5T1DH

Crystal structure of ebv ghgl/gp42/e1d1 complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
213
structure length
213
Chain Sequence
EVQLEQSGPELVKPGASVKMSCKASGYTFTDYVISWVKQRTGQGLEWIGEIYPESGNTYYNEKFKGEATLTADKSSNTAYMQLSRLTSEDSAVYFCAEGYAMDFWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein H
publication title Structural basis for Epstein-Barr virus host cell tropism mediated by gp42 and gHgL entry glycoproteins.
pubmed doi rcsb
source organism Epstein-barr virus (strain b95-8)
molecule tags Viral protein
total genus 26
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t1dH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t1dH02
1GGUA 5SWSE 1QHPA 1LNUA 2VDQH 4Z5RA 3C5ZC 3BKJH 2MPAL 4PB9H 5I0DA 3QG6A 4OM0H 4KK6D 4OUOA 2IF7A 5I1DA 5J06A 5GS1C 5L8LB 3KAAA 2Q8AH 1FLRL 1YYLH 3K1KC 4YGVB 1NC2D 4U1IA 5TDNB 1S7XA 2XQBH 5GGSY 2P47B 3BESR 4IBLT 1T6WA 4JM2F 1RQ5A 3UJTH 4XGZA 4XVUC 1PQZB 1T1ZA 2AQ1A 3WFBL 5IMMA 1A14L 1ND0A 4WTWA 4ZODA 3FQRA 3QWRD 1RD6A 1PG7X 2ARJB 2FBJL 4ZUVB 1AGCB 5C0AB 3PWJB 3RJDA 1RIUL 4QHNB 3V4PH 3QWQB 4EVNB 1HHGA 1HSBB 3O45B 2RIKA 4O2EA 4YXHL 5T3XE 1RK0B 1X5YA 3BP5B 5HI3D 3LEVL 3IU3A 1WTLA 2AJVH 1TZIB 2XFXA 4G9FB 1KPRA 2Y36L 3CFBB 4JAMA 3WEXA 2YD3A 4NQEA 3OAUH 2BMKA 2B7DT 2A0LC 4LSQL 3JBG7 4UNTA 2CXGA 4UILL 1ZKAA 2J5LC 2X9XA 4G6JL 4LNRA 1HKFA 3NAAL 3NCFB 3EBAA 1HH6B 1YEJL 4JREC 1FPTH 3OR6A 4YHNB 2OSLA 3G6AB 3V6FB 5IBLD 3QP3A 1E4KC 3W9DA 3CFCH 5DK2B 4XTRD 5F7WC 4WEMB 4HLZG 4EI5A 1S9WB 4DKEH 4Z77B 4FQIL 3D0VB 4AENB 5I1IL 4W4OC 5SWZE 3QQ4B 1MI5D 1GSMA 1XEDA 1T66D 4FFZL 4F15C 4R4FH 2IADA 3KR3L 4EXPX 1JFQH 4M6MH 4PUBH 2ADFL 2LE9A 3P40A 1V7NL 5DD0H 3FFCD 5EUOE 1XT5A 2NTFB 2OLDA 4I3RL 3FT2A 4HJJH 4H8WH 5DJ6B 2A1WL 1E27A 4YDKL 3ARBA 1N0XH 2V7NA 2Z8VC 3MROA 4PY7B 4PJ7E 3IF1A 5ETUB 3I6KB 5HHXL 4A2LA 3LS5L 3DO7A 3O11B 2YD1A 2BNQA 4KRPC 2AJZA 5DURD 5IOPA 3B9KA 5KSBE 4XI5D 5IMOB 2DAVA 1WIUA 3CVHH 4HW6A 3B9VA 5DZOA 4CN1A 1AKJB 1CFVL 3D69B 4MXQC 1P53A 2X4PA 2I07B 3D0LA 4QRPA 1NL0H 5IJKA 1F2XK 4O2CB 2P5EE 3SKOA 1R5VB 1RK1B 1KTLA 4DGYL 4M5YL 4U6YB 2NY4D 1J0YA 2HJLB 2NY5L 4K7FA 1MF2L 1ZHKA 4ZAKD 1JGLL 3HUJE 4UU9A 4UNVA 3FHQA 3U9UB 4Z7UE 1DLHA 1LMKA 1QEWA 2A73A 5C70A 4YO0B 5T1LD 3PF2A 3QUMB 3DSNA 3D39B 2OXHA 1IEAB 1QA9A 3RIFF 4OZIA 1I7ZB 1Y0LB 1JZ4A 1PZ5B 3C09B 2NY1B 4JGJA 1RUPH 2PO6A 1RJZB 2V5SA 4JRWA 4PG2C 1IILE 3S5LG 4KROC 3SDDA 1CG9B 5DS8B 1GAFH 5F97E 5DQJA 2F53D 4MB3A 1FC2D 5F6IC 3ESVF 3VCLB 3CDFA 5IMLB 2EE2A 3LKQB 2GFBA 5FM5O 3V6ZA 4Y4KA 1CD9B 2OTWA 4XCCH 2IH3B 1OSPL 5HYSG 3HFML 1OSZA 3MGTA 1MCNA 5FB8A 1T22A 5E9DB 1W8NA 3FZUD 3S4SB 4JN2A 2BRRH 1D5ZB 3BDYH 1J1PL 3CCHB 2GY5A 3RVTC 32C2B 1I8IA 4UTBL 3U0TB 4HF5L 1RUML 3PDOA 4LEOA 3Q3GA 2R2EA 4JJ5B 1NBVH 3ZTJG 3S8WA 3TN0B 3MO1A 4NT6A 1JWUB 1FORL 1N2RA 3CUPA 3GJFH 4LCUB 4PRDB 5FM5M 4JPVL 4NYLA 3RNKA 3QEGL 3FOMB 1NGZB 2A6IB 3SJVE 5MENA 1LP9B 3VI3F 1JUFB 5KAQF 4PBXA 1X5FA 5HD8D 4G6FD 4HIHB 5CS7A 3QHZH 1F02I 4UI2A 4GT7A 1DBBH 3KWWB 2DWEA 4CJ1A 1RULH 3OKOA 3FAXA 5EU7C 1JHKL 2NZ9C 2QSVA 3QH3A 1C8PA 2VDPH 3KPMB 1NCWH 3DIFA 1U8QB 3L7EA 4Y16A 4DK3A 4HPYH 4J3UA 4RIRB 3GB7B 2GAZB 3VGDA 1D5BB 1JMXA 5LQBH 2DN7A 3GMOB 1BBJB 4JY6B 4OF7A 3G5VB 3UJIH 4C56D 1P7KA 3SE8L 1AFVL 4Y19A 3VFPB 2HLFC 1BD2D 3TCLA 5CP7B 1LK2B 2Z8WC 5JZ7D 3BIKB 3QO1A 1MFNA 5CBEB 1U8JA 3RUGF 4PJHB 5GGSB 4N0RA 1F6LL 5IF0B 3K81A 1Q1JH 1X5ZA 4KKBC 1RZFH 1I85C 1UZ8B 4GRWB 2BOBB 5KVGL 5K9JL 3BVNB 1JI1A 4OLYL 2BSTB 3QG7L 1TENA 2FR4A 3SEPA 1YECL 2WQ8A 5ERWA 2VDNH 3WJJC 2WQRA 4OCWL 4P5TB 4NKDA 2AJ3B 3OR7A 1MRCL 4GAJL 3ZE1E 4YE4H 4C54A 4GXUM 4N0YL 4U6XB 5C07D 4ENEC 1OPGL 1MJ7H 1BQLL 4PG9B 4H25A 3D18A 5KSAC 4HXAH 4LLWA 4JFFB 4U1LA 1F6AA 2H2SD 2UV3A 2CIIB 3LZFH 1MHPL 1HK6A 1SY6A 1KTDA 5MP6H 3FQNA 5EOQH 5D9SB 4S1SL 5CJQH 1R3JB 3MOBH 4LCWD 5DUML 2HH0H 2I9LA 4KUCD 2ZUTA 3PV7A 2CK2A 3UTQB 4NM8L 4OZFB 2GITB 4Y1AD 2HT4D 3CVIL 3U4BH 3CC5B 2VZVA 5I6XC 4HH9A 2W0FA 1GOGA 3CK0L 3P9MB 4K3DH 2GJ6B 4EUPG 3WFCL 1TIUA 3SQOL 1KIRA 3W39B 4Y4HA 5KANI 1TETH 2IG2L 4BKLB 4KHTL 1H3GA 1PFCA 2OJEA 5D71L 1CU4L 5EU3A 4JCLA 1AQDA 1X7QA 1R3LA 3MREA 3P0VH 5CGYC 4BSWA 3MRQA 1OL0A 3A6BH 4X4MA 1XZ0A 5F21B 1DE4B 3LQMA 1WJ3A 2EC8A 1U58A 2DI9A 2OXGA 5TE4H 2OP4L 3TO4D 5CEZE 3LY6A 4ZQKA 2I60L 2VJXA 1EHLL 1Z9OA 1OM3L 1EMTH 2D31B 3VD7A 4WI4A 4OCSL 5I16A 2IQAB 4H0IA 4IIQB 12E8L 1QBLL 1W72H 5F8QC 2Y7QA 3EYOB 3LKNA 3GIZH 4H1LA 3VJ6A 5CJXC 3ULSA 1SJHA 5D7IF 1J8HB 4LVOB 2VDRL 2WBJA 4WFHD 4HFUH 3CH8A 1DBKL 1YJDC 1PEWA 2PF6A 5B8CB 3OKNB 1NBQA 5T3XH 5E2UL 2Z35B 1MCSA 3ARPA 1YEGL 2ZCLH 1FNLA 4ODWB 5GGUA 4LPUA 2IQ9H 3SDXB 3U7YH 4X0KB 3FCTB 2PTVA 4RX4A 4DOHB 2NNAA 4O51A 5D93B 1WTGT 4HEPG 1TVBB 4DCQA 5HPMB 5JOPE 2F54A 3VFTA 2WUCL 5FDWB 5ICZA 4WFEE 2BVQB 3W82A 1JWMB 3BPNB 1FNSH 1TJGH 4HGWA 5DUBB 3OKLA 5ESVA 2NY2C 3S7GA 4G8GD 3ULVC 4PJ8A 4ZDHB 4X7FC 1WLHA 3WNPA 4PREA 3KNBA 2IH1A 4YBQD 5IHBA 3QEQB 3TVMD 4F7TA 4Y2DD 3HI5H 43C9B 4U2YA 2C3GA 1AH1A 5DJZB 1OCWL 4FG6D 2R8SL 4MJID 2V17L 1WISA 4PJFA 4DQOL 3QI9B 5D7JC 3UP1A 4JG1L 3T0ED 4R3SA 3ARED 3SE4A 1TNMA 4QHKI 4Z76A 4N0UE 1NJ9B 3SDAC 5E1AA 2DF3A 3H0TB 4Y5XC 2W9EL 4GQ9L 3VI4F 3TFKC 4NCC2 4AIOA 1BAFL 5ID0B 3VRIB 4MNQA 4M1CC 4WV1A 1T1XB 2UYLA 4IRZH 5CLTA 4EI6A 3A67L 4JFEB 1JYVA 4UOW0 2YPVL 3DROA 5DRXA 4TOYH 4XVTL 3KPSE 4GBXB 3SE3C 2IWGA 1NCCL 4JKLA 3V95A 3WNNA 4AEIL 2BY3A 5L2JA 3T08A 1K8IB 5KS9A 1FDLH 5BW7A 1K4DB 4LMQE 1QLFB 1CCZA 1MCOL 4ZUTA 2E6JA 2HT2D 5BRZE 4OZHF 3M8OH 1Z9SA 4ETQB 5GXBB 1MQ8A 4MQSB 5DGRA 4HZAA 1VDGA 3A6CH 4EQ2A 3LN5A 1G7JB 1INEH 4HMDA 3U0PA 4URTB 1FIEA 3IDNB 2DQJL 3K7UA 5C2UB 4YLQT 3CVHB 3QXDB 3TBWA 4X7DC 5CEYB 3C5ZB 1WIPA 4KRMB 1I1FB 4JFPA 4LHJB 1ZLVK 1MRDL 1S9XB 5FM8A 1WQVT 2QR0B 5GISH 3ZDYE 1ZGLP 2VWEE 1KELH 1UVQB 4JFQB 3C6LC 4RGND 1RUQH 1RU9L 3QEUB 3NCEB 3I02A 4YXLH 1HHKA 3F12A 4GRMA 5GS1B 1JPTL 4Y88A 4X83A 2PXYC 1JWSB 2YN5A 3RGVD 4MXWH 3GSQB 4POZC 2DIBA 5ILTL 4FQQB 4JB9L 2ADJB 4U6HA 3VFUA 1ZS8B 5ESAA 5FYJE 3RX8A 3UXFA 1QRNE 3EYFA 3O4OC 2E6QA 4O4YL 1JNLL 2BVPA 4KMQA 5CD3A 3ULVH 3TF7C 4DTGL 5TDPA 2KUTA 3MRGA 2GTZA 2AXGB 1ZSDA 3CSYB 5TPWH 3RY6C 4JDVB 4E41B 5DZLA 4PLJD 1NANI 2EXYD 3MNVA 4YGAB 3ARWA 4L1DA 5DD6B 4Z6AT 5BVPH 4JZJC 3C6SB 5HGBA 4HPOL 5F9OL 1A6AB 1GGCL 2DQGH 3SY0B 1G6RH 3FO2A 3T77A 1D9KC 2J5LB 3OZ9L 3NIFE 4JRYE 1RI8A 1QFWM 3IFPB 4JREB 2IAMC 2CKBA 2DTML 1JV5A 2CK0H 2PYEA 3ALXA 5INCB 1FL5A 3KPNB 4HT1L 3TM6A 2EDXA 1CE1L 2WBKA 3GGWB 2Q7YA 1T03L 4NRYB 3O6LL 3O6FD 4X5XB 5IT2H 1NAMH 3MBEC 2XTJC 3GJFB 3UPCA 1T3FB 1TTGA 4MAYD 1JF6A 3CFDB 1PY4A 4YPGB 3EJYD 4F15B 5CINL 3E6FB 3E3QE 1S7QA 5F7UA 3QUYC 1FYHB 1X5LA 1A8JH 1X4YA 5ANME 4NN7C 4PGCB 5EIIB 4CADA 1N6QH 5IG7B 1CICD 4M02A 3P9LB 2VXQL 4X6EA 4NHUA 4NHCL 4O58H 1I8LC 4LPXA 3FN3A 1QR1A 1MCRA 5DDHA 5FYLE 2BERA 5T33L 1I8MB 2B5IC 2YA1A 5A2IH 7FABL 4CU7A 2FZ3A 4ZSOE 4G9DA 2CUHA 5C0FA 1DQDL 4KRPB 3V5DB 3DVNA 1NKOA 4TPRH 4BFBD 1VEMA 2B4CC 2X41A 1KLFA 3MLRL 1TMCB 4JJHA 4XC3H 2EYSB 1DUZA 1MWAH 1XGQB 3JTSA 4OQ1A 5IBTL 4XPGL 3QNZB 4CAGA 2ILLA 1QFWH 2P7TB 3MR9B 3K4AA 3A6OA 4WO4C 2YA2A 4NM4H 5C09A 3QXTA 4KAQL 5HVHC 3HR6A 4DN4L 1DQLH 3IFLH 5TDOA 2E9IA 2EECA 5DFWH 3S88L 2ITDB 1H15A 4PRHA 2UZIL 5JIKA 4ZXBD 5GIRB 3RWHB 2WUBL 4GKOA 5DMGC 5GRXG 5JTWA 3C2SA 3FFDB 3O6ML 4KROB 1QHOA 3MV7D 3U7WH 1NLDH 3KVQA 1NMBH 2X89D 3ARDA 1I7TA 1QSEE 4LHUA 4TSBH 5F6IB 1AO7D 3LB6C 3GHEH 4RRPA 3EDJA 3WFDL 3SCMC 2PW2B 5SWQB 2NYYD 8FABA 3ROOB 4HK3J 1S5IH 1MCFA 2P42B 3MRNB 3CFKA 2AK4D 5CEZH 1VACA 1OTUC 4HDIB 4DN3H 3SDYH 1BZ7A 5JUEH 5C0BB 5EU6E 3TYGL 4YHZH 1JK8A 4P5KB 4G43B 5JNYA 4MCYB 4ONHA 4M7ZC 1UM6H 5IFJA 1U3HD 2FD6H 4F7CA 1B4JL 3UJJH 5JHDE 1OAZH 3MUGA 5HVGB 1KNOB 5SWSB 3VH8A 2JLLA 4G80A 2IEPA 1U8NA 5I1HL 2VXTL 1TQBC 5GS3A 3RU8L 1HH9A 3PWPD 2BCKA 4XCFH 3KLSA 1OAQL 5EO9A 3MLVL 3T1FA 4TVSa 1MLBA 4JZOA 1XCTB 4LDLB 3HI6H 3IETB 2CGRH 5E99H 2PW1B 4FQJL 4LDOB 4XPFL 3EJJX 3HC3L 1W72B 1H3TA 1YNTB 4F3FA 1IM9A 1L9NA 3DMMC 3MOAL 4OJFL 2VC2L 4JFZL 4OI9A 2EIEA 1OGAE 5E2WH 4P5MA 3SOBL 1VKXB 3IVKB 1IARB 3O4LE 4KTDH 4Y7MA 1UZ6E 2FEEI 2DMCA 4L3EE 2B4CH 3W0WD 4M1GL 3L3HB 3V8OA 5CBAB 2ESVD 3VXQA 3QUXA 4FQ2H 4NWTL 5EU4A 5EOTB 1AKJD 1EO8L 2YKLL 3OAYH 4P49A 1KEMH 1TPXC 3ZDXF 5DEGB 4XHJD 5DFTA 3WE6A 3L3OA 1P84J 2NY6D 5GHWH 3OHXA 3BAEH 4TNWK 4I3GA 3GNMH 3UBXG 3REWB 5FGCB 1BBDL 4X9HA 1XR9A 5JHLH 1QRND 1UADC 4ELMF 3STLA 1KPUB 3P4MB 5SWZB 2E3VA 3DETC 4V1DD 2HYMA 4HUWB 1INQA 1KC5L 5KJRL 1YNLL 1G7QB 3QIUC 3E3QC 2D4FA 4WGVB 5DMIL 1LO5B 1F58L 4XMPH 1IGIH 4UOJA 4ODUA 5JDSA 1ODAA 5EUOB 1JMZA 3VDCA 5KSAB 3T3PF 3QUZA 3PNWB 3PV6A 3Q5OA 3VXSA 2KBGA 4GUPB 2ZCHH 4JLRB 4KGLA 4C83A 3N9GL 3ILQD 1WAAE 4N1EA 2ZPKL 4PJ7B 1CZ8L 2HFGL 4GW1B 1CLOH 3WUWB 2VITB 5EORH 4LSVH 5I6XB 4NKMA 5IMKB 5KSBB 2E8YA 4CDHA 2X4QB 1NLBH 4Q2ZA 4Y8DC 3S36L 2OJZH 4QRQA 1HEZB 1XF5B 4KKNA 4BFGA 1AD9A 1IKNC 5JW4Q 5MERA 1MIEL 1KYOJ 1I1YA 2DLFH 1J5OH 2MKWA 2P5EB 4XBGA 2ZUSA 4RQQB 4Y19E 2F58H 5E8NA 2H8PA 5BJTB 4OZFG 1P69B 1IAOA 1SJXA 4YK4C 1T2QL 1I3RB 5ALBL 3GKWH 3SN6N 3WJLA 2Z31D 4UB0L 4F9LA 3HUJB 4P3DB 3WSQL 1TZGL 1FLTX 2AV1B 4Z7UB 2VXSL 4E42B 5CKAA 7CGTA 1NDGB 2F74A 2GT9A 4ALAL 5FYJH 5K9OB 4OSUH 5M94B 4OLXH 1U95B 4GSDH 2V2XA 4BSVA 4ZOAA 3HKFA 4IOIB 4YIQB 2VLME 4OKDA 2VQ1B 1ZOXA 2EO9A 4JKWA 2NLJA 1PD6A 2P4AB 3PWVA 3DJ9A 4PJBE 4L8DA 4KMLB 3HR5B 3JTTA 3TO2A 4LLYA 3L7FA 5JPNA 1NGXA 1HYSC 4XBEH 3SO3C 5TQ0L 3U1SH 3PWLA 4LPCA 1TTFA 3VXTB 2AAVA 1CF8H 1NSNH 5GGTA 4PRBA 1U8IB 2C4FU 3SKJH 1E4XL 3GSNL 3ARBC 4DKFH 1OD9A 2NY2B 5D7LA 3L5XH 2ADGB 1EUUA 1ZVSB 4M1DL 3OWEA 1RZ8A 4XRCB 3IJSB 1MFCH 2BNRE 3B9KC 3P11L 4W6WB 4NSKB 4QHLA 3MV9D 3VWJD 4WCYH 1IC4L 2AKRA 2DB8A 2V9QA 3TIDA 3LRSA 1P7QA 3K46A 1G7MB 5IROA 3S37L 5IJKC 2AJYL 1MCBA 5D7JB 3CZJA 1G6RB 1NFDA 1BQHA 3HZKA 3MRIB 5EZLB 2FL5A 2ENYA 4DEPC 3MRPA 1FVEB 3QA3B 4BZ1L 1GIGH 3SDAB 3KPPA 2FB4L 3GSXB 3BQUC 4Y5XB 4UT9H 4JFFD 3IJHA 4YNYA 1HILA 2EICA 2J88L 2EIZB 5FYLH 4P59L 4G42A 4OD3L 1NAMB 3TT1H 3NFPB 4AEHL 2OTUA 5D6CA 3DXAA 3SHSA 3QJHA 5E24E 4FHBD 1KENH 3UZQA 4Z78A 2I25N 2BVTA 3HZMA 1XF3B 1GCFA 3HNVH 2R1WB 4ZFOL 3SDCC 1B6DA 1R3HB 2ZKHL 1CK0H 5F7DB 5JA8B 3PABA 4X99B 2EDHA 2IPUK 1EHAA 1MFEH 1H9VA 3MCG1 1LE5A 1QZ1A 35C8H 1VADB 4TNVK 4CDGC 5GS0D 1A5FH 4TTDC 3W81A 5T3ZD 4RFEA 3QFJE 1FC1A 2P44B 4Q9CA 4ZTOL 4UT7H 4LCCC 2VR5A 3RVXD 2JCCE 4K3JH 4P46D 4HUUA 5EOCL 3MV8A 3DURA 2VLKD 1MWAB 5LJYH 2NY3C 1CGVA 5GSRA 1C5DA 4JDZA 2EXWD 1P1ZA 3C6LB 3B6SA 1W0VA 4PRPA 4YBLC 1AXTL 1YN6B 5D1ZD 1TVDA 3QDGE 2ZOKA 3MRBA 1E4WL 2PXYB 2NY7L 4KY1H 3BEWB 3STZB 4OZGA 2D4DA 3FRPG 2R0WL 4FFWD 2LAGB 3MACH 1IAKB 4POUB 4XAWL 3VDAA 4RGOH 2V9TA 2VZTA 3OXRB 1KYOK 3O4OB 1CDCA 1WFNA 3BN9C 4FZEL 1B0GA 3T2QA 3O6KL 5ADOH 1A7RH 2C26A 2ATKB 5FKPB 1X5KA 4Y16C 1JHTA 4JN1H 3V7MA 1H3PH 5HHOD 1ES0A 2R2BB 1ZLSL 4CVWA 1GZQB 3I6LE 3GI8H 5B22A 3UTOA 5IJVB 1F90H 1N8ZA 3EO9H 1RAMA 3QEQD 3RVVC 1NUDA 4JZJB 3CLFL 1PSKL 5IVXF 4F7EB 4Z7WF 4F57L 4UV7H 3VRJA 4DW2L 4X80H 1IL1A 1D9KB 3QPQD 1OF2A 5I1AA 5ICXB 4NWUH 4J3XA 4GJTB 3U82B 1U8HA 4N8CL 2QHRH 2IAMB 1NCTA 3EFFA 4YHYC 1J18A 1DFBH 3BMWA 1C5BH 4QHUB 4NKOA 4JFYA 4KHXH 4AK1A 1MJUH 2CDEB 4MJ6B 3CNKA 1VHPA 4BELD 1CGWA 3C9NA 5FHAH 1YYMH 4EZMA 4GKZA 3MBEB 5EO0B 2XTJB 1YNKL 2VB5A 3OXSB 1VFMA 4G6MH 5D1XC 3QIBA 3BDXA 5F89B 1QFUH 4DAGH 2DQCL 3TBSB 3QUYB 5JXED 3IXTB 2ZSWA 3PL6D 2XZZA 3LRGA 3RWGB 1W0YT 4NN7B 4JPWH 1UQSA 3AXLB 1I7UB 3NCJL 5GZNC 2ICEB 3WDJA 2E7LC 1PAMA 1DQQA 1FO0H 1CQKA 3TV3L 4NZTH 4LNVA 2B5IB 5F1NB 3L3JB 3CU1A 1UCBH 4BQCA 2VE6A 1IBGH 3B8YA 4PYHA 5I73C 3FTGA 1WWWX 2ID5A 5DVLA 3L1OH 3MRJB 3H2WA 5ACZA 5FA3A 5EBLA 3T65A 5IUSA 1RIVL 3SQBA 5CILH 3G5ZB 3FOLA 3IJYA 4WHCA 2AI0H 2MQ3A 3RPIA 4KH2A 1XH3B 3U46A 1KCRH 4X6DE 1LEKB 2F5BH 2HT3C 5IVNA 5D72H 2X4RA 5EN2B 2VKXA 4CMHC 4WO4B 1QO3A 4FXGA 4N0UB 3VGGA 4WUKL 1XF1A 5HVHB 5A16A 1FVCB 1RPQA 5B38B 2VDKL 4PJGF 4B53A 2CRZA 3Q5YA 5CKGA 4QLRA 5IB4B 4OKVB 5EU5A 4NQSB 2MPAH 1BQUA 1WZLA 1WFUA 3R06A 1Q9WA 3H9HB 4P4RB 3V6BR 4RMTA 3KPSB 1XGUA 3VWKD 3TLRA 3QO0A 4D0BB 2FATL 4J3WA 1ED3A 5HHQB 3U6RB 3ARGD 3PWUA 3AM8A 2NY5C 2HFFA 1I1AD 1BVZA 5HI5D 1JNJA 1FLRH 1W0WB 2FGWL 1R5IB 5E70A 1JIBA 1FNEB 3O8XC 3SCMB 3ZZ1A 2JB6A 1N6VA 4XNUL 4PTTB 4WDIA 5C9JB 3W9EB 3WFBH 5BRZB 4S2SA 2E9JA 2NX5E 4YDJB 1A14H 3KYOB 4D8PB 3LKRA 1BMGA 4QHMB 1IC7L 4WU7B 4M7ZB 3EGSB 1RIUH 4D0CA 3HE6D 4PJ8C 4P2CG 1KIUA 2VLRE 3OKEA 4X6CA 1RJLB 3LEVH 4FMKA 3QULA 3NZ8A 1TQBB 3H9SA 3G6DL 3K4ZA 1N5AA 5CSBA 3K8MA 4GKNB 3QCTL 2Z4QB 2Y36H 5JPMA 2HKHL 1XGRB 4MVBC 1A6UL 1R24B 2W59A 3OKDA 4QOKB 4LSQH 1S7WA 5KTEL 4OGXL 4G6JH 2BSED 4OFIA 4TQEL 1TFHA 3BKML 1KB9J 3NAAH 1WWCA 1YEJH 4NRZB 2HG5A 1U8LA 1II4E 3EO1A 3MNZB 4FZ8H 2A9ML 1YEKH 4OCXL 5IQ9A 5B4MC 3DMMB 1JCKA 4FQIH 3SGDI 1VFBB 3N0PB 3HS0B 4FFZH 1K3IA 2E9BA 3KR3H 1A1NB 1R5WB 4XXCA 3W2DL 4V2CB 4IRSD 2ADFH 4Q6YA 3LH2L 1H8OA 4I3RH 1Q8MA 3MLPA 4UINL 4Z0XA 5C0JA 3G5YB 3KYMB 2D0HA 4HK3N 2A1WH 3MJ9L 3QISA 4YDKH 1IGJA 4EUPA 5DVNA 4I2XA 1TPXB 5HHXH 3LS5H 1YEHL 4NBZB 2R1XB 1NBZA 3ZO0A 2GY7B 3ELAT 1T5WA 4LVHC 5L7XL 3HC4L 1A3QA 3DBXA 1KFAH 5CJOL 3HMWL 4OF3A 1GH7A 2YRLA 5I0ZA 4Z5RB 2ZZUT 1SQ2N 4K23L 3KXFA 4FQXA 5IKCA 2NXYD 4PB0L 4L8BA 4M5YH 1M05B 4K9EC 3VGAC 4PY8J 3QIUB 1CL7I 3BP4B 1QBML 2NY5H 2X6MA 5B39B 3OPZL 4KROD 5I1DB 1MF2H 1JGLH 4PJ5A 5TH2B 5T1DL 2YUXA 1L6ZA 4CUCA 1WCBA 3MXVL 3GMQA 5ESQB 1OP5K 1FYTA 3GMNA 1JYNA 1T1ZB 2GJZA 5KVEL 2XN9E 3I2CH 4HS6A 3FQRB 5HDLA 4PJDA 1KLUA 1OP9A 4IRJC 5CUSL 5JLZB 2WV3A 4XBPA 3NGBC 4ZNEA 3RVTD 4L4TD 4JRXD 3WNLA 4Q58C 4QRUA 3MRKA 1D5MA 2CUIA 1G1YA 4NOFA 1B2WL 1OSPH 2DMBA 3WLBA 3HFMH 5KZCD 4QRSA 3RA7L 2PTUA 5DTFA 4B7LA 1G9ML 4JAMB 3HN3A 3WEXB 4YK4B 4NQEB 5IP4A 1CLYH 2IANE 4JGMA 1J1PH 2PTTA 4ODHL 3QNXA 4P48A 4PTUB 5GRJL 1T5XB 3CSBA 3UTZB 4UTBH 2KQNA 1PDKA 5HXMA 2YD2A 4W70A 4HF5H 5F1IA 1RUMH 1DVFC 1SEBB 4JPKH 3OR6B 3MQIA 1X5GA 2JJVA 1NCAH 3MJ7A 2CDFA 3QZWG 5IB3A 5BZDB 4QRRD 1FORH 3ARVA 3JUZA 3LEXA 4MQTB 2P49B 3P77B 4JPVH 3QEGH 4X9IA 5IEKA 4F33B 4UV4L 5B3JE 1MCHA 3VXRA 4R2GC 1QSEB 1HSAA 2ITCA 3UZVB 3SO3B 1FZOB 5TE7L 4W81A 5HSFA 5HYJE 1DQTA 4WI7A 3KPRE 3HRZA 2BC4A 1BJ8A 4EKXA 2HLFD 1JHKH 4KKLC 3QDME 1TDQA 5L6YL 5EU6B 1E27B 3E1F1 1FRGL 3ARBB 5I2IA 2BVYA 3VGFA 2V7NB 4OM1L 5F1KC 3IF1B 3QNYB 5JHDB 3DUSB 2PYFA 2J8UE 1H3UA 4P2RA 3B9KB 4PS4L 1KB9K 5CWSA 1X4XA 2IPKB 1AHWA 3OKKB 1ZMYA 2BY2A 3LSOA 1A2YB 5C0GA 2VDOL 4CVXA 2OBGA 2VLJE 5IV2B 4XPBL 4K9EH 2RGSA 5HYQA 1EXUA 9CGTA 1UC6A 1KTLB 5EZJA 5DRNA 4IMKC 4RGMC 3MLYL 4DEPB 3VG9C 5TQ2L 1EVUA 1SEQH 3G6JF 5KVGH 4OFVA 4PR5B 5K9JH 4ENED 4OLYH 4WUUD 3BQUB 3EZ8A 5HHNA 2A73B 1QEWB 3NCYP 5E1HB 1G9NL 3V6OA 5FA4B 3VFMB 1FZJA 5JXAH 1YECH 1OGAB 4WW2A 4G7YL 1CFSB 3MV11 2AW2A 4OCWH 3O4LB 5D7SH 5HTSA 4C57C 5C71A 3H7LA 1MRCH 4GAJH 4L3EB 2VOTA 3LIZL 4N0YH 1MNUL 1YY8B 4LCIL 1OPGH 1BQLH 1E4JA 2NTSP 3SDCB 5A2FA 3EDEA 3ARDC 4XP1L 3KPOB 4GMTL 1MHPH 5E2JA 3L3DA 4S1SH 5B3NA 5FUOL 2BFVL 1XIWC 3MGTB 3QDJA 5DUMH 4YGVA 4MDJB 3QAZC 5CGYD 4YHML 5TDNA 3CVIH 5J57B 1WZMA 3MRRB 3CK0H 1A7PL 5KVMC 4ONFL 4YHPB 4GRLD 1I8IB 2IG2H 4LCCB 2ARJA 4ZUVA 4Q9QL 4KHTH 1EZVY 5C0AA 3PWJA 5D71H 1CU4H 5JA9A 4N0CC 4QHNA 4EVNA 3ARTA 2NY3B 1RK0A 3BP5A 1PJ9A 4WI9A 3M45A 3MO1B 1N2RB 1JRHI 1NGQL 3CUPB 2GK2A 3MGOA 3RNKB 4YBLB 4XPHL 4G9FA 4MS8D 2MKLC 5GS2H 3MYZA 1UA6L 3O3BB 3CFBA 2I60H 4PJIF 4XB7A 3DUHA 1EHLH 2VDLL 3K8LA 1OM3H 3ARXA 4LU5H 4OCSH 1IGFH 1CXLA 4HV8B 5E7FA 2D3VA 12E8H 1OAUH 4PJ9C 2ARJQ 1HH6A 1J0HA 3QIWC 1ZHNA 4YHNA 4XPAL 1CE6B 2VDRH 3G6AA 4MA8H 2Q87A 4I0KA 4HQQL 1F4YH 4Y16B 5I1JL 5DK2A 1DBKH 4MCZB 2E6PA 2Z93A 4P9HL 3B83A 3BGFC 4HUKB 5E2UH 1S9WA 1PKOA 2G75B 1YEGH 1IGTB 3DXAE 5C08D 2WK2A 4AENA 4MD5B 2CR3A 5HHVL 4Y19B 5DT1L 5I1GL 1HNGA 2EE3A 2X9YA 3QUXC 5HGDA 4Y2OA 5DO2C 3O3UN 2WUCH 4LSUL 3ARSA 1GXEA 2NTFA 2HWZL 3RTQD 2DD8L 1FFPA 5L2KE 3INUL 5LWYL 1CGSL 5DJ6A 4L4VA 1YC7A 3EZJB 4PY7A 4YHYB 3X13B 4KVCL 1ZANL 2EDBA 1MH5B 4F2MB 2YMXL 1OCWH 2R8SH 3TFKD 3D85A 4S1DC 3ZLQC 5DD5L 3IAPA 2RB8A 3I3EA 2V17H 4OQTL 5FM4A 5J4MA 3BWUC 5D1XB 1JVKA 3D69A 2I07A 4JG1H 4P23C 1MAKA 4X7EC 3TJHD 4O2CA 4TUOA 5IEHA 1RK1A 4H25B 4U6YA 4PLKC 4LLWB 2HJLA 4U1LB 1M71A 4GQ9H 3NIDF 1UWXK 1H8SA 4TVPL 3FQNB 1BAFH 1ZLUK 3EOYG 2O5XH 3MPCA 4YO0A 1YYLL 3A67H 2VH5L 3QUMA 3ZDZE 3D39A 2YPVH 5FUCE 5I73B 4LLUA 4XVTH 3VRLE 4Q7DA 1I4FB 1I7ZA 1NH6A 1RJCA 1PZ5A 1NCCH 4HH9B 3S6CA 3X12A 2BNRB 4AEIH 1IGYB 1RJZA 3UDWA 4R7NB 2FHFA 4UNUA 4XNQB 1CG9A 2OJEB 5DS8A 3RZCD 1RZ7L 4M3JA 2OCFD 5I30L 3ZKMD 5I18H 1TITA 3SPVB 3U83A 3VCLA 5IMLA 3LKQA 1X7QB 2EEBA 3MXWL 1W2KT 4K8RL 4R4NC 3DX9B 4CMHB 1NPUA 5EBGA 5E9DA 5C2BH 1E6JH 3WL9A 3WJLC 1WAAF 4NKIL 3HE7A 4ZQKB 4P2QD 3S4SA 4H0GA 4U1SA 5ICYA 5ALCL 4WHYH 1A6ZB 4EDXB 1D5ZA 3DV6B 5D70H 4EQ3A 3V2AR 5JW4M 32C2A 5L8KB 3U0TA 3ULSB 4NQDD 3CFJB 4OD1H 4JJ5A 3C60C 4BQ9A 5B38G 3B3IB 3CFCL 1JWUA 1JPTH 4LCUA 4PRDA 4U3HA 4K71C 1NGYB 3P9WB 3FOMA 2A6IA 5C0EA 3T1WA 5GGUB 3B9DA 1IRAY 3O8XB 3HA0A 5FOBB 1CFQB 2HMID 5DJDB 3BPCB 3RFZC 5ILTH 4JB9H 4EIZC 2NNAB 4O51B 3G9VA 2QKIA 4I0PA 5D2LF 2F54B 4O4YH 4PUBL 1WWBX 3MMEB 1T1YB 4DTGH 3F7PC 1D6VH 2VSDA 4HJJL 5BZWB 2COQA 4H8WL 1F4HA 4PJ8B 1U8QA 4PJBF 3ZYIA 1JF5A 1CQYA 1QBAA 2GAZA 2D7MA 1D5BA 2HTLC 5D7IA 1U8MB 4OFDA 3GMOA 4KI5E 1BBJA 4JY6A 4M6OL 4KMTL 4DGIL 2IMMA 4RMSA 4KTEL 2XTJD 4J2XA 5GGQH 3OZ9H 3WIIL 3QDGB 3H6JA 4HC1A 2P45B 2HLAA 4LSSL 4PJHA 4YHOL 1VENA 5GGSA 4WTZG 3JUYA 4X7TB 3QUYD 4G3YH 4HT1H 5JQ6L 1CE1H 4QXUL 1F3RB 2AXHA 1T03H 1UZ8A 2BOBA 4HUNB 3O6LH 3BVNA 1HI6B 3O2DL 1NCBL 2XZCL 3OG4B 2UYLB 3I50L 4HWUA 4TSCH 2XYCA 4DVBB 5CINH 4P0DA 4P5TA 2R4RH 5CZVL 4ZMAT 2AJ3A 3TBTB 4U6XA 2ICES 1GAFL 3AU1B 2VXQH 4XNMB 3T0VA 3NFNB 4NHCH 4ZUTB 5T33H 4E0RA 7FABH 3V8CA 1R3JA 1DQDH 1A7QL 4FFVD 5HY9B 4LVNC 3UTQA 4LLDB 1MRFL 4LVHB 3FO9B 3U0PB 4OZFA 2GITA 3CC5A 3MLRH 4APQD 4DUWA 4QGYA 5EPMB 3P9MA 1X5IA 2GJ6A 2WIIB 4YPJA 5IBTH 4XPGH 3W39A 3EIFA 4NN6C 5C0CE 1INDL 3DNKA 4UDUB 1JN6A 3PHOB 4OI8A 5DMGD 1F3JB 1V7ML 3QUKB 4TNVF 3N06B 4U49A 3VGAB 2X44D 4Z95L 3H8NA 5I66A 2IPTH 4KK8D 1X6NA 3F12B 4KAQH 1CDYA 1RV6X 3V5KB 1G7IB 4WWKD 4DN4H 4S11A 3OGCB 5IM7B 1WF5A 3OB0H 4O00A 4OCRL 4YC2C 4OZHA 5AZ2L 5DMKB 2CKNA 3EOBB 1S7VB 2D31A 2WUBH 3QHZL 2IQAA 5E8DL 3VXME 4IIQA 4M7KL 2JCCF 2Y5EA 1S9YB 4J3TA 3MODL 3EYOA 3O6MH 4IRJB 5CD3B 1J8KA 1BREA 1J8HA 3WD5H 3NGBB 5DHVH 1UM4H 3WFDH 5B8CA 3BUYB 2Z35A 4ODWA 4X6DB 5DVMA 4X0KA 3FCTA 4PJAE 1MCPL 3TH2T 2C5DC 5ISZE 4UQ3B 3UJIL 1HXYB 4K55A 5F1SA 3TYGH 3C2AL 4QOKD 2HRLA 3FO2B 4Y5VC 4DGVL 5HPMA 1MY7A 4FA8A 5FDWA 2BVQA 1JWMA 2NY0D 2CXKA 5DUBA 1DVFB 1MHCA 1ZWIB 1GJIA 4ODVL 1JV5B 4Q0XL 1FL5B 5I1HH 4ZDHA 1Q1JL 4JQXC 1NUFA 3RU8H 2DQHL 4DZBB 1MIMH 2C4FT 1OAQH 3DMMD 3MJ8A 1SJEB 4R2GB 3IDGA 3KXFE 4FTVD 1I9JL 5HHPB 1VB9A 4U1HB 4BM7A 1IEHA 2ENSA 3QI9A 3BH9A 4FQJH 4RFOL 3IDYC 5D5MF 2NX5B 4NNPL 4YE4L 3HC3H 1DANT 1NJ9A 2XXMB 2XI9A 4FQHB 4OJFH 4JFZH 1MFBL 3H0TA 2YPLD 1JHLL 3ZL4L 5DDHB 3SOBH 1BP3B 4NO0A 4PLNC 5ID0A 3VRIA 5I8EB 2XQYK 2VLRB 2HH0L 1FG9C 3HZYA 4M1GH 4PRID 5TE6H 3MJGX 4LQFH 1AJ7L 4KI5C 4GBXA 4NWTH 1KCLA 4EN3C 4GG6F 1QP1A 3BOVA 3IAGC 1EO8H 2YKLH 4MNGE 3GSVA 1K8IA 1KN4L 3RJQB 1VEPA 4RGMB 5F70A 2EYRA 1KN2L 3QCVH 4JHAL 1QLFA 1U6AL 4KV5F 3VG9B 2FO4B 1WFOA 3I3DA 4NFBA 1IEBB 1LILA 3A6BL 5C09B 4ETQA 3BUTA 4NO5B 1WCQA 3OF6A 4Y4FD 3TEUA 5BCAA 1BBDH 1G7PB 1T0PB 1YPZF 2NCMA 1G7JA 3TA3C 4HK0B 3VXPA 1C1EL 1T4KB 3IDNA 4AH2B 4WEBL 2V2TB 4NKQB 4POYA 1EMTL 2HFEA 3CVHA 4ODSL 1CDIA 3C5ZA 3FRPA 5KJRH 1YNLH 1IT9L 4N90D 4PV8B 1F58H 4JFQA 3ILPB 3ARDB 4LHUB 3K0WA 4P2OC 5I1LB 3QEUA 2MTPA 4HFUL 4DWHA 3WNKA 5GS1A 4NUGL 5C6WH 4YAQB 1XIWB 2JKXA 3N9GH 1JWSA 2ZCLL 3QAZB 2ZPKH 4EIGB 4WVRA 1K9TA 1YUHB 2IQ9L 1CZ8H 1EJ6A 2HFGH 3U7YL 3GSQA 1OT2A 3CFKB 1VACB 3JWOL 2ADJA 3ULUD 1ZS8A 2EH7L 3SKMB 1JK8B 2X4UB 5JNYB 1D5XB 4ONHB 1FCCA 1UXSB 1YMME 3L9RB 5FYJU 1ZT4A 1WEJL 3MUGB 5SX4I 4MJ5B 1TJGL 5CAYB 1MIEH 4NC2B 1HZHL 2AXGA 5F1OB 1U8NB 3CSYA 4E41A 4JDVA 3I75B 4Z8FL 2OX5A 3AY4A 5DD6A 2N56A 3MFFA 5EO9B 3C6SA 5ALBH 2OZ4L 4EI5D 4UB0H 3T1FB 5E7BA 1A6AA 4JZOB 3WSQH 2VXSH 3P4NB 4ALAH 3WKNA 4PJEE 3FMGL 2DQUH 4PJ9B 1K5NA 2DIJA 3QIWB 3IFPA 2W1NA 2XN9B 4F3FB 1IM9B 3GGWA 4Y5YC 4NRYA 5MHSE 3ARBD 3BGFB 2I26N 2N4IA 2XQYG 5TQ0H 5H37H 3GJFA 1T3FA 4GG8B 1LD9A 4AT6A 4W4OA 1H3XA 3P73A 3P3YA 4KKAD 3CFDA 4YPGA 5BO1L 3X3FL 2BNQD 3E6FA 3B9KD 3VXQB 3QUXB 3BFOA 3RL2B 5EU4B 15C8L 4LOUC 1A1OB 2YD5A 2IANB 3IS1X 3QSKB 3GSNH 2YD7A 4PGCA 4QRPD 5EIIA 3CH1B 4WW1A 3GMRB 4ZFFA 2VXVL 3WE6B 4M1DH 4WIQA 4Z0BL 4JPIB 3RWJB 3P11H 2IGFL 1EAPB 5BS0E 3ZKNC 4JZNB 1NFIB 1MCCA 5IVOA 3A6CL 1IC4H 4QHKJ 1OOAA 4XX1G 3S37H 2FLRT 2Y6SC 3OX8B 4FQXC 2EYSA 4F9PC 1OTTD 1XGQA 5HVFB 4P23B 1HINL 2Q86B 4HX1B 2HFTA 2PO6D 1HHHB 3QNZA 1QYGH 1ADQL 1NC4B 2VSCA 4JM4L 5GRUL 4BZ1H 3SDDD 2FB4H 1KELL 3OJVC 3MR9A 2FDBP 4YXLL 3QDMB 4JVUA 3ZHDA 4JFDE 4UIKH 5DC9B 1BF2A 1IGCH 3P0YL 2J88H 3Q6FA 4P59H 1PBYA 4Y4KD 2APTA 2EDEA 2H2PC 4OD3H 1G6VK 5F93C 2Y4SA 3BDBA 5GIRA 3RWHA 2J8UB 1QNZL 4TTDD 2NXZD 4PG2A 4Q2ZB 3TBYB 2ZKHH 1BIIB 2VLJB 5E94B 5F9JA 2FECL 5T5NG 1UH3A 2NR6C 3ZT5A 4XBGB 2H45A 2YEZA 3QWOA 1OWRM 2Y07L 1T0MB 3PG2A 4G6KL 4LFHD 4KKCD 2B39A 5DJ8B 3ROOA 5BVPL 3VI3E 3MRNA 2R0KL 4WFFE 1LEGB 2EDKA 5MEND 4ZTOH 5C0BA 3RDTA 1BFTA 4L4VE 1G6RL 2A38A 4P5KA 4G43A 3NN8A 4MCYA 5EOCH 4JM2C 1UT9A 1KSRA 1DR9A 5F7KC 1T7WA 1KNOA 3O9WC 5SWSA 5JDJA 2C3XA 3TYFB 3C60B 3FHAA 1IAIL 4TYUA 4L8DB 1K2DB 1UKTA 4PJCF 4Y16D 4K71B 1SYVA 3L7FB 2NY7H 4N5EC 5TF1L 3T0DA 3OGOE 1Z9LA 4GAYB 1XCTA 2R0WH 4DVRL 5HGHB 4L3CB 1YEEL 3IETA 4XAWH 4K2UL 5KN5B 4FZEH 4LPTA 3RUGE 3UX9B 3O6KH 1AGEB 1EFXB 1P4BL 1JYXA 1W72A 1YNTA 1N6QL 5D7LB 3KYAA 1ZLSH 3BP7A 4IOSD 1QSFE 3B2UC 5DHVB 1F4XL 2J1KA 4P3WA 1VKXA 3IVKA 1EIBA 1NUGA 3GK8L 5KW9L 4Q6IC 3CLFH 4PJXF 4XCEA 4FN0A 3GRWL 2F9BT 4D94A 3L3HA 3ARFC 4F57H 5CBAA 4DW2H 3QXAB 5D1QC 1GOFA 4R26L 4XC3L 4ZO7A 1QFHA 4NQCE 2HTKC 2XKNB 5JOFB 4N8CH 1BX2B 1WBZB 2CLVB 5CJBA 3KPPB 5DEGA 4JO3L 5C0IB 1I85A 4GAGL 3NCBB 4N0FB 4J4PA 5DJCB 3REWA 1YNKH 4MJ2A 3B8SA 2OZ4A 4P9ML 2DLIA 4GFTB 2AXFA 3DXAB 3LN9A 1KPUA 3QJHB 3P4MA 5SWZA 4Z78B 3WJJA 5AZEL 1J05A 2MHAB 4HUWA 3QEHA 2Z0BA 1BFSA 3AB0C 4U1NB 4Y4HD 3QHFL 1GGBL 3VD3A 3NCJH 3BXNA 1Q38A 4HKZB 5EUOA 3W11C 4ERSH 5KSAA 3PABB 5L2KB 4LHQB 2Q3ZA 3BZFB 3TV3H 4GUPA 3R4DA 4JLRA 1NEZA 5C92A 4YDIL 4LVNB 4HWEL 4GW1A 2CLZA 3WUWA 5CEZL 4MSWB 4DN3L 2ZOLB 4HKBB 1A4KB 5JUEL 1Q9KB 5IMKA 5KSBA 4HUUB 4NN6B 2RFXB 2X4QA 3UJJL 1HEZA 1OAZL 1XF5A 2DJUA 2NW2B 5GSRB 1C5DB 4A6YL 4LPWA 3B6SB 2P5EA 2KQMA 3IRZA 4PRPB 4XMLL 4RQQA 4NPYB 4WUKH 5BJTA 2WBJD 2V5YA 2QSCL 2VDKH 5BQ7A 4X8JB 2ZOKB 4WWID 1U8KB 1I3RA 2UWEF 4JFHD 3HUJA 4P3DA 1FCGA 2ZNXA 4ZO6A 2AV1A 4YC2B 4Z7UA 4E42A 3RVUC 1N26A 4KVNL 3JSSA 4RX4D 1QFWI 3GBNL 2UUDH 3JZ7A 3OL2A 5K9OA 2X05A 2F54D 3CU7A 4Z7QF 1ZT1A 2FATH 1EHXA 4IOIA 4YIQA 4R6UA 2VQ1A 4R90H 3RWDB 3VW3L 3IXAB 2Z92A 4PJ8D 3RAJL 1AQKL 4R97C 3HR5A 1N8ZB 4WNQB 5H8DA 4XNUH 3AREA 4AG4L 4HWBH 2APFA 4KTDL 2P5WE 3VXTA 2R56L 4Q9RL 5JR1L 2XKSA 1P5VA 5FO9B 3WO4C 5E6IC 1U8IA 4FQ2L 1FFOB 4Y5VB 1IC7H 4F37K 3DX6B 1JGEA 1OF2B 2OK0L 5I1AB 2W65B 5AUMB 1CVRA 5A2LH 2DQIL 5I15L 1U3ZA 2VAAB 3BPLC 4P4KC 1KEML 4PBWD 4OV6F 2ADGA 3VE0B 2Z8RA 5ACMA 2V7HA 3G6DH 2VNCA 2ATPB 3QCTH 3HRPA 4XRCA 2HKHH 3IJSA 1A6UH 5B4MD 4GKZB 5E03A 4NSKA 2VL5B 4YHKL 5KTEH 4OF6A 4MNQD 3HG1E 4OGXH 4HS3B 5JHLL 1KB5L 4TQEH 3SJVA 3PQYD 5D7JA 4GMSL 1U3YA 1G6RA 3IU4L 3D2UB 2ZSWB 3IDYB 4I5BB 4RFNC 1KGCE 1F3DJ 3NA9L 4HD9A 3T8XB 3WN5A 1FVEA 2A9MH 1F4WL 3QA3A 4OCXH 1SVCP 5AG9A 4FXKA 3SDAA 5FK9A 5LBSL 3GSXA 5LCVL 1DBMH 3LOWA 4Y5XA 1RUKL 3BSZL 1KJMB 3F6IA 3DYMA 3G04B 3KS0H 4HSQA 5EC2A 2EIZA 2VE6B 5F6HI 2AABL 4R96A 1NAMA 4ZPTB 5K93A 4YEEA 5ACZB 3NFPA 2RHEA 3RHWK 1DLFL 3LH2H 3SE3A 2R29H 2XACC 4UINH 3FN0L 2R1WA 2UY6A 3MJ9H 3DYPA 3VXUD 1R3HA 4TVPE 3U46B 2OJZL 2YS4A 1OARL 4XNYL 3GSNB 1OP3H 4CGTA 2AEQL 4X99A 2WLZA 2X1OA 1WICA 3WV0A 1JZ3A 3R0NA 1KJVB 5L7XH 3HE7C 1VADA 4RDQG 3HC4H 5CJOH 1FIGL 3TA3B 5EU5B 3UTSE 4XP4L 3L3KB 2VDMH 4K23H 3FB8B 1XCQB 4OV5A 4YFDB 4PB0H 3R06B 4BFIB 5FYJL 3MJ6A 1MWAA 4OLXL 2A6JB 2EDFA 3ZSSA 1QBMH 4DZ8B 1WITA 1ED3B 5BV7C 3D3VE 1HHJB 1DN0B 1V3MA 3C6LA 3PWUB 4L1HA 4P2OB 4PGDA 4BZ2H 5T1DH 1YN6A 3BW9A 2JB6B 1G9NC 2PXYA 4XBEL 4WDIB 2QADD 1TLKA 3CFEB 4RISL 3STZA 5DZNA 4C4KO 4KJPD 5KVEH 4I0PC 4ZPVA 4NQCD 1IAKA 1NSNL 1X5XA 3LKRB 2XWTB 5CUSH 4LHUG 4LMQI 1MVUB 4ZFOB 4RRPG 1YEDB 2ATKA 5IR1B 5FKPA 2R2BA 5C0CB 1YEFH 2PYED 1GZQA 1HQ4B 3NZ8B 3RWFB 2X1WL 3RA7H 1AGDA 4TRPL 5C3LD 2AJSH 3SGKC 4JZJA 1EDQA 5AYUH 4KZEL 4WCYL 3MNWB 2CDGB 4HAFA 4ODHH 5GRJH 3VH8G 4M9OA 1D9KA 4M03A 3TP4A 5ICXA 5JORA 5FHBL 6FABL 1U8LB 4KRLB 5FV1L 2IAMA 3VXMB 2DJSA 1GIGL 3FQTB 1QOKA 1JZ5A 2CDEA 2JJSA 4UV4H 4Y5YB 3U79A 4UT9L 3MRMA 2O93L 2AK1L 3MBEA 5FYLL 5TE7H 5EO0A 2HP4A 3EO0A 3OXSA 4JG0L 4WHYG 5F89A 2DYPB 2FIKB 4S1QL 2GEEA 1YY9C 2IBZY 1QFOA 3ULUF 4ZS6D 5ISZB 4PJAB 3TBSA 5FCUL 1SBSL 3BIAX 3IXTA 3RWGA 4EXKA 5L6YH 2EDRA 4IOFC 4GXVL 1S3KH 1FRGH 3MRCB 4G6AD 1I7UA 3WBDA 5JMOC 2ICEA 3V9FA 1NGWB 3Q6GL 1I8LA 4P9HC 1I8KB 3IRPX 3EYQC 1MFEL 1J1OL 2YK1L 5F1NA 3L3JA 1V3LA 4PS4H 5C09D 3OB0K 2NPLX 4ODTL 2ZP0T 3MRJA 2VDOH 5D2NE 5JIPA 1CXEA 1MI5E 2BDNH 4PRHD 3RNQA 1M4KA 2EDYA 3G5ZA 3QQ9D 3KXFB 4FQXB 4OGAC 4XPBH 5GRWA 4UT7L 1ZLWH 3RL1B 4S1RH 3S35L 4L8BB 4AJ0A 1Y6NR 3FFCE 2Q7NA 4I13B 4F58L 5BV7H 4CNIB 2VZ1A 4X7CC 5TQ2H 2DQTH 3F7YB 5F71A 5HI4D 5CZKA 3EOTL 1A3RL 5JW5B 4WO4A 3ARDD 1UYWL 4LHUD 4FP8L 4GKSB 4N0UA 2CRIA 5CGMA 4WHTB 1G9NH 1FVCA 3VFVB 2IFGA 1WCBB 2HN7B 3OKMB 4YFLI 1A6WL 3UTPD 3TT3L 5IB5A 1FYTB 3GMNB 5DJXB 3S9DB 2EZ0D 1KJ2L 3FQUB 5EH1A 5IB4A 4OKVA 4NQSA 1KB5A 3MACL 4RGOL 2DBLL 3LIZH 3QXUA 1MNUH 2WWKO 4J23A 1QVOB 4LCIH 4CW1B 2R2CA 3KPSA 4XP1H 4XBPB 4D0BA 4D0DB 1IE5A 1LDPL 1A7RL 4HFWB 3IKCB 3U6RA 2Y06L 2R4SL 4KDVA 1L6XA 2BFVH 4MNGB 4N0CD 5FUOH 4BUGA 2QJDA 5AAMA 3IFNL 3GI8L 3ZHLA 1FNEA 3SCMA 5GGVL 5AAWA 3DVIA 4N5UA 4KTYA 3MUJA 1B90A 4PTTA 3W9EA 2AEPH 5BRZA 4YDJA 1M7IA 3E0GA 3IT8D 5F3HA 3RVWC 3KYOA 1A7PH 4ONFH 3RP1A 1C08B 1XGTB 4D8PA 1LVEA 4Q9QH 1K8DB 5GS0L 3HPLB 3MBXL 4WU7A 2J4WL 3LMJL 4JM2B 5F1IB 4K94L 3K74B 3EGSA 4KK9D 4NC1C 4OZIF 2VUYA 5T3ZL 2BSSB 4H20L 3MFGB 3O9WB 2QHRL 3HNSH 2F15A 1RJLA 2F53E 4I9WD 5GGRY 3T3ME 1NGQH 3LEXB 4GO6B 1IM9D 5IEKB 1JPST 1MJUL 1CWVA 4K8RC 4OTXL 5D7KD 4XPHH 4GKNA 3UC0H 3VXRB 2Z4QA 1UACH 4PYGA 1XGRA 2ITCB 1R24A 4OB5L 1ROWA 4P2YA 1BEYH 3OKYA 4QWWD 1OAXL 2VDLH 1T04B 3TH4T 3MRDB 4HJ0D 4TULL 1TVHB 3DGGB 1QFUL 5T1MB 2BC4B 4NO2B 4G8FB 3AUVA 2EYTB 3QUXD 4NRZA 1OLZA 3TIEB 1LEIA 1BLNB 3CGTA 5ENWB 5A40E 2NW3B 5LVEA 5I1JH 3MNZA 1QRNA 5DQDL 4P9HH 4L8CA 3F62A 3REVB 1FO0L 1NANH 4NZTL 1VFBA 3WIFB 4P2RB 3KGRA 4KK6C 5GPRA 3AMLA 4KDTC 5HHVH 3HS0A 5DT1H 4Q6IB 5I1GH 1A1NA 1R5WA 4MD4B 4ELME 3LSOB 5C0GB 1S78D 3IAQA 4CVXB 2ZCKL 3ARFB 4LSUH 4S1DD 2YR3A 5D1QB 2HWZH 2ICWB 5HYQB 3G5YA 3KYMA 5KSUB 5DRNB 1CGSH 2AI0L 4Z9KB 3T09A 1EAJA 1WT5A 4ZD3L 3V7AG 1ACZA 3T3PE 4JRYA 2FJGB 2P48B 4KVCH 2W0KA 1ZANH 4OGYL 2BZDA 1V8HA 3K3QA 3QUZD 2R1XA 2YMXH 3VXSD 3MLTA 1DCLA 1PY9A 4U7MA 3RIAK 5CHNA 5DD5H 4OQTH 1KT2B 5D6DC 4LRIC 3O0RH 1BQHG 2J8HA 4C56E 5BVJA 1JZ7A 1J0ZA 4B7IA 1BD2E 2C1PB 1JBJA 1GOHA 3EYUL 1M05A 2XWBA 3QIUA 5FYKD 2LV4A 2Z31A 3AB0B 2YWZA 3BP4A 5DJ0B 2DDQL 4HUXB 5B39A 2YZ8A 4PGBB 3L3DB 4TVPH 5HYIA 4OF8A 3AS3A 5ANMA 3MUZ1 5TH2A 5T1KA 3QDJB 2VH5H 5DFVD 4NQVB 5ESQA 4JKKA 4R4ND 5IBLC 1TZHB 1RUAL 3T4AB 4XTRC 2X4OB 5I8OL 5LXGL 4ZSOA 5BS0B 5K33A 4AIXA 5D2NC 5TJWK 5JLZA 1RZ7H 1RZJH 5I30H 3C5JA 3DUUB 5FAAA 3MXWH 1IKNA 5C07E 2A6DB 2GI7A 5A43C 4K8RH 3UROR 3GBMH 3AY4C 3MGOB 4NKIH 4X6FA 5J7CC 4UZGA 4WU5B 4LCWE 4NN5C 5ALCH 3BHBB 4CN6A 4JFDB 3EHBD 2V2WA 5CP3H 2W38A 3GDBA 5T5NF 4PBVC 4Y1AE 4PTUA 1T5XA 2WMPA 3UTZA 2XWJB 1NQBA 2R1YA 3AS2A 3SE9L 1RIHL 2X2YA 4XI5C 3TWCL 1SEBA 1L0XA 1ZHNB 1Q9LA 4QXWA 5KG9B 1VPOL 1N5YH 1OAKH 2GSGB 4CU6A 5BZDA 4FZ8L 1YEKL 2Z93B 1ETZB 4ETYA 5FO7A 3P77A 4JHBA 5D7LD 3IB4A 4F33A 1A7OH 4LSRL 1PLGL 3NABL 4R97B 2P24B 4OAWB 1QSEA 4M7LL 1G7HB 2NY4C 5D96C 2BSRA 1FZOA 3N1PC 3OAZH 4ZAKC 5HGDB 2XA8L 1X5HA 3WO4B 1KJ2A 2L7UA 1J88A 4HIEB 4PJEF 5KVDL 5E6IB 4HXBH 1T7VA 1P7QD 1FFPB 1AR2A 1JTPA 3BGAA 5EU6A 1NMCC 3BPLB 4L4VB 1MJ8L 4P4KB 5GJSL 1QSZA 4LAQL 4NCC1 3QNYA 4UQ2B 5EIQA 5JHDA 4WFHE 3HC0B 4U1KB 3DUSA 3BWAA 2A6KB 4M6OH 3D87B 4KWUA 4XAKD 2DIAA 4KMTH 3D85B 4M93C 4XNXL 2IPKA 3OKKA 4DGIH 4KTEH 1KFAL 3MZGB 1A2YA 1DZBA 3WIIH 2B1HH 4WFGD 3AC0A 5C6TL 5IV2A 4LSSH 3BZ4B 4TUOB 4YHOH 5F44A 5IEHB 1O5DT 4Z7VE 1OW0C 3FZUC 4QXUH 1P4IH 1ZVYA 3O3AA 4RFNB 5M7QA 1M71B 4HIIB 4RAUB 4PR5A 5F88B 2ADIB 4G8GE 3RUGB 3O2DH 1NCBH 3BQUA 4L5FL 5FEBA 2XZCH 1S8DB 1WUNT 1SHMA 3I50H 2HVJB 2VTFA 1RZKH 5FA4A 4IDJL 3VFMA 4LLUB 1QSFB 1OGAA 5GGRB 4M3KB 1CFSA 3GM0A 1N0LA 3O4LA 3X12B 5CZVH 4FFYH 3ARZA 4MJIE 3I2CL 4AQ1B 5DMYA 4L3EA 4YWGL 1YY8A 1P9MC 3O2VL 3SDCA 1CFNA 2MQ0A 3T0EE 5IWLC 4PJFF 3DECA 1N4XL 3KPOA 3MV8D 4NQXA 1J0KA 3UYPA 2FJFB 1U0QA 4MDJA 4PRPD 1A7QH 4NNYA 3WL9B 1FO0A 3DRQB 1MRFH 3TPKA 3HE7B 1JL8A 4U1SB 5ICYB 1CLYL 3RDTC 4HJGB 2EE9A 1QSVA 3MRRA 4XHQA 2AP2A 1D7FA 4MA3A 4YHPA 1INDH 4KJWD 4LCCA 4ELKA 2X9WA 3FT4B 4I3SH 1V7MH 1Y18A 2WLYA 4JPKL 4Z95H 1NCAL 2OR8A 3H9ZA 3QRGL 2JJWA 4M7JL 5BV7B 2G60L 5JZ7C 2W91A 3V4UH 5IBUB 5KS9F 4HH8A 5C0EB 4MJ4A 1CIUA 2W0PA 4QXGL 3O3BA 4WJ5B 2JF1A 4OCRH 5AZ2H 1GZPA 5IVXE 1LK3L 4ONGL 4Z7WE 2QKIB 2HJKA 1R3IL 2YSSB 4HV8A 4I0PB 5E8DH 4M7KH 5LAXB 3LQZB 1WAAA 3MODH 5MI0C 4JHWL 3S36X 4HS8L 5IHZA 1CE6A 1Z3GL 5K9KA 5SX5K 2ZUUA 4UMGA 4MCZA 4KC3B 4MWFB 1FVDB 5J1AB 2WP3O 3KJ4C 1V3KA 1ACYL 4RGNE 2G75A 4U7KA 1IGTA 3BZEB 5D7IB 5JXEA 2RQ8A 1KCSL 2F8OA 4MD5A 1LDSA 5FXCH 1MCPH 4R8WL 2EEAA 1HWHB 2H2SC 2J3SA 4FQPA 4LKXA 3C2AH 1FHGA 3JWOC 4DGVH 1AR1D 1UM5H 3QIBD 4HMCA 1W8OA 2HLAB 1KF9B 2Y23A 3T2NH 4K9EL 4HLZH 4G7VL 4ODVH 3TJEL 4Q0XH 5AEAA 2HT4C 5D2LA 3NZHL 2DQHH 5KVFL 1SEQL 3X13A 1I9RL 1MAMH 4J4PC 4O9HH 1MH5A 1X3DA 4F2MA 1I9JH 1DEEA 1YDPB 4PJBA 1CYGA 5JXAL 1TTUA 1XF2A 5D1XA 3PXJA 2H9GA 4RFOH 5D7SL 3T0XA 1GPOH 2P5WB 1BZQK 4NNPH 3TO4C 5EO1A 4D9LL 1QD0A 1ZA3B 3UCRA 2JK5B 4TN9A 1MFBH 1UKQA 1JHLH 4OLWL 4YH6A 3ZL4H 3VFOA 2E7LA 4E0RB 1QLRA 2X4SB 1KBGH 3NCCB 5FGRA 2I5YL 4YDVB 3DVFA 4PJGE 5HJ3A 3DI2B 4MX7B 1AJ7H 3PE9A 1I4FA 3WCYA 2B0SL 4JDTL 4MD0B 4XP6L 2K7QA 3BGMB 3BKCL 2BNRA 1IGYA 4R7NA 4XNQA 3DX8A 5EWIL 3HG1B 1OGTA 1KACB 1KN4H 1JN6B 4M48H 2XY1A 3SPVA 1KN2H 4JHAH 1U6AH 2I24N 2FNBA 2FEDD 4X9FA 5I66B 2EKSB 3NH7H 5E6YA 4F8QA 3DX9A 2IFFL 2R0LL 3UTTD 5E4EC 5E8OB 1C1EH 4WEBH 4U31A 4OZHB 5ECJE 4EDXA 1A6ZA 3CDYA 4LU5L 4YBQC 4ODSH 1IGFL 2QV2A 4I8DA 3DV6A 3TVMC 4Y2DC 2GYSA 4RZCB 1IT9H 1OAUL 5DI8B 5HHMD 3QT2A 2UZYB 4FG6C 3CFJA 2FGZA 1FP5A 4MA8L 3B3IA 1F4YL 5T5FL 4NUGH 5FDYA 3ISWA 4K7PX 2HRPH 1NGYA 1ITBB 3AREC 5GSVB 1R3KA 2KZWA 3DV4A 3O8XA 5FOBA 1CFQA 3H9SD 5DJDA 3BPCA 1YMHB 3F7QA 3JWOH 1O7VA 5EG6C 1OQXA 4UDTB 2EH7H 1BGXL 2VZSA 3MMEA 4LPVA 3ZTJH 3GO1L 1T1YA 1WEJH 1MHCB 3QFJA 3UTSB 5BZWA 1FNHA 1HZHH 2OQJB 5CCKL 3MV7E 2JCCA 4Z8FH 4GW4A 3I84A 1AO7E 5DJ2A 5C7XL 3MJ8B 4QNPF 1U8MA 2OZ4H 3DYOA 3VMOA 3IDGB 2E7HA 1JNNL 4YEFA 4C58B 1QKZL 2HT2C 2ZUQC 3BH9B 3QDGA 2AK4E 3CXHJ 3FMGH 5F9WC 4O02H 3MCKA 1OTSD 5ID1A 3EDDA 3WN5C 3VFNB 4X7TA 1FE8L 5DC4B 1LWRA 2J6EH 5M95B 5J56B 5DK3A 1G84A 1HI6A 4QT5B 4NO0B 3BE1L 2O5XL 1R6VA 2WINB 4I18C 3PWPE 3HZYB 5BO1H 1KJ3L 1UH4A 3X3FH 4RGNC 5MEOB 2QSQA 4DVBA 1BVKB 1RHHA 3PP3K 1I9EA 2QHLA 4PV9B 2VL4A 15C8H 5LGJB 1NC2B 3TBTA 1J0IA 1PYWA 3GSVB 4FQXD 1BOGA 3AU1A 2VXVH 1UB5B 4XNMA 1Z5LA 2EYRB 5I18L 3NFNA 1F6FB 2FSEA 2MOVA 4HGMA 5D5MA 4Z0BH 4N68A 3RHWF 2IGFH 2QQNL 2B1AL 5JW3L 3E6HB 4PJ5D 3MLZL 5C2BL 1E6JL 4Y89A 4KQ3L 1HCFX 5HY9A 4LLDA 3FO9A 3VXPB 4KXZH 1TNNA 4PGEB 3F5WB 2LU3A 4PLJC 5EPMA 1FYTD 5E2TL 3W0WE 2HFEB 2EXYC 2WIIA 5D70L 3MTRA 1HINH 4MNHB 2ESVE 5I17B 1BJ1H 3T4YB 3RWCB 1ADQH 4UDUA 4JM4H 3PHOA 5GRUH 2OR9L 3GSOB 4NQUA 1F3JA 1IAIM 3QUKA 3CMOL 4OD1L 5EB9A 1I3UA 4XCYB 4FS0A 2XA3A 3V5KA 3P0YH 1G7IA 3OGCA 4OCYL 5IM7A 2VYRE 1KXQE 5DMKA 1JF1A 1A3LL 1A4JB 2N7AA 1S7VA 3EOBA 1QNZH 5DXWA 2KKQA 2YD4A 1ZGLA 3O6FC 1S9YA 1KPVA 4IRJA 4MAYC 5D2NB 1ZT4B 2GQHA 3WS6C 1D6VL 1MI5B 4V1DE 3EJYC 3QDHA 4MQXD 1NBYB 2E5EA 1T83C 4N8PA 1C7SA 3HMXH 3BO8B 2Y07H 2UZXB 4G6KH 3BRFA 3BUYA 2LU4A 4X6DA 3MFFB 1ZXQA 2GSIB 2NZIA 4LLQA 2R0KH 1CICC 4UQ3A 3D1MC 2PR4H 3IDXL 1CFTA 1HXYA 4NN5B 4EJ1C 4OFYD 5EUKA 5E95B 2ORBL 5GGQL 3FB7B 1K5NB 4M4PA 3C8KB 1JPSH 5C86A 5DSCB 2D9QB 5DURB 1DVFA 1ZWIA 4C55A 3FAWA 4G3YL 4U0QB 1B88A 3PGFL 3MSPA 2G5BB 1IAIH 2AQ2A 2X10A 3U36B 2JJSC 2JJTA 4DZBA 3B5GA 2EEDA 4PRAB 3ZHKA 1MQKL 2BVUA 2PUQT 3LEYL 5TF1H 4LKCB 1SJEA 1HDMA 3KLHD 1LD9B 4AT6B 4CL7A 3B2UD 5HHPA 3P73B 4DVRH 2NY4B 4U1HA 5D96B 4TSCL 1YEEH 4P2RD 4K2UH 2O61B 4ZAKB 4OIAA 4M7LT 3UMTA 2VQUA 2R4RL 5I8CB 3F7RA 1AP2B 3THML 2NX5A 1P4BH 5T1LB 5F7NC 5J3HD 1EEZB 4WW1B 4KGJA 4ZXBC 4ZFFB 4FQHA 1NMCB 4DKAA 4YQXL 2HTKD 3G6JE 1F4XH 5A3ID 4NDMB 5DD3H 3GK8H 5KW9H 4NQTA 1A0QL 4U0RC 5I8EA 2VLRA 3OBAA 2F53B 2IBBA 3CXHK 3GRWH 3GUTB 3DSFL 4PRNB 1CDGA 4M93B 4BQ8A 4Z18A 1WBYA 5KAQG 1LQSR 2DM4A 3G5XB 4R26H 3EYSL 2AJXH 2NYYC 2V5RA 4FQCL 4IMKA 5CJ8A 4JO3H 2FO4A 2IPTL 2O5ZL 4GAGH 1IEBA 1U3HC 4NO5A 4YXKL 2W92A 3Q6FB 3SGDH 1G7PA 2CO6B 3QDJD 4HK0A 2YA0A 4P9MH 1T4KA 1EV2E 4AH2A 3MV9E 2GTWA 1S7UB 3PP4L 2V2TA 5AZEH 4Z7OF 2X1QA 2CH8A 5IW1B 1B0RB 2XPGB 1CTNA 4ELMB 4PFEA 2K3TA 1Q0YL 1GGBH 3QHFH 4PV8A 3ILPA 3VFSB 3WD5L 5C0AD 4G6FB 4WTXA 5F9JB 4AIZB 5I1LA 3JVGA 1T0NA 1UM4L 1NFDF 4U1JB 4RMWA 2YEZB 3QWOB 3QDAA 4YAQA 1XIWA 4JFFE 4YDIH 2Q1EA 2FWOB 1YUHA 4HWEH 2DLGA 4PJIE 4G9FD 1WGOA 1AC0A 1F2QA 2OL3L 3RDTB 1FH5L 4KJQC 3SKMA 2X4UA 4JHZA 5FF6B 1ZT7A 1S5HA 3NN8B 1D5XA 1UXSA 3L9RA 2X4NB 3RVUD 2DTSA 4MJ5A 1FFNB 1RJYB 4A6YH 1BD2B 1RVFL 1UJ3C 2C4XA 4XMLH 3EJZD 3IDIB 3I75A 1MIML 2VWEC 2QSCH 3DRTA 3GMLB 5HDQL 3S4SG 3L3IB 2PETA 1SYVB 5EZIL 2DBJA 2YD9A 3B43A 4FNLL 4MXVE 2ZG3A 3KPLB 2DRUA 4XHJC 5IVZB 4KVNH 3P4NA 2NY6C 3ZYZA 3GBNH 5T3ZE 5F7EL 1DDHB 4PJ9A 1IQDB 3NFSL 5MI0B 1BFOA 3FB5A 3QIWA 4LAJH 4MZ2A 2XN9A 5GZOD 5IBUG 2VLKE 2I9TA 3WFHB 3VW3H 3T3MF 3V0WL 3Q5TA 3BP7B 3RAJH 1AQKH 3KJ4B 2YWYA 2QL1A 4LARL 4AG4H 5DD1L 4JGUA 3IDUA 3CDCA 5C07B 2R56H 1QQDB 3LAFA 4GG8A 1L0YA 4NP4L 4Q9RH 4XCEB 1CDJA 5JR1H 4YUEL 5IB1B 4HIXH 5TE6L 4LQFL 3L95B 3RL2A 2OK0H 3SDXE 2DQIH 5I15H 2CD0A 1A1OA 4LCWB 4OZGF 3ILQC 4D9RD 2IANA 4P3CH 1WT5C 3CH1A 3WLWD 3GMRA 3EFDL 5HBBA 3OTTA 4IHOB 3QCVL 2FCBA 3NIDE 1V3JA 3KJ6L 5DGQA 5HHOE 1U3JA 4JPIA 3RWJA 1EAPA 4JZNA 1NFIA 4YHKH 1NKRA 3GJEB 3L6FB 1FAKT 1KB5H 4MB5A 3QEQE 2AXFB 1T7YA 1MCWW 3D39D 4K3GA 3OX8A 4GMSH 1U92B 3LDBC 1J05B 1RZIA 3IU4H 4BYHA 4P23A 2NY1D 4KQ4L 2Q86A 3QEHB 4HX1A 3TO4B 4KUZL 2MCPL 2Z31C 4LPYA 5HYJA 3NA9H 1HHHA 1NC4A 1F4WH 3KPRA 1KIPB 5FGSA 4P2QA 3RIAF 3BXNB 5LBSH 5LCVH 4YJZL 1M7DB 1RUKH 3BSZH 3VFWA 2OMBA 3QDMA 4FABL 4JO4L 4LBEB 2O5YH 5EFIB 1Y6KR 4IDLA 1NEZB 2AABH 5E9DD 2CLZB 5ACLA 1MUJB 2K1MA 1DLFH 1ZLVH 3HE7D 4U3XA 3ZE2F 1UKSA 2J8UA 3FN0H 4UTAL 1MCDA 3DI3B 3M1BB 4YR6B 1EBPA 3TBYA 4I48A 1QUNA 1OARH 1UXWA 2HKFL 1BIIA 2VLJA 4XNYH 4QTIL 5E94A 1S9VA 3TESA 2AEQH 4QF1B 2VISB 3BIBX 4MHHG 1NCNA 1DN2A 1T0MA 3TN0D 5BQ7B 1VCAA 3GSWB 3VU2A 5DJ8A 3RX7A 1FIGH 5E4EB 3J8F7 3SBWC 3OAZK 4WEUD 4G8GB 1LEGA 5I1CH 3ARUA 4XP4H 5CZXC 3HNTL 5D2LE 4UIMA 3ZE0F 3TVMB 4Y2DB 4WI6A 2DQUL 1HKLL 3VGBA 5FGBC 1AIFA 3HCVB 1MEXH 3VWJC 2AEWA 1ZT1B 5TGBA 3TYFA 3C60A 4J12A 3HPJA 3V0AC 3Q2CA 1K2DA 3C08L 2Z92B 3MV01 3V4VL 1MCLA 1J1XH 1VFAB 3AREB 3FONB 4NGHL 3LKSB 1S7RB 4RISH 3BJLA 4GAYA 4KUCF 5IFAL 5HGHA 4L3CA 1WZ1L 3JV4B 1L9MA 3SGEH 5KN5A 2K9UA 2VMFA 2W60B 1JGEB 3MUY1 5H35B 3VDBA 5C9KA 1V5JA 1AGEA 2YBRA 1EFXA 3BPOC 1WBXB 3ULUL 1A9EB 3D9AL 3O3EA 4AZ8A 5I19L 3TNMB 2V7HB 4RWYH 4HIJB 5DHVA 4HCRH 4TRPH 1MCWM 2XNAB 2PCPA 4ESKA 2UY7A 1NDMA 4FRWA 1UH2A 1PVHA 3BISA 4KZEH 4J7RA 4LLAA 1IJ9A 1DANU 5FIEA 3MRLA 1I3GH 3SJVB 3EYVB 3QXAA 5ADPH 2ZUQB 1A1MB 1UWEH 5F9WB 1RFDH 5FHBH 6FABH 5GS0C 1ULVA 2XKNA 4P5TD 5IVXB 1P2CB 4LCYB 5JOFA 1YY9D 4K94C 4Z7WB 3WN5B 1QYGL 5J6HB 1BX2A 1WBZA 2CLVA 4FXKB 4HKXB 2BY1A 5C0IA 5FK9B 3RQ3A 1FQ9C 4P46C 4UIKL 2AK1H 4N0FA 1IGCL 5EC2B 5IGXL 5DJCA 4X6CF 2X09A 4I18B 4JG0H 4R96B 5IK3A 2EXWC 4S1QH 2VQTA 4RGNB 5J6GB 1DSFL 4HHAB 4OLVL 5D1ZC 5FCUH 1SBSH 2MHAA 2LVCA 4Z7VF 4GXVH 1PKQE 4BZYA 2GJ6D 1X4ZA 4U1NA 4NZDA 4Z7NF 2MFNA 4HKJB 3PJSB 5IIEA 4HKZA 3EOAB 4FFWC 1JNHB 1U91B 2D2OA 3Q6GH 1DQJB 3GJFK 2WBWB 1P7HL 4RNRB 3WIHH 5L2KA 4HWNA 3BZFA 1HQRB 1J1OH 2YK1H 3UAJD 3O41B 1E6OH 1E28A 3BJ91 4U05A 4NNXB 4ODTH 3MLXL 3BRDA 1E4XI 2FRGP 5E5UB 4MSWA 2ZOLA 4HKBA 3HAEH 1A4KA 5FECB 1Q9KA 4OV5B 2A77L 3S35H 1EJOL 2RFXA 4F58H 4NCDA 2NW2A 3CMGA 2HA1A 3RX5A 3EOTH 1ZA6B 3KYKL 1A3RH 4PGDB 5MEQA 1J8HD 1UYWH 1CI5A 4FP8H 1LHZA 3QPQC 4NPYA 3BW9B 2APVA 4X8JA 1A6WH 4U6TA 1U8KA 3TT3H 3CX5K 3WHE1 1KJ2H 1CBVL 1IKFH 2PKDA 3PHSA 4BH7A 4ZPVB 2XRAH 2DBLH 4JY5H 4PJGB 3SGJC 3V79C 3O6FB 4D9QD 3BMVA 1C16A 4FTVA 4MAYB 1LDPH 5DR5L 4RMUA 1Q0XL 2Y06H 2R4SH 4ONOA 3RWDA 4E5XB 3GMMA 3IXAA 3IFNH 5JXEC 3I6GB 1AGDB 5GGVH 4WNQA 2CRYA 3PL6C 2C7UB 3X3GL 1A22B 1G7LB 2IJ0C 4LF3B 1CICB 5DF0A 5FO9A 2X1XR 1Y6MR 4PP1D 1AD0B 1FFOA 4XNZC 4Y5VA 5GS0H 3MBXH 3DX6A 2J4WH 3LMJH 2XICA 2W65A 2YUZA 4K94H 5AUMA 5FO8B 3P2TA 5B21A 3QI9D 5CGTA 5JORB 5D5ME 1CLZH 5T3ZH 4H20H 2VAAA 1KLGB 1QBBA 1J12A 5BOPA 4PJDF 3VE0A 2DI7A 4PLOB 4JQXA 1OHQA 4L4TE 4OTXH 4JRXE 1BVLB 3H42L 1B0WA 1VA9A 2ATPA 1K4CB 2H32H 4A6YB 4OZ4B 3MRMB 2E7CA 3RKDC 4OB5H 3Q48A 3OJDA 5CSGA 1OAXH 2VL5A 4NO0D 4XWOD 3EO0B 3AS1A 4LIQL 3ARRA 4TULH 4HS3A 2P46B 3LN4A 4JFED 3ROLB 2XG5A 4N1HB 1H0DB 4Q9BA 4X4XB 4GG6E 2J2ZA 3CSPA 1WZKA 4Y4FA 4GBXD 3D2UA 2DKMA 4I5BA 2A83A 3T8XA 1TXKA 5DQDH 4ZXBB 3NTCL 3STBA 1XF4B 3TGXA 1TCMA 2R9HD 4ERSL 4KV5E 1CT8B 1KJMA 4QRRE 5EU7E 1EEQA 3G04A 1BFVL 4Y0GA 3X11B 3VWKC 1VGEH 4U0RB 3MV7B 1YPZE 4AM0B 1MHEA 3OF6D 3ESUF 5D8JH 4ZPTA 3GIVB 5C6PB 1MPAL 3ARGC 1AO7B 4ZS7L 5HI5C 1I1AC 2ZCKH 2JELL 4EDWL 3RNQB 4EN3A 2GCYB 2DICA 3B4NA 5L8JB 4P57B 1UENA 1TJHH 2DKUA 4JCMA 3C5ZD 1FL3A 4ZD3H 2AK4B 4L9LC 1NFKA 3GSNA 4NJ9L 2R2HA 2E8ZA 4R0LC 1CGTA 1X5JA 5E00B 4OGYH 2YC1A 5TFSH 2C3VB 1U3HB 4NC0B 1KJVA 2GIYA 3HE6C 5IB5B 3PDGA 3TA3A 4XH2B 2BXZA 1KB5B 3K80A 3L3KA 1HE7A 3FB8A 3PWPB 4FQ1L 1SY6L 1XCQA 1FSKC 5FGCE 5DQ9B 4XVUD 4BFIA 2P8LA 3EYUH 5HDBF 4F7MB 4G8IA 1A7BA 1HOCB 2A6JA 5GGVY 2DDQH 4DZ8A 4LSPH 1HHJA 1DN0A 4R90L 3TPUB 4P2OA 5K59E 1MSPA 3TCXA 1VGKB 1CXKA 2W9DL 4E41D 2FYYB 2NQCA 4WUUE 1RUAH 1N6UA 3I3BA 3CFEA 4HWBL 1WVZA 1M7IB 5I8OH 2D0FA 5F3HB 5LXGH 1ITCA 2QQKL 3ET9F 2A0LD 2XWTA 3PGDB 5J0BA 4WW2F 1MVUA 4ZFOA 1YEDA 5IR1A 2GHWB 3W0WB 4IRSC 1KOAA 1UJ3B 2ESVB 2X4TA 4WHDA 5C0CA 1HQ4A 2VR9A 3RWFA 4GH7B 5HYEA 4G8EB 5FYKU 3IFOA 4JEGB 1OAYL 1QFPA 4J3VA 3MNWA 1MJJB 2CDGA 2D9CA 4OLUH 1Z9MA 1C12A 2N7BA 2NY6B 1YQ2A 4I77H 3SE9H 1RIHH 3TWCH 2DQDL 1LEIB 1VPOH 2FHCA 3A0OA 3FN9A 1QRNB 2VKWA 3VXMA 3WNOA 4IM8A 4L8CB 2IALB 3FQTA 2J12B 4NO3B 2AGJL 2DS4A 4LSRH 1PLGH 1DBML 2NXYC 4Y5YA 3NABH 4V1DB 5DA4A 4M7LH 5DA0B 4YZFF 2EKJA 1CTOA 3RY5A 2XA8H 2DYPA 2FIKA 2A2QT 4KRPD 3PGCA 4U1MB 5KVDH 3DOSA 3GI9L 5ISZA 4PJAA 1L7IL 2R29L 1ZE3C 2H26B 4MXQD 3VFRA 2APWA 3DLQR 2E7BA 4X6BB 1MJ8H 3MRCA 5CSZB 5GJSH 3CXDL 2OR7A 5CD5C 2BK8A 2APXA 4LAQH 5JO5B 3VD5A 3ZYJA 4JRYB 1NGWA 3BEVB 2C1OA 1I8KA 2ICWI 3SO5A 4DUVA 3MLTB 3BX7C 3ULVE 4XNXH 3FL7A 5CHNB 4ISVB 3KLAA 5C08E 1RSFA 2HVKB 5BVJB 5CMAB 5C6TH 2VDML 2VLLA 3RL1A 2WAHA 3LDBB 4F9PA 3FQWA 4N8VB 2XWBB 2XOTA 3LPGA 2Z31B 5F6HJ 4CNIA 3V0VB 5F7YC 1OQOA 1F8TL 3F7YA 5JW5A 1JTTA 4L5FH 5ANMB 4BZ2L 4GKSA 5T1KB 4WHTA 3MLUL 3VFVA 1MVFA 1NEUA 4IDJH 2HN7A 4QCIB 3OKMA 1WFTA 3G6JB 3LS4L 5DJXA 4XP9H 4P99A 1HXMB 5EBMB 3FQUA 1ORSB 4ZSOB 4MA7L 5D4QA 4NZUL 1U9KA 1RZGB 2YPKB 1CS6A 4YWGH 5C0BD 3RDTD 2AV7B 1QVOA 4CW1A 3VD4A 3O2VH 2JTDA 5IW6B 1N4XH 3Q0HA 4D0DA 3C5JB 3OG6B 1L7TL 5DC0A 4HFWA 1SMAA 3E8UL 3IKCA 2X42A 1NEZG 2DQEL 5SWSD 4MNGA 1YEFL 3B9EA 4YHLL 4PJCE 3UBXB 4JY4A 3WUWG 4X6FB 2AJSL 2WWMC 3NPSC 4BH8B 4M5ZL 5AYUL 2W0LA 2V2WB 3UYRH 4WRLA 1L0QA 1C08A 1XGTA 2XV6B 1F11B 1K8DA 2R1YB 1GC1L 3HPLA 3HAEB 4JFXB 4JM2A 1Q9LB 3MV9B 2BSSA 3VWJB 1KCUL 3O9WA 5DHXB 3QRGH 4M7JH 2JJTC 2G60H 2NZ9D 2IC2A 5FO7B 4QXGH 3PWNB 3S3PA 1ZGLM 1LO2L 2P8PB 4QO1A 2BSRB 1CXHA 1T04A 4PJXE 2ZSVA 1UEMA 1LK3H 1JZ2A 3MRDA 4ONGH 4OT1L 1R3IH 5T3XD 3SKUD 1TVHA 3DGGA 5T1MA 1KJ2B 4P2QE 4NO2A 4G8FA 3FQXA 2EYTA 3LHPH 4JHWH 1JI2A 4HS8H 4PJIB 5LGHH 1QACA 4M8QB 4J1UB 3TIEA 1BLNA 5ENWA 1Z3GH 2NW3A 3BPOB 5SX4H 1S3KL 4DKDC 1F97A 4OLEA 4QRTB 4NQDE 1ACYH 1YMMA 5GRZA 3REVA 4YDLC 3BWAB 1KCSH 4KKBD 3WIFA 4R8WH 1C5CL 1MCQA 1EUTA 4Q6IA 5DHYA 2GK0B 2YRZA 2CKBL 4GLRH 4J4PD 4HWBA 4MD4A 1FFQA 5HDOA 3ARFA 1ZHBB 2BDNL 1GHFL 1LP9F 1ONQB 5D1QA 2KL6A 2ICWA 3WS3B 5TF0A 4G7VH 4S1RL 5SWZD 3TJEH 5KSUA 1JGDA 3O3AB 2EDNA 3NZHH 1NCDL 5BV7L 5EIVA 4PJEA 5KVFH 5F96L 3MC0A 2YUWA 2DQTL 2FJGA 1I9RH 1T89C 4GRLC 5KSAD 2FX8H 4P46B 2VIRB 2VLKB 1HCVA 2H32B 3ES6B 5E0QA 3QCUL 1KT2A 5CLWA 3RKPA 4N1CA 4U1GC 3TNNB 2C1PA 2XTJE 4MS8C 5D1ZB 3U0WL 3MA7B 4D9LH 3F6LA 1CFNB 5F9AC 5MEPB 4NQXB 5DJ0A 3JVGC 4HUXA 4OLWH 4PGBA 2V5TA 4PJHF 3DARA 5DUPL 4NRXB 1MREL 2I5YH 2BNUB 2P5ED 3FO1B 4NNYB 1FO0B 3JWDL 1NAKL 4NQVA 3FRUB 3KYNA 2UWEE 1TZHA 4GRWF 3T4AA 5CIPH 2AEPL 2B0SH 4JDTH 4XP6H 5HHOB 3BKCH 2OS7A 1SBBA