 2RD2A 2WMDA 2Z04A 4IS3A 2IHZA 3V1MA 4H3KB 2IEIA 4U1RA 3V8VA 4EG6A 4Z3OA 5DCYA 3IEIA 4OB6A 2GN2A 4BQOA 4GSYA 3I61A 4L4ZA 2GEDA 1XRQA 1CF4A 2O1SA 1ZIXA 1Z47A 3NETA 4AO7A 2YFKA 3EBOA 1P0QA 2X7JA 1SXQA 1JEYB 4XFKA 5BPHA 1GEEA 3H83A 3HKEA 5KOIA 5B1EA 3VYVA 1PUJA 1HO3A 4KJZA 5KQGA 1U2PA 1N5LA 3NBZC 3C3WA 4JJGA 4RF2A 3SP1A 2UVPB 1CJUC 5E4YA 1WP9A 1M2VA 2CHEA 2XW6A 4C29A 1BMDA 3GFOA 3H2JA 3I01M 3MWDB 3II6X 7YASA 4W8OA 4MROA 4TMKA 5JMTA 1P45A 4HBZA 5C53B 4QBHA 2L82A 2VWGA 4DA6A 1JFSA 3PHIA 3HNOA 3AV3A 2X77A 2O2ZA 1NVUQ 1JJAA 3FPGA 3ILHA 2OY0A 3O8NA 4J3FA 4RZHA 1UBJS 4GECA 1LJ8A 3I4FA 3LVBA 4V3CA 2LKCA 5F12A 5LB4A 4S1TA 1KJYA 1QG6A 1W1IA 1Z8NA 2ZIXB 1F51E 3WGLA 4XD7A 3ER9A 5IDYA 1X87A 5KS2A 3E2PA 2PL1A 2JD1A 2X6RA 4UCWA 5KYYA 5IX8A 3DV2A 1WUJS 2N46A 3D0OA 3OBIA 5TS3A 3NPMA 3TSWA 1MMFB 4HNSA 1NRIA 2NO7A 3PVSA 3BM5A 3VR5D 4EG4A 3VAZA 2H92A 1JR4A 1S6YA 2P8SA 5C7IO 1R88A 1CUAA 4H1VA 3T1OA 5DH9A 3ZI7A 4CLEA 4LE2A 1L4BA 2CMHA 2ZYAA 3SVTA 3F3SA 3HVJA 4OM8A 2JI7A 3CSSA 4MV9A 5KSYA 3I9KA 2V96A 3EEYA 4RENA 2FMKA 5CVDA 5A3QA 5LQRA 1EA7A 3C87A 4G56A 3I01A 1ZG3A 2ZPAA 4YRAA 4JJZA 4D0NA 1P7VA 3JQ7A 3CEHA 3KD3A 4PW0A 4PX5A 4X44A 3H9GA 1XOIA 3GXOA 2AOTB 5E1DA 1AVTA 3L6BA 1DRVA 2HKIA 4OJKA 4P7GA 1I1QB 1U2GA 3GLIA 4PGGA 1QGED 2GFQA 3RHTA 2CL7X 2I6TA 4LMPA 4OG2A 1QFMA 4C5AA 4Q05A 1UQRA 2CLSA 3PNOA 1YE8A 3MLAA 2OVBA 4R1NA 4P93A 1QF6A 2P5UA 1G5RA 1QG2A 2VBCA 2VXOA 4XUGB 3LZDA 5CVJA 4W1PA 4PPQA 1UJCA 2PMEA 4EKYA 3LK7A 2OAEA 1DIRA 2RHOA 2VWPA 4HLUC 2PE5A 1WF3A 4PGFA 5EP3A 5HBGA 1NJFA 1Z5UA 3E15A 4AP6A 1RC8A 2QLNA 3HFGA 5FO0A 2QZZA 1QRUA 5KQLA 4F5YA 3ZJ5A 1MJHA 3DEKA 2O7QA 2R8ZA 1UBGA 5KNBD 4TWRA 3GLRA 3I9NA 1AKNA 2NZJA 1Z73A 3MJVA 1AZWA 3LPNA 3D81A 3OY7A 4KODA 1YKSA 3AOGA 4GOMD 4C7OB 4ZI3A 3GPCA 3I0MA 3OFND 3PC6A 3MAAC 3V4VB 1AKWA 1DP4A 3UJ7A 3GNQA 3VR1A 1D07A 1A1VA 2E0IA 3BWDD 4R4JA 4A0HA 5WRFA 3SEFA 1I2ZA 3CKYA 5DTRA 2I7TA 1B0AA 1TUEA 2GHQA 1MAUA 3ZVNA 1J90A 3QPCA 2HHHB 3IUJA 1WM1A 2FR8A 2PX0A 2OWEA 2DRIA 3SSMA 2XRMA 1OCEA 4JYCA 5CT8A 1QHHB 1K6MA 3NEPX 2MCFA 2HPAA 3FPJA 4G89A 1E98A 3AMVA 4MKIA 1DCTA 3WKCA 1YFLA 2QY6A 2MSLA 2Z5VA 1RZVA 4H7JA 1W1UA 2OLJA 2XUHA 1SKAA 2Y4OA 4LJRA 2CHVA 4NMHA 3UHOA 2HMAA 2P8JA 4R31A 2YVUA 3LH5A 4J6FA 2BKXA 3QQPA 3A3YA 2PH7A 3O95A 2NO1A 1JFTA 1OIXA 2XNDA 3COWA 1KY2A 4O2LA 4IJKA 3RWOA 2WFLB 4GAEA 5CLIA 3U4HA 4M8SA 2FMIA 2JDIA 2F90A 3E48A 1NQOA 4AICA 9LDTA 3GWZA 4YRCA 1YFKA 2XXJA 3LNTA 5AJZA 5IJXA 3RS8A 5ISMA 3RIGA 5IKOA 5LMNB 1K06A 4KK3A 4EABA 1RAGA 1MAWA 1V3UA 2Z8YA 4DQDA 2OMKA 2PKXA 4MIEA 4L5JA 4RQTA 3VHXB 4DGSA 1IXSB 4E3ZA 1FRVA 4ZIRB 1NAHA 1SNYA 3S70A 4OP1A 3HADA 1BE8A 2FEAA 3DTVB 5BR8B 4ZJYA 1I6KA 2HH9A 2J30A 3OZDA 4BFWA 3S68A 5BMVA 1RQ7A 4OAQA 3V9AA 4IX1A 3KBBA 4LV8B 4MULA 1IEVA 5JARA 5ECWA 1MC1A 3EUFA 3DDOA 3RVQA 1Y1PA 2HRQA 3FHCB 2AEFA 3IOYA 1SUEA 3KXIA 3MEQA 3HCFA 4O3FA 3G89A 3RTCA 2XWPA 2XUKA 3KJZA 3DBVO 1QIKA 5TS2A 5ALJA 2YN4A 2C95A 1ECCA 1A9PA 1CDDA 1I9GA 3SF0A 1A5AB 1QYWA 1KOLA 3ZGZA 3PRJA 4ALKA 4QNNA 2QUHA 4Z2AA 1BD4A 2PBLA 2NZWA 5INTA 2NP7A 4KN9S 2O3RA 4D92A 2NQ8A 5LKRA 2FCAA 1E3SA 3KELA 1V11B 1W29A 3IIEA 4MRAA 4YJ2F 1F9AA 2FG6C 3Q0EA 4HLUA 1ECBA 3TCNA 2IYYA 3HCOA 1NJ2A 3OKAA 4RIIA 1U5AA 3KFXA 3B3JA 4RPKA 2XR1A 2AOTA 2B20A 4X97A 5DTMA 4LI3X 2DY0A 3B82A 4MNTA 2Z4TA 3T9CA 1YC5A 1VE7A 3OF2A 4GP7A 1PFWA 4DKXA 1CNFA 1C9JA 1KC1A 1YGPA 3MUEA 1NV9A 1V5EA 3AUJB 1Y7HA 3BMQA 4Y3UA 1JECA 2COKA 4Z7JA 2CY0A 4ZEXA 5AVXA 1A98A 1MW9X 3U62A 2CZCA 2I1VB 3AF0A 5LBIA 4EY7A 3W6UA 4F2GA 1FNDA 3A31A 1L4EA 3N2LA 4IEIA 4PZ9A 4WBXC 3EVBA 3OOYA 3UGTA 2GN6A 5KVVA 3FYHA 1E60A 2SICE 5AM3A 3T3PB 4Z4HA 1MCZA 5LMUB 2OM2A 3ESAA 4NCNA 2B1QA 4GM4A 4MGEA 4WOKA 1L4LA 3I39X 3DT9A 3LC2O 1EWVA 4TMWA 2WJWA 3OE7D 5B2ZA 1BWSA 4JL5A 4K46A 2LIVA 5EJ2A 2GCGA 1O4VA 3RIEA 1WQ4A 4F56A 1W25A 4IDOA 1AIPA 4HH1A 2P2SA 5DX8A 5ADWA 2XTAA 1Q0TA 2KWIA 4Q9HA 2N0SA 4G07A 1NM5C 1E94E 2AQIA 1CF9A 3BTOA 4CMKA 2HA5A 4NXMB 3G0IA 4YACA 4XPZA 1JLLA 4ZOLB 4X90A 3UJHA 1UWLA 5K6AA 4UE2A 5AJYA 3VO2A 4KV7A 4LK3A 4M0KA 2QVLA 3OA0A 3VVCA 2WT4A 5AXCA 3NCHA 3RE1A 1D9XA 2W2NA 2BKLA 1K6XA 3STUA 1SB8A 2IDMA 3EXIB 1W88A 3A6DA 2CNWA 3KXKA 1T36A 3KLMX 1G8MA 1NKTA 1ZJ5A 2LV8A 2ZYRA 1G1AA 3NWPA 4RDXA 3K9GA 4HDCA 4ENTA 1NF3A 1NR7A 1SG0A 5DW3A 3IKTA 2QTGA 4IIBA 1QC5A 3MG9A 3ANLA 1P9OA 1SHUX 3S3TA 2GCOA 2CE7A 4K9MA 4LCJA 4OFBA 5BV8A 2EL9A 2M6SA 3DHYA 4YRIA 1GFWA 1AURA 2PSHA 3KR2A 2RHRA 3LYHA 2FFRA 5L51A 1IHXA 5HIIA 1TLFA 1MN6A 5HILA 1G7TA 2H9AA 1PNOA 1BSVA 4C07A 2AZ4A 6ADHA 5CFMA 3FSEA 5KREA 2OXIA 2PKCA 2VLBA 3AZPA 3BCUA 4MXDA 1IN4A 1MKYA 1WA5A 2H18A 2YZ2A 3I9FA 2G1JA 4JKYA 4ZRDA 4EI8A 3TNDA 3EEOA 4Z6KA 2I6QA 3WIDA 4LAFA 3O0TA 1XN4A 4LGMA 4ITRC 5FRDA 3KZCA 1XXHA 4BRZA 4HZIA 3PGA1 2X14A 3LGAA 1K0UA 2EARA 1C9MA 4KH1A 3WLMA 3T52A 1Q2UA 3UN1A 3WJ2A 3MT7A 4B5LA 3TNFA 1TAHA 1VKNA 3IEXA 4QDXA 4R1SA 3C70A 3LKVA 3FMVA 2AC2A 4RM2A 4UVHA 4WJZA 1IN7A 4F6RA 3RS3A 2EGGA 5M3BA 2O2SA 1B26A 2BEUA 3KUCA 4RGQA 1A72A 2DH6A 4XYEA 5DI3A 1CQIB 2IFTA 3K1AB 3F46A 3ONDA 4G85A 4J0HA 4Y6OA 2OZKA 5HMMA 5LFAA 1ZJWA 2CYAA 2WMNB 5CDYA 3B9PA 2HJ9A 2OA0A 4JWKA 3ESYA 4K9NA 4YV7A 2C9BA 1HQKA 4RIHA 3QG5A 2QKYA 1H22A 1THGA 3DWEX 1T2VA 4V0LA 4DKJA 3RK0A 3Q6MA 5JS1A 5B5SA 3NTLA 4II7A 1OT3A 1LQTA 3E70C 2JDID 4K3UA 2G07A 1N2IA 3R0IA 4L8VA 3IV7A 2BWJA 5A03A 3W90A 2PT5A 3HLKA 4IUDS 4OKNA 1O0SA 3RTAA 5DXAA 4Y2GA 1E9SA 1SIBE 2JFHA 1Y9ZA 4N9QA 4ECEA 5AVWA 1WZCA 1SOUA 4IUYA 1G3QA 1RRMA 5IWCA 3RIXA 1EINA 2BZ0A 2IS1A 3UKDA 1CXZA 1H9BA 2A33A 4CHTA 1U0FA 3LBYA 4QWWA 4Y2VA 5LJLA 3FWPA 2HLHA 3AB8A 2JFWA 3RVOA 3W3AD 3BWMA 2XVAA 1FJXA 4IIFA 1DT3A 3Q15C 4ZT3A 1EFDN 5FX2A 1BHQ1 5KHAA 4Y2SA 3UVEA 1NNEA 2WJ4A 1I5OA 2QK4A 1G16A 3PQDA 4BVKA 2O3QA 4GVLA 4M22A 3Q3EA 3LLUA 2V03A 4R3NA 4BFUA 4KR7A 1IZZA 2ZI5A 4BTLA 1T4MA 2QMUA 2R9VA 4KQKA 4WV3A 2ACWA 2O8BA 3NWBA 4DBLC 4D43A 2P9HA 2QGNA 1F0KA 3LD9A 4X7PA 2D06A 3UJPA 3WJAA 3NDJA 4L74A 3R40A 5KWVA 4FCWA 4EJMA 2GZRA 4E22A 3DD5A 2OBNA 3X1DA 4YJ2B 4ZT6A 4BO9A 4QATA 4I4TF 2ZTMA 3ELDA 1U5CA 4BFTA 1W76A 3BFPA 5C1PA 2QL5A 4IVRA 4JP5A 3IP5A 4YV0A 4Q5IA 2PMDA 1L5LA 5I45A 4FR5A 2JGAA 2ZI9A 2IELA 2C4UA 4MICA 2QSZA 2CXSA 1YQWA 2FX3A 4HNGA 1HE3A 1NHGA 2PK3A 4F9EA 4MIKA 4PRYA 3FHJA 2F3SA 4MGKR 1JTVA 4O5OA 1I4TD 1YBFA 2OXCA 4BNFA 1GM5A 4YMGA 3VNVA 1P2UA 4O2AF 2OMEA 1QC5B 4DLUA 1ARZA 1RYZA 2NT4A 2NVWA 2GM4A 3L7KA 3KXPA 4Z0PA 4NSNA 5TF0A 4CE6A 3QEAZ 2E49A 4HNUA 1VHWA 4Y67A 3R44A 4EI2A 3FYUC 2BH9A 2ZI3A 4TVBA 1C1XB 1N5DA 2DFTA 3GFVA 2FMFA 3TW4A 3GUCA 1BCRA 1KR5A 4RSGA 2RB5A 3KSZO 4N65A 4IVNA 3NDPA 3LDHA 1E18A 5D3QA 3W5UA 3HWSA 5C81A 4JBLA 5JXWA 4JP3A 2XRYA 1TCBA 1JP7A 1KWKA 2FPRA 1XALA 1JG6A 4EUSA 1QLHA 4W7IA 1J5EB 3QTLA 4KAAA 5A02A 3R9XA 3LC7O 4IJQA 4JHXA 3OZRA 3T7KA 5J4VA 3ZE1B 3BJEA 2GWRA 2E4AA 4NECA 1PDOA 4WZ6A 1C1HA 4RD1A 4KQMA 3LYAA 1SXJB 1Q1NA 4R2IA 3GQBB 3MYYA 4G0VA 4LRQA 1BZYA 1IXZA 1SWWA 1U9IC 3DP9A 3FOBA 1FDVA 2ZJ6A 3S81A 2X0JA 4YWJA 2XCSB 3PUKA 3QTTA 4RA9A 4DIDA 5ED0A 3S4YA 3E3LA 4IGKA 3CN9A 2EJCA 2PTGA 2VH1A 3OQBA 2E4XA 3C5VA 2GVNA 3M34A 3TKYA 3TVDA 4W5JA 2FZWA 1IU9A 1JDVA 3B2QA 4ED9A 1R6VA 1QE0A 1AUQA 3QPAA 4RL4A 4YP7A 2CE2X 3ILYA 2H16A 2ZB8A 1B42A 1I3MA 3HN6A 4QYTA 3V1LA 1BKSB 1JPJA 3LCVB 1UBMS 4XE5A 1UWCA 2RH4A 5DYGA 3IPXA 4BE4A 3UC5A 2GPJA 1AKUA 1BFKA 3RUCA 1S2NA 4RK1A 3WMEA 3KSBC 2ZSJA 3PF9A 1RCTE 2PLFA 4HXYA 4IF4A 4P83A 4PFKA 2JVJA 3ZKWA 4I66A 4R2XA 1D1QA 4F45A 4JOBA 1RADA 3WQRA 1K63A 4R54A 3K94A 1D6NA 3D6HA 1XR3A 3R3XA 4AYXA 3V4ZA 4LNUA 4NNOA 4P82A 4XWTA 1ECLA 4GE0A 2N1BA 3LCJA 4NJMA 4WFQA 2QX7A 2FJPA 4KR6A 4CQLB 2WHQA 4L0CA 1WRBA 3M6XA 2ZRMA 5BSUA 1VKOA 3EQ2A 3QNMA 4EH1A 4QWMA 5IJ9B 1PFVA 3A14A 4NH0A 3HJAA 1I4OA 5TE9A 2R5WA 5AQEA 2NZYA 3OFKA 2JIZA 1CCWA 5JPIA 3ZQ6A 5JSZA 1RAAA 1UKZA 2AFIA 1F2UB 1G5HA 5AXDA 4BWGA 4US1R 2Z3WA 2J09A 2NXEA 3ENQA 4TV9F 2PKQO 3CPHA 5F78A 3PC8C 4C01A 3DL2A 4BO4A 5I7RA 2LXNA 4LJ6A 5DOZA 1DC3A 4EZIA 1B23P 4HD8A 5FLKA 5I7WA 2GUGA 1GN9A 4O1IA 1NBAA 4ZMSA 3UAWA 4JBGA 2EGUA 4B7CA 2IYNA 1DDOA 3MELA 1HT2E 4KQ2A 4WN3A 3N6VA 1XRJA 1T9GS 4NATA 5JMWA 1PQPA 4B48A 3AESB 5EJ8A 1E62A 1YOVB 2V6IA 5AESA 1VJ5A 3JS5A 3PIRA 3W5AA 2PWAA 3KFLA 5EIOA 1RKQA 1WCYA 1C0KA 4KXQA 3HCNA 2EFCB 4XVCA 4KDCA 3AJEA 1KAOA 2FSPA 1GTL1 2NUBA 1TJ5A 2V58A 2HU2A 3NLLA 4N0DA 4TKUA 4I9NA 4ZYZA 3I2KA 3I23A 2JHAA 4YAFA 2OVFA 1NNLA 4YJ3F 5AVYA 2I9KA 2P6OA 2Y1XA 5IDWA 3WYNA 2XKJE 4FYJA 1QIDA 3F5MA 5EMJA 3RSZA 1N0UA 4G81A 5FPQA 1Q16A 2AR9A 1H2XA 2NN3C 1KK0A 1JX6A 4OKSA 4X92A 1M8JA 1CE8B 2P69A 3ENZA 4C76A 4AY5A 4LSWA 4YRKA 3I73A 2NTNA 1FU8A 2C7VA 2BY4A 2CXPA 5BW8A 5DLEA 4M8LA 2Q6IA 4DSAA 4MA5A 1U2RA 1X9HA 1Z0JA 2XE4A 4S3MA 5DHUA 1VKRA 5EJ5A 5JI2E 3ZJVA 2A9VA 3H1BA 3PVCA 2JZNA 2QXUA 1Q7RA 3R1IA 4YROA 3ZDQA 1RYNA 1E3EA 2Y1EA 3HACA 1YIOA 3U40A 1F8FA 1YI1A 3TZCA 5A4DA 1DI0A 1Q2XA 2DUNA 1DCKA 2H54A 3KJXA 4WXHA 5I4CA 5M34A 3AEZA 3EIUA 5IKPA 3R9KA 2MSEB 1YULA 3FCSB 4LPKA 3VSBA 1RWMA 3D7SA 3WIVA 4RHTA 1Q95A 4EKIA 5BP7A 5FR1A 4ENPA 3PUWA 3NQ41 4QICA 3I37X 1SXJA 1TA4A 4FFSA 3KUKA 3T5PA 3FETA 2P2GA 3D1VA 1R15A 5FI5A 2FPKA 5KYGA 1R37A 2H1FA 3EXG1 1W1WA 1E2PA 4WGFA 3AUUA 5SYMA 3PXEA 3DLIA 1NRXA 3T7CA 1SCIA 2F1HA 5GJCA 2O8EB 2QVCA 2XTJA 3GL9A 1SBZA 3L43A 4QHSA 4CR6A 1WV1A 4Q1VA 2QAGA 1XZMA 3WMXA 4D82A 1LDBA 4G5RA 3H5NA 3ZS9A 3GLIB 1GA4A 3ZU3A 1WCIB 1U2EA 3TQSA 5AW7A 1XRMA 1IHOA 1JSCA 2DPGA 3FMPB 4JS0A 4NS1A 5E9JA 4DJAA 4F8YA 3KQNA 2VHWA 2G28A 5HSGA 4L1KA 1U6IA 4KXXA 3VNQA 4YT2A 3FR8A 5KYXA 4DIKA 1EUCB 4X7MA 1DDIA 2Q9UA 4O4JF 3L41A 2IC5A 3C5HA 3EY9A 2PU7A 1R2QA 4CF4A 2RGGA 2PO7A 4L9AA 4M37A 4MQLA 3VVBA 4BRWA 5CBPA 4DC1A 4NJMB 4LCEA 1PE0A 1WZUA 5EY5B 1ZHFA 3LCMA 2I2CA 3B6IA 3NWOA 2C94A 2QT9A 1CJBA 1P1RA 1XF1A 4BQNA 1YA6A 3KX2A 2J3KA 1QHFA 4G1FA 4HJRA 2EP8A 2I2WA 2V1XA 3GJ6A 3KSUA 1ULSA 1K75A 4PFQA 2ZXUA 1EXWA 2ONKA 3C8MA 4Q15A 4E5UA 2AN9A 1C0IA 2H1VA 2QLJA 2DR3A 4DR1B 4US2R 3VHRA 3BRWA 3OKCA 3MMNA 4OQEA 5DNCA 1CR4A 2A0YA 3JW8A 1E0AA 4C03A 4KFUA 1ISMA 1IG0A 1HDOA 1HQDA 1ONSA 2HMTA 1NYLA 2VR1A 3DVSX 1YRQA 2ZJ7A 2CJFA 4LRUA 5T8KC 4QYIA 3ZLTA 4R2KA 5EJIA 2FQYA 1T24A 4MW1A 4BJ5A 2XE6A 2UUPA 3CCFA 2DLNA 3DF7A 4IEEA 5P21A 3QJYA 1RKUA 2W7TA 5ALTA 2AF4C 2W43A 1BFDA 2DHRA 4JJ7A 5JZSA 5DP2A 4G4SO 3KDPA 3PEWA 1L5GB 2D0PB 5J2TB 4D9HA 1XNGA 5A3JA 5CYOA 3RQSA 4B3IA 1CUXA 4D98A 4CEIA 2QIPA 5AH0A 5ITWA 3K35A 1Y9EA 4F4HA 5F7XA 4E2XA 4I55F 1OWPA 2R8EA 1N92A 1ESZA 4MUGA 2BFCB 1R4MB 2VTDA 3EHEA 3ICVA 3GRRA 1FRNA 1X94A 2X7HA 4JCCA 3J81A 4W1RA 4C7JA 3BRQA 1I6MA 1YS9A 1L5SA 2ZJAA 2P67A 5ICSA 5A0FA 1T0PA 4JSRA 3TL2A 5B53A 3U3XA 1L5FA 2CVFA 3VJRA 3A4LA 3IJEB 1KJ9A 1P2TA 3WHPA 5BNZA 1H2EA 5CLJA 5BR7A 3PENA 5AI4A 4RZXA 1ZVKA 2FRDC 4EFMA 2PMBA 3BL5A 4DA8A 2XUOA 3PQ7A 5JFOA 1XQWA 4UM5A 5B4TA 4RTOA 3FB4A 3H5TA 3WMGA 3ZU4A 2CD7A 4FYYA 1EFTA 5LWHA 1FP2A 2AV6A 2FX2A 2QRVB 4G25A 1L3IA 4R0MA 4HQKA 1Z5ZA 4LZAA 2DTEA 3ZY6A 2ORVA 5HOEA 1G9SA 1L0BA 1COWD 1E3WB 1VFPA 1OAOA 2QGZA 2QZSA 4UEKA 2WKPA 2QGFA 1RAIA 2H0AA 2PFGA 3RROA 3W3AH 3E05A 4PG8A 4HNVA 2BONA 2JASA 4P80A 3VQTA 1KI4A 1M72A 3WBKA 1KOGA 2Q0XA 5KAMA 5D5QA 1MLDA 1U9YA 2H48A 2QX6A 2A3RA 3WGJA 3VDQA 2ASEA 3STYA 1MEJA 4HNQA 3M89A 4ISCA 2Z6QA 2R7KA 3U5TA 1ZNXA 4M2LA 2ZSAA 5AMXA 4J4TA 4UUPA 4DJJA 1LTHR 5AI9A 3ETJA 1QBKC 2Q4RA 4NV0A 1XEXB 2B8NA 2JJQA 3DMPA 1WVIA 3ZE8A 1VL6A 3K9WA 2Q1YA 5A0TA 4EGFA 3EX7C 3RRZA 4FJ2A 3HGQA 2B83A 1FXWF 2B4RO 3BZBA 1IM8A 1JKMA 1WLYA 2P2NA 3MWDA 2C5FA 1PSZA 3O1LA 3ZHRA 1YACA 1JHMA 1Y8RB 3RK1A