5SYMA

Cocrystal structure of the human acyl protein thioesterase 1 with an isoform-selective inhibitor, ml348
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
223
structure length
223
Chain Sequence
b'TPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-protein thioesterase 1
publication title Molecular Mechanism for Isoform-Selective Inhibition of Acyl Protein Thioesterases 1 and 2 (APT1 and APT2).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 76
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.1.2.-:
pdb deposition date 2016-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5symA00
1XZDA 3AILA 1XZBA 3C8DA 3WKAA 4NZZA 3HRHA 3F96A 1GQSA 1CVLA 4KRYA 2WQZA 1YR2A 4FBMA 3M82A 2OQIA 4G9EA 4Y2JA 3D2AA 4KJXA 1I6WA 1XRMA 1LPAB 4Q3OA 3RM3A 5CXXA 2Z8XA 3G8YA 4JUIA 2WUEA 1ORWA 3BIWA 1UZAA 2VJCA 2I3ZA 2OG1A 4MQLA 4AXBA 3QPAA 3AUKA 1ACJA 1LPSA 3F98A 5DYYA 2XUAA 5AOAA 3JYHA 3G0CA 4JEIA 4ZWNA 4AO7A 4ROTA 2WFZA 2ORYA 5DJ5A 5ALSA 4I3FA 2QT9A 5AKEA 3VJLA 3U0VA 1UOPA 1ZIXA 2CB9A 1KEZA 4G8CA 1TQHA 2QXTA 2ZYSA 2XUPA 1HKHA 1XRPA 4B9AA 4BZZA 5ALYA 3D0KA 4X95A 2AJ8A 4DNQA 2BKLA 1AC5A 1CUSA 1GKLA 5AH0A 5A7GA 1QGED 3H17A 4A16A 4G8BA 3DJYA 3DD5A 4BDSA 3VXKA 3VVLA 2GZSA 3I1YA 3IBTA 4N8EA 1R9NA 4MWSA 2JGJA 2JGLA 1EK1A 2I78A 4F5ZA 2WIGA 2G5TA 3STVA 3C5WP 2FUKA 5AI9A 5AHXA 4B84A 3ANTA 1ZI9A 5ALUA 5FDFA 5C7YA 4Y2PA 5CT8A 4H77A 2GBGA 3K2IA 4BAZA 1TIBA 3FYTA 5FLKA 3I2GA 1GZ7A 1P0IA 2BGNA 3KWFA 1NU8A 2B61A 5CW2A 4KACA 2JGMA 5LIPA 5HKBA 5CH5A 2D0DA 3GROA 5AKGA 5HF9A 4ITVA 2PPLA 4W1QA 1W6RA 2H9YA 1W76A 3I2FA 2DQYA 5DNUA 5ALTA 3TEJA 2BAGA 3ESCA 4OSEA 4AO6A 5AKZA 3E1GA 2JGEA 2WFLA 1YS1X 1W4LA 2XUDA 3QITA 2BJHA 2OAGA 1BEEA 1YA8A 3FCXA 3H2JA 1KU6A 1F6WA 2WU4A 3BXPA 4FWBA 1H23A 3FVTA 2XQFA 2ZSIA 3IIIA 1CQWA 1QIHA 5FPQA 3WKCA 1CUCA 4OPMA 4YX9A 2HA4A 4DMKA 4Y2UA 5I7UA 2CBGA 4V2IA 3KSRA 2GBIA 1XZIA 1FJ2A 2C5FA 3DKKA 4HVTA 4PV7A 5JD5A 3EQ9A 1TKRA 4C01A 3A2LA 3HJUA 5CRIA 3BDIA 4QDZA 1UT6A 2RHWA 5ALHA 2WJ4A 3DOIA 3RK4A 1XKTA 4Y9SA 5AM1A 2J4FA 3IA2A 5ALQA 1NX9A 2YYSA 4W63A 4DMFA 5ALMA 1CUUA 2WUFA 3PF9A 3ZV7A 2WIDA 4LXHA 3QZUA 4X7BA 4FLMA 1Y7IA 4GXNA 1VXRA 1FFAA 1UOOA 4H7IA 3SX4A 5ALXA 1ZD5A 1Q83A 2PX6A 2WTMA 3NGMA 1CUEA 3PUIA 2ZSHA 1ZJ4A 4ARBA 3OTQA 1AQLA 5AO9A 3NWOA 2XUHA 5ALNA 4KE6A 1BU8A 1DU4A 1A8UA 4UBLA 2B20A 3KXPA 4G9GA 2WHQA 1TCCA 2XLCA 1MN6A 5HFNA 2ZJ7A 1K8QA 1XZGA 1VE6A 4KE8A 4X6UA 1X2EA 1CFJA 1LPNA 3QMVA 3V1MA 2DQZA 2LIPA 4BBZA 3H0CA 1E8NA 3EQ8A 1JKMA 2WFLB 3G7NA 2QJWA 2OXEA 4X00A 4J0KA 4B82A 1P0QA 3QYJA 4Y7DA 4G4IA 4B6GA 4WY5A 5EHQA 1R50A 3H1BA 3G0BA 5LYYA 3V9AA 5A6VA 1JI3A 4IO0A 1J07A 5LZ2A 2X8BA 3C8HA 1H2WA 4K2AA 1QTIA 3D59A 4N8DA 1R3DA 3F67A 3FLBA 1XZJA 2BGRA 1ZGBA 5JZ9A 5DNVA 1WCYA 2WIJA 5AKJA 1CUWA 4A23A 3ILSA 4WFJA 2WTNA 3K9BA 4CCYB 2HFKA 4HXEB 5LP1A 1CRLA 2XQGA 4MEAA 1KU0A 1ODSA 3BDVA 4Y2SA 2HU5A 1K5PA 3WYNA 5C8XA 1DT5A 3V48A 2CEKA 4TGLA 4IH9A 5CMLA 5AOCA 2QUAA 1L7RA 4MYDA 3C6BA 4H0CA 3DNMA 1GPNA 2QVBA 2O7RA 1UK7A 1ZIYA 1EVEA 3NUZA 1YB7A 2OPHA 1FFDA 1CR6A 5CT9A 1JU4A 3F9CA 3ESDA 1VXOA 2OCGA 4OYLA 2EDCA 3F97A 1CUZA 2JBWA 3PF8A 3I6MA 1DT3A 1K63A 5JAPA 4UFNA 5IVKA 3CN7A 2XT0A 3KDAA 3OG9A 4UBJA 4AO8A 1TK3A 3WK9A 2O2HA 5JAUA 1X2BA 2X5XA 3R3VA 2QRUA 4ZXFA 2HRQA 2OQVA 2Y2UA 3RKSA 1EVQA 3HZOA 5LZ7A 3R3XA 2IITA 3HXKA 5FKJA 1CUVA 2R8BA 5JAHA 1CPYA 5HF8A 5JATA 2QXUA 1R9MA 5AIBA 2WUDA 3VDXA 2VAVA 3B12A 4OB7A 3N0TA 4AB1A 1ZOIA 4J0JA 1ZGCA 4FBLA 1Q0ZA 4CG2A 1HLGA 2WG0A 4DNPA 5FV4A 3PFBA 1AUOA 1CIJA 2CUTA 1MPXA 2WHRA 3DYIA 5T4BA 2QUBA 3WIBA 1YCDA 2ES4A 1VOTA 3WZMA 4X92A 5ALZA 3DS8A 3F8SA 5CBKA 2O2IA 1MX9A 3ZLUA 2XMZA 4AZ0A 3DYVA 1N8SA 4C89A 5FP0A 2PU7A 2ZYIA 4H35A 2WKWA 3I2HA 4W9RA 1XZLA 4BZWA 3SWWA 1OXMA 1GGVA 5YASA 2PSFA 1YAJA 3M3DA 4XJVA 1L7QA 3VJKA 2PUHA 5AP9A 5LZ9A 2Z3ZA 4M0FA 1UKAA 5AM0A 3E0XA 3O9VA 1U2EA 1CUIA 3AIKA 4MYSA 4H7FA 4LIPD 5AKLA 3AZPA 1AZWA 4BVKA 3IUQA 2GYWA 2C7BA 4H7JA 3G9TA 1MAHA 5JD4A 5I9IA 3KOOA 3DDUA 5D3ZA 5K5EA 3MGAA 3WJ2A 1CEXA 1QO9A 2QM0A 1MX1A 5AM2A 4AMZA 4DGQA 2W6CX 3V1NA 4BC0A 3I1IA 2H7CA 4DMCA 2CJPA 2BCEA 4DNFA 4B83A 2PU5A 4ZREA 1QIDA 4Y2RA 3EBLA 2OCIA 4PF1A 3IB3A 3LCRA 3W04A 5JADA 3OOSA 1XRRA 2OCKA 4Y2XA 1EK2A 4Y2VA 5ESRA 4J0IA 5LLSA 4KE9A 2RAUA 4P92A 4FNGA 3H19A 4LYEA 3JWEA 3WIOA 1O6FA 1EI9A 1QFMA 1J2EA 3BF8A 4EUSA 1BCRA 3D3NA 4ZI5A 5EIHA 3WK7A 1XZFA 1QO7A 4X6YA 2BUBA 3HYSA 1XZMA 5E4JA 3WMRA 4AZ3A 4N5IX 1E66A 3LIPA 2Y2VA 3WJ1A 1USWA 3Q0TA 4IQ4A 1UKBA 4QDTA 5ALWA 1CQZA 4HXGA 4HXFB 1SFRA 5K3EA 1XKLA 2DCMA 4HAIA 1UK6A 1QIFA 4OD0A 4C87A 4KRXA 2WU3A 2XLBA 4DYHA 1HQDA 3YASA 4J3JA 5LZ5A 4GLBA 4BE9A 2AJCA 4B81A 3STTA 1JMYA 4PQEA 2PKYX 2JF0A 3LS2A 4W1RA 2PM8A 5AJHA 4BCCA 1TRHA 2DHEA 1SOMA 2J4CA 5EFZA 2HFJA 4KAJA 3G0IA 4KYVA 4W1SA 4W1PA 4PW0A 3WYDA 1R4ZA 1C7JA 5AK5A 1OCEA 1H2ZA 4GBGA 2C4HA 1CUJA 2RI6A 4EY4A 1PJAA 2PBLA 4KEAA 2FJPA 4KR0A 4DIUA 3C6ZA 1MAAA 4BDTA 1E89A 4U2EA 4UFOA 1EB9A 1EXWA 4ZRDA 4UFPA 4GDMA 4HRYA 5JD6A 1XRQA 1A7UA 3SC2A 4KAFA 2QTBA 3S2ZA 3FYUA 3AZOA 5CTAA 1EB8A 5ALFA 4ZV7A 5BWCA 4RE6A 1AMNA 3W2TA 3DL4A 2WSLA 1E3QA 3C87A 1LPPA 3DL7A 1JJIA 2AJBA 4FTWA 3C6XA 2O7VA 5AICA 1XZCA 4DTCA 3AFIA 4S0XA 3FVRA 4U2FA 3WWPA 1K4YA 3HACA 1HPLA 3D2CA 4UHHA 3R0VA 1XZAA 2G5PA 2HA3A 4GHWA 1DX6A 5AOBA 4RPCA 3GBSA 2QKYA 4CIAA 1F0NA 3R3UA 4Z49A 3STUA 1WB4A 1T2NA 4MEBA 2B4KA 2WILA 1ZI8A 3CXUA 3V1LA 3KWJA 3OPMA 5JAOA 1ODCA 4E15A 4TPKA 1CV2A 3GUUA 1EH5A 4FLFA 1QONA 4EY6A 3FBWA 2QR5A 5AIAA 2XMBA 1WHTA 3G9UA 1K6EA 1BEZA 1GPKA 4DLNA 3L1JA 5AM3A 2DHDA 3DQZA 5DYTA 1R1DA 1SCIA 4GEGA 3Q8WA 3IUMA 1FFEA 3BE8A 4JYMA 5BOVA 3QH4A 4OUKX 1DINA 3T4UA 3FCYA 2PUJA 1CUDA 3BF7A 4C88A 2OGSA 4BCDA 1JFRA 5DYWA 3GA7A 3GELA 5FXMA 3WKBA 3EF3A 2WHPA 1QZ3A 2Y6VA 5AI0A 3PE6A 3FYUB 2HRRA 2G63A 1HL7A 4Y2YA 4FHZA 3H04A 4ARAA 2YXPX 3ICWA 1H22A 3WWEA 3FAKA 1IMJA 3O4GA 4D9JA 5ALKA 1O6GA 1IUPA 1A88A 1WB5A 5KWJA 4CFSA 2HADA 2ACEA 3WWCA 2J3QA 2WLSA 2VTVA 1YB6A 2C5GA 2C58A 2O2GA 3D7RA 1MT3A 2XMDA 3WZLA 5AK4A 4JNCA 5BWBA 5AKHA 2XMRA 5AKYA 3RLIA 3GZJA 4UBIA 3WKEA 5FUMA 4EB0A 4NMWA 2HA6A 1PV1A 5J3JA 1ORVA 2JIDA 1LPMA 3OC0A 4NVRA 3W9UA 1IUNA 1IZ7A 4QDUA 1M33A 4AMYA 4UBOA 4WDQA 3HLKA 3WKDA 3ESBA 5AKKA 4KE7A 1HDEA 4K5QA 5HFAA 1SCQA 3G9XA 4G8DA 4MJ3A 4J0DA 1N5MA 3AIMA 2HU8A 1L7AA 4OB6A 1QIJA 4DM7A 4X91A 1U65A 3WI7A 4IHAA 3CN9A 4XX1A 2WHPB 1IUOA 2H1IA 2GBCA 1MO2A 3DEAA 5ALVA 3C6YA 4RE5A 1T4MA 2WG2A 1AX9A 5K3DA 1P0MA 3VVMA 5EIEA 1DTEA 3V1KA 1BS9A 3ICVA 2EDAA 2XB6A 5EI5A 3G9ZA 1X70A 1BE0A 4M0MA 4MXDA 1VZ3A 3FSGA 2XUGA 1BROA 3G02A 4BAUA 1DWOA 2PL5A 3U1TA 1LNSA 4FMPA 5T4HA 2VAXA 1Y7HA 4J0CA 3I2IA 1VZ2A 1BN7A 1EDDA 1SCKA 5CT6A 3IUJA 5HK8A 5E4YA 1LPOA 3BJMA 4B7ZA 3A6ZA 4CG1A 3STYA 4U2CA 4FOLA 2WFMA 3FLAA 1MU0A 2VJAA 1VA4A 1ZD2P 4CIBA 2HA7A 4Q05A 3R40A 4IH1A 2RIPA 4ZGBA 2QMQA 4WCVA 4CI9A 1THGA 4RGYA 2BFNA 4FFVA 5AI4A 4WFIA 4DMHA 1OILA 5CT5A 3C5VA 2NW6A 1CUGA 5A2GA 5FOQA 2XUIA 3TJMA 2I3DA 2DHCA 4X6XA 1B41A 4QLAA 2WUGA 4OB8A 5H3HA 1RWQA 1A8QA 5K3BA 4H7DA 5ALLA 1W52X 4QDOA 2V98A 4QWMA 2XQJA 3CCCA 5HZGA 4LYDA 4K6KA 2EEPA 4LKOA 3ED1A 4J0HA 4L0CA 3BL8A 2HA0A 1ETHA 5DTIA 2ZJFA 3VISA 3DCNA 3H1AA 2RHTA 1BN6A 7YASA 5LZ8A 2JGIA 4C4XA 1JT2A 3R3YA 4Y2TA 1QTRA 1XLWA 2ZYRA 3WK4A 5A71A 4LXIA 3H2IA 3QBJA 4N5HX 2VEOA 5ISMA 1EX9A 2WJ3A 3ZI7A 3IURA 1QFSA 1UK9A 3IULA 3O4HA 2ROQA 4AX4A 1D07A 1G5FA 3R3ZA 4HRXA 2RGUA 2XMCA 1ZD3A 3I2KA 2GBFA 2GZRA 4M0EA 5KWIA 5ALGA 1E8MA 1WOMA 4PSDA 1PFQA 4Q82A 2XE4A 2GYUA 2ZVDA 1MJ5A 2OLEA 3A70A 4F60A 1QIGA 5LKRA 4GW3A 1VA5A 5HK9A 5AKIA 2Z8ZA 5CXUA 1TCBA 3IDAA 2CZQA 4KAAA 2PVSA 1NU6A 2XQIA 3M81A 2XUFA 4NS4A 1XFDA 4BRZA 3QVMA 1CUBA 2OGZA 1WHSA 3DKRA 2PSJA 2WG1A 1TCAA 1JMKC 1GPLA 1FSSA 3PICA 1FFCA 1G4HA 2VT6A 1YS2X 4RNCA 3SK0A 3NOXA 1EDEA 1VJ5A 4H7HA 3W9BA 1A8SA 4UHEA 2G4LA 1JJBA 2H7YA 1C7IA 3M83A 3ESAA 3FOBA 1UK8A 3UUEA 3STXA 3W06A 1JJFA 1UWCA 4BRSA 3H2KA 3HSSA 3FYUC 1AURA 3JW8A 1XROA 3I28A 2RONA 2V9ZA 4UHFA 5HQ3A 4J7AA 1UOQA 4Q3KA 1LZLA 2XUOA 2Y6UA 5T4FA 1U4NA 4WFKA 4LXGA 4BATA 1WM1A 5K3FA 2AJLI 4K6GA 2XI4A 4Q3LA 5IH7A 4QE3A 3WA6A 4K6HA 3MUOA 4E11A 3MUNA 1ISPA 2XUQA 2VJBA 5AM4A 3OM8A 4HZGA 1LBSA 1J06A 2ZJ6A 4WY8A 4JH0A 5AK6A 3AIOA 3HI4A 4P9NA 2CKMA 1N1MA 3EIOA 5IKXA 2HA2A 4UHBA 5E2IA 1XQVA 1EA5A 4OYYA 4PSUA 5JASA 1LGYA 1ODTC 4YASA 2WM2A 5D3KA 5JIBA 1YASA 2GYVA 4G4GA 3K6KA 1WB6A 5LZ4A 3PI6A 3WLAA 1RYYA 4B0PA 4BVLA 3WK8A 2VATA 2FX5A 1DQYA 4BC1A 4J03A 4BCBA 2V96A 1TAHA 1EDBA 2WJ6A 1XQWA 5HKAA 1CUFA 2I03A 1XLUA 3ZPXA 5HQ3B 3CCBA 3G0DA 4I19A 4HTAA 4QNNA 1AKNA 2YASA 4UBNA 1LBTA 3X3HA 1W75A 4BTLA 5K3CA 3LIIA 4UHCA 4UHDA 5JYCA 2JEZA 1VLQA 5E4TA 5CT4A 5K3FB 4U2GA 5LKAA 4OU4A 1H2XA 1XRNA 4BE4A 2HL6A 4QEKA 4A5SA 4I4CA 1DWPA 3UUFA 2AXEA 5FRDA 5ALOA 5ALRA 4C6HA 5AK3A 5AKXA 3O4JA 4ETWA 1XZEA 3R3WA 1QIMA 4L3WA 2XMQA 1RP1A 1YA4A 5D7BA 3O4IA 3QPCA 2QOEA 5EHNA 1ZICA 1ZD4A 1WPRA 1AGYA 4H18A 1CUHA 1GQRA 2HIHA 3KD2A 2VQ6A 1H2YA 1BCSA 2IIVA 3BIXA 3W05A 3L1IA 5EHZA 4YK7A 4AN1A 1EINA 1U8EA 2HDWA 3C45A 1C4XA 1XLVA 5D6OA 5IVHA 2HU7A 4EZIA 5FPPA 2H7XA 3ANSA 4DSAA 5AI5A 2XMSA 3FWHA 1G66A 4X94A 2E3JA 1B6GA 3LLCA 1UFOA 2B9VA 3D5EA 4L9AA 5IVDA 3DLTA 4Q1VA 4MWTA 4UBMA 2BUCA 4CCYA 1DQZA 2JGKA 4AQDA 3VKFA 4EHBA 3E3AA 1EHYA 3BWXA 5EIAA 5DLPA 1YAHA 5KBYA 1XQYA 3I6ZA 5CH8A 2QZPA 5JANA 5ALIA 2Q0XA 4TVKA 5HF6A 2D5LA 3G0GA 4F21A 3RARA 4Q34A 4CG3A 2WIKA 4GECA 3TRDA 4QLOA 4LHEA 4JYPA 3C70A 5ALPA 3N2ZB 3VJMA 4HS9A 5SYNA 4J0GA 1UKCA 5ALDA 1Q0RA 2DFPA 2V97A 3UMJA 3WL6A 2XUKA 4X90A 4B85A 2CMFA 4FDMA 5HF5A 2VJDA 1S8OA 3D2BA 1ZI6A 1Z68A 3B3QA 1P0PA 5CURA 3WQHA 1GXSA 1Y37A 4QZVA 5JARA 3WK5A 1LPBB 2C0PA 1VE7A 4H7KA 2XUJA 2OGTA 3PUHA 3MVEA 4C4YA 5ALEA 5KREA 5ALJA 1MX5A 2HM7A 4FNMA 4P08A 3WL8A 2PSHA 1XZKA 3QPDA 4UUQA 4X3CA 3STWA 6YASA 3PDCA 4GI1A 1QJ4A 5AI6A 5DWDA 5A7FA 4WJLA 2Y1KA 3QMMA 1XZHA 4BB0A 4U2DA 3C43A 4C4ZA 2HA5A 4U2BA 2OAEA 2VF2A 2UZ0A 1YSCA 5F4ZA 3QMWA 3WA7A 4XIIA 3WL5A 2HHAA 4X97A 1CUYA 2XMGA 3FNBA 4UPDA 2WIFA 5SYMA 4BP9A 1WPXA 4ZV9A 3AZQA 4B9EA 1QIKA 4F0JA 4XWGA 3AJAA 1LLFA 4B0OA 4MQMA 1QIEA 4B80A 1G42A 3ZWQA 4H7EA 5I8PA 2JEYA 4INZA 4O08A 2DSNA 3O95A 3I2JA 2QJRA 1XQXA 4EY5A 1E8DA 3R41A 4CCWA 1IVYA 4N8SA 5EHXA 2JGFA 4EY7A 4Y2QA 2ACKA 1CLEA 1HBJA 4XVCA 2DR0A 1THTA 5JALA 1QLWA 4PO3X 5C8VA 2XQKA 4QA9A 1R88A 1N5RA 3OURA 1DWQA 3IUNA 2VSQA 2C0QA 4FKBA 4G4JA 5IVIA 2K2QB 3TGLA 3HABA 3P2MA 2Z3WA 5JZBA 5AI8A 2ONCA 1IZ8A 1LZKA 2PSEA 1ACLA 3O9MA 1W1IA 5DNWA 3WWDA 2J3DA 4OCZA 1F0PA 3H2HA 5C8ZA 3QM1A 3DOHA 3FLEA 1QE3A 2YH2A 1JU3A 3A2MA 5EGNA 3WK6A 2XDWA 3LP5A 5C81A 1J1IA 2X76A 4QWWA 4EY8A 1UXOA 2R11A 4GWLA 2Z5GA 2P8SA 3EQ7A 5BV7A 3H2GA 4L72A 3H18A 2PSDA 4UBKA 4BAGA 1MTZA 3HC7A 1SC9A 1F8UA 4PSCA 4E14A 3O0DA 2OCLA 4FLEA 1BRTA 3E4DA 4EBBA 2W22A 4PNZA 1QIIA 1Q84A 5DTJA 3WL7A 1MNAA 5A62A 1FFBA 3B5EA 4P93A 3D4LA 4OU5A 4X85A 3IVMA 4EA6A 4X71A 4BYMA 4E46A 1VKHA 1XRLA 1ZJ5A 3A2NA 3ZLTA 3FSGD 2IX9A 1GT6A 3S8YA 4BVJA 3AINA 4YPVA 5AM5A 2VT7A 1DX4A 2VA9A 2AJDA 5CH3A 1CUAA 5T4EA 4G1FA 3GFFA 4DNOA 2ZYHA 3WWOA 3HEAA 4FFWA 1QOZA 2BUAA 3L1HA 4X93A 1CUXA 4DSZA 1E5TA 5JZSA 1MNQA 3BJRA 4BP8A 4WDRA 4G5XA 3PFCA 3ZLVA 1GKKA 3I6YA 2FJ0A 5HCUA 2ECFA 4IH4A 4AN0A 3T52A 2QS9A 4QDXA 5K3AA 5A7HA 4BTVA
chains in the Genus database with same CATH superfamily
5AHWA 3L04A 5LXTF 1I3NA 1T91A 1QLHA 3AMVA 2E9SA 4ZHQB 2BYTA 1KI6A 4XZ3A 6CHYA 1ISGA 2BMAA 4EYQA 3BJIC 3GO4A 3N7TA 4ZICA 3QU7A 1W0CA 1CHDA 1E2HA 3HRHA 3PGLA 4LHVA 2HRCA 3F96A 1GQSA 1OV4A 2VDUE 1ZL2A 2PJZA 4KRYA 1MG0A 3HMKA 4PLZA 5AXAA 2KX7A 5I9LA 4AU1A 2ANCA 4JLKA 4NNJA 2WMDA 2EATA 4FBMA 3SMQA 3N07A 4E5MA 1L5HA 5DX0A 3M82A 2OQIA 1Q7CA 3QXXA 4Y2JA 4FHFA 4YXWD 5JNTA 1FY2A 3JQGB 3LVBA 3VH4A 3MRTA 3HJNA 1F48A 4RVGA 2CXXA 3EX7C 1XWIA 1E1KA 3HKDB 3K0CC 1FTGA 4URWR 3SJAA 4M8NE 2WD7B 4JB3A 3V33A 3UMFA 2UZAA 4Q1CA 1NV9A 4BKUA 4LZPA 2G5CA 1BD3A 1E98A 4KPUB 1QV6A 1W5FA 3TLAA 4TL9A 1XAJA 3DBVO 4RWZA 3B2EA 4YA6A 5CXXA 4D9MA 4DIDA 1MO6A 1T9KA 3NAGA 4IIEA 3SI7A 1QB7A 1LH0A 4R1PA 5JSYA 2QSJA 3PWZA 1FTSA 1C1DB 2IYZA 3CT6A 1ORWA 1TEHA 3D5QA 4I4TF 4LNAA 2I5PO 1IWOA 2NU6A 4MRAA 3L6UA 3U26A 1J8YF 1MENA 4Y30A 4C7KA 4Q66C 1UPUA 1I2AA 4MQLA 4GQAA 4TLAA 2O8DA 4NC9A 2VSYA 2FPLA 1RKVA 4ER3A 4Q01A 2CDRA 3KUUA 3C3KA 4FB4A 3TJZA 3JYHA 3PFKA 1QP8A 4M2LA 5HJ5A 2EF1A 2MR5A 2XYRA 3B60A 1LTKA 4NIMA 4BV2A 5B3KA 4ZD6A 5E9QA 3VJRA 1FCJA 4QUJA 1EE2A 2QV0A 3V6LA 4D8WA 1RWKA 2JIZA 2BHLA 3JZFA 3CVJA 3VBEA 3MJDA 4I3FA 1P7ZA 8OHMA 5AKEA 1A0OA 5IDVA 1ABFA 4JDPA 4RY2A 1F8FA 1OW3B 3P2JA 3CUTA 4ID9A 2X9GA 3IEMA 4WBNB 1ADFA 4H6XA 4V1CB 3S0JA 3V55A 4IO1A 5HMMA 2RHGB 3PHCA 1PD1A 1AVTA 2ZI3A 4JT8A 4FGUA 4TV8B 1E2LA 2C9MA 3FDZB 4MI1A 2WB4A 4GQBA 1LRLA 1O08A 1AQ6A 1OV6A 3FWPA 3LY9A 3M1AA 2RSLA 3MRVA 2K87A 4NCNA 4JUCA 4F71A 1T2UA 3I92A 2PUCA 2E1RA 2O3QA 3AFNA 5A4MS 1X8LA 2IYLD 1SUPA 3IEUA 1AC5A 1XEFA 4IIJB 4Q1AA 2GARA 1CUSA 5KVAA 3L7IA 1V45E 4D6XA 3WGTA 5AH0A 3DXYA 5F76A 3BICA 3IVCA 2RGWA 2EARA 3MRSA 2O50A 5B4VA 3GYGA 3OOJA 3THWB 2VTBA 1QVWA 2EJCA 3ZR4B 5JSQA 1Z5GA 2DM6A 3DJYA 3DD5A 1SO8A 4DMRA 2IBTA 1SEPA 4GICA 1MUUA 1QG6A 1SVWA 2J6BA 2AWNA 2D2FA 4RVOA 2ZITA 4KPEC 3I1YA 1GYQA 3QFFA 3IBTA 4YHBA 2OM6A 1LD3A 4IF4A 5HZKA 5IM4F 4L4RA 3MQ2A 4QRHA 2GFHA 1QYIA 1L7VC 3EEQA 3L06A 5FWXB 4NHEA 3ZWKA 1GDDA 3CU5A 1GN8A 1T0UA 2VBGA 1S7CA 2QLLA 2WIGA 2YHIB 3GRFA 3H3FA 4G0OA 1WX1A 1CSEE 4XGNA 2J48A 4XM2A 4RJIA 2RCYA 3GV0A 3BILA 4EG6A 1KQPA 3THSA 3VX4A 3OLXA 2GXAA 3S70A 1ID8A 4XI9A 2AQHA 4D3ZA 1I7DA 2C7PA 1P1HA 2FUKA 4XJTA 4JK3A 5AI9A 2LW7A 3T41A 4QULA 4X1KB 4B84A 2VPZA 3SICE 2AE1A 2D2VA 3FY4A 4M9QA 4RK4A 1TEVA 1CU1A 2ODTX 3AONB 4TQGA 3VR3D 4UUOA 2D1QA 2P2ZA 4N5LA 1CNEA 1GNRA 1L5MA 2R3SA 1A9ZA 3CW9A 3H9GA 1H69A 1R8XA 4M36A 2GBGA 3P20A 4OUDA 3SDZA 2Y92A 3K2IA 3OQHA 3KJIA 2WHYA 1V5WA 2BM8A 3KPVA 4R2JA 2VRWA 5BNTA 1TCVA 2MJLA 3AUFA 3QUTA 2IF0A 1YWGO 2ZIGA 3LPDA 1QNLA 3LUPA 1L3IA 4KBGA 3IMCA 3TZBA 5A9SB 2CXPA 5ERYA 3KWFA 2WSYB 1FLDA 2WJVA 2QXYA 3PRYA 5IWCA 4YCNA 2PKWA 6NULA 1GLGA 4CLHA 4AC9A 5M29A 3OJLA 5GM2A 2VJPA 3N1UA 1EFLA 1YR6A 3PNBA 1P17A 1RR6A 1EWRA 1UM8A 4GX5A 1SQSA 2JGMA 3KQLA 1HYHA 2G9UA 5HKBA 1WCXA 1DELA 2WZQA 4ML3A 4UW9A 2FPPA 5J4VA 1ZOLA 5AKGA 1OF1A 4Z0HO 3L0DA 4W1QA 3TLEA 5CFRA 3IPAA 2FWBA 1W6RA 2JG3A 4QYWA 2XZDA 2DECA 4QFBA 5DHPA 2IDZA 2TRSB 4R71A 4YMSA 4NCXA 5E2AA 4NQRA 3ZU4A 2WWYA 3CR3C 3TEJA 2PL9A 5HZMA 1A5TA 2CD9A 4PN7A 3P7MA 1T9HA 2UZ3A 4OSEA 1KNXA 3QVJA 1X15A 2WJAA 3MTIA 3PNPA 4HAZA 4RESA 2O1EA 3RK0A 1TA9A 1U8AA 3E1GA 1XXLA 3QENA 2R85A 2H29A 3M70A 4FR0A 4ZDWA 3ZLBA 4ESEA 1SG6A 2GUGA 2HBZA 1F5SA 4O4HF 5T7BA 1I80A 4TMZA 2YXLA 1GD1O 2JFQA 1ORTA 3BL5A 3KFXA 3LCMA 5ETJA 5SICE 1TJ5A 1O8BA 4F45A 2BFDB 3KVVA 2B8JA 5B1HA 3A6LA 2AMJA 3MWEA 4E2FA 1JW9B 5FPHA 4BLSA 1BEEA 3VR5D 4WSOA 1YA8A 3TVDA 2XVAA 2QD1A 3QX8A 4CUJA 1KU6A 2WU4A 4FWBA 4II2A 5ES3A 1VIDA 3FVTA 2XQFA 1FRVA 1R0SA 4E08A 3IIIA 4NBUA 3C15C 3UOWA 3UWOA 4JR2A 2V58A 1N0WA 4PC1A 3CUYA 4DMKA 2L82A 4ZT3A 4ZJZA 2K5UA 3TSZA 2ODQA 1YKSA 2H51A 4RTNA 5LDGA 3VC7A 2EWVA 4NOMA 1MPTA 4FONA 2O52A 1KI2A 2HEIA 3IQIX 5AHOA 4ZPJA 5CA1A 1G9TA 1O1YA 3FMGA 3GCWA 4UXJA 1SN7A 1XZIA 2HWUA 4NOJA 5IHXA 1I4DD 3A3OA 3OMXA 4LJKA 4ARIA 1FJ2A 2IEDA 4HVTA 1L7BA 5TPWA 3IRVA 4YGYA 3DP7A 1KYYA 5IG2A 2QN3A 1AY0A 5AJZA 3S40A 4C01A 4ZAGA 3NP9A 4A15A 2H1FA 4DV5B 1R15A 1M3SA 4QDZA 1E2FA 4NZPA 1B0PA 1T8YA 1WBJB 1YO6A 1Y9AA 2IOFK 2RHWA 2R5NA 2VPIA 3KU4A 3CRMA 2B0JA 4DCTA 2ZFUA 1I0LA 1KAEA 1THZA 5G3YA 4C22A 1J2UA 2J4FA 1YS4A 3DDHA 3CZ9A 5TPWB 3OJOA 3BL6A 3JARA 2EBWA 2EGGA 3HN6A 1NX9A 1PL0A 1Z6TA 4FYVA 4HFNA 2YYSA 4PNEA 3CX6A 4DMFA 4AN4A 1V3VA 3PB3A 5EZYB 5GIPE 2ZE7A 2WUFA 3Q1LA 3ZV7A 3O0TA 1LTHR 1RMTA 4X7BA 1XJ0A 3T95A 4EPRA 1Y7IA 1CBUA 2VYVD 2ATXA 3GJ5A 3OQNA 3FJ1A 3OEHA 5C3UA 4EHNA 1FFAA 3DVSX 4HX2A 4PTYA 3SX4A 5ALXA 3QF4A 2GZ1A 3W1VA 4Z6KA 3C3JA 2DJ5A 1T34A 2PBRA 4PHHA 3RQSA 1JWBB 2BLLA 3ZN2A 3PUIA 3PQ7A 3NJ8A 2AR9A 3I42A 4HDSB 4IV0A 4KIFA 1A69A 4TSFA 2AA3A 1NGSA 1C30A 4JLJA 4YUZA 2QZJA 1W34A 1BS1A 2P5YA 2XUHA 3AC0A 4BKOA 2O8CA 5FX2A 2AOXA 1U9IC 1UH5A 1BU8A 2D2XA 1DU4A 3EOBI 3KV3O 4URUR 2AI1A 5EWJB 4CF7A 5IF3A 3DMPA 4OHRA 2AR7A 5IABA 2C0CA 4MA5A 3B2QA 4UBLA 4LWOA 1DBVO 4F4DA 1Y4UA 5TPZD 3QLVC 2R47A 4GMDA 2VP4A 1TCCA 3S27A 2ZPAA 2GOYA 4JQSA 2B6NA 1D3AA 3JD0A 3P9XA 1JH8A 3QKTA 4N3GA 4QNRA 4CLXA 4PLVA 4BP1A 2ZWPA 3RC9A 4BVGA 5L3SA 2GESA 1YDHA 5IXYA 3S8EA 4KI0A 2C7OA 4AZWA 1XZGA 2D0OB 2YWJA 2P9ZA 1HT2E 5ADHA 2O19A 1QMGA 2YYYA 1U3TA 1YJQA 4GC5A 3Q8MA 5IN4A 1EZ1A 1EMDA 5G4KA 2M2IA 4PLFA 2G9NA 2OO3A 2CNWA 5B64A 5J63A 3R9XA 1V4NA 1PJCA 3ZIUA 821PA 4DR7B 4MUYA 1JKMA 2WFLB 4Q3BA 2A4MA 4IPTA 2OXEA 3KNZA 2R1TA 1TMGE 3DT8A 4J0KA 4KHPB 3QYJA 4G24A 4TMTA 4YMUA 5JD3A 4IUCS 4EG8A 2ZAYA 4ZCSA 1XXHB 4Y7DA 3CUWA 4RK0A 3O82A 2NM0A 5DWVA 3PD0A 1A98A 3O4FA 1ZONA 1W35A 1R50A 3H1BA 5I9NA 4OHFA 1NUSA 1D1PA 3EGDB 2QY6A 3GEDA 1EFVB 3QPWA 5KCZA 1E60A 3Q72A 3I5MA 1SXIA 1KVQA 3WP1B 2FFHA 1LC3A 4J4BA 4MYCA 3C3MA 2ILTA 1NXQA 4CF3A 2EFGA 2MYUA 5LZ2A 1VL5A 3V9PA 2RHOA 3D8HA 3AH8A 3LDGA 5FUWA 3HCWA 2CKDA 3IE2A 4MULA 2BISA 5LA6A 4DLXA 1L5NA 2AXNA 4WBXC 1HNZB 3IMKA 4LGYA 1JLMA 1QHNA 2EJUA 2E21A 1BD4A 5EKSA 4BNTA 4UNIA 1BWRA 4YEDA 4TS3A 1NVEA 1FP4A 2PUVA 3CV3A 3F67A 3FLBA 3PQ2A 3PFWO 3QVUA 1OAAA 3ZZTA 1XI2A 4HK4A 4WLUA 5JZ9A 5DNVA 1QR2A 2WIJA 3P9KA 5AKJA 5FI0B 5GMOA 4DCSA 3AP2A 4KVGA 4ZA2A 5EUCA 5EY5B 1T25A 3ZTYA 3RRJA 4ALJA 4FI3F 5B36A 1CR2A 3BYZA 4HLQB 4N01A 4C30A 3EVTA 4Y0VA 5LFAA 3I45A 2AF4C 4JBGA 2DLCX 4B1FA 5AVXA 1VL2A 4KDCA 1GPMA 5IRCD 1YGYA 4ZANA 1OXUA 5HKLA 2DZDA 2AZTA 2OAP1 2XQGA 3K9WA 3RABA 1U6JA 3ZHTA 5KVCA 2DB3A 3OLQA 1WQ4A 4MA0A 3B13B 4X8MA 4Y98A 4LF6B 4M9XA 2O54A 2HU5A 4I5IA 1TVCA 3EXAA 1EZ4A 1TXGA 2IZ7A 4Z4CA 4BWYA 4F6LA 2R8YA 2WR8A 4O4IB 3A4LA 5TQ2A 5PNTA 3FTNA 4BMVA 4RU1A 4I1IA 3EMBA 3SC6A 3SLGA 4LEIA 4E32A 2R4TA 2UXBB 3GJ0A 2BZSA 3C8MA 3I09A 3OQIB 4L76A 2FN4A 3WY9A 5KYKA 2QTTA 2ACWA 2X7HA 4KVAA 3TKLA 1GU0A 2OEPA 1F2UA 4NHOA 1NVMB 2P3SA 1M2HA 2YWGA 3C6BA 3LLVA 3NGLA 4H0CA 4YJ2F 3BAZA 5F64A 3J7AC 3E82A 2YZ2A 3AU8A 4BNHA 3GLKA 4L8WB 1UK7A 4NYJQ 4KW7A 1ZIYA 2BHRA 3AOEA 1D0IA 3GVCA 3PFNA 3CLKA 4QKQA 1JIVA 3I76A 3O4RA 4OJMX 2Q5EA 2AMFA 3QBTA 1XK7A 3T7RA 1GM5A 1R12A 3PEWA 1MP0A 2DWPA 2OPHA 4RQAA 1FFDA 4KLRA 2JBHA 3GT7A 2REOA 4H17A 5CT9A 1JU4A 4EF6A 4BLOA 4YAGA 3KTDA 1VXOA 4F85A 3E35A 4OYLA 1RYHA 3QWAA 3EQ6A 5JZMA 1W29A 1MO5A 5HIAA 2DSTA 2R1UA 3GWGA 2Z8YM 2VQ3A 4AJ4A 4FHGA 2XECA 5JXHA 2FZEA 1CY2A 4FHCA 3K6SB 2R8PA 1F8GA 4DABA 4HEQA 2VK2A 4ZCMA 1Z4IA 3ZXSA 4F38A 4QL3A 4HY3A 1PHPA 4NABA 1N7JA 5JVDB 2VRCD 4MR9A 3RRFA 3BFKA 2PQ6A 4ZYXA 2YS7A 5C52B 1NQAO 1GUZA 4DRXA 1W46A 1B8VA 3FLMA 2XT0A 1H6AA 5CCEA 3WQSB 3OG9A 1QGYA 3RYIB 2J7KA 2WV7A 1KK0A 2B8TA 1YQUA 3A31A 3C8ZA 4M1YA 3LD9A 1ZM9A 4P4LA 3QY9A 5FWDA 2PH7A 3WK9A 3DV0A 3WG9A 3OT5A 3G79A 1KE2A 2B21A 1NBIA 5JAUA 2UU9B 3M8KA 4NEHB 2EP5A 3T15A 5LYJF 1U0OC 4ZI3A 1PT5A 3OIUA 3S29A 1QH8A 3R3VA 1F0KA 4XVHA 3GLGE 4ZVSA 1WXHA 3PEUA 4MQ6A 2HRQA 1U3FA 2VDJA 1M10A 4M6WB 1DE0A 2CC2A 1CDDA 4WH0A 2G1KA 4OH7A 2OQVA 4Y67A 3JD1A 4PIVA 5J2TA 2OV3A 4N7RA 2Y0BA 5F73A 3N8KA 4DLZA 4HDRA 2GEFA 3VPDA 2H4XA 2GD0A 3ZNPA 2ZZMA 1VE3A 2B7BA 5EWMB 4NBRA 3NYRA 2FKNA 2OHIA 2WU0A 3AEUA 1KYQA 2C03A 4I55F 1ODFA 1E3SA 1U2GC 3IBSA 2FW0A 2M1XA 3ET5A 1X3SA 5DT9A 3UYKA 2XXBA 1XPOA 1J0EA 1H9BA 3BGIA 5E1MA 5IP5A 5I7OA 1L1EA 4GI5A 1G4AE 4RHYA 5AVWA 1EUQA 3ZDFA 1WOYA 2Q1XA 2QD3A 2QTAA 3RSHA 3V8RA 1ID1A 1J8FA 1R9MA 3IQXA 3ZZMA 4DPLA 1S1CA 1MB9A 4YUWA 2I1QA 5AIBA 5K7SA 2GF0A 3VDXA 4F2PA 3EDMA 5T6BA 4YT4A 2VAVA 3ABOB 1Y3AA 2D59A 2M1ZA 2OXCA 2W2VA 2WP8J 3N0TA 4I8XA 4JBWA 4D79A 4CIYA 1U2QA 3Q0EA 1SBCA 5KQSA 3K9QO 5J59A 2YVLA 3LCVB 4WXRA 1BMDA 1YONA 1Q14A 4PAOA 5IUKC 3UCFA 4MS4B 3T06B 3WGJA 5EL0A 1HLGA 4C7MA 4D3SA 1IY9A 4DNPA 4DQXA 5FV4A 3NJRA 4IDGA 2QNIA 4YMTA 1M73E 1CIJA 1Y8AA 4ARVA 2BFBA 2CUTA 4F4HA 1GUBA 3HWRA 3TNDA 5BW4A 2WTUA 4RJJA 1XAIA 4HH0A 2ZXFA 2BEJA 4TMWA 3U3RA 2F9MA 3Q8LA 1X13A 3M6MD 1Y34E 1DI0A 5EIXA 5JXGA 5JTTA 1LXCA 3NVAA 5JT1A 3OO0A 4ER7A 3P2EA 3EZ2A 4YI3A 2F90A 1DDOA 3D6JA 4EG3A 5B5SA 1Z2OX 4JAVC 3TRKA 4RQBA 4AY5A 3NO4A 1KFEB 4HZUA 4X8OA 4LBVA 1VCNA 1HEUA 4MUHA 3SIXA 3WLMA 5JNVA 1DIGA 5KJCA 3J81A 4LXTA 4RGQA 4XGQA 2P9QA 4LV5B 4R8RA 4YLGA 3OM9A 1MX9A 3IALA 3I6BA 3AL2A 3OIDA 3DFMA 4GM0A 3GPIA 1EUDA 3AI7A 4HDKA 4S24A 3LP6A 1ZCJA 2QJFA 5H59A 4BX8A 2WD9A 5JMOA 2EJBA 2ZIUB 3AKCA 1IVNA 2G1JA 4C89A 3S81A 2PU7A 2GEUA 5HFJA 3HJFA 2ZYIA 1RRMA 2WKWA 3NYIA 4HB3A 1KO1A 1KQ3A 3SWWA 3TOVA 2NP7A 2DX7A 3NDPA 1BGWA 1G2OA 3MGBA 3PQFA 4YJKA 1USGA 1ZD1A 3G5UA 1DKUA 4CR7A 4AYWA 4B8WA 5EE5B 4BNDB 1GKYA 3CVVA 2OMEA 3FUWA 1AUVA 5CYGA 1MHPA 1PR4A 3GHYA 2EC5A 1QO0D 2EWWA 1GNPA 3HVUA 4M99A 1TJPB 4YS6A 3RVDA 5BSGA 2A1TR 4G86A 1AHPA 3FPGA 4M0FA 1E18A 4PO8A 2D5AA 5THQA 2B69A 3CLUD 3MWDA 3W0LB 4DG8A 1KEEA 1GHTA 4EGSA 4OOFA 1CUIA 2QD4A 3BS4A 3AIKA 3JATA 1UIMA 1XTRA 4H7FA 1T9BA 3E81A 4MPTA 4MYSA 1NF2A 4LV6A 1AO3A 5F5XA 3VU9A 3UB4A 4A26A 2LBPA 5KDLA 1ZXLA 2C7BA 5B3JC 2QQEA 5JW6A 3G9TA 2EHDA 4GOMD 4RTKA 1NVFA 3KOOA 3C39A 1ZVQA 3AKDA 3JWHA 1KMHA 2ZROA 3N2IA 3I1FA 3BD6A 1WULS 1S1MA 3WJ2A 4GGPA 1DCKA 1QO9A 2QM0A 3Q6MA 2WF8A 4WXHA 3RFVA 4LJ9A 4AK9A 1MX1A 2VXOA 5ITSA 1R74A 3JYOA 4PQFA 2H3EA 1N4AA 4DGQA 1XZQA 1UBGA 4PS0A 3CRQA 2A94A 2SCUB 1XWWA 3LE8A 1KJ8A 4WQMA 2CVZA 2OOKA 1YULA 2W2KB 2QTVA 2YIVX 1NXSA 4B83A 2QHXA 3GDOA 3WB9A 5KKNB 1ZSNA 4QG7A 1CRPA 1KY4A 4TLDA 2H1VA 3VR3A 2VUSA 2ZBVA 5JDCC 5BNFA 5IULC 1CRZA 2YWRA 3CFYA 3TR0A 4D41A 3SLRA 1Q15A 2XWSA 4MP3A 3GJYA 4LPKA 1G20A 1G291 3OOSA 3QBVA 4B2YA 1BMQA 3H5IA 1LK5A 2W42A 1AUQA 4KN8A 1TM2A 4QOJA 3F6EX 1RYMA 1H65A 2EOAA 1PBNA 2CDAA 3I72A 4Y2XA 3SEZA 4B6RA 4MW0A 4Y6QA 3TD9A 2QB5A 2CXTA 3C3CA 2ADOA 3DBRB 4E4RA 4M1QA 1WNTA 2RAUA 3DR3A 5KNDD 4BMCA 4P92A 4EO9A 2D1FA 4CV2A 1G5RA 2PMDA 4FNGA 3H19A 4O5AA 3GGGA 1KAHA 4Q15A 4L8LA 3R76A 3NGXA 3VYWA 4D4GA 1J2EA 1MG5A 1BCRA 1ZJ6A 3GB9A 4EFNA 2IUUA 2PLWA 4B3TB 1JYEA 5DGTA 4IMRA 3I9JA 2FMHA 2QR2A 3MD0A 4JT2A 3MCWA 4DXDA 1XZFA 1SU6A 3VYVA 4DYVA 5DCWA 3RKUA 4EL0A 3RVOA 2BUBA 1ADJA 3NHJA 1B0UA 2R7KA 1A5SB 2XT6A 4LDAA 3ROXA 3DTNA 4IICA 2P3LA 3F5DA 4W99A 1ZW6A 5EXXA 3G8BA 5IM4A 3ASZA 3QLUA 3KYJB 3LCCA 3WJ1A 3E2IA 1GEGA 1USWA 3DEIA 4GO1A 3UY4A 1VHWA 1I1QB 2VP3A 3Q0TA 1GFWA 3KHSA 4INPA 1UKBA 2X9VA 4J1TC 3L7AA 4IJUA 5HX7A 5AD1A 2EERA 4MHOA 4QJ5A 3MILA 4HXFB 2DUMA 1U2RA 1U0TA 1T3SA 2PFKA 2BE7A 3EVBA 4J1SA 3RREA 4DCOA 5I5EA 5SZKB 3QXCA 4BV9A 1XV5A 3QKWA 1U9ZA 1WE2A 3U19A 4JJZA 1G5HA 2ANBA 3PC7A 4QBKA 1S9DA 4EMUA 1MB2A 4BUJA 4DLWA 4ZDKA 4C87A 1T9GR 3EPPA 3GRAA 2GAAA 2WU3A 4U02A 4IVRA 2X5JO 3MMPA 3WRYA 2Z2JA 1HQDA 3BGSA 3UFXA 4EHJA 2GCOA 4J3JA 3F7MA 5LZ5A 1I01A 3U7HB 3F7OA 1D8TA 1Y8CA 3K5HA 4J2TA 3Q5GA 4PYQA 3CH6A 5SZJA 5T3YA 3STTA 3T54A 2CJYA 4YUVA 4YJHA 3RIHA 3ENKA 3NS7A 1ZNQO 2B7LA 5HJ7A 2PKYX 2JF0A 3UQYS 3I23A 5DNDA 4W1RA 3NVKI 1PU2A 1T9ZA 2PD3A 5DF1A 2DHEA 1G1AA 2IDJA 3A6FA 1NVVR 3L7NA 1FMJA 1Z6XA 3RT9A 5AVVA 1NBHA 3BIOA 4IX9A 4NFYA 2B8WA 2H4YA 3E5RA 2IZ1A 2HK9A 1GCUA 2HFJA 4KAJA 2W8BB 3QEJA 5EFZA 4OF4A 3R7LA 3T3GA 4E5UA 5JU6A 1XF1A 4FFBA 2HSWA 2HUNA 4W1SA 3SYLA 3TW6A 1Z5OA 5CPBA 1C7RA 1RWBA 5FL7D 4EFLA 3DE4X 3FTPA 1OCEA 4BN0A 1V2HE 4A2CA 5AVTA 3DNFA 4UZEA 5F3RA 4BECA 3U7RA 3IL2A 3ZE6A 3T1TA 3TTYA 4G5HA 2FDXA 3HADA 1LKZA 2XCRB 2C4HA 1R6XA 2EIHA 3LWDA 2CLEB 2FEXA 2ZWOA 4PYNA 1IH8A 5JCOA 5DYIA 2PBLA 3TIFA 2AOTA 2IOYA 4ZI7B 4DIUA 1E0SA 4IVQA 3ANXA 4QQRA 5CJ2A 4CEJB 3E2MA 4AM8A 3C6ZA 3RVLA 2W6PA 1MAAA 3GJRA 1KZHA 3RIGA 2IH2A 3KPYA 4MW2A 1QAQA 3IJPA 3W6ZA 3U4QB 2FE1A 2BDEA 3LAWA 4ZEMA 3HCAA 3VDRA 1BA3A 4D4KA 2A1UB 4DA8A 4J7XA 1XRQA 4A2PA 5IUJC 2QZ9A 1BQ3A 5FNVF 4B43A 4TTAA 3S2ZA 2TS1A 1NP7A 1TK9A 4C4OA 5LMUB 3EXFB 1PJ2A 3AZOA 5EKTA 3GJ7A 1Y6QA 3B1YA 3LBAA 3HPQA 3P5BA 4ZV7A 5ELXA 4YV0A 1VRWA 3OECA 5FJJA 1R9JA 5B7NA 4FXPA 5I48A 1Z4QA 2RGXA 2EKQA 3VR1A 4ZRMA 3C87A 3JQ7A 3LO5A 1GNQA 4HI0E 3G1TA 1SVNA 1T1GA 3BK7A 3HYNA 4W8OA 2FEAA 4GOJA 1BKDR 2BEVA 4O63O 5A2QA 1Y5RA 4RMIA 3GMSA 2R1VA 1RM5A 2YWCA 4S0XA 4E5NA 3IVGA 2AYZA 5HTOA 3GP8A 2Y0DA 3FG9A 4K87A 3E3MA 4BB9A 4OP1A 2VDMB 4IJQA 5H9VA 5IHPA 3A6PC 4P3PA 4JUFA 1HPLA 2VBCA 1YS6A 5B4UA 1SKYE 1XEXB 3OP4A 2TYSB 4B8YA 4UHHA 5LQSA 2AZXA 1N1GA 1KQNA 3ODPA 2XVMA 3JALB 2G5PA 1DX6A 3GGSA 2ZB3A 3GLHE 2A67A 3HYRA 4EHKA 1V6CA 2FMIA 4JP1A 3MGGA 2C1XA 3L79A 5FWYA 1YQ9A 3BVPA 4K9QA 3QYFA 2NU8A 1SRQA 4N4AA 4FI3C 1MEOA 3RPEA 5KNBA 4A10A 3STUA 3JAWB 5DSTA 4JY7A 1L4BA 1JRLA 4MUIA 2YWEA 1Q7GA 3BCRA 4UJ5A 5FPSA 5CB4F 3L82B 2O8EB 1WB4A 5IDWA 5BN4A 3TE6A 2FWJA 2WILA 3KVYA 1NJ2A 1ZI8A 2IOQA 4PZCA 1KJIA 1JLKA 4O6VA 3RC7A 5C2JB 3W8DA 1PG2A 1RZRA 2WV9A 3GUUA 2O3TA 2P7IA 1CC1S 4DQUA 2MDTA 1XEAA 3HG7A 1P4SA 1K4MA 3GUZA 1GSOA 4JVMA 4N0EA 3X1MA 2PX5A 2XMBA 5IFLA 2IHYA 2CHEA 3L1VA 2AOWA 1F51E 4LGCA 1GG9A 2P79A 3GAMA 4LV8B 3T1QA 1M1YE 4BNMA 3Q85A 3EA4A 4M86A 4NESA 4KOEC 3R8XA 4BIMA 4E5DA 1UJ4A 3AK4A 5JLAA 3OM1A 3DZHA 2NUAA 2PYDA 3U7IA 3EIXA 5DVZA 3UH0A 4YJGA 3AI1A 4EG5A 4OHKA 4RVSA 4XPZA 1MVLA 2QL5A 3KB6A 4QASA 5DYTA 4F4CA 4QATA 1ZYUA 3E23A 2Y66A 1Q3TA 3Q8WA 4GEKA 4YRDA 3OZEA 7REQB 2QGNA 4RZUA 4CIXA 5IU6A 2MU1A 4Q4JA 3BRSA 4G5FA 2V7TA 3QH4A 1Z37A 2H5IA 3PG5A 3C0KA 4ZDJA 4MLCA 2B4QA 4WVFA 1DINA 3T4UA 2XRYA 2PUJA 3LH5A 4R98A 5LBUA 2K7FA 5DM2A 1AS2A 1XE3A 4GPZA 1CUDA 1A95A 1J23A 3BF7A 3RFXA 1H66A 3MT9A 3FGNA 4XCXA 3K9HA 4BCDA 1GGJA 1H2BA 4D5GA 3DNPA 1E9VA 1LJ8A 1ZO8A 4S0ZA 3HB7A 2IXGA 3DQPA 3EF3A 1T29A 2WHPA 3LUAA 4NBKA 4DWWA 1JQKA 5C7IO 3ND6A 4OG2A 1JFTA 4ZGGA 1YF3A 3N2EA 5AQ1A 2YMLA 2WFAA 1AKVA 2AFHA 1YVUA 2CLOB 2QAGA 2WT4A 2G63A 3FNQA 2AFIA 1XT6A 1YTUA 7AT1A 4FHZA 3N39C 4BB6A 4PLCA 1C7ZA 2I6XA 1ZR2A 3FPKA 1H22A 3K73O 3COZA 2CN1A 4G67A 4Q5IA 2ZUSA 1L3CA 2BONA 2F2TA 1GTZA 2FZWA 3FMVA 4BLVA 4KWIA 2FQWA 4R2WA 1A88A 4TMYA 4ETIA 1L7MA 1ZM2A 5TV2A 3F5QA 5MFPA 3NHLA 4CFSA 4KR2A 3EISA 5M7EA 3CLTC 3M1YA 1NBOA 2G9ZA 2J3QA 1DS6A 2R68A 3FZYA 4CKEA 4LTNA 1NT2A 3SSAA 2PRZA 1ZSYA 2I6UA 1QQAA 1YB6A 4TWBA 1YOBA 1NONA 1XO1A 2UZIR 3EPHA 3ZBTA 1Y5NA 4LY3A 2IH4A 1OTXA 1KYIA 2CUNA 3MCZA 2N1BA 1Z3IX 2XPCA 4GBJA 1JEAA 3H87A 4O33A 1KARA 4QPCA 4DWOA 4LMPA 1MORA 1S4MA 2B5VA 2JFPA 3HR4A 3OU7A 3ZXIA 2QVCA 1UPAA 3GT4A 1IJFA 1E2JA 5F78A 1KI3A 2WVJA 2IDKA 3ZIAD 1NMYA 2X58A 1UAYA 3HJBA 5AKYA 3RLIA 4OHMA 3AB8A 4RDCA 5JBNA 4V3BA 1HH4A 2J45A 4ZVRA 1EG7A 2FZ5A 5CXSA 5BURA 1QZXA 1K7YA 3HE3A 4C0LA 1IBKB 3N2KB 3HY4A 4TQUS 4IAOA 2LR0A 2P4HX 4IGAA 5AW7A 1U7DA 5EEHA 1VIMA 2F1KA 4NMWA 5DO9A 5JROA 1CR0A 2O2ZA 3FBTA 1ZD8A 2IE0A 2ODNA 4L9WA 1ZH6A 4KJZA 1SB8A 1L6RA 3N74A 5CTJA 3DCIA 3GD5A 1YGPA 2HV9A 2JFVA 2QDXA 4HWKA 4LJRA 3R9WA 1GQ2A 3MLEA 3NM5A 4CMIA 1JU9A 2XNCA 4GX1A 1R2QA 2Q21A 3OC0A 4KVZA 4PCUA 4DLPA 3HBFA 3A3YA 2ZRDA 2J46A 4JWKA 3UFBA 4X45A 4WKCA 3DXZA 4NVRA 3WP0A 2NQ2C 3W9UA 4WKNA 2RG1A 4C7XA 5LM3A 1MIOA 2R62A 3GA0A 1H3NA 3T1NA 4YJ2A 4ZTUB 2AXQA 2XKJE 4D43A 1FNCA 2DH5A 4UTPA 2GAJA 2OMKA 4UM9B 5BORA 1WHTB 2Z0MA 4QDUA 1M33A 2Z09A 4LTMA 1CJBA 1NZFA 3TUZC 2HQBA 3ZK8A 1KKUA 2CK3D 5DI3A 5H82A 5KYWA 4C7OB 3HLKA 1A7JA 4NLLA 3HDQA 3NPMA 1OXVA 1NLZA 2ZKLA 4NECA 4QQKA 2NZJA 3E48A 1XSEA 2CT8A 1E7SA 1TZBA 2HNBA 4KE7A 2GQ0A 4DEVA 2OC4A 3UJBA 4K5QA 4UNRA 4UQLA 4L2IB 2P27A 5HFAA 1QYCA 4CQMB 4JP5A 2YWDA 4HDCA 1B73A 1W0KA 2F3RA 2IZ6A 2N0SA 2OSBA 3DAGA 1XA0A 4GKAA 4KO3S 1KYXA 4MJ3A 4MUXA 4S1NA 3RYFB 1E9AA 1NRIA 4UARA 3BGDA 5CDYA 5JWHA 1MC5A 4J0DA 5F4BA 3QEMA 3ZBPA 1UBMS 1D4ZA 1N5MA 2FHSA 2VWQA 3HDVA 4HMPA 4JVOA 5IZCA 3U56A 3EA5A 2HU8A 4DFDA 5KOJB 3OQ6A 5I6DA 1QIJA 5JFTA 3VR6D 4A8TA 4CFYA 2AOVA 4HQLA 4B33A 4PLPA 5T5QA 3RFFA 5A5DA 3TXXA 2BGWA 4IHAA 4RENA 2EHJA 3KTAA 1N6LA 1ZK0A 4PCLA 2GETA 4CJXA 4FEAA 4XD7A 2I2XB 5A6SB 4DBLC 4DJEC 1IUOA 1SJ9A 2H1IA 4JI4B 2GBCA 4M54A 3O93A 5CAEA 3DW1X 2GFQA 3UB3A 3DE0X 4P3NA 4LDNA 4YRSA 2WG2A 5FLEX 4KIGA 1AX9A 3NTOA 2R96A 3OIWA 2D3WA 4WLNA 1P8JA 2GKSA 1IN5A 1V1JA 1ZCZA 1WXIA 1XOIA 1Z47A 2MMCA 3E5NA 3W8FA 5EIEA 5L51A 3RR2A 3GJQA 5A0VA 1R6UA 2V7PA 2IJGX 3NH6A 4B2PA 2Q8QA 1J8DA 4X7RA 1OFHA 4JBXA 1VLLA 2PANA 5BW5A 1RCFA 2V6JA 5EI5A 4ZIRB 4C6RA 3GLRA 3KAQA 4FYJA 4NAVA 4CE6A 4G84A 1TVMA 1BE0A 3VNVA 1H6CA 4RTMA 1VMAA 1Z88A 4G0XA 4M0MA 3E03A 1T1SA 2DUJA 2P9BA 1I5EA 5K2OA 1LFDB 2ZAMA 1N75A 3DDZX 1QP4A 2VCYA 1A71A 2CXUA 4CV1A 5JS1A 4N1AA 1NW5A 1WUJS 3C74A 2PRSA 2G8LA 3JYPA 5P8WA 2QF7A 3MCTA 4LFCB 5JY6A 4DUYB 2YVKA 3R0XA 3OESA 3S2FA 4PG8A 5I9MA 2VLBA 1Y7HA 3I2IA 3SFVA 1N2JA 3RVJA 2VP6A 5EIBD 2HHLA 3IUJA 4MW7A 2IS2A 4RORA 4C1BA 1C29B 3MLAA 2Q4EA 2O7QA 1W8IA 2ONYA 1TJYA 4RD6A 6GPBA 3BJMA 3C6QA 3FSRA 2BMWA 4YIHA 3MQFA 1U2TA 2DBZA 4OMDA 1JB1A 4MQUA 3UIEA 4MDFA 3AWIA 4ZVVA 4EGJA 5DSZA 4GI7A 2WFMA 4ENSA 3NXSA 3PKZA 4UM5A 3MBOA 6LDHA 4GT1A 4G1EB 4KMOA 3CMCO 2RIPA 1V16A 3H8SA 5K0GA 1LLDA 2Y0CA 3TL3A 4C2UA 2FPGB 2WP0A 4JP2A 2QP9X 3PNLA 4QYTA 2PJRA 3EF0A 4LHZA 5JQGB 4MR7B 2EL9A 2GAFA 2OV1A 4TZ6A 3TB4A 5H9WA 2QZZA 2MINA 3F49S 2Y1XA 4UMFA 4DMHA 2ZXEA 4MZXA 3MJFA 4YP7A 1D6JA 3VZBA 3DLCA 3QHPA 4F12A 4A1FA 4YONB 1RCUA 1X6VA 2VDQB 3EDRA 3LHSA 2NW6A 1CUGA 2OUKA 4BU1A 5A2GA 5FOQA 2RGAA 1FQWA 2D1SA 3BBLA 3KKLA 4Z8YA 3SKVA 1C3VA 3TQIA 2O8BA 1N25A 5CK5A 3D0OA 1H8HA 3M89A 4FUTA 4HRVA 6Q21A 5JAIA 2B4YA 1J20A 2I2DA 2A8YA 3AI2A 5BNZA 5DIFA 2OHXA 1I5RA 2WUGA 5J4HA 1WP4A 3TINA 4OB8A 2H17A 3KX2A 1ONBA 2VPPA 4MAFA 5KQRA 2OBXA 3WO1A 5L4SA 4X5OA 1LDEA 2OYRA 4D3DA 1X74A 2EQ5A 1SKBA 2AS0A 3SZOA 4CR8A 4CEHA 4NENA 4YAUA 1XTPA 4H7DA 4FWIB 4PHCA 4GVPA 3RHZA 4OKNA 3TLBA 1W52X 5JECA 3IP8A 3N0RA 4KQFA 1G38A 1WTAA 2XQJA 3O1JC 5HZGA 4LYDA 3RIEA 4GXTA 4RABA 5JYEA 1LFAA 1UPFA 5E2BA 2IZZA 3AEZA 1IWPB 2JNWA 1ZK1A 3IMGA 5TMDA 5K8LA 3A1WA 3OF3A 2GGSA 2FN3A 1GLNA 2XF2A 2ZP1A 3BL8A 3D2LA 5NULA 4DR4B 3C3EA 1NXWA 1UIRA 3V4OA 2VH2A 4RIFA 5JE8A 2VQFB 1LK0A 2Q8PA 1ZMXA 4LCEA 1ZBQA 3TRIA 3ETJA 1VKOA 5DEIA 1NG1A 3B48A 4PRKA 1CNMA 4TKUB 2I2AA 3K0FB 4MUFA 1OR8A 4YDHB 5IYZF 3Q7PA 4L5AA 3TLGB 3IVXA 1PJBA 1E1CB 3ADPA 3NNDA 4QPZA 5HIIA 4LQDA 4R41A 4CM9A 2OECA 1F1JA 2IZ0A 3FUUA 4TVSA 1VJ1A 1BN6A 2PMCA 1EUYA 2VXBA 3STHA 1WDLA 1X92A 2JGDB 2YNMC 4RNDB 3GDWA 3NHPA 5AFSA 1WJGA 2QG9A 4LVUA 3P0FA 2AG8A 3E3NA 4JLSA 3QI2A 3PDJA 4CGYA 2YJZA 2X8WA 2ZYRA 5AOVA 3WK4A 4BX9A 3NHRA 2A35A 3GW8A 3O2QB 1QPZA 2GN8A 3BSWA 3DMGA 3H2IA 4M46A 5AW8A 4MAAA 2W2LA 3GG2A 4N5HX 2VEOA 3DLHA 4U8HA 4YJ3F 2W0MA 3CNLA 3OPQA 5ISMA 1EX9A 4LZAA 4GLJA 4RVDA 2C29D 4BMXA 4OHVA 5K05A 2HLPA 3JQGA 5BO5A 1K66A 1V43A 2C9ZA 2VC2B 2W6JA 1DC6A 3IULA 4MYUA 2QRMA 1K27A 4EYEA 1MEEA 5BWOA 3BD9A 3ZJTA 4G2TA 4D9BA 4WVLA 1X86B 2E18A 2MSNA 2WD7A 1T3LA 1C81A 3VNQA 4CW7A 1AKYA 5K0JA 4B40A 4BPRA 2XCTB 5KYYA 4BMNA 1X1QA 1HT0A 5KWIA 1J2RA 5ALGA 1E8MA 1WOMA 3TTTA 5C1PA 1IQ0A 4MVJD 1EFKA 1TU4A 3ONDA 2IV7A 2XE4A 5G53C 3RUDA 4QUEA 1OGYA 1OOEA 3HQ4O 3MM4A 3TDKA 2ZVDA 2OLEA 2JEOA 2V65A 1P4HA 2XE6A 1MEJA 3OE4A 3OZ7A 4F60A 4MLDA 4OGFA 2EWMA 1EK6A 1C1DA 2CFRA 2PD4A 3G23A 3WZ2A 1YUNA 1VA5A 2HZBA 1ZN8A 4CNQA 3TKAA 3C5HA 1WAMA 2I0FA 5CHEA 1MA0A 5BWNA 1TO1E 3BMCB 1NI4A 1Q7EA 1JEYA 1EFPB 1SGWA 5A9TA 1JNXX 3V46A 2Q29A 3PT5A 4G2NA 3KQSA 1JFFB 1X7XA 4JENA 3UWDA 4KAAA 1JPNA 1LUAA 1OY1A 3K8ZA 1JSXA 5DRTA 5GGYA 3VTKA 4ZO7A 1CW2B 2XQIA 4EELA 2B1IA 1J25A 1ZP6A 1P2GA 1R37A 2FWNA 1E9BA 3KQQA 3M81A 4M0PA 1JFSA 1AQIA 1XFDA 3KXIA 1LS6A 4GNRA 1RNLA 4I9NA 4KBYA 4DIFA 2DUNA 1CUBA 3HKCB 4HDNB 1D6MA 5I51A 3K70B 5CYFA 2IT1A 4NCJA 4Q39A 4AP5A 1F17A 3GI1A 4MTLA 5FADA 1L4YA 4RACA 2DPXA 1SBNE 1TCAA 5COBA 3SS7X 3HL4A 3NBKA 4LYYA 4RF5A 1GPLA 2PLNA 3PICA 5G0WA 4JITA 4CLOA 5IWAB 1BHSA 2A9OA 1RQXA 3IQHX 3MOIA 2VT6A 4Y0AA 1ZH8A 4MO2A 4YRLA 3RO7A 3WJAA 3WLQA 2KS6A 1C1YA 4A6XA 4K9SA 3NOXA 3PRHA 1ZRNA 3PHBE 4CMHA 3JTEA 1YJXA 4RELA 1L5QA 2G4LA 1Y4AE 3NEAA 1SOUA 1CIVA 1XNQB 5CVVA 1K8XB 3DKVA 1QKJA 4NE2A 3A37A 2NO7A 4MRSA 5DBHX 1GUAA 4CLEA 4ASUD 2QG6A 2V3CC 1MJNA 3ENWA 2A14A 2X86A 2ZVJA 2B7CA 3CLSC 3NATA 4O4JB 3ZDYB 2IE8A 2IVZA 5J58A 3PI7A 3LX5A 4OV6B 2I3AA 1HDRA 1JLHA 4NBLA 4GU5A 5BPHA 4WNCA 4ZAXA 5B4TA 1II8B 4RM2A 1Q12A 3B9BA 2Q99A 2EGUA 1MFPA 3FYUC 5HNKA 4UMEA 4JEUA 1XTVA 3VV2A 2EKBA 4UUBA 1KK1A 2VHZA 1DTSA 2R1ZA 3JW8A 1XROA 1VPLA 1AQUA 3CO5A 1TJ4A 5FWXA 1YOVA 3RTEA 2R25B 2V9ZA 2XB4A 4A0HA 1I4LD 1W59A 2VK8A 3I4CA 1Q0TA 1DGQA 1JG6A 3L92A 4IX1A 2H48A 3RAGA 2CV1A 2X0FA 5HGJA 3NBQA 3MJRA 1Q5PA 4PX2A 2W6ZA 1H2AS 1UOQA 5SYAA 2MTBA 4AZ0B 4P86A 4L95C 4LQCA 4HUTA 4A36A 1GNSA 3DZDA 2C84A 3H1FA 4D3XA 1KH3A 4X1KA 5EE0A 1R4AA 121PA 2UYYA 3LOPA 4XSVA 5E3JA 4JHLA 2QAJA 3P0HA 3ZUGA 4GR4A 3VI3B 1RXYA 2WE8A 4J9UE 5K3FA 1FQOA 3WXBA 3HJGA 4P0QB 3KALA 2VNJA 3FA2A 4FYIA 1Y6FA 2X42A 1CF4A 4UOEA 1FBNA 5ESXA 5FUXA 4WA8A 3LPNA 3BJEA 4UMDA 4I1RA 3W78A 5BMVB 3MQ4A 3NRJA 1DZIA 1JEOA 2ZPUA 1BVUA 1VBMA 2V5UA 3AF2A 1YDEA 3CRRA 4BQOA 1EE1A 1W4AA 2R84A 4D4HA 2DFNA 3G49A 4RD0A 1TVKB 1NVDA 1N5LA 2EW8A 3SQLA 4R9RA 1UBLS 1DFIA 5D1HA 2XKKA 4GKJB 3ESZA 4I5GA 3COYA 5CGQB 4PG4A 1CRWG 3P9PA 4E11A 4K88A 4BNIA 3IA7A 3DTVB 4HXYA 1E2QA 3LNTA 2VJBA 1UL1X 3OM8A 2G9RA 3DWGA 3TN7A 4CEIB 4AKIA 3SZ3A 1T1RA 3GJ4A 2DPYA 2P9YA 2ZUCA 4N65A 3EFOB 1U1EA 4NFSA 3SM9A 1EM6A 1BDMA 3LKBA 1PVOA 2Y9PB 1NJ6A 1ADGA 3GJZA 4WY8A 4JXZA 5AW0A 4RQTA 3M5PA 3JQBA 1PT7A 2MSKA 3V2IA 2UUPA 3ETCA 3HI4A 4HBGA 5IF9A 2AHOA 3QJYA 2CKMA 1Y7PA 2I7TA 3KV1A 4C06A 3WMWA 3RS8A 4OHBA 4W4TA 1QDUA 1R3UA 3CE6A 4MQFA 5IAAA 2C77A 2XWPA 5ANRB 3VX3A 3HM9A 4BNXA 3PGA1 2GD1O 1XQVA 2I4NA 1EEHA 5KKCA 1LSSA 2E5LB 2PX8A 2ACVA 2FX3A 3ZJYA 1A50B 4UCXA 3TAXA 2RI1A 4O02B 5CB4A 5JC8A 1DJQA 1G5TA 3CZAA 4IQ0A 2QN7A 1LWOA 1KL7A 3B1VA 1Q11A 1YS9A 3H2BA 4NZMA 1YBFA 4KR9A 4UU1A 5C1OA 2QI9F 4E13A 2Y1LA 2H0RA 4CI0B 2P0AA 1KWGA 1BXRA 2JARA 2Y1CA 4OI1A 1G8YA 2IQIA 4TTIA 1TQ2A 5JASA 2CNKA 4OQDA 5CDTA 1M2OB 4ND4A 1Y3FE 3LK6A 3ORQA 4IRMA 4UD6A 2P68A 1NPDA 1LWNA 4OFWA 3VAYA 4QTXA 3KQVA 1KI9A 2GK3A 1J56A 3A9SA 3G85A 4WZBB 5COAA 4QUBA 1XMVA 3C6KA 5AXDA 4ZEOA 4G4GA 3QA3E 4S1OA 5IMBA 5JCPA 2YYAA 1FFSA 4XCQA 1ZWKA 5D3MA 4ZOCA 1NOKA 2IK8A 1DO2A 3PI6A 4H3SA 2UXCB 1UAGA 4Y9DA 3VPAA 3A3PA 3OQBA 4ZOLB 3WLAA 4WTOA 1RAEA 3PSHA 3DFZA 1RYYA 3SP1A 4EI8A 3GL9A 4FMBB 3MAAC 2W83A 3FRHA 4B0PA 4TLEA 4KRFA 4MW1A 4FHEA 4Y1FA 1QR6A 1Y7LA 4TUYB 1VKJA 3A9UA 4TRMA 2WAMA 4J03A 2ZDHA 3ZWOA 4X41A 4BCBA 4ILEA 1PEYA 1J5EB 1TAHA 1KI4A 3AFMA 2PUFA 1P44A 2V4ZA 1XQWA 1O6ZA 1UWLA 3SZLA 4OLBA 1XCJA 5CDGA 3ZPXA 4R5MA 5HQ3B 1ISIA 4JBIA 1QXSA 2D4HA 1I32A 1ECJA 2A5DA 1QZZA 2FSPA 1WCIB 2Z58A 4FEYA 3X1XA 4UBNA 1G7TA 3C41J 2QY9A 4IRUB 3SSNA 3X3HA 3OQ1A 3D1LA 4BTLA 2RGBA 4MGKR 1EM8A 2PS9A 3FB1A 4F93B 4RWEA 3W7VA 1QH1B 3LRXA 3AHDA 2TMYA 2ZRHA 1E6MA 5EZYA 4G0WA 1RQ2A 5BNIA 3PR1A 3NTLA 3RC3A 5F1OA 4YLEA 3DP9A 3QKSA 4NU5A 4U2GA 4WMLA 1BQEA 3HKEB 3NFRA 4B35A 4OU4A 1G8FA 1H2XA 4GMKA 1HUQA 2EJVA 4CU2A 1XRNA 4BGDA 4HR7A 2FEMA 4ZT6A 4V0SA 1H05A 3D6HA 1DRUA 2JKZA 5JS6A 1C8BA 5HDQA 2HJWA 3K4PA 5FT9A 1P45A 2DVMA 4HDSA 4CM6A 4D0LB 4DR1B 2QT1A 1CY0A 1N32B 2XOKD 4PG7A 9GPBA 2L0XA 3KQTA 1B3BA 4WZAE 1NHGA 1ENZA 5L45A 3DKIA 1ZY2A 5ALRA 3VR4D 5DN6A 1L4KA 1XDGA 3U7EB 1HZJA 4M1MA 1NMSA 2CEAA 4U3JA 5EWJA 3BPSA 2NSLA 5E9WA 1WB9A 4B6PA 3VR6A 2GA8A 3FGZA 3LKVA 4IJWA 5DHQA 3DZFA 1YU6A 3OWOA 4G09A 4N47A 1FNBA 2GSDA 1GSIA 2JIBA 2FTKE 2YL2A 5BN5B 4F9TA 4KXMA 3R3WA 2PUBA 3O90A 1N3LA 1CZOA 2J0UB 4O8ZA 4OK5A 1NLMA 1P1KA 1PV2A 1U1FA 3D43A 3DHWC 3T35A 3UWKA 4B4DA 1J70A 3R5FA 2SECE 1UBKS 2P1RA 3BFXA 3LWNA 1ECFA 2FF7A 3SXUB 5M5BA 1YRYE 2Q4OA 2ZB2A 2DERA 1KJZA 1IBSA 1VJDA 3FNFA 3HDJA 3O4IA 1KETA 3QPCA 4F6CA 1RI4A 3KETA 2OFOA 2YS6A 1CQPA 2NXEA 5CIQA 5EHNA 4HO1X 2OXTA 3UKJA 1MAWA 1NPTO 2GJ8A 1HRDA 2HU2A 1B1AA 2KW5A 2XWQA 4AJ9A 4B4OA 4F11A 3QUQA 4ZK2A 5K0SA 1P2VA 4BUCA 1QFXA 5K20A 3UATA 4S35A 1R6BX 4YJFA 4ZMBA 3VOBA 2G9VA 2PWYA 4IUDS 1EFHA 2VQ6A 1L9XA 5KJEA 1VBKA 2D06A 1H2YA 1BCSA 3GLVA 2JI6A 3LQKA 2QRGA 1UFRA 4BNUA 3N6XA 1C0IA 4OIFA 3T3EA 5EHZA 3MK31 5JR3A 1IEQA 3AJ9A 3NTXA 4FS3A 4LOLA 4AN1A 3E8MA 1MGPA 2XDYA 3C45A 4KN5A 2R66A 4N5DA 1H3FA 3SC2B 1IJBA 5JZVA 5IVHA 4JKYA 2HU7A 2L2QA 4X1IB 2Y1FA 1D7AA 1TI7A 2J6HA 3GOHA 5F21A 5JG7A 3J80A 2H7XA 1NMZA 3FF1A 2D8MA 4DSAA 2QLTA 4RUKA 2OKGA 1E4EB 1ZA2A 2XMSA 1FYFA 3A9TA 1G66A 3FUVA 3FWHA 3FWKA 3QG5A 4QBHA 3ZHQA 4ZCRA 4TXHA 1EVYA 4YFYA 3WSWA 1DRVA 1JHZA 1RE1A 4QYMA 4IP0A 1YB4A 1R10A 5GJCA 1UFOA 5AVKA 3G2IA 1FVXA 1UPCA 2ECQA 4I46A 4Q1VA 4ZQFA 1S2NA 2JK0A 1N2OA 3G89A 1IAVA 3GFTA 4OYHA 1B00A 4YRRA 2G0NA 4D25A 3DR5A 5IT9A 4XOUA 1KGSA 3EY9A 3GXOA 4EQ6B 3VH1A 1O0SA 3VHXB 4QQNA 2DAPA 2XAUA 1TIPA 3NH9A 3CONA 3HTXA 1X0XA 2LDBA 1JDJA 2IODA 3QKIA 1EHYA 1YZHA 2OO5C 4PHFA 5ADVA 1A76A 1TO6A 2A88A 2OFWA 2R00C 4DIOA 2NUPB 2VH1A 4REMA 5AVUA 4KDRA 4MWEA 1PTJA 4PQRA 3ZH9B 2EBUA 3OZTA 1TZ2A 1Q7TA 1IC6A 1URPA 4WNAB 1MOSA 4J2OA 2ZTLA 1XQYA 2BW0A 4ACAA 2QZPA 5KBYA 3TG8A 5EMLA 4RULA 4Q4LA 1VL1A 5MN6A 1BXGB 1L4MA 3TLJA 3W5DA 4LC9A 4P22A 3FR7A 4L74A 5ALIA 1ISHA 1E7WA 2PT6A 2Q0XA 3VC2A 1C8LA 2FUCA 1T9CA 4GM4A 4TTPA 4TVKA 3WOHA 1SXJC 3PHGA 1FZTA 2EKDA 2I71A 3D8BA 4GYJA 2D5LA 5J4LA 3G0GA 2FN9A 4WN9A 4NATA 3U13A 2QK4A 3DHYA 4JA0A 4FOPA 4AMBA 3QELB 1DTWB 4RLHA 1LF5A 2BZ1A 2XBUA 3IR5A 3CVWA 1H8ED 3L7DA 1Z62A 1E0DA 3KT3A 3PCTA 1IPEA 4RKQA 3AM4A 3I6IA 1UOEA 5B7PA 5JY1A 4JYPA 3JQ6A 1FF9A 1H2HA 3IDSA 3ETEA 3H42B 4I8IA 4D5EA 4CODB 4EHLA 3K1AA 3FBGA 1IBCA 2UYGA 4J0GA 5ALDA 1GGNA 2DFPA 2X6QA 1WIWA 3K2BA 4YDQA 1JDTA 2XUKA 4LXXA 4KGXA 1PJZA 4B85A 4Z4GA 3H5AA 5JVDA 3PDWA 4LDZA 3BE6A 4JLAA 2JRCA 4RANA 4JJKA 3BKXA 1W36C 1JHUA 1J0AA 1ZI6A 1NW4A 4HB2A 4ZYLA 4MARA 3RYIA 3L6CA 3TM4A 1ZQ1A 1Y37A 1MQ9A 2O48X 4RJKA 1X8XA 5JARA 2ZIFA 4OBBA 3GC6A 2PZGA 4WI1A 1XYYA 1REQA 2WE7A 2JIRA 1N3BA 3GAFA 1CS0B 3KCQA 3M5DA 4QBGB 2X9NA 2EJWA 4RYDA 1IOZA 3OZRA 5TRTA 4C4YA 4TX1A 4EG1A 1QB8A 3DWEX 2LPMA 4KQWA 1RYZA 4EENA 2V9PA 4FNMA 1NC1A 2OUIA 2OCXA 3BH6A 4AZTA 2XTNA 3N5CA 4FCCA 1ZC4A 2EZ9A 5DBGA 3ZHCA 1XZKA 1E6KA 4XTRA 5EWMA 1MRNA 2XNDD 1AUXA 2ZYTX 3F2IA 1HMYA 4TTSA 4MUAA 4N9QA 2VNSA 3BWMA 1FDSA 4TXLA 2LCQA 4BVEA 3PDCA 1UPTA 3QWIA 5JH7B 3V4RA 2A0FA 3OPYB 3KKPA 1RP7A 5CM2Z 1M2FA 3WQBA 2VHXA 1B8NA 2BRUC 2NZXA 3HUDA 5E6RA 4LF9B 1WPGA 8AT1A 2BY4A 4UNPA 5KNLA 5CEFA 1JG7A 3QMMA 2A0UA 4HRAA 3F71A 1NXPA 1GNVA 1CDZA 3QTTA 1G2QA 1U02A 1Y1PA 2QTMA 2OYCA 3WNVA 3LLUA 5KX5F 2HA5A 3QXJA 5BR8B 3PUYA 4U2BA 4KO4S 5J2UB 5DM70 1ESEA 2OAEA 4CQMD 1ZM3A 2UZ0A 3L18A 3PUKA 4BO9A 4QHYA 1IXZA 3QMWA 4YP6A 3MMZA 3LKZA 3P4UA 4XIIA 3WL5A 5C7LO 2G9QA 2C2XA 4L5CA 1IXSB 2HHAA 1UBUS 2OXRA 5FCDA 4KP7A 1E2PA 3BSSA 4DEYA 2CWDA 3ONVA 1EWQA 4KQ1A 2P77A 1CUYA 2XMGA 3K09C 2C3OA 5CD9A 2PGNA 4MW5A 4RZSA 5D5PA 4ZQHA 2WIFA 3JWIA 4L57A 5IYZA 1L7DA 3D3WA 4G36A 1U7HA 1WPXA 5FOSA 2EAUA 1HOXA 4N9WA 4ZV9A 3PNYA 3A6JA 4B9EA 1QIKA 4ZT2A 3JZMA 4M53A 1AS3A 2JFZA 5CVTA 1S8AA 4MQEA 1GPJA 2XIQA 4GMHA 5A5GA 1T26A 2C20A 2Y68A 4RL6A 4BUZA 4MPRA 3LXUX 4H7EA 4KG7A 2BEKA 1Z5ZA 3N8GA 2IYAA 5KS2A 1USVA 3LCJA 4RD2A 1JQAA 3VHLB 2BM9A 3DM5A 1UBTS 4O08A 1CZNA 1E3TA 2I4LA 2X1HA 3FDJA 4GGOA 1HLPA 4PZLA 1FMTA 3AEQB 3X1WA 1QP0A 4HPXB 3VKUA 3FWYA 4TS4A 3G68A 2A2ZA 2HK8A 2GRAA 4LK2A 4YJ3A 1J33A 1E8DA 1R16A 4RYLA 5AW4A 4B3HA 1JJVA 3LPCA 3OA0A 2PFGA 5KNCA 3PWSA 2QRJA 2JAQA 5GVRA 3GRKA 1I7PA 1BGVA 1CLEA 2JLBA 3FWZA 3ZY2A 8ADHA 1RJ9B 1LBIA 4INAA 3GFPA 3GF4A 3QMPA 1I0ZA 1PR5A 2JL1A 2P4SA 2V3WA 2VLIA 4BIIA 1JSCA 1E61A 3MCAA 3OTOB 1SUBA 4REQA 1YV9A 1NIPA 3VSDA 3WMEA 4ASUA 1THTA 2QX9A 3C4VA 1OLOA 3Q8KA 2EU8A 2RHBA 2XTJA 2XQKA 4LVCA 5EEGA 1GAQA 1R88A 1N5RA 1G4UR 3GGOA 1N6HA 2FW9A 4MTCA 1Q0UA 3LX8A 3RHTA 3TVYA 3B3AA 1DWQA 4MYHA 2D00A 3HN2A 2O0KA 5JEDA 3JQPA 3FKSD 1IATA 2PMFA 4IJ5A 4ZCTA 2C0QA 2FFJA 2VVTA 2W6IA 4W9NC 4TN5A 1FW8A 1KVUA 4DILA 2ENWA 3IVRA 1K89A 1FVFA 1HI9A 2Z3WA 2NVBA 3P19A 1HV8A 4YROA 3SBXA 4E5SA 1O89A 5A4JA 4PWZA 4PC6A 1YQGA 3CLRD 2QMUA 4PHGA 1Q20A 4JD5A 5G0TA 1PVDA 2IP4A 4D97A 4R84A 3PDIB 1U0RA 5C1DA 4K03A 1F2VA 2SCUA 3NI2A 3B1ZA 4C7VA 5ILOA 2PKQO 2PSEA 1H42A 4D9IA 3O9MA 1U5CA 1W1IA 3AP1A 4RS3A 5DNWA 4LZOA 3FOCA 1A96A 1ZM4A 5BMOA 4BXOA 2CLDX 4ID3A 3QFRA 3DB1A 3VZCA 1TKAA 2YQZA 4BGVA 4OCZA 2EG9A 3N8HA 1DIHA 3BRQA 4ZC8A 4B3BA 3JWPA 1MC1A 1RYDA 3A4MA 1NZJA 1CZLA 4HMOA 3V7NA 3N2LA 1A9RA 4OHPA 3AGQA 3CMMA 3V80A 4INOA 3DVQX 1HG1A 2LV8A 2H11A 3SYRA 3ZHYA 3WAGA 1J0XO 1P5JA 4KWCA 4MWOA 1T5IA 4U7DA 2I33A 1FUEA 1RLIA 2HEGA 1T5OA 3PGMA 4Q3CA 4Y6GB 2ZU6A 1LRJA 3DKPA 5EA2A 5EGNA 4DJDC 4EPXA 5BYKA 1CEYA 2VH5R 2ZBGA 1GFIA 2DOKA 2IY7A 1QOPB 1KBZA 2XDWA 1IN7A 5C81A 4HH1A 1X42A 1BDIA 5I5GA 1X87A 2C9BA 4BLWA 5EP3A 1UXOA 4L78A 1FU4A 4JJ4A 1G21E 3ZWNA 4GUDA 4QO7A 1TQ6A 4WXPA 5B6IA 2P8SA 3N8DA 4EGQA 1FTYA 5HA5A 1UZMA 1JA9A 1JXOA 1SUSA 2PSDA 4G56A 4UBKA 2XV1A 3ECAA 3GRZA 5IK2D 2LKCA 4YRFA 3SSMA 1NQXA 3QFSA 1KC3A 2D0PB 4D99A 1SEVA 4J90A 4DKXA 1KEVA 4YRCA 1Z29A 3CRVA 3LA6A 3LVQE 3L0PA 2V5AA 3ADKA 1OX4B 1FTNA 5ECDA 4QELA 1RM4A 3EUFA 4W5HA 4WKBA 1O97D 4FLEA 3TLKA 2C83A 4U0JA 1W1WA 3I61A 3N70A 4FE4A 1QRUA 4XDGA 1ULHA 4FYPA 1MNAA 5FTLA 3UPTA 3T4EA 1YI8A 4WEQA 1ATIA 1HX7A 1XTSA 1EIZA 4P93A 3W77A 4D56A 1AM4D 4X85A 5HVNA 4KGDA 2HBQA 4Y1GA 3FHJA 4W8GA 1XL1A 2JGNA 3RU3A 3LT4A 4BYMA 1V8PA 1E59A 4FILA </