5T1GA

Chromo shadow domain of cbx1 in complex with a histone peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
EKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title chromo shadow domain of CBX1 in complex with a histone peptide
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Chromobox protein homolog 1
total genus 13
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2016-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01393 Chromo_shadow Chromo shadow domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5t1gA00
2VXWA 2J7ZA 2MPMA 1RODA 3FPUB 1DOLA 1RHPA 2K03A 2NWGA 3I8ZA 4MN3A 1IKLA 4ZAIA 1HHVA 4IUQA 1S4ZA 1ILPA 2HCCA 4ZK9B 1X3PA 1MI2A 2N88A 4R8IA 1WTVA 1U4LA 2XIWA 1ILQA 4LMQD 2K04A 4U68A 2Q8TA 2JYOA 3I3CA 1CA5A 1JE4A 4O42A 2KUMA 4IUPA 4IUUA 2HUGA 1O80A 1Q3LA 2NYZD 1GUWA 1F9RA 2RA4A 1BBXC 2CVRA 3N52A 1F9SA 2KEDA 4RA8A 3TN2A 5D65A 2KEEA 2EE1A 3DEPA 5E4XA 4ZKBB 3MTSA 1C8CA 1J8IA 1EIHA 3KBXA 4X3KA 4CJ1B 2B2UC 1X32A 1CM9A 1E0BA 2L11A 2MP1A 1SAPA 4IUVA 4RAUC 4QUFA 2FJ2A 1M8AA 1SDFA 2L4NA 1NR2A 4X3SA 1VMPA 5EPJA 5CMDA 2MGSA 5JJZA 3GV6A 3TZDA 1MSGA 2FFKB 2RSNA 4CJ2C 3I90A 1G2SA 5COYA 5EKIA 1B3AA 1KNEA 4MHEA 1QNKA 2L9HA 5T1GA 2K28A 2BDNA 1B50A 2B2WA 2B2WC 1HUMA 1QE6A 1WTOA 3FDTA 1WTXA 2K1BA 1B2TA 2RSOA 1AZQA 3QO2A 1ML0D 2JP1A 2FHTA 1B53A 4XT3B 1G6ZA 3R93A 5T1IA 1A15A 4ZLTF 2KECA 2RVLA 1WVLA 2M2LA 1G2TA 2B2YC 3KUPA 2B2VC 3LWEA 1O7YA 1NCVA 4HEDA 1U4MA 4X3TA 5DNFA 1PDQA 1U4RA 3HP3A 3SVMA 4HAEA 4IUTA 1MGSA 2DY7A 1XX8A 4XDXA 1CA6A 4IURA 2X6GA 2DY8A 3MWYW 4RWSC 2HCIA 4HCSA 2KVMA 1DONA 2D9UA 3IFDA 2MJ8A 1RTNA 2FMMA 5E4WC 5EJWA 1BF4A 3Q6SA 4NW2A 5AFWA 4CJ0B 1VMCA 3I91A 1X3QA 4HSVA 3IL8A 4XT1B 1F9QA 2B2UA 1HRJA 1J9OA 4OIJA 1WTQA 1ESRA 5EPKA 1EIGA 4QUCA 3DEOA 1AP0A 1DOMA 2SDFA 1PLFA 1HA6A 1ZXTA 2H1EA 2R3ZA 1QG7A 1PFBA 1IKMA 1B4OA 1HFGA 3F2UA 3ONAB 1LV9A 1F9PA 2B2TC 2B2TA 1BO0A 2HDMA 2EOTA 1EQTA 5CBAE 3DM1A 1HFNA 1WTPA 3UI2A 1XYIA 1TVXA 4OIKA 2N55A 1EOTA 1KNAA 2EPBA 2L12A 2NZ1D 1WD1A 1EL0A 2Q8RE 2X6LA 4DN4M 1G91A 4X3UA 1PFNA 1NAPA 2HDLA 1U4PA 2IL8A 2KOLA 5CBEE 4UAIA 5CORA 1WTRA 2L1BA 1SSOA 2K01A 1DZ1A 1DOKA 1RTOA 3H91A 2B2VA 3GV3A 3P7JA 2B2YA 1NR4A 1IL8A 2X69A 5D14A 1F2LA 4R9WA 1WTWA 3G7LA 1ICWA 1O7ZA 5EQ0A 1WD0A 1AZPA 1PFMA 1RJTA 5EPLA 1HUNA 1MSHA 2K05A 2FINB 4ZKCB 1BNZA 3D6WA 1JICA
chains in the Genus database with same CATH superfamily
2KJXA 2WKDA 1AEXA 4ZAIA 1OXSC 4IJLA 3AFPA 1PTOD 3M4PA 4FDBA 1TS5A 3K7AB 1ASZA 4G4KA 1MI2A 1SE2A 3EIVA 4LF4L 3MEHA 3M4QA 4U68A 3I3CA 5KNCA 2DNEA 1K8GA 1TR5A 5IOCA 3U4VA 4GLXA 2CVRA 4JCVE 2UXCQ 4JI4Q 4DR7L 1YNXA 1XJVA 1VQPA 1E0BA 5J1ZA 3CCEA 2FJ2A 1O7IA 5M5XB 1EU4A 4HJ5A 4H13C 1N32Q 3SR1A 3KDFB 2WB1B 2Z9HA 1X3GA 2UUBQ 1VQ5A 1IBLQ 3VA7A 1C48A 2VUMB 3AQQA 3R93A 2JA9A 3HKZE 2Z0SA 3ULLA 3RZOH 3GTMH 1TWHB 1SJHD 1U4MA 4P74A 1I4QA 2F1MA 2ZT9C 3HOWH 2RBMA 1VQBA 3SVMA 3F8TA 4IUTA 1IBLL 2X6GA 3H3VC 1JWSD 2F0LA 3IFTA 3MZ5A 3AU7A 3Q6SA 5AFWA 1TS4A 2VUMG 1VQ6A 5KIXA 1QJOA 2C35B 1Z7TA 1EY0A 1V1QA 2J4XA 2Z4HA 3ICEA 4F87A 3GTLB 1H9RA 2OTJA 2VUMH 2PMZE 1VQHA 1K28A 1BO0A 2R7FA 4X64L 2EOTA 1SFOH 4AQYQ 1EY9A 2E76C 2GA4B 1KNAA 1HZBA 3S15H 4DR3L 5I4DA 1TS2A 2IL8A 1II3A 2KOLA 4PV1C 2Y0SG 5M3MG 5CORA 1DZ1A 2R92H 1RTOA 3QOLA 1HZCA 5D14A 4X65L 4DXFA 5D3IB 5TSSA 1EY8A 4BA2I 2FINB 1SMXA 3P20A 3HG9A 3U58A 5FK9C 1EFWA 3GTKH 5EBDA 3U9SA 4HJ8A 3NBHB 1EY6A 4A3FH 3C46A 1SE8A 2KQ3A 2Q2HA 2TMPA 1EWCA 1PVOA 3VDYA 2NVYH 4K0KQ 3NQIA 4Y7NB 1K0SA 2B63H 2B39A 4JI7Q 4A3CH 4JI3L 1CA5A 1EQVA 1KDAA 2LSSA 3BVGA 1E2VA 2E2HB 4K2KA 4A76A 4FF3A 2YTVA 3I4MB 4CDDC 1CM9A 3GTOB 5EBCA 2I5HA 1ONLA 4BWGB 4IUVA 3H94A 2MO1A 2EYPA 3ULPA 2E75C 2IX3A 4RHSA 3HS0C 2XWBB 2E2IH 2JEAI 1BKBA 2MFIA 3UDFA 1Q8KA 1Z6HA 3VR4A 1HQMC 1WTXA 3S16H 2K1BA 2Z6KA 2NN6G 4DK0A 1BR9A 1GO3E 1U5KA 3HGBA 3QJYA 4DV5Q 1C9OA 4A3DG 1G2TA 1SYDA 3BDOA 3G48A 4JI4L 4DR7Q 4DFAA 4LFBQ 5DEHA 3MWYW 4B9WA 3I72A 3PO3H 1HNWQ 3PSIA 3KLWA 2F52A 2FMMA 5BN5A 1VQ9A 1MJCA 3K5LA 3OWFA 3CP0A 1X65A 1FL0A 1NTGA 1WTQA 4FXGC 4JBKA 1H95A 3HOWB 5EAYA 4LUZA 5EGTA 4K0KL 1HA5A 1LV9A 3R2IA 4YWLA 5IGGA 4KV6A 4DV0L 4DR1Q 5C4HA 2ID0A 5KNBA 1HFNA 3MFGA 2ZJQA 1YNJD 3K5MA 4JI2Q 4HIDA 1HH2P 3K5OA 4A3LG 3H0GB 4DR5Q 1EYAA 4BY1H 3MXUA 3M3YB 5M5YH 4DV0Q 4KKUA 3BZKA 3KF6A 3PGZA 5JJIA 4DV4Q 3HKZG 1Y8OB 1PRTF 4A3FB 1KC8C 2ZM6L 1RJTA 2JA7H 4TRDA 2G9DA 2HIVA 3NXWA 1IYVA 2CWAA 3BVMA 3E0EA 3I4OA 5JVG3 2HCCA 1CKMA 2O5IC 3BYYB 4UP7A 5GAGC 3PO2H 4BY7B 3D4DA 3HKZB 3F1ZA 4RMFA 4IUPA 4ABNA 4YCWA 3AYHB 1BBXC 2CH4A 4WJ4A 3QB3A 3TN2A 2KEDA 4RA8A 4B08A 4KLKA 1GVPA 1K9MC 2OWOA 1E3PA 1J8IA 3PQIA 5JVH3 3SHLA 4DK3C 4CJ1B 2YV5A 1Y1WB 3JC66 1YITA 1XTDA 1HNZL 1DXMA 2M9VA 5KEEA 1M4VA 4YWKA 3I90A 1RCVD 1OTCA 4A3IG 5C0XH 3ULJA 1B50A 4DUYL 5L37A 1K8OA 3I4LA 1PH5A 3NBIA 4ZUIA 1E22A 3J7YW 2UUAL 2AMCB 1LT6D 2PI2A 1G51A 4R4CA 4HJAA 1ASYA 2ZM6Q 3TBIB 3CMAA 4HEDA 1U4RA 3L7ZC 4HAEA 5IWAQ 2IPKD 2BDOA 1UE7A 2I46A 4DNIA 3AB9A 3D31A 1PZKD 1BF4A 2AUJD 3TDQA 4IFDI 4C3JH 4C56C 4DF7A 4CDFC 1PH4A 2F0EA 2F0DA 1LTLA 5LL6S 2WKCA 5K5PA 2D2CC 2R3ZA 4DAYB 1WJJA 1T9HA 1IYUA 2R7ZH 2V4DA 3DUZA 2LKVA 2IWHA 2DUDA 1PRTB 3HOVB 1J6QA 5M5YB 3NWSA 2CFMA 4OIKA 1TQOA 4DV4L 1EZ8A 3RN5A 4ZYSA 2UXBL 3P1HA 2A19A 2E2DC 2IHFA 2CCZA 3W1BA 4DR1L 1QWYA 1STHA 1Y69U 3OW7A 4P73A 4KHVA 1YJWA 1CT1D 1GKHA 1QOHA 3HOZB 2Z1CA 2VQEL 3DWAA 1RL2A 5FO9B 4ZUJA 4R8IA 4Q5VA 1Q86C 2JYOA 4YY3L 4DR3Q 5CR3A 1F9RA 2ZJRA 1WFQA 4LAAA 2K5QA 5AJ3Q 3VYTA 1VF5C 3DEPA 4O2DA 5C0XI 3MTSA 1IBKQ 2F3WA 1X32A 1B70B 5CV7A 1SNCA 4RCOA 1LTTD 3MFYA 2ALYB 5CMDA 4L5QA 4HJ7A 2DN8A 1TY2A 4LF6Q 2OEOA 1QNKA 3CHBD 4X62Q 3D4WA 2QILA 1WTOA 4B3TL 4A93G 3TP7A 3TQYA 1LT4D 1PXUA 1FVIA 2RKSA 1EOVA 4OO1H 1KXLA 1HTLD 3MEFA 5J39A 5HGQA 2F0KA 2ZXOA 4UDUC 3H3VH 4QMGA 1PDQA 2D5DA 4I65A 3K5NA 5C6AA 2MO0A 4A93B 4K6DA 4M1UB 4XYOA 2RHQB 1B1ZA 3MA2B 4L5SA 1DD2A 4GKKQ 2AQ1B 4JG2A 4KD4A 1VQAA 3SE0A 5C44H 1IBMQ 3CCQA 2IHEA 4QUCA 3DEOA 3R3OA 1PLFA 4PZ8A 1S5ED 2NVQH 4V190 5C3EB 3BJUA 1B4OA 4JI8Q 1YHAA 3ONAB 4EQPA 5KNDA 1UE5A 4ODGA 3TMEA 1TVXA 4G57A 4POGA 5IODA 3OIQA 3L0OA 4DN4M 5JPMC 2G9HD 4QL5A 4PMCA 2K01A 3A74A 4JVZA 2UUCL 4J6HA 2M00A 3PV0A 2A5HA 3ERQA 3D0FA 4A3KB 5C3WA 2WAQB 4UP9A 4A3EG 5ELNA 3QOJA 3W3AA 1RHPA 4MN3A 2K52A 2D0OA 4GOPA 1LTID 5G3LD 1HNXL 2K5VA 2O4XA 4LFAQ 1S5CD 5LMUQ 1TWGH 3HFZB 1SNOA 3J81E 4DR4Q 1RKNA 2QGQA 2KUMA 1CKNA 2QEJC 1SN8A 3NTHA 4FP5D 4L6TB 3RLOA 3UDXA 4A3KG 5C5LA 4B3ML 1PH3A 1JORA 3SGIA 5JEAJ 4CKCA 4IQZA 1GHJA 1Q46A 1H9SA 3LX0A 5NUCA 3HOYG 4JYAL 4LFBL 2RDGA 2R93B 3GV6A 4BY1B 1ZKOA 5EKIA 1B3QA 1V43A 4B3TQ 1E2ZA 1TU2B 1C4QA 1PTOC 1A3TA 1B2TA 1ML0D 3DWQA 3G6EA 1YVCA 1Q7YC 2CQOA 2EYFA 4MNOA 5BR8Q 3S1RB 1H9JA 2F0IA 3TP6A 2OQ0A 2R93G 2B2YC 1N34L 3HOXG 1IL2A 3LWEA 2R7ZG 2PMZB 2F0VA 2QW7A 4V0BA 2A69C 2EY5A 1WOCA 2EDGA 1PYBA 3GQBA 3IFDA 3F2BA 5EJWA 1LABA 5FLXc 2QDLA 5CV9A 4XQQA 4XT1B 3I4MG 1J9OA 2EY2A 4OIJA 4IOCA 2Y0SB 5M3MB 4LF5L 3T53B 1KTKA 4IPHA 1FR3A 2AKWB 5IP7G 3S1RH 1IKMA 1HFGA 4RHRA 4JOIA 2KCNA 4DAPA 3OWEB 2N8NA 1XYIA 1A6XA 4IO9A 1Q90A 2JA8B 1YNND 2VB3X 1EL0A 1N36Q 3URYA 3NHHA 2XRQD 4X3UA 1PFNA 2WINB 2R93H 4A3IH 3T16A 3E0JA 1Q1BA 2B2VA 4KJNA 3J81L 1EQQA 2IX0A 2I07B 3PF4A 4ULLA 1HUNA 1L0WA 1HR0L 4ALPA 1B9NA 1B44D 4PQXA 2ATWA 3KJOA 3BDCA 5ELEA 4N9TA 3SK6A 3U9OA 4A3JH 1UE6A 1J5EQ 2XIWA 1A3VA 1WCMH 4QB4A 3M9BA 1V1OA 1KABA 4LF7L 4DAVA 1GUWA 3PUZA 1HJPA 3T4AC 3A56A 3KF8B 2QF7A 2A6HC 3E6ZX 2HHHL 3OHXC 4KI0A 4C3IH 1JOOA 3K80C 1KLGD 5IY0A 1DGSA 2MP1A 1KRTA 5IE8A 1W2BA 1SDFA 2Q2IA 2DJFC 4GS3A 3RLFA 5JJZA 2MGSA 3TP8A 4RGMA 2F4IA 1QVFA 3W2DA 1UUPA 2B2WA 1TWFB 3FDTA 4KD3A 2WP8J 5E3FA 1IW7C 1QVCA 4K14A 1TWAB 4O1NA 1DM0B 2GN5A 2FHTA 2PCFB 4HIOA 3CD6A 1S5BD 3MC0B 1A15A 1Q1EA 5JOBA 1EIYB 4BBSH 1STNA 3G4SA 3PF5A 2SOBA 1XMOL 3HOWG 4ME5A 2PPBC 4LFCL 1UEAB 1CHPD 1CSPA 1IHZA 5M3FG 1VQ8A 2HCIA 2O2LD 1CK1A 4X64Q 2A73B 4DR2Q 3UE0A 1A0IA 2UUBL 5M3FH 3H09A 1RD9D 3K0YA 3HKSA 1ZXTA 2PQAA 2ES2A 3GO5A 4LF9Q 2VS1A 2F3VA 4PMWA 4WJWA 1A3UA 1TWCH 2B2TA 2JEBI 4XXEA 2A74C 3M4OB 1ZYRD 1CFMA 2KHJA 4A3IB 1QCBD 1FYCA 1GUTA 2L12A 4A3BG 5FLMG 2UXCL 4B3SL 2LXKA 4JW0A 4GNXA 1WTRA 1E1OA 2F4VQ 2IT1A 3KF6B 4IPCA 4KMUC 3R2TA 4BY7G 3P7JA 1BQQT 1QUQA 2K33A 4DV5L 4LF5Q 1EYGA 3CPWA 1F2MA 5M5WB 5IWAL 1N33Q 5D3DA 2PZTA 3CCSA 2E2HH 1I3QH 5BN4A 2ZXRA 3ND9A 3JAMi 4LUVA 3HOUB 4A3GB 2EJGC 2IX1A 4LMQD 1DJRD 3V2TA 5A2QL 5FLXE 2NYZD 3VR3A 4K8IA 2RA4A 1EIFA 2YU9H 5FO8B 2H4OA 2G5DA 4AYBB 1JB3A 3PUVA 4DV1Q 4JI5Q 1YHBA 1X56A 1VQDA 4BXXG 1M8AA 2LY7A 2CW0C 4KK7A 4Q0FA 4NP5A 2RSNA 4TSSA 3OPOA 1KNEA 2B8FA 1SROA 5G3LF 2BDNA 4FXKC 5E1FA 1UAPA 4A3LH 3MXNB 4AYBG 3KJPA 2EYMA 4OO1I 3ND8A 4GN4B 2PZUA 3B6YA 3S1QH 4Z9CB 1S5FD 1CQVA 2L15A 2ZXPA 3H3VI 1XXGA 2XWJB 3TSSA 2UXDQ 3L9AX 4HN7A 3TS2A 3PUXA 1CA6A 3BS1A 5A2QE 2R6GA 4A75A 1NMFA 4X66Q 4DR6Q 1DONA 2F0MA 4LF8L 1LTSD 3FRPB 3K8AA 1R4QB 4A4IA 1Z47A 4HMJA 4MIUA 1SYFA 1YNJC 2VNUD 4A3JB 1F9QA 2AWOA 2CW0D 2EY1A 3SK5A 1ESRA 1AP0A 3UDIA 4DV7L 4GKJQ 5C5MA 4CHTB 1HPCA 1PV4A 3GTOH 5IYDG 4RH6A 3DM1A 4UP8A 5C4JB 1VQ4A 3GTPH 4EGVA 4FF2A 4H7BA 3RZDB 3ZYYX 2E2IB 3ZJYC 5LMUL 2B3GA 2EIFA 3CC7A 2L1BA 1SSOA 4NXNQ 2K5HA 3RUZA 3D4RA 2UUAQ 5C0XJ 1A8VA 1LTAD 5CV6A 3CC4A 1WD0A 2RCFA 3Q23A 3MAQA 3IRBA 2K05A 4RKBA 1VQFA 3GD7A 1M1KC 2Q2UA 1BBWA 2E74C 1RODA 4PMBA 1KDCA 1N9WA 4N8X1 4ME3A 1BUVT 4IZ8A 3HOXH 3AEVA 4HR7B 2XTIA 4DR6L 4GKKL 4LF6L 2K04A 4KY7A 2F0OA 1JE4A 5C4XB 1KLUD 1UE1A 3T1YQ 2F0FA 1F9SA 1JMCA 2VL6A 1SYCA 1YHQA 1JOKA 4HIMA 3TREA 2L4NA 1NR2A 4X3SA 4E6IA 1PH6A 5I9PA 5IP9G 1KRSA 3CPFA 2N3SA 2EQSA 2K14A 5C4XG 3J81j 3NENA 2JK8A 1QVGA 1M90C 3VR5A 1UEBA 2NVXH 3MXPA 1Y1VG 3J80i 1ET6A 3T13A 1CQFA 2HQEA 2HT1A 4FXDA 1JWMD 1JR0D 2VB2X 4DV1L 3NELA 2CH4W 4C3HG 1HZAA 2UXDL 1IBKL 2Z6BA 4JBMA 1Y1VH 3VA5A 1B7YB 1K3BC 2V1CC 2EJMA 4OWWB 1N36L 5C3EG 4XQNA 4GOPB 2MHVA 1LTGD 1E2WA 4JV5Q 1IW7D 4K8JA 2R61A 4HCSA 4K5VA 1B8AA 2CHBD 3EN2A 2KBNA 4KY5A 1TIID 1PTOB 2B63B 1NE3A 3T51B 5BR8L 1OXVA 1VMCA 2FMCA 3G71A 1X3QA 3HOUH 4KJOA 2B2UA 1B9MA 1GUGA 3RN2A 5ELCA 1S5DD 1K83H 2PQAB 1H9SB 3EFXD 1GXDC 2B2TC 1FGUA 1F2ZA 3S1MB 5GAEC 1CSQA 1GM5A 2WB1G 4A3EB 2NN6H 1Q82C 1K73C 2NZHA 5LHY1 1OO9B 3VR2A 1PRTD 1G91A 1HZ9A 3BDLA 3T1HL 2OCEA 1VQLA 1FNUA 2L55A 4DV3Q 2LMCB 5CC4A 2EXZA 1AZPA 2R7ZB 3WOEA 4HMIA 4MZ9A 1O7LA 3CCRA 1YEZA 1I94L 4LFAL 1I4RA 1STBA 4FNFA 3PO3G 4NPSA 2GVAA 1STGA 3EBEA 2PYKA 4KTAA 3S14H 1RIPA 2MPMA 1K8MA 3S1NB 4KY6A 3K58A 1IKLA 2A68C 1QUQB 4ZRZA 2AQ2B 1KD1C 1BCPF 4K5XA 2F0GA 3SDZA 4A3CG 2NBFA 1PH7A 4O42A 3S24A 4KKSA 1Q3LA 1BOSA 1W6JA 5HURA 3S2DB 2KHSA 2F0HA 3CQZH 2F03A 5IIFA 5LMNL 1EFID 2KEEA 5FLMH 2C9OA 4GN3B 4X3KA 4IALA 3C3LA 3CW2C 2NB0A 1XMQQ 3M7NA 1PH9A 4CJ2C 3AMUA 3EA6A 3RR5A 3NUCA 2EXDA 5T1GA 4GKJL 2K28A 4HIKA 3TEHB 1EY5A 1KIXA 1X55A 4IFDJ 1XMQL 1AZQA 3M4YA 3RZDH 1AW7A 4JBWA 1Y1WH 1NBWA 4UHVA 1D5MC 1I4PA 4RCNA 1N8RC 1Y8PB 2J0TD 1SMYC 2SNMA 1E24A 4LF7Q 1K0RA 2IW3A 3K7UC 2A6ED 2PNRC 4G7OC 2MJ8A 1RTNA 4P71A 4JI8L 3FVQA 5I6YA 1BCPB 1GUOA 3P75A 1U9RA 4DV7Q 1VQCA 4GLAC 1ZYRC 4LK1C 1VS0A 2SDFA 1QILA 2HIXA 2F0WA 4YCUA 1MBYA 3E9HA 3T56B 1V9PA 1O78A 2MNAA 3CU7A 1TWFH 3K6OA 4IPDA 3J80c 4JI0Q 5KGUA 4A3GH 3CXCA 3WDNA 1NAPA 1U4PA 5AJ3L 3PO2B 3BG3A 2UUCQ 4A3DB 4R9WA 5IP7H 2LFNA 3OMCA 1PFMA 1Z9FA 5FOBB 5IGEA 1LT3D 2K5WA 1BNZA 3HEJA 2PO4A 3EQLC 3QWNA 3OIPA 4NB3A 1AE3A 2LXJA 3I8ZA 1CZGA 4HSPA 3LGJA 3W1GA 3PO2G 1T5XD 4EVOA 4RG1A 3A8JE 5IYDH 4R8NA 1TY0A 3I4NB 4TVAB 4H02A 2F3IA 1D5ZC 1TWHH 4L5RC 4J8QA 3CKIB 5I2XA 3CCJA 2A1AA 3I4MH 5E4XA 2RQXA 3ERSX 2PQEA 4IFDH 1LUZA 3L3OC 1U0LA 1X9NA 1SNQA 2PI2E 2WB1E 1LYLA 3V96A 2F0QA 5C0XG 3IKJA 1NUCA 4HJ9A 1IYJB 2B2WC 2NUCA 1TT2A 3PIP3 2E2JH 4AIMA 3MXNA 4KHPL 1VQIA 5IGDA 1VQOA 2QA4A 1R4PB 5FO7B 3LNNA 4JI1L 5H1SE 2Z6KC 3UDGA 3K81C 1O7YA 5DNFA 3S1QB 1V1PB 2UXBQ 3J7AV 4DNRB 1ENCA 1MKHA 2ENBA 5IP9H 4DV6L 3HZXA 2N49A 5FJ8H 3VR6A 5E4WC 3KLSX 1PA6A 3KFUA 2QDBA 4CJ0B 1TWGB 3H15A 4WFN3 1YNNC 4HSVA 4NDXA 4DK6C 4AQYL 4BBRB 2PW5A 2YTXA 1FD7D 1EYDA 2H1EA 3M7GA 1YI2A 3KBGA 1STAA 4PNYA 4C1NK 2PW7A 3UI2A 1EOTA 2NVXB 1YIJA 3GTGH 1LO5D 4OONA 2RDFA 1ESFA 3EROA 3M3YH 1EUJA 1I4HA 4UY8C 3C1FA 3HOUG 3SK4A 1TS3A 2EYHA 2VW9A 4X6AH 2KENA 2X69A 1F2LA 3RMHA 2JA7B 1ICWA 2XSCA 5HY6A 2AQ3B 5M9OA 3JAME 1JOQA 5FJ8G 4EX5A 4A3MB 4R4TA 4JK1C 1IBML 1VQEA 1LT5D 1EWIA 3PUWA 3FPUB 2Q2TA 4K6LA 2NTTA 1GUNA 1I50H 1GD7A 3S2DH 4EQOA 4N9PA 4NXNL 1CI3M 4GZYC 4LF8Q 4A3JG 2TSSA 2JQOA 4ZK9B 1P8LA 2K7VA 1I3QB 2VY3A 1U4LA 1JJCB 1ILQA 1KL9A 5IGFA 2XRSD 4OO1G 5C4JH 3GTPB 4BY7H 3DM3A 2EVBA 2EY6A 3PIPA 1XWEA 4DR2L 5ELOA 4XQJA 1C8CA 3S1MH 3FPPA 2KHIA 4QIWB 3I7FA 1BVSA 1NY4A 4U673 5FKAC 1EU3A 3PIO3 1VQKA 3S17B 5CV4A 3TZDA 1S72A 2RHSB 2L9HA 4YHHQ 3J80E 2NN6I 2XNAC 4PG3A 4DV6Q 1DYQA 2A6EC 5IYCG 2A68D 3CCLA 2KCMA 3FMCA 3H0GG 3V05A 3A0JA 4K5WA 5J3BA 1QNUA 3NEMA 4QJFA 4JI1Q 4DR5L 2M2LA 1G8ZD 1ICFB 2B2VC 4X3TA 3GDEA 4RGNA 3HP3A 1HNZQ 4IURA 5IT9L 3T1YL 1XPUA 1D6EC 3EVQA 2BOSA 1SYEA 3A8IE 2VQEQ 3J81c 1PTOF 2B8GA 1PRTC 2BH8A 4NW2A 4Y7NH 3I2ZA 3KDFA 5LMNQ 3FHWA 1LM0A 5BN3A 3VYRA 5EPKA 1KHIA 4CKBA 2R7DA 5LL6X 1CZWA 1F2YA 4OEMB 1QG7A 4OXPA 1XTCD 1Q81C 4AH6A 2NVTH 3JAML 2EZVA 1YBYA 3NK9A 1HNWL 4IJHA 3NWTA 4P72A 1Y1WG 3KK7A 3H0GH 2F0NA 2K75A 1YJNA 1SBBB 4DUZQ 3K59A 2HDLA 4MTNA 4A3EH 3GTJB 4DAMA 4F7XA 4B3MQ 4C3HB 3FKIG 1AFPA 1S40A 1YJ9A 2PNHA 1IZ6A 3H91A 1EY4A 3GTMB 2UU9L 4DXGA 4QQBX 2YYZA 1WTWA 1PH2A 3M4OH 4KHZA 4BXXH 3FKIH 5IYBH 3RZOB 4IFDG 4R4QA 4KN4C 3GP7A 4JI6Q 2R92B 1EEID 1F77A 4QIWE 2N78A 1QB5D 1NNXA 1Y8NB 1MJEA 4OX9L 3A7LA 2WAQE 5FLXL 3HOZH 4GNXB 2I0QA 1L1OA 4JI0L 4CBVA 4ILWA 4L8JA 1P16A 1Y1VB 1LTBD 4DR4L 3GTKB 3ITPA 4NXMQ 2B2UC 3CQZB 1LACA 4A3MH 4BBSB 1CKNB 3KLRA 1CHQD 4YCVA 1WCMB 4DUYQ 5JJKA 2WV6D 1C0AA 3HOVG 2OF1A 1B3AA 4EQNA 2K32A 4QCLA 1X54A 2EYOA 4GOPC 5IYBG 1D1KA 2K5DA 3CCUA 1PMRA 3PO3B 5GROA 3QO2A 4BS9A 2UU9Q 2ICIA 3BZCA 4XT3B 1BXTA 1YZ6A 3S1NH 3I73A 4K2LA 1QZGA 1XNQL 3KUPA 3RNUA 4TQUS 3JAMc 1HNXQ 4NMZA 2F0SA 2K5NA 1EQRA 1OXTA 2DY7A 3I70A 1STEA 3NBHA 1Q12A 1SE3A 2EJFC 2ZJPA 2HD3A 4C3IG 2BE5D 1A63A 2F0JA 4H44C 1NMGA 5JPNC 1N33L 3M85A 2ZTDA 2E8GA 2GVBA 5EKKA 1I94Q 5DM73 3HOVH 1Q8IA 3RD4A 4H0LC 4XYQA 4LW1A 3OTOQ 4DNTB 3DMUA 2ICEC 3SXHA 3TZUA 4FVMA 5CBEE 4L63B 3J80L 4OHJA 3O13A 1IL8A 1UNSA 3HOXB 5DLQE 1TXYA 2NTSA 2DNCA 3DXJC 3OSOA 4X62L 1SE4A 3NP8A 4ZKCB 4Y52H 4J1MA 3E9IA 1S3OA 1D5XC 2J7ZA 5C3XA 4CKEA 3A54A 3NPPA 1G291 4MTKA 5GADC 4L5TA 3T1HQ 3A8KE 3HRZC 4JV5L 2Z4IA 1H9MA 2BA0A 4KN7C 1O80A 4C2MB 1FJGL 1RF2D 1PZJD 5D65A 1XMOQ 4NXML 1MIUA 3KBXA 2JA8G 3R8BA 4OGQC 4QUFA 5I2YA 1L1OB 1VMPA 1MSGA 3CC2A 2L5TA 5C44B 2ZTCA 5COYA 4OL7A 5C4XH 3VYUA 1G6PA 1PYSB 3FP9A 4B9XA 1CTMA 1JCKB 1GHKA 4DK1A 4LNQA 2RSOA 4JYAQ 5LMNW 2RF4A 1PZID 1X3FA 4CDCC 1G6ZA 4LUOA 4DPGA 3CCMA 5CGKA 4OELB 1ET9A 1OXXK 1OXUA 5C44G 4DV2L 4DV3L 1L0XB 4XDXA 3PCOB 4B3RL 2WAQG 5E7NA 4F88A 2SEBD 1D8LA 2JA6G 3NTKA 1ZEQX 2IJ0A 3NQTA 4RGOS 3KOJA 3K0XA 4R4OA 4OX9Q 1AN8A 4N8FA 5F2DA 4A3BH 3A7AB 3BYTB 1C7YA 5K36G 4P75A 3A55A 1F9PA 1QZHA 1D1IA 3W5OA 3OW2A 1HR0W 2JA6B 3F2DA 3KF8A 4B3RQ 1PH1A 2N55A 1EYCA 2BE5C 2C5CA 2BCOA 2Q8RE 1VQ7A 3HOYB 2X6LA 2WFWA 2F0PA 3AFQA 1I5FA 2OT2A 3PIOA 4BY1G 1E1TA 1EWHA 2K4KA 1GJXA 3UE1A 1NR4A 3I4NG 2B29A 4TKOB 1O7ZA 2F4VL 2JE6I 5EPLA 1VQNA 3L2PA 1MSHA 2XN9C 3WWVA 4PZ7A 1I4XA 1XNRL 3QG1A 5M3FB 1DOLA 2OXPA 3Q0AA 2NWGA 5JEAH 3Q8DA 1S4ZA 5JJLA 1ILPA 3X3NA 4YHHL 3SEBA 1X3PA 2N88A 4RFBA 1WTVA 1SXTA 2BA1A 2Q8TA 4C1NI 4IUUA 1W6KA 1GOZA 1VF7A 3BVZA 2HUGA 1SYGA 1HTPA 1R9TH 5KRUA 3N52A 4A3KH 4ZKBB 2H5XA 1I6HB 4OWTB 2NVQB 1FNWA 3S14B 2A6HD 4ID6A 2MQHA 2YU9B 1L0YB 1EZ6A 1WI5A 4OWXB 4A3DH 1XPRA 1CUKA 4DU9A 3S2HB 4YIJA 4A3BB 2F0TA 3OYYA 4QGUA 3DLLA 2FXQA 3GTJH 2KA7A 5C4ZA 4UPAA 4LJZC 5JAVA 4MHEA 2HHHQ 1HUMA 2NVYB 4X66L 3BU2A 1JE5A 1X3EA 3HOYH 5ELDA 1JWUD 1TWCB 1VQJA 4JI5L 2JA5H 2JP1A 3IAYA 5T1IA 3I55A 2JN4A 3CF5A 4JPBW 4APVA 2L0CA 3D6CA 4BBRG 2Q8IB 2K6AA 4FYDA 5GAHC 3I56A 1HQRD 3CRLC 4A3GG 2EYJA 1XX8A 1BCPD 3OMGA 2DY8A 2KVMA 2D9UA 1KQSA 4HTHA 1HR0Q 5IT9E 2A8VA 3G6JB 1JJ2A 3H6MA 1WTHA 3DHQA 3I91A 3D3RA 5I9OA 5DM63 1IXRA 1D2BA 1HRJA 3NSWA 5KYIA 1DOMA 4GN5A 1JT8A 1NSNS 3MXGA 4ZCKA 1J5EL 1PYWD 4FF1A 1Y14B 3F2UA 1A62A 4C2MH 4QY7A 2JA7G 1EQTA 1I6HH 4PZ6A 1WTPA 4DA2A 3X3MA 4A3MG 2JA5G 1PTOH 3N6RA 3OOCA 1WD1A 3D8GA 3CCVA 3CRKC 4QF4A 3GTQH 4XTCS 1UWVA 1HCZA 3QIAA 3GTGB 4G7HC 4FO2A 1WYDA 4AYBE 4GNXC 3C1EA 2A69D 5KYLA 2E5LL 2VZAA 2B2YA 4CDEC 2SNSA 5IGCA 2VQFL 5EKLA 1XPOA 3LWUA 3A5UA 1W3SA 1SYBA 4LWCA 2JA5B 4KKTA 5CV8A 5A35A 3F2CA 3A5ZB 1E7ZA 4KHPQ 3J7ZC 2ASBA 3U50C 3U4ZA 1TWAH 4DGZA 3WOFA 1A2TA 1V8QA 1AH9A 2VQFQ 2PZWA 4POFA 4EQ5A 4C3JG 4HCEA 4B3SQ 4G7ZC 3DWPA 4JOIC 3VYSA 1LTRD 2IY5B 1VQMA 3S2HH 4NKLA 2NVTB 1I6VC 2AHOB 4GLVB 2OQKA 3NTIA 4DUZL 1L2FA 1SNDA 4LF9L 3GTLH 5GQOA 1SAPA 4RAUC 5J22A 1KDBA 3MHBA 4C3JB 3K57A 3EJIA 5CYUA 3Q22A 3J81i 1QE6A 2KCCA 1FGBD 2DGYA 3GTQB 4CGYB 1SRUA 2LS01 4JI3Q 4ZLTF 2E5LQ 2RVLA 1WVLA 1K83B 1FJGQ 4A3FG 1NCVA 5C3EH 5CV5A 1MGSA 3S9WA 4WRDA 2JXMB 2XVSA 1VDZA 2ZTEA 3NE5B 2E2JB 4I7ZC 4C3HH 2JA8H 1ENAA 1PFSA 3TRZA 4O0AA 2P5ZX 1L1OC 4X65Q 1PH8A 5IYCH 2NZOA 2K50A 2BH2A 4WJ3M 4A93H 3FKIB 4J15A 4JI7L 1JB7A 1CKOA 3KLSA 3CAMA 1LLRD 1WCMG 5ELFA 1N32L 4RKLA 1STYA 2CQAA 2KCTA 4IOAA 5M3MH 1EEFD 2EPBA 5JEAG 5IGBA 4P2CB 3K7AH 2Z8LA 2R92G 3TP5A 3MVVA 4R4IA 1SFOB 1K8AC 1DOKA 3J7A5 4I7AA 2MUYA 3KYHC 2RCNA 2JA6H 3OTOL 5K36H 1SR3A 5M5WH 5HGTA 5DAUA 1JICA 2RDHA 2VXWA 3STBD 3C2PA 4IUNA 2K03A 3PMFA 1HHVA 2B63G 1K3RA 1R9TB 1HXYD 4IUQA 1BDOA 4BBSG 2D62A 4FF4A 2I5MX 1KAAA 1MD2D 1SLJA 4JI2L 4ZQ3A 5IT9c 2CWPA 2YTYA 1EY7A 4IPGA 1RDPD 2OTLA 1D7QA 4XIGS 4LFCQ 3S17H 2EE1A 1EIHA 2QKIC 1X6OA 1TKWB 2I5LX 4LF4Q 1XNQQ 4BBRH 2L11A 4M8AA 1PHJA 5EPJA 3I4NH 2DJGC 4YWMA 4DKAC 3J7AF 2FFKB 1G2SA 2JJQA 1XNRQ 3PUYA 5M5XH 3QR8A 1BBUA 5I6WA 2Y0SE 1BCPC 4R1JA 2QEXA 2QCPX 3ER0A 4C3IB 1B53A 1NJIC 3STBC 2KECA 1V1PA 4BA1I 2AWNA 1JC7A 1VCIA 2AUKA 5ELBA 1H9KA 1JJGA 4DV2Q 2WACA 1DCZA 4F8MA 1KAWA 1SNPA 4RWSC 2F0UA 4WORA 1SJED 1MHWC 3HOZG 2XGTA 3IL8A 2O5JC 3TS0A 3BZDB 4IN3A 1JQYD 1EIGA 3Q24A 4YY3Q 4DAYA 1A2UA 2JSOA 1HA6A 2WIIB 3CMEA 1PFBA 3SK8A 1VQGA 3FEWX 1I4GA 1T5EA 2HDMA 5CBAE 3E5SA 4RGTA 3S16B 1SNMA 5ISRA 2NZ1D 3E3XA 1AE2A 4JC0A 2EYLA 4UAIA 1GUSA 4JBJA 3S15B 3GV3A 1I50B 1SEBD 2HQLA 3G7LA 1N34Q 4S3SA 5EQ0A 4JI6L 1SMYD 1ENFA 2D0PA 2CKZB 3RLNA 3D6WA 1FNVA
chains in the Genus database with same CATH topology
2KJXA 2WKDA 1AEXA 4ZAIA 1OXSC 1PTOD 1TS5A 3K7AB 4G4KA 1MI2A 1SE2A 3MEHA 4U68A 3I3CA 5KNCA 2DNEA 1TR5A 5IOCA 2CVRA 1E0BA 5J1ZA 2FJ2A 5M5XB 1EU4A 4H13C 3SR1A 2WB1B 3VA7A 1C48A 2VUMB 3R93A 1TWHB 1SJHD 1U4MA 1I4QA 2F1MA 2ZT9C 2RBMA 3SVMA 4IUTA 2X6GA 3H3VC 1JWSD 2F0LA 3IFTA 3MZ5A 3AU7A 3Q6SA 5AFWA 1TS4A 5KIXA 1QJOA 1Z7TA 1EY0A 2J4XA 2Z4HA 4F87A 3GTLB 1H9RA 1BO0A 2EOTA 1EY9A 2E76C 2GA4B 1KNAA 5I4DA 1TS2A 2IL8A 1II3A 2KOLA 4PV1C 5CORA 1DZ1A 1RTOA 3QOLA 5D14A 4DXFA 5D3IB 5TSSA 1EY8A 4BA2I 2FINB 3P20A 3HG9A 5FK9C 5EBDA 3U9SA 1EY6A 3C46A 2KQ3A 2TMPA 1EWCA 3NQIA 4Y7NB 2B39A 1CA5A 1EQVA 1KDAA 3BVGA 1E2VA 2E2HB 4K2KA 4FF3A 3I4MB 1CM9A 3GTOB 5EBCA 1ONLA 4BWGB 4IUVA 3H94A 2EYPA 2E75C 2IX3A 4RHSA 3HS0C 2XWBB 2JEAI 1Z6HA 3VR4A 1HQMC 1WTXA 2K1BA 2NN6G 4DK0A 1BR9A 3HGBA 3QJYA 1G2TA 1SYDA 3BDOA 4DFAA 5DEHA 3MWYW 4B9WA 3I72A 2FMMA 5BN5A 3K5LA 3OWFA 1WTQA 4FXGC 3HOWB 5EGTA 1HA5A 1LV9A 3R2IA 5IGGA 4KV6A 5C4HA 2ID0A 5KNBA 1HFNA 3MFGA 1YNJD 3K5MA 3K5OA 3H0GB 1EYAA 3MXUA 3M3YB 4KKUA 1Y8OB 1PRTF 4A3FB 1RJTA 4TRDA 2G9DA 3NXWA 1IYVA 3BVMA 5JVG3 2HCCA 2O5IC 3BYYB 4BY7B 3D4DA 3HKZB 4IUPA 4ABNA 1BBXC 3QB3A 3TN2A 2KEDA 4RA8A 4B08A 1J8IA 5JVH3 3SHLA 4CJ1B 1Y1WB 1DXMA 2M9VA 5KEEA 1M4VA 3I90A 1RCVD 5C0XH 1B50A 1K8OA 3I4LA 3NBIA 4ZUIA 3J7YW 1LT6D 3TBIB 4HEDA 1U4RA 3L7ZC 4HAEA 2IPKD 2BDOA 2I46A 3AB9A 3D31A 1PZKD 1BF4A 2AUJD 3TDQA 4IFDI 4C56C 4DF7A 2F0EA 2F0DA 5LL6S 2WKCA 5K5PA 2D2CC 2R3ZA 1IYUA 2V4DA 3DUZA 2LKVA 2IWHA 1PRTB 3HOVB 5M5YB 3NWSA 4OIKA 1TQOA 1EZ8A 4ZYSA 3P1HA 2E2DC 1QWYA 1STHA 1Y69U 3OW7A 4KHVA 1CT1D 1QOHA 3HOZB 2Z1CA 3DWAA 5FO9B 4ZUJA 4R8IA 4Q5VA 2JYOA 5CR3A 1F9RA 4LAAA 2K5QA 3VYTA 1VF5C 3DEPA 5C0XI 3MTSA 2F3WA 1X32A 5CV7A 1SNCA 4RCOA 1LTTD 3MFYA 5CMDA 2DN8A 1TY2A 2OEOA 1QNKA 3CHBD 3D4WA 2QILA 1WTOA 3TP7A 1LT4D 1PXUA 2RKSA 4OO1H 1HTLD 5J39A 2F0KA 2ZXOA 4UDUC 4QMGA 1PDQA 2D5DA 4I65A 3K5NA 5C6AA 4A93B 4K6DA 4M1UB 4XYOA 1B1ZA 3MA2B 1DD2A 2AQ1B 4KD4A 3SE0A 4QUCA 3DEOA 3R3OA 1PLFA 1S5ED 4V190 5C3EB 1B4OA 3ONAB 4EQPA 5KNDA 4ODGA 3TMEA 1TVXA 4G57A 5IODA 3OIQA 5JPMC 4DN4M 2G9HD 4PMCA 2K01A 4J6HA 2M00A 3PV0A 2A5HA 3ERQA 4A3KB 5C3WA 2WAQB 3QOJA 3W3AA 1RHPA 4MN3A 1LTID 5G3LD 2O4XA 1S5CD 1SNOA 3J81E 1RKNA 2KUMA 2QEJC 3NTHA 4FP5D 4L6TB 5C5LA 1JORA 5JEAJ 4CKCA 4IQZA 1GHJA 1H9SA 3LX0A 5NUCA 2RDGA 2R93B 3GV6A 4BY1B 1ZKOA 5EKIA 1V43A 1E2ZA 1TU2B 1C4QA 1PTOC 1A3TA 1B2TA 1ML0D 3DWQA 2EYFA 3S1RB 1H9JA 2F0IA 3TP6A 2B2YC 3LWEA 2PMZB 2F0VA 4V0BA 2A69C 2EY5A 2EDGA 3GQBA 3IFDA 5EJWA 1LABA 5CV9A 4XQQA 4XT1B 1J9OA 2EY2A 4OIJA 2Y0SB 5M3MB 3T53B 1KTKA 1FR3A 1IKMA 1HFGA 4RHRA 2KCNA 4DAPA 3OWEB 1XYIA 1A6XA 1Q90A 2JA8B 1YNND 2VB3X 1EL0A 3URYA 3NHHA 2XRQD 4X3UA 1PFNA 2WINB 3T16A 3E0JA 1Q1BA 2B2VA 4KJNA 3J81L 2IX0A 2I07B 4ULLA 1HUNA 1B9NA 1B44D 4PQXA 3BDCA 5ELEA 4N9TA 3SK6A 3U9OA 2XIWA 1A3VA 4QB4A 1V1OA 1KABA 4DAVA 1GUWA 3PUZA 3T4AC 3A56A 2QF7A 2A6HC 3E6ZX 3OHXC 4KI0A 1JOOA 1KLGD 2MP1A 1SDFA 3RLFA 5JJZA 2MGSA 3TP8A 4RGMA 2F4IA 3W2DA 1UUPA 2B2WA 1TWFB 3FDTA 4KD3A 2WP8J 5E3FA 1IW7C 4K14A 1TWAB 1DM0B 4O1NA 2FHTA 2PCFB 1S5BD 3MC0B 1A15A 1Q1EA 5JOBA 1STNA 2SOBA 4ME5A 2PPBC 1UEAB 1CHPD 1IHZA 2HCIA 2O2LD 1CK1A 2A73B 3H09A 1RD9D 3K0YA 1ZXTA 3GO5A 2F3VA 4PMWA 4WJWA 1A3UA 2B2TA 2JEBI 4XXEA 2A74C 3M4OB 1ZYRD 1CFMA 4A3IB 1QCBD 1FYCA 1GUTA 2L12A 1WTRA 2IT1A 4KMUC 3R2TA 3P7JA 1BQQT 2K33A 1F2MA 5M5WB 5D3DA 2PZTA 5BN4A 2ZXRA 3ND9A 3HOUB 4A3GB 2EJGC 2IX1A 4LMQD 1DJRD 3V2TA 5A2QL 5FLXE 2NYZD 3VR3A 4K8IA 2RA4A 5FO8B 2H4OA 4AYBB 1JB3A 3PUVA 1M8AA 2LY7A 2CW0C 4KK7A 4Q0FA 4NP5A 2RSNA 4TSSA 3OPOA 1KNEA 2B8FA 5G3LF 2BDNA 4FXKC 5E1FA 1UAPA 2EYMA 4OO1I 3ND8A 2PZUA 4Z9CB 1S5FD 1CQVA 2ZXPA 1XXGA 2XWJB 3TSSA 3L9AX 4HN7A 3PUXA 1CA6A 3BS1A 5A2QE 2R6GA 1DONA 2F0MA 1LTSD 3FRPB 1R4QB 1Z47A 4HMJA 4MIUA 1SYFA 1YNJC 2VNUD 4A3JB 1F9QA 2AWOA 2CW0D 2EY1A 3SK5A 1ESRA 1AP0A 5C5MA 4CHTB 1HPCA 4RH6A 3DM1A 5C4JB 4EGVA 4FF2A 4H7BA 3RZDB 3ZYYX 2E2IB 2L1BA 1SSOA 3RUZA 3D4RA 5C0XJ 1LTAD 5CV6A 1WD0A 3Q23A 3MAQA 2K05A 4RKBA 3GD7A 2E74C 1RODA 4PMBA 1KDCA 1BUVT 4IZ8A 4HR7B 2K04A 4KY7A 2F0OA 1JE4A 5C4XB 1KLUD 2F0FA 1F9SA 1SYCA 1JOKA 2L4NA 1NR2A 4X3SA 4E6IA 5I9PA 3VR5A 3MXPA 1ET6A 3T13A 1CQFA 2HQEA 4FXDA 1JWMD 1JR0D 2VB2X 4C3HG 3VA5A 2EJMA 4XQNA 2MHVA 1LTGD 1E2WA 1IW7D 4K8JA 2R61A 4HCSA 4K5VA 2CHBD 4KY5A 1TIID 1PTOB 2B63B 3T51B 1OXVA 1VMCA 2FMCA 1X3QA 4KJOA 2B2UA 1B9MA 1GUGA 5ELCA 1S5DD 1H9SB 3EFXD 1GXDC 2B2TC 1F2ZA 3S1MB 4A3EB 2NN6H 5LHY1 1OO9B 3VR2A 1PRTD 1G91A 3BDLA 1FNUA 2L55A 2LMCB 5CC4A 2EXZA 1AZPA 2R7ZB 3WOEA 4HMIA 1O7LA 1I4RA 1STBA 4FNFA 1STGA 2PYKA 4KTAA 2MPMA 1K8MA 3S1NB 4KY6A 3K58A 1IKLA 2A68C 4ZRZA 2AQ2B 1BCPF 4K5XA 2F0GA 3SDZA 2NBFA 4O42A 4KKSA 1Q3LA 1BOSA 1W6JA 5HURA 3S2DB 2KHSA 2F0HA 2F03A 5IIFA 1EFID 2KEEA 2C9OA 4X3KA 4IALA 3C3LA 2NB0A 3M7NA 4CJ2C 3AMUA 3EA6A 3NUCA 5T1GA 2K28A 1EY5A 4IFDJ 1AZQA 3M4YA 1AW7A 4JBWA 1D5MC 1I4PA 4RCNA 1Y8PB 2J0TD 1SMYC 2SNMA 2IW3A 2A6ED 2PNRC 4G7OC 2MJ8A 1RTNA 3FVQA 5I6YA 1BCPB 1GUOA 3P75A 1U9RA 1ZYRC 4LK1C 2SDFA 1QILA 2F0WA 1MBYA 3T56B 1O78A 3CU7A 3K6OA 5KGUA 3WDNA 1NAPA 1U4PA 3PO2B 3BG3A 4A3DB 4R9WA 2LFNA 3OMCA 1PFMA 5FOBB 5IGEA 1LT3D 2K5WA 1BNZA 3HEJA 2PO4A 3EQLC 3QWNA 3OIPA 3I8ZA 1CZGA 4HSPA 1T5XD 4EVOA 3A8JE 4R8NA 1TY0A 3I4NB 1D5ZC 4J8QA 3CKIB 5I2XA 5E4XA 2RQXA 2PQEA 4IFDH 3L3OC 1SNQA 3V96A 2F0QA 5C0XG 3IKJA 1NUCA 2B2WC 2NUCA 1TT2A 3PIP3 3MXNA 5IGDA 1R4PB 5FO7B 3LNNA 5DNFA 1O7YA 3S1QB 1V1PB 3J7AV 4DNRB 1ENCA 2ENBA 3HZXA 3VR6A 5E4WC 3KLSX 2QDBA 4CJ0B 1TWGB 4WFN3 1YNNC 4HSVA 4NDXA 4BBRB 2PW5A 1FD7D 1EYDA 2H1EA 3M7GA 4C1NK 1STAA 3KBGA 4PNYA 2PW7A 3UI2A 1EOTA 2NVXB 1LO5D 2RDFA 1ESFA 3EROA 1I4HA 3C1FA 3SK4A 1TS3A 2EYHA 2X69A 3RMHA 1F2LA 2JA7B 1ICWA 2XSCA 5M9OA 2AQ3B 3JAME 1JOQA 4A3MB 4JK1C 1LT5D 3PUWA 3FPUB 4K6LA 2NTTA 1GUNA 4EQOA 4N9PA 1CI3M 4GZYC 2TSSA 4ZK9B 2K7VA 1I3QB 1U4LA 4OO1G 1ILQA 5IGFA 2XRSD 3GTPB 2EVBA 2EY6A 1XWEA 4XQJA 1C8CA 3FPPA 4QIWB 4U673 5FKAC 1EU3A 3PIO3 3S17B 5CV4A 3TZDA 2L9HA 3J80E 2NN6I 2XNAC 1DYQA 2A6EC 2A68D 3FMCA 3V05A 4K5WA 1QNUA 2M2LA 1G8ZD 2B2VC 4X3TA 4RGNA 3HP3A 4IURA 5IT9L 1D6EC 3EVQA 2BOSA 1SYEA 3A8IE 1PTOF 2B8GA 1PRTC 4NW2A 5BN3A 3VYRA 5EPKA 4CKBA 5LL6X 1CZWA 1F2YA 1QG7A 1XTCD 3JAML 2EZVA 3NK9A 3NWTA 3KK7A 2F0NA 1SBBB 3K59A 2HDLA 3GTJB 4F7XA 4C3HB 1AFPA 3H91A 1EY4A 3GTMB 4DXGA 2YYZA 1WTWA 4KHZA 3RZOB 4IFDG 3GP7A 4KN4C 2R92B 1EEID 1F77A 1QB5D 1Y8NB 3A7LA 5FLXL 4CBVA 4ILWA 4L8JA 1Y1VB 1LTBD 3GTKB 3ITPA 2B2UC 3CQZB 1LACA 4BBSB 3KLRA 1CHQD 1WCMB 2WV6D 2OF1A 1B3AA 4EQNA 2K32A 4QCLA 2EYOA 1D1KA 2K5DA 1PMRA 3PO3B 3QO2A 4BS9A 2ICIA 4XT3B 1BXTA 3I73A 4K2LA 3KUPA 4TQUS 4NMZA 2F0SA 1OXTA 2DY7A 3I70A 1STEA 3NBHA 1Q12A 1SE3A 2EJFC 4C3IG 2BE5D 2F0JA 4H44C 5JPNC 3M85A 5EKKA 5DM73 1Q8IA 3RD4A 4H0LC 4XYQA 4DNTB 3DMUA 2ICEC 3SXHA 3TZUA 4FVMA 5CBEE 4L63B 3J80L 4OHJA 3O13A 1IL8A 1UNSA 3HOXB 2NTSA 2DNCA 3DXJC 3OSOA 1SE4A 3NP8A 4ZKCB 4J1MA 1D5XC 2J7ZA 5C3XA 4CKEA 3A54A 3NPPA 1G291 3A8KE 3HRZC 2Z4IA 1H9MA 2BA0A 4KN7C 1O80A 4C2MB 1RF2D 1PZJD 5D65A 3KBXA 3R8BA 4OGQC 4QUFA 5I2YA 1VMPA 1MSGA 2L5TA 5C44B 5COYA 4OL7A 3VYUA 4B9XA 1CTMA 1JCKB 1GHKA 4DK1A 2RSOA 1PZID 1G6ZA 5CGKA 1ET9A 1OXXK 1OXUA 1L0XB 4XDXA 4F88A 2SEBD 3NTKA 1ZEQX 2IJ0A 3NQTA 4RGOS 1AN8A 5F2DA 3A7AB 3BYTB 5K36G 3A55A 1F9PA 1D1IA 2JA6B 3KF8A 2N55A 1EYCA 2BE5C 2C5CA 2BCOA 2Q8RE 3HOYB 2X6LA 2F0PA 2OT2A 1EWHA 1GJXA 1NR4A 4TKOB 1O7ZA 2JE6I 5EPLA 1MSHA 2XN9C 1I4XA 3QG1A 5M3FB 1DOLA 2OXPA 3Q0AA 2NWGA 5JEAH 1S4ZA 1ILPA 3X3NA 3SEBA 1X3PA 2N88A 4RFBA 1WTVA 1SXTA 2BA1A 2Q8TA 4C1NI 4IUUA 1W6KA 1GOZA 1VF7A 3BVZA 2HUGA 1SYGA 1HTPA 5KRUA 3N52A 4ZKBB 1I6HB 2NVQB 1FNWA 3S14B 2A6HD 4ID6A 2YU9B 1L0YB 1EZ6A 4DU9A 3S2HB 4YIJA 4A3BB 2F0TA 2KA7A 5C4ZA 5JAVA 4LJZC 4MHEA 1HUMA 2NVYB 5ELDA 1JWUD 1TWCB 3IAYA 2JP1A 5T1IA 2L0CA 3D6CA 2Q8IB 2K6AA 4FYDA 1HQRD 3CRLC 2EYJA 1XX8A 1BCPD 3OMGA 2DY8A 2KVMA 2D9UA 4HTHA 5IT9E 3G6JB 3H6MA 3I91A 3DHQA 5I9OA 3D3RA 5DM63 1D2BA 1HRJA 3NSWA 5KYIA 1DOMA 1NSNS 3MXGA 1PYWD 4FF1A 3F2UA 1EQTA 1WTPA 4DA2A 3X3MA 1PTOH 3N6RA 3OOCA 1WD1A 3D8GA 3CRKC 4QF4A 4XTCS 1HCZA 3QIAA 3GTGB 4G7HC 4FO2A 3C1EA 2A69D 5KYLA 2B2YA 2SNSA 5IGCA 5EKLA 3LWUA 2JA5B 1SYBA 4KKTA 5CV8A 5A35A 4DGZA 3WOFA 1A2TA 1V8QA 2PZWA 4C3JG 4HCEA 4G7ZC 3DWPA 3VYSA 1LTRD 4NKLA 2NVTB 1I6VC 3NTIA 1SNDA 1SAPA 4RAUC 5J22A 1KDBA 3MHBA 4C3JB 3K57A 3EJIA 5CYUA 3Q22A 1QE6A 2KCCA 1FGBD 3GTQB 4CGYB 2LS01 4ZLTF 2RVLA 1WVLA 1K83B 1NCVA 5CV5A 1MGSA 3S9WA 4WRDA 2JXMB 2XVSA 1VDZA 3NE5B 2E2JB 4I7ZC 1ENAA 3FKIB 3KLSA 1LLRD 5ELFA 4RKLA 1STYA 2CQAA 1EEFD 2EPBA 5JEAG 5IGBA 4P2CB 2Z8LA 3TP5A 3MVVA 1SFOB 1DOKA 2MUYA 5K36H 5HGTA 5DAUA 1JICA 2RDHA 2VXWA 3C2PA 4IUNA 2K03A 3PMFA 1HHVA 1R9TB 1HXYD 4IUQA 1BDOA 2D62A 4FF4A 1KAAA 1MD2D 4ZQ3A 1EY7A 1RDPD 4XIGS 2EE1A 1EIHA 2QKIC 1TKWB 2L11A 4M8AA 5EPJA 3J7AF 2FFKB 1G2SA 3PUYA 5I6WA 1BCPC 2QCPX 4C3IB 1B53A 2KECA 1V1PA 4BA1I 2AWNA 1JC7A 1VCIA 2AUKA 5ELBA 1H9KA 2WACA 1DCZA 4F8MA 1SNPA 4RWSC 2F0UA 4WORA 1SJED 3IL8A 2O5JC 3BZDB 3Q24A 1JQYD 1EIGA 4IN3A 4DAYA 1A2UA 2JSOA 1HA6A 2WIIB 1PFBA 3SK8A 3FEWX 1I4GA 1T5EA 2HDMA 5CBAE 3E5SA 4RGTA 3S16B 1SNMA 5ISRA 2NZ1D 2EYLA 4UAIA 1GUSA 3S15B 3GV3A 1I50B 1SEBD 3G7LA 4S3SA 5EQ0A 1SMYD 1ENFA 3D6WA 1FNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXW A;  2J7Z A;  2MPM A;  1ROD A;  3FPU B;  1DOL A;  1RHP A;  2K03 A;  2NWG A;  3I8Z A;  4MN3 A;  1IKL A;  4ZAI A;  1HHV A;  4IUQ A;  1S4Z A;  1ILP A;  2HCC A;  4ZK9 B;  1X3P A;  1MI2 A;  2N88 A;  4R8I A;  1WTV A;  1U4L A;  2XIW A;  1ILQ A;  4LMQ D;  2K04 A;  4U68 A;  2Q8T A;  2JYO A;  3I3C A;  1CA5 A;  1JE4 A;  4O42 A;  2KUM A;  4IUP A;  4IUU A;  2HUG A;  1O80 A;  1Q3L A;  2NYZ D;  1GUW A;  1F9R A;  2RA4 A;  1BBX C;  2CVR A;  3N52 A;  1F9S A;  2KED A;  4RA8 A;  3TN2 A;  5D65 A;  2KEE A;  2EE1 A;  3DEP A;  5E4X A;  4ZKB B;  3MTS A;  1C8C A;  1J8I A;  1EIH A;  3KBX A;  4X3K A;  4CJ1 B;  2B2U C;  1X32 A;  1CM9 A;  1E0B A;  2L11 A;  2MP1 A;  1SAP A;  4IUV A;  4RAU C;  4QUF A;  2FJ2 A;  1M8A A;  1SDF A;  2L4N A;  1NR2 A;  4X3S A;  1VMP A;  5EPJ A;  5CMD A;  2MGS A;  5JJZ A;  3GV6 A;  3TZD A;  1MSG A;  2FFK B;  2RSN A;  4CJ2 C;  3I90 A;  1G2S A;  5COY A;  5EKI A;  1B3A A;  1KNE A;  4MHE A;  1QNK A;  2L9H A;  5T1G A;  2K28 A;  2BDN A;  1B50 A;  2B2W A;  2B2W C;  1HUM A;  1QE6 A;  1WTO A;  3FDT A;  1WTX A;  2K1B A;  1B2T A;  2RSO A;  1AZQ A;  3QO2 A;  1ML0 D;  2JP1 A;  2FHT A;  1B53 A;  4XT3 B;  1G6Z A;  3R93 A;  5T1I A;  1A15 A;  4ZLT F;  2KEC A;  2RVL A;  1WVL A;  2M2L A;  1G2T A;  2B2Y C;  3KUP A;  2B2V C;  3LWE A;  1O7Y A;  1NCV A;  4HED A;  1U4M A;  4X3T A;  5DNF A;  1PDQ A;  1U4R A;  3HP3 A;  3SVM A;  4HAE A;  4IUT A;  1MGS A;  2DY7 A;  1XX8 A;  4XDX A;  1CA6 A;  4IUR A;  2X6G A;  2DY8 A;  3MWY W;  4RWS C;  2HCI A;  4HCS A;  2KVM A;  1DON A;  2D9U A;  3IFD A;  2MJ8 A;  1RTN A;  2FMM A;  5E4W C;  5EJW A;  1BF4 A;  3Q6S A;  4NW2 A;  5AFW A;  4CJ0 B;  1VMC A;  3I91 A;  1X3Q A;  4HSV A;  3IL8 A;  4XT1 B;  1F9Q A;  2B2U A;  1HRJ A;  1J9O A;  4OIJ A;  1WTQ A;  1ESR A;  5EPK A;  1EIG A;  4QUC A;  3DEO A;  1AP0 A;  1DOM A;  2SDF A;  1PLF A;  1HA6 A;  1ZXT A;  2H1E A;  2R3Z A;  1QG7 A;  1PFB A;  1IKM A;  1B4O A;  1HFG A;  3F2U A;  3ONA B;  1LV9 A;  1F9P A;  2B2T C;  2B2T A;  1BO0 A;  2HDM A;  2EOT A;  1EQT A;  5CBA E;  3DM1 A;  1HFN A;  1WTP A;  3UI2 A;  1XYI A;  1TVX A;  4OIK A;  2N55 A;  1EOT A;  1KNA A;  2EPB A;  2L12 A;  2NZ1 D;  1WD1 A;  1EL0 A;  2Q8R E;  2X6L A;  4DN4 M;  1G91 A;  4X3U A;  1PFN A;  1NAP A;  2HDL A;  1U4P A;  2IL8 A;  2KOL A;  5CBE E;  4UAI A;  5COR A;  1WTR A;  2L1B A;  1SSO A;  2K01 A;  1DZ1 A;  1DOK A;  1RTO A;  3H91 A;  2B2V A;  3GV3 A;  3P7J A;  2B2Y A;  1NR4 A;  1IL8 A;  2X69 A;  5D14 A;  1F2L A;  4R9W A;  1WTW A;  3G7L A;  1ICW A;  1O7Z A;  5EQ0 A;  1WD0 A;  1AZP A;  1PFM A;  1RJT A;  5EPL A;  1HUN A;  1MSH A;  2K05 A;  2FIN B;  4ZKC B;  1BNZ A;  3D6W A;  1JIC A; 
#chains in the Genus database with same CATH topology
 2KJX A;  2WKD A;  1AEX A;  4ZAI A;  1OXS C;  4IJL A;  3AFP A;  1PTO D;  3M4P A;  4FDB A;  1TS5 A;  3K7A B;  1ASZ A;  4G4K A;  1MI2 A;  1SE2 A;  3EIV A;  4LF4 L;  3MEH A;  3M4Q A;  4U68 A;  3I3C A;  5KNC A;  2DNE A;  1K8G A;  1TR5 A;  5IOC A;  3U4V A;  4GLX A;  2CVR A;  4JCV E;  2UXC Q;  4JI4 Q;  4DR7 L;  1YNX A;  1XJV A;  1VQP A;  1E0B A;  5J1Z A;  3CCE A;  2FJ2 A;  1O7I A;  5M5X B;  1EU4 A;  4HJ5 A;  4H13 C;  1N32 Q;  3SR1 A;  3KDF B;  2WB1 B;  2Z9H A;  1X3G A;  2UUB Q;  1VQ5 A;  1IBL Q;  3VA7 A;  1C48 A;  2VUM B;  3AQQ A;  3R93 A;  2JA9 A;  3HKZ E;  2Z0S A;  3ULL A;  3RZO H;  3GTM H;  1TWH B;  1SJH D;  1U4M A;  4P74 A;  1I4Q A;  2F1M A;  2ZT9 C;  3HOW H;  2RBM A;  1VQB A;  3SVM A;  3F8T A;  4IUT A;  1IBL L;  2X6G A;  3H3V C;  1JWS D;  2F0L A;  3IFT A;  3MZ5 A;  3AU7 A;  3Q6S A;  5AFW A;  1TS4 A;  2VUM G;  1VQ6 A;  5KIX A;  1QJO A;  2C35 B;  1Z7T A;  1EY0 A;  1V1Q A;  2J4X A;  2Z4H A;  3ICE A;  4F87 A;  3GTL B;  1H9R A;  2OTJ A;  2VUM H;  2PMZ E;  1VQH A;  1K28 A;  1BO0 A;  2R7F A;  4X64 L;  2EOT A;  1SFO H;  4AQY Q;  1EY9 A;  2E76 C;  2GA4 B;  1KNA A;  1HZB A;  3S15 H;  4DR3 L;  5I4D A;  1TS2 A;  2IL8 A;  1II3 A;  2KOL A;  4PV1 C;  2Y0S G;  5M3M G;  5COR A;  1DZ1 A;  2R92 H;  1RTO A;  3QOL A;  1HZC A;  5D14 A;  4X65 L;  4DXF A;  5D3I B;  5TSS A;  1EY8 A;  4BA2 I;  2FIN B;  1SMX A;  3P20 A;  3HG9 A;  3U58 A;  5FK9 C;  1EFW A;  3GTK H;  5EBD A;  3U9S A;  4HJ8 A;  3NBH B;  1EY6 A;  4A3F H;  3C46 A;  1SE8 A;  2KQ3 A;  2Q2H A;  2TMP A;  1EWC A;  1PVO A;  3VDY A;  2NVY H;  4K0K Q;  3NQI A;  4Y7N B;  1K0S A;  2B63 H;  2B39 A;  4JI7 Q;  4A3C H;  4JI3 L;  1CA5 A;  1EQV A;  1KDA A;  2LSS A;  3BVG A;  1E2V A;  2E2H B;  4K2K A;  4A76 A;  4FF3 A;  2YTV A;  3I4M B;  4CDD C;  1CM9 A;  3GTO B;  5EBC A;  2I5H A;  1ONL A;  4BWG B;  4IUV A;  3H94 A;  2MO1 A;  2EYP A;  3ULP A;  2E75 C;  2IX3 A;  4RHS A;  3HS0 C;  2XWB B;  2E2I H;  2JEA I;  1BKB A;  2MFI A;  3UDF A;  1Q8K A;  1Z6H A;  3VR4 A;  1HQM C;  1WTX A;  3S16 H;  2K1B A;  2Z6K A;  2NN6 G;  4DK0 A;  1BR9 A;  1GO3 E;  1U5K A;  3HGB A;  3QJY A;  4DV5 Q;  1C9O A;  4A3D G;  1G2T A;  1SYD A;  3BDO A;  3G48 A;  4JI4 L;  4DR7 Q;  4DFA A;  4LFB Q;  5DEH A;  3MWY W;  4B9W A;  3I72 A;  3PO3 H;  1HNW Q;  3PSI A;  3KLW A;  2F52 A;  2FMM A;  5BN5 A;  1VQ9 A;  1MJC A;  3K5L A;  3OWF A;  3CP0 A;  1X65 A;  1FL0 A;  1NTG A;  1WTQ A;  4FXG C;  4JBK A;  1H95 A;  3HOW B;  5EAY A;  4LUZ A;  5EGT A;  4K0K L;  1HA5 A;  1LV9 A;  3R2I A;  4YWL A;  5IGG A;  4KV6 A;  4DV0 L;  4DR1 Q;  5C4H A;  2ID0 A;  5KNB A;  1HFN A;  3MFG A;  2ZJQ A;  1YNJ D;  3K5M A;  4JI2 Q;  4HID A;  1HH2 P;  3K5O A;  4A3L G;  3H0G B;  4DR5 Q;  1EYA A;  4BY1 H;  3MXU A;  3M3Y B;  5M5Y H;  4DV0 Q;  4KKU A;  3BZK A;  3KF6 A;  3PGZ A;  5JJI A;  4DV4 Q;  3HKZ G;  1Y8O B;  1PRT F;  4A3F B;  1KC8 C;  2ZM6 L;  1RJT A;  2JA7 H;  4TRD A;  2G9D A;  2HIV A;  3NXW A;  1IYV A;  2CWA A;  3BVM A;  3E0E A;  3I4O A;  5JVG 3;  2HCC A;  1CKM A;  2O5I C;  3BYY B;  4UP7 A;  5GAG C;  3PO2 H;  4BY7 B;  3D4D A;  3HKZ B;  3F1Z A;  4RMF A;  4IUP A;  4ABN A;  4YCW A;  3AYH B;  1BBX C;  2CH4 A;  4WJ4 A;  3QB3 A;  3TN2 A;  2KED A;  4RA8 A;  4B08 A;  4KLK A;  1GVP A;  1K9M C;  2OWO A;  1E3P A;  1J8I A;  3PQI A;  5JVH 3;  3SHL A;  4DK3 C;  4CJ1 B;  2YV5 A;  1Y1W B;  3JC6 6;  1YIT A;  1XTD A;  1HNZ L;  1DXM A;  2M9V A;  5KEE A;  1M4V A;  4YWK A;  3I90 A;  1RCV D;  1OTC A;  4A3I G;  5C0X H;  3ULJ A;  1B50 A;  4DUY L;  5L37 A;  1K8O A;  3I4L A;  1PH5 A;  3NBI A;  4ZUI A;  1E22 A;  3J7Y W;  2UUA L;  2AMC B;  1LT6 D;  2PI2 A;  1G51 A;  4R4C A;  4HJA A;  1ASY A;  2ZM6 Q;  3TBI B;  3CMA A;  4HED A;  1U4R A;  3L7Z C;  4HAE A;  5IWA Q;  2IPK D;  2BDO A;  1UE7 A;  2I46 A;  4DNI A;  3AB9 A;  3D31 A;  1PZK D;  1BF4 A;  2AUJ D;  3TDQ A;  4IFD I;  4C3J H;  4C56 C;  4DF7 A;  4CDF C;  1PH4 A;  2F0E A;  2F0D A;  1LTL A;  5LL6 S;  2WKC A;  5K5P A;  2D2C C;  2R3Z A;  4DAY B;  1WJJ A;  1T9H A;  1IYU A;  2R7Z H;  2V4D A;  3DUZ A;  2LKV A;  2IWH A;  2DUD A;  1PRT B;  3HOV B;  1J6Q A;  5M5Y B;  3NWS A;  2CFM A;  4OIK A;  1TQO A;  4DV4 L;  1EZ8 A;  3RN5 A;  4ZYS A;  2UXB L;  3P1H A;  2A19 A;  2E2D C;  2IHF A;  2CCZ A;  3W1B A;  4DR1 L;  1QWY A;  1STH A;  1Y69 U;  3OW7 A;  4P73 A;  4KHV A;  1YJW A;  1CT1 D;  1GKH A;  1QOH A;  3HOZ B;  2Z1C A;  2VQE L;  3DWA A;  1RL2 A;  5FO9 B;  4ZUJ A;  4R8I A;  4Q5V A;  1Q86 C;  2JYO A;  4YY3 L;  4DR3 Q;  5CR3 A;  1F9R A;  2ZJR A;  1WFQ A;  4LAA A;  2K5Q A;  5AJ3 Q;  3VYT A;  1VF5 C;  3DEP A;  4O2D A;  5C0X I;  3MTS A;  1IBK Q;  2F3W A;  1X32 A;  1B70 B;  5CV7 A;  1SNC A;  4RCO A;  1LTT D;  3MFY A;  2ALY B;  5CMD A;  4L5Q A;  4HJ7 A;  2DN8 A;  1TY2 A;  4LF6 Q;  2OEO A;  1QNK A;  3CHB D;  4X62 Q;  3D4W A;  2QIL A;  1WTO A;  4B3T L;  4A93 G;  3TP7 A;  3TQY A;  1LT4 D;  1PXU A;  1FVI A;  2RKS A;  1EOV A;  4OO1 H;  1KXL A;  1HTL D;  3MEF A;  5J39 A;  5HGQ A;  2F0K A;  2ZXO A;  4UDU C;  3H3V H;  4QMG A;  1PDQ A;  2D5D A;  4I65 A;  3K5N A;  5C6A A;  2MO0 A;  4A93 B;  4K6D A;  4M1U B;  4XYO A;  2RHQ B;  1B1Z A;  3MA2 B;  4L5S A;  1DD2 A;  4GKK Q;  2AQ1 B;  4JG2 A;  4KD4 A;  1VQA A;  3SE0 A;  5C44 H;  1IBM Q;  3CCQ A;  2IHE A;  4QUC A;  3DEO A;  3R3O A;  1PLF A;  4PZ8 A;  1S5E D;  2NVQ H;  4V19 0;  5C3E B;  3BJU A;  1B4O A;  4JI8 Q;  1YHA A;  3ONA B;  4EQP A;  5KND A;  1UE5 A;  4ODG A;  3TME A;  1TVX A;  4G57 A;  4POG A;  5IOD A;  3OIQ A;  3L0O A;  4DN4 M;  5JPM C;  2G9H D;  4QL5 A;  4PMC A;  2K01 A;  3A74 A;  4JVZ A;  2UUC L;  4J6H A;  2M00 A;  3PV0 A;  2A5H A;  3ERQ A;  3D0F A;  4A3K B;  5C3W A;  2WAQ B;  4UP9 A;  4A3E G;  5ELN A;  3QOJ A;  3W3A A;  1RHP A;  4MN3 A;  2K52 A;  2D0O A;  4GOP A;  1LTI D;  5G3L D;  1HNX L;  2K5V A;  2O4X A;  4LFA Q;  1S5C D;  5LMU Q;  1TWG H;  3HFZ B;  1SNO A;  3J81 E;  4DR4 Q;  1RKN A;  2QGQ A;  2KUM A;  1CKN A;  2QEJ C;  1SN8 A;  3NTH A;  4FP5 D;  4L6T B;  3RLO A;  3UDX A;  4A3K G;  5C5L A;  4B3M L;  1PH3 A;  1JOR A;  3SGI A;  5JEA J;  4CKC A;  4IQZ A;  1GHJ A;  1Q46 A;  1H9S A;  3LX0 A;  5NUC A;  3HOY G;  4JYA L;  4LFB L;  2RDG A;  2R93 B;  3GV6 A;  4BY1 B;  1ZKO A;  5EKI A;  1B3Q A;  1V43 A;  4B3T Q;  1E2Z A;  1TU2 B;  1C4Q A;  1PTO C;  1A3T A;  1B2T A;  1ML0 D;  3DWQ A;  3G6E A;  1YVC A;  1Q7Y C;  2CQO A;  2EYF A;  4MNO A;  5BR8 Q;  3S1R B;  1H9J A;  2F0I A;  3TP6 A;  2OQ0 A;  2R93 G;  2B2Y C;  1N34 L;  3HOX G;  1IL2 A;  3LWE A;  2R7Z G;  2PMZ B;  2F0V A;  2QW7 A;  4V0B A;  2A69 C;  2EY5 A;  1WOC A;  2EDG A;  1PYB A;  3GQB A;  3IFD A;  3F2B A;  5EJW A;  1LAB A;  5FLX c;  2QDL A;  5CV9 A;  4XQQ A;  4XT1 B;  3I4M G;  1J9O A;  2EY2 A;  4OIJ A;  4IOC A;  2Y0S B;  5M3M B;  4LF5 L;  3T53 B;  1KTK A;  4IPH A;  1FR3 A;  2AKW B;  5IP7 G;  3S1R H;  1IKM A;  1HFG A;  4RHR A;  4JOI A;  2KCN A;  4DAP A;  3OWE B;  2N8N A;  1XYI A;  1A6X A;  4IO9 A;  1Q90 A;  2JA8 B;  1YNN D;  2VB3 X;  1EL0 A;  1N36 Q;  3URY A;  3NHH A;  2XRQ D;  4X3U A;  1PFN A;  2WIN B;  2R93 H;  4A3I H;  3T16 A;  3E0J A;  1Q1B A;  2B2V A;  4KJN A;  3J81 L;  1EQQ A;  2IX0 A;  2I07 B;  3PF4 A;  4ULL A;  1HUN A;  1L0W A;  1HR0 L;  4ALP A;  1B9N A;  1B44 D;  4PQX A;  2ATW A;  3KJO A;  3BDC A;  5ELE A;  4N9T A;  3SK6 A;  3U9O A;  4A3J H;  1UE6 A;  1J5E Q;  2XIW A;  1A3V A;  1WCM H;  4QB4 A;  3M9B A;  1V1O A;  1KAB A;  4LF7 L;  4DAV A;  1GUW A;  3PUZ A;  1HJP A;  3T4A C;  3A56 A;  3KF8 B;  2QF7 A;  2A6H C;  3E6Z X;  2HHH L;  3OHX C;  4KI0 A;  4C3I H;  1JOO A;  3K80 C;  1KLG D;  5IY0 A;  1DGS A;  2MP1 A;  1KRT A;  5IE8 A;  1W2B A;  1SDF A;  2Q2I A;  2DJF C;  4GS3 A;  3RLF A;  5JJZ A;  2MGS A;  3TP8 A;  4RGM A;  2F4I A;  1QVF A;  3W2D A;  1UUP A;  2B2W A;  1TWF B;  3FDT A;  4KD3 A;  2WP8 J;  5E3F A;  1IW7 C;  1QVC A;  4K14 A;  1TWA B;  4O1N A;  1DM0 B;  2GN5 A;  2FHT A;  2PCF B;  4HIO A;  3CD6 A;  1S5B D;  3MC0 B;  1A15 A;  1Q1E A;  5JOB A;  1EIY B;  4BBS H;  1STN A;  3G4S A;  3PF5 A;  2SOB A;  1XMO L;  3HOW G;  4ME5 A;  2PPB C;  4LFC L;  1UEA B;  1CHP D;  1CSP A;  1IHZ A;  5M3F G;  1VQ8 A;  2HCI A;  2O2L D;  1CK1 A;  4X64 Q;  2A73 B;  4DR2 Q;  3UE0 A;  1A0I A;  2UUB L;  5M3F H;  3H09 A;  1RD9 D;  3K0Y A;  3HKS A;  1ZXT A;  2PQA A;  2ES2 A;  3GO5 A;  4LF9 Q;  2VS1 A;  2F3V A;  4PMW A;  4WJW A;  1A3U A;  1TWC H;  2B2T A;  2JEB I;  4XXE A;  2A74 C;  3M4O B;  1ZYR D;  1CFM A;  2KHJ A;  4A3I B;  1QCB D;  1FYC A;  1GUT A;  2L12 A;  4A3B G;  5FLM G;  2UXC L;  4B3S L;  2LXK A;  4JW0 A;  4GNX A;  1WTR A;  1E1O A;  2F4V Q;  2IT1 A;  3KF6 B;  4IPC A;  4KMU C;  3R2T A;  4BY7 G;  3P7J A;  1BQQ T;  1QUQ A;  2K33 A;  4DV5 L;  4LF5 Q;  1EYG A;  3CPW A;  1F2M A;  5M5W B;  5IWA L;  1N33 Q;  5D3D A;  2PZT A;  3CCS A;  2E2H H;  1I3Q H;  5BN4 A;  2ZXR A;  3ND9 A;  3JAM i;  4LUV A;  3HOU B;  4A3G B;  2EJG C;  2IX1 A;  4LMQ D;  1DJR D;  3V2T A;  5A2Q L;  5FLX E;  2NYZ D;  3VR3 A;  4K8I A;  2RA4 A;  1EIF A;  2YU9 H;  5FO8 B;  2H4O A;  2G5D A;  4AYB B;  1JB3 A;  3PUV A;  4DV1 Q;  4JI5 Q;  1YHB A;  1X56 A;  1VQD A;  4BXX G;  1M8A A;  2LY7 A;  2CW0 C;  4KK7 A;  4Q0F A;  4NP5 A;  2RSN A;  4TSS A;  3OPO A;  1KNE A;  2B8F A;  1SRO A;  5G3L F;  2BDN A;  4FXK C;  5E1F A;  1UAP A;  4A3L H;  3MXN B;  4AYB G;  3KJP A;  2EYM A;  4OO1 I;  3ND8 A;  4GN4 B;  2PZU A;  3B6Y A;  3S1Q H;  4Z9C B;  1S5F D;  1CQV A;  2L15 A;  2ZXP A;  3H3V I;  1XXG A;  2XWJ B;  3TSS A;  2UXD Q;  3L9A X;  4HN7 A;  3TS2 A;  3PUX A;  1CA6 A;  3BS1 A;  5A2Q E;  2R6G A;  4A75 A;  1NMF A;  4X66 Q;  4DR6 Q;  1DON A;  2F0M A;  4LF8 L;  1LTS D;  3FRP B;  3K8A A;  1R4Q B;  4A4I A;  1Z47 A;  4HMJ A;  4MIU A;  1SYF A;  1YNJ C;  2VNU D;  4A3J B;  1F9Q A;  2AWO A;  2CW0 D;  2EY1 A;  3SK5 A;  1ESR A;  1AP0 A;  3UDI A;  4DV7 L;  4GKJ Q;  5C5M A;  4CHT B;  1HPC A;  1PV4 A;  3GTO H;  5IYD G;  4RH6 A;  3DM1 A;  4UP8 A;  5C4J B;  1VQ4 A;  3GTP H;  4EGV A;  4FF2 A;  4H7B A;  3RZD B;  3ZYY X;  2E2I B;  3ZJY C;  5LMU L;  2B3G A;  2EIF A;  3CC7 A;  2L1B A;  1SSO A;  4NXN Q;  2K5H A;  3RUZ A;  3D4R A;  2UUA Q;  5C0X J;  1A8V A;  1LTA D;  5CV6 A;  3CC4 A;  1WD0 A;  2RCF A;  3Q23 A;  3MAQ A;  3IRB A;  2K05 A;  4RKB A;  1VQF A;  3GD7 A;  1M1K C;  2Q2U A;  1BBW A;  2E74 C;  1ROD A;  4PMB A;  1KDC A;  1N9W A;  4N8X 1;  4ME3 A;  1BUV T;  4IZ8 A;  3HOX H;  3AEV A;  4HR7 B;  2XTI A;  4DR6 L;  4GKK L;  4LF6 L;  2K04 A;  4KY7 A;  2F0O A;  1JE4 A;  5C4X B;  1KLU D;  1UE1 A;  3T1Y Q;  2F0F A;  1F9S A;  1JMC A;  2VL6 A;  1SYC A;  1YHQ A;  1JOK A;  4HIM A;  3TRE A;  2L4N A;  1NR2 A;  4X3S A;  4E6I A;  1PH6 A;  5I9P A;  5IP9 G;  1KRS A;  3CPF A;  2N3S A;  2EQS A;  2K14 A;  5C4X G;  3J81 j;  3NEN A;  2JK8 A;  1QVG A;  1M90 C;  3VR5 A;  1UEB A;  2NVX H;  3MXP A;  1Y1V G;  3J80 i;  1ET6 A;  3T13 A;  1CQF A;  2HQE A;  2HT1 A;  4FXD A;  1JWM D;  1JR0 D;  2VB2 X;  4DV1 L;  3NEL A;  2CH4 W;  4C3H G;  1HZA A;  2UXD L;  1IBK L;  2Z6B A;  4JBM A;  1Y1V H;  3VA5 A;  1B7Y B;  1K3B C;  2V1C C;  2EJM A;  4OWW B;  1N36 L;  5C3E G;  4XQN A;  4GOP B;  2MHV A;  1LTG D;  1E2W A;  4JV5 Q;  1IW7 D;  4K8J A;  2R61 A;  4HCS A;  4K5V A;  1B8A A;  2CHB D;  3EN2 A;  2KBN A;  4KY5 A;  1TII D;  1PTO B;  2B63 B;  1NE3 A;  3T51 B;  5BR8 L;  1OXV A;  1VMC A;  2FMC A;  3G71 A;  1X3Q A;  3HOU H;  4KJO A;  2B2U A;  1B9M A;  1GUG A;  3RN2 A;  5ELC A;  1S5D D;  1K83 H;  2PQA B;  1H9S B;  3EFX D;  1GXD C;  2B2T C;  1FGU A;  1F2Z A;  3S1M B;  5GAE C;  1CSQ A;  1GM5 A;  2WB1 G;  4A3E B;  2NN6 H;  1Q82 C;  1K73 C;  2NZH A;  5LHY 1;  1OO9 B;  3VR2 A;  1PRT D;  1G91 A;  1HZ9 A;  3BDL A;  3T1H L;  2OCE A;  1VQL A;  1FNU A;  2L55 A;  4DV3 Q;  2LMC B;  5CC4 A;  2EXZ A;  1AZP A;  2R7Z B;  3WOE A;  4HMI A;  4MZ9 A;  1O7L A;  3CCR A;  1YEZ A;  1I94 L;  4LFA L;  1I4R A;  1STB A;  4FNF A;  3PO3 G;  4NPS A;  2GVA A;  1STG A;  3EBE A;  2PYK A;  4KTA A;  3S14 H;  1RIP A;  2MPM A;  1K8M A;  3S1N B;  4KY6 A;  3K58 A;  1IKL A;  2A68 C;  1QUQ B;  4ZRZ A;  2AQ2 B;  1KD1 C;  1BCP F;  4K5X A;  2F0G A;  3SDZ A;  4A3C G;  2NBF A;  1PH7 A;  4O42 A;  3S24 A;  4KKS A;  1Q3L A;  1BOS A;  1W6J A;  5HUR A;  3S2D B;  2KHS A;  2F0H A;  3CQZ H;  2F03 A;  5IIF A;  5LMN L;  1EFI D;  2KEE A;  5FLM H;  2C9O A;  4GN3 B;  4X3K A;  4IAL A;  3C3L A;  3CW2 C;  2NB0 A;  1XMQ Q;  3M7N A;  1PH9 A;  4CJ2 C;  3AMU A;  3EA6 A;  3RR5 A;  3NUC A;  2EXD A;  5T1G A;  4GKJ L;  2K28 A;  4HIK A;  3TEH B;  1EY5 A;  1KIX A;  1X55 A;  4IFD J;  1XMQ L;  1AZQ A;  3M4Y A;  3RZD H;  1AW7 A;  4JBW A;  1Y1W H;  1NBW A;  4UHV A;  1D5M C;  1I4P A;  4RCN A;  1N8R C;  1Y8P B;  2J0T D;  1SMY C;  2SNM A;  1E24 A;  4LF7 Q;  1K0R A;  2IW3 A;  3K7U C;  2A6E D;  2PNR C;  4G7O C;  2MJ8 A;  1RTN A;  4P71 A;  4JI8 L;  3FVQ A;  5I6Y A;  1BCP B;  1GUO A;  3P75 A;  1U9R A;  4DV7 Q;  1VQC A;  4GLA C;  1ZYR C;  4LK1 C;  1VS0 A;  2SDF A;  1QIL A;  2HIX A;  2F0W A;  4YCU A;  1MBY A;  3E9H A;  3T56 B;  1V9P A;  1O78 A;  2MNA A;  3CU7 A;  1TWF H;  3K6O A;  4IPD A;  3J80 c;  4JI0 Q;  5KGU A;  4A3G H;  3CXC A;  3WDN A;  1NAP A;  1U4P A;  5AJ3 L;  3PO2 B;  3BG3 A;  2UUC Q;  4A3D B;  4R9W A;  5IP7 H;  2LFN A;  3OMC A;  1PFM A;  1Z9F A;  5FOB B;  5IGE A;  1LT3 D;  2K5W A;  1BNZ A;  3HEJ A;  2PO4 A;  3EQL C;  3QWN A;  3OIP A;  4NB3 A;  1AE3 A;  2LXJ A;  3I8Z A;  1CZG A;  4HSP A;  3LGJ A;  3W1G A;  3PO2 G;  1T5X D;  4EVO A;  4RG1 A;  3A8J E;  5IYD H;  4R8N A;  1TY0 A;  3I4N B;  4TVA B;  4H02 A;  2F3I A;  1D5Z C;  1TWH H;  4L5R C;  4J8Q A;  3CKI B;  5I2X A;  3CCJ A;  2A1A A;  3I4M H;  5E4X A;  2RQX A;  3ERS X;  2PQE A;  4IFD H;  1LUZ A;  3L3O C;  1U0L A;  1X9N A;  1SNQ A;  2PI2 E;  2WB1 E;  1LYL A;  3V96 A;  2F0Q A;  5C0X G;  3IKJ A;  1NUC A;  4HJ9 A;  1IYJ B;  2B2W C;  2NUC A;  1TT2 A;  3PIP 3;  2E2J H;  4AIM A;  3MXN A;  4KHP L;  1VQI A;  5IGD A;  1VQO A;  2QA4 A;  1R4P B;  5FO7 B;  3LNN A;  4JI1 L;  5H1S E;  2Z6K C;  3UDG A;  3K81 C;  1O7Y A;  5DNF A;  3S1Q B;  1V1P B;  2UXB Q;  3J7A V;  4DNR B;  1ENC A;  1MKH A;  2ENB A;  5IP9 H;  4DV6 L;  3HZX A;  2N49 A;  5FJ8 H;  3VR6 A;  5E4W C;  3KLS X;  1PA6 A;  3KFU A;  2QDB A;  4CJ0 B;  1TWG B;  3H15 A;  4WFN 3;  1YNN C;  4HSV A;  4NDX A;  4DK6 C;  4AQY L;  4BBR B;  2PW5 A;  2YTX A;  1FD7 D;  1EYD A;  2H1E A;  3M7G A;  1YI2 A;  3KBG A;  1STA A;  4PNY A;  4C1N K;  2PW7 A;  3UI2 A;  1EOT A;  2NVX B;  1YIJ A;  3GTG H;  1LO5 D;  4OON A;  2RDF A;  1ESF A;  3ERO A;  3M3Y H;  1EUJ A;  1I4H A;  4UY8 C;  3C1F A;  3HOU G;  3SK4 A;  1TS3 A;  2EYH A;  2VW9 A;  4X6A H;  2KEN A;  2X69 A;  1F2L A;  3RMH A;  2JA7 B;  1ICW A;  2XSC A;  5HY6 A;  2AQ3 B;  5M9O A;  3JAM E;  1JOQ A;  5FJ8 G;  4EX5 A;  4A3M B;  4R4T A;  4JK1 C;  1IBM L;  1VQE A;  1LT5 D;  1EWI A;  3PUW A;  3FPU B;  2Q2T A;  4K6L A;  2NTT A;  1GUN A;  1I50 H;  1GD7 A;  3S2D H;  4EQO A;  4N9P A;  4NXN L;  1CI3 M;  4GZY C;  4LF8 Q;  4A3J G;  2TSS A;  2JQO A;  4ZK9 B;  1P8L A;  2K7V A;  1I3Q B;  2VY3 A;  1U4L A;  1JJC B;  1ILQ A;  1KL9 A;  5IGF A;  2XRS D;  4OO1 G;  5C4J H;  3GTP B;  4BY7 H;  3DM3 A;  2EVB A;  2EY6 A;  3PIP A;  1XWE A;  4DR2 L;  5ELO A;  4XQJ A;  1C8C A;  3S1M H;  3FPP A;  2KHI A;  4QIW B;  3I7F A;  1BVS A;  1NY4 A;  4U67 3;  5FKA C;  1EU3 A;  3PIO 3;  1VQK A;  3S17 B;  5CV4 A;  3TZD A;  1S72 A;  2RHS B;  2L9H A;  4YHH Q;  3J80 E;  2NN6 I;  2XNA C;  4PG3 A;  4DV6 Q;  1DYQ A;  2A6E C;  5IYC G;  2A68 D;  3CCL A;  2KCM A;  3FMC A;  3H0G G;  3V05 A;  3A0J A;  4K5W A;  5J3B A;  1QNU A;  3NEM A;  4QJF A;  4JI1 Q;  4DR5 L;  2M2L A;  1G8Z D;  1ICF B;  2B2V C;  4X3T A;  3GDE A;  4RGN A;  3HP3 A;  1HNZ Q;  4IUR A;  5IT9 L;  3T1Y L;  1XPU A;  1D6E C;  3EVQ A;  2BOS A;  1SYE A;  3A8I E;  2VQE Q;  3J81 c;  1PTO F;  2B8G A;  1PRT C;  2BH8 A;  4NW2 A;  4Y7N H;  3I2Z A;  3KDF A;  5LMN Q;  3FHW A;  1LM0 A;  5BN3 A;  3VYR A;  5EPK A;  1KHI A;  4CKB A;  2R7D A;  5LL6 X;  1CZW A;  1F2Y A;  4OEM B;  1QG7 A;  4OXP A;  1XTC D;  1Q81 C;  4AH6 A;  2NVT H;  3JAM L;  2EZV A;  1YBY A;  3NK9 A;  1HNW L;  4IJH A;  3NWT A;  4P72 A;  1Y1W G;  3KK7 A;  3H0G H;  2F0N A;  2K75 A;  1YJN A;  1SBB B;  4DUZ Q;  3K59 A;  2HDL A;  4MTN A;  4A3E H;  3GTJ B;  4DAM A;  4F7X A;  4B3M Q;  4C3H B;  3FKI G;  1AFP A;  1S40 A;  1YJ9 A;  2PNH A;  1IZ6 A;  3H91 A;  1EY4 A;  3GTM B;  2UU9 L;  4DXG A;  4QQB X;  2YYZ A;  1WTW A;  1PH2 A;  3M4O H;  4KHZ A;  4BXX H;  3FKI H;  5IYB H;  3RZO B;  4IFD G;  4R4Q A;  4KN4 C;  3GP7 A;  4JI6 Q;  2R92 B;  1EEI D;  1F77 A;  4QIW E;  2N78 A;  1QB5 D;  1NNX A;  1Y8N B;  1MJE A;  4OX9 L;  3A7L A;  2WAQ E;  5FLX L;  3HOZ H;  4GNX B;  2I0Q A;  1L1O A;  4JI0 L;  4CBV A;  4ILW A;  4L8J A;  1P16 A;  1Y1V B;  1LTB D;  4DR4 L;  3GTK B;  3ITP A;  4NXM Q;  2B2U C;  3CQZ B;  1LAC A;  4A3M H;  4BBS B;  1CKN B;  3KLR A;  1CHQ D;  4YCV A;  1WCM B;  4DUY Q;  5JJK A;  2WV6 D;  1C0A A;  3HOV G;  2OF1 A;  1B3A A;  4EQN A;  2K32 A;  4QCL A;  1X54 A;  2EYO A;  4GOP C;  5IYB G;  1D1K A;  2K5D A;  3CCU A;  1PMR A;  3PO3 B;  5GRO A;  3QO2 A;  4BS9 A;  2UU9 Q;  2ICI A;  3BZC A;  4XT3 B;  1BXT A;  1YZ6 A;  3S1N H;  3I73 A;  4K2L A;  1QZG A;  1XNQ L;  3KUP A;  3RNU A;  4TQU S;  3JAM c;  1HNX Q;  4NMZ A;  2F0S A;  2K5N A;  1EQR A;  1OXT A;  2DY7 A;  3I70 A;  1STE A;  3NBH A;  1Q12 A;  1SE3 A;  2EJF C;  2ZJP A;  2HD3 A;  4C3I G;  2BE5 D;  1A63 A;  2F0J A;  4H44 C;  1NMG A;  5JPN C;  1N33 L;  3M85 A;  2ZTD A;  2E8G A;  2GVB A;  5EKK A;  1I94 Q;  5DM7 3;  3HOV H;  1Q8I A;  3RD4 A;  4H0L C;  4XYQ A;  4LW1 A;  3OTO Q;  4DNT B;  3DMU A;  2ICE C;  3SXH A;  3TZU A;  4FVM A;  5CBE E;  4L63 B;  3J80 L;  4OHJ A;  3O13 A;  1IL8 A;  1UNS A;  3HOX B;  5DLQ E;  1TXY A;  2NTS A;  2DNC A;  3DXJ C;  3OSO A;  4X62 L;  1SE4 A;  3NP8 A;  4ZKC B;  4Y52 H;  4J1M A;  3E9I A;  1S3O A;  1D5X C;  2J7Z A;  5C3X A;  4CKE A;  3A54 A;  3NPP A;  1G29 1;  4MTK A;  5GAD C;  4L5T A;  3T1H Q;  3A8K E;  3HRZ C;  4JV5 L;  2Z4I A;  1H9M A;  2BA0 A;  4KN7 C;  1O80 A;  4C2M B;  1FJG L;  1RF2 D;  1PZJ D;  5D65 A;  1XMO Q;  4NXM L;  1MIU A;  3KBX A;  2JA8 G;  3R8B A;  4OGQ C;  4QUF A;  5I2Y A;  1L1O B;  1VMP A;  1MSG A;  3CC2 A;  2L5T A;  5C44 B;  2ZTC A;  5COY A;  4OL7 A;  5C4X H;  3VYU A;  1G6P A;  1PYS B;  3FP9 A;  4B9X A;  1CTM A;  1JCK B;  1GHK A;  4DK1 A;  4LNQ A;  2RSO A;  4JYA Q;  5LMN W;  2RF4 A;  1PZI D;  1X3F A;  4CDC C;  1G6Z A;  4LUO A;  4DPG A;  3CCM A;  5CGK A;  4OEL B;  1ET9 A;  1OXX K;  1OXU A;  5C44 G;  4DV2 L;  4DV3 L;  1L0X B;  4XDX A;  3PCO B;  4B3R L;  2WAQ G;  5E7N A;  4F88 A;  2SEB D;  1D8L A;  2JA6 G;  3NTK A;  1ZEQ X;  2IJ0 A;  3NQT A;  4RGO S;  3KOJ A;  3K0X A;  4R4O A;  4OX9 Q;  1AN8 A;  4N8F A;  5F2D A;  4A3B H;  3A7A B;  3BYT B;  1C7Y A;  5K36 G;  4P75 A;  3A55 A;  1F9P A;  1QZH A;  1D1I A;  3W5O A;  3OW2 A;  1HR0 W;  2JA6 B;  3F2D A;  3KF8 A;  4B3R Q;  1PH1 A;  2N55 A;  1EYC A;  2BE5 C;  2C5C A;  2BCO A;  2Q8R E;  1VQ7 A;  3HOY B;  2X6L A;  2WFW A;  2F0P A;  3AFQ A;  1I5F A;  2OT2 A;  3PIO A;  4BY1 G;  1E1T A;  1EWH A;  2K4K A;  1GJX A;  3UE1 A;  1NR4 A;  3I4N G;  2B29 A;  4TKO B;  1O7Z A;  2F4V L;  2JE6 I;  5EPL A;  1VQN A;  3L2P A;  1MSH A;  2XN9 C;  3WWV A;  4PZ7 A;  1I4X A;  1XNR L;  3QG1 A;  5M3F B;  1DOL A;  2OXP A;  3Q0A A;  2NWG A;  5JEA H;  3Q8D A;  1S4Z A;  5JJL A;  1ILP A;  3X3N A;  4YHH L;  3SEB A;  1X3P A;  2N88 A;  4RFB A;  1WTV A;  1SXT A;  2BA1 A;  2Q8T A;  4C1N I;  4IUU A;  1W6K A;  1GOZ A;  1VF7 A;  3BVZ A;  2HUG A;  1SYG A;  1HTP A;  1R9T H;  5KRU A;  3N52 A;  4A3K H;  4ZKB B;  2H5X A;  1I6H B;  4OWT B;  2NVQ B;  1FNW A;  3S14 B;  2A6H D;  4ID6 A;  2MQH A;  2YU9 B;  1L0Y B;  1EZ6 A;  1WI5 A;  4OWX B;  4A3D H;  1XPR A;  1CUK A;  4DU9 A;  3S2H B;  4YIJ A;  4A3B B;  2F0T A;  3OYY A;  4QGU A;  3DLL A;  2FXQ A;  3GTJ H;  2KA7 A;  5C4Z A;  4UPA A;  4LJZ C;  5JAV A;  4MHE A;  2HHH Q;  1HUM A;  2NVY B;  4X66 L;  3BU2 A;  1JE5 A;  1X3E A;  3HOY H;  5ELD A;  1JWU D;  1TWC B;  1VQJ A;  4JI5 L;  2JA5 H;  2JP1 A;  3IAY A;  5T1I A;  3I55 A;  2JN4 A;  3CF5 A;  4JPB W;  4APV A;  2L0C A;  3D6C A;  4BBR G;  2Q8I B;  2K6A A;  4FYD A;  5GAH C;  3I56 A;  1HQR D;  3CRL C;  4A3G G;  2EYJ A;  1XX8 A;  1BCP D;  3OMG A;  2DY8 A;  2KVM A;  2D9U A;  1KQS A;  4HTH A;  1HR0 Q;  5IT9 E;  2A8V A;  3G6J B;  1JJ2 A;  3H6M A;  1WTH A;  3DHQ A;  3I91 A;  3D3R A;  5I9O A;  5DM6 3;  1IXR A;  1D2B A;  1HRJ A;  3NSW A;  5KYI A;  1DOM A;  4GN5 A;  1JT8 A;  1NSN S;  3MXG A;  4ZCK A;  1J5E L;  1PYW D;  4FF1 A;  1Y14 B;  3F2U A;  1A62 A;  4C2M H;  4QY7 A;  2JA7 G;  1EQT A;  1I6H H;  4PZ6 A;  1WTP A;  4DA2 A;  3X3M A;  4A3M G;  2JA5 G;  1PTO H;  3N6R A;  3OOC A;  1WD1 A;  3D8G A;  3CCV A;  3CRK C;  4QF4 A;  3GTQ H;  4XTC S;  1UWV A;  1HCZ A;  3QIA A;  3GTG B;  4G7H C;  4FO2 A;  1WYD A;  4AYB E;  4GNX C;  3C1E A;  2A69 D;  5KYL A;  2E5L L;  2VZA A;  2B2Y A;  4CDE C;  2SNS A;  5IGC A;  2VQF L;  5EKL A;  1XPO A;  3LWU A;  3A5U A;  1W3S A;  1SYB A;  4LWC A;  2JA5 B;  4KKT A;  5CV8 A;  5A35 A;  3F2C A;  3A5Z B;  1E7Z A;  4KHP Q;  3J7Z C;  2ASB A;  3U50 C;  3U4Z A;  1TWA H;  4DGZ A;  3WOF A;  1A2T A;  1V8Q A;  1AH9 A;  2VQF Q;  2PZW A;  4POF A;  4EQ5 A;  4C3J G;  4HCE A;  4B3S Q;  4G7Z C;  3DWP A;  4JOI C;  3VYS A;  1LTR D;  2IY5 B;  1VQM A;  3S2H H;  4NKL A;  2NVT B;  1I6V C;  2AHO B;  4GLV B;  2OQK A;  3NTI A;  4DUZ L;  1L2F A;  1SND A;  4LF9 L;  3GTL H;  5GQO A;  1SAP A;  4RAU C;  5J22 A;  1KDB A;  3MHB A;  4C3J B;  3K57 A;  3EJI A;  5CYU A;  3Q22 A;  3J81 i;  1QE6 A;  2KCC A;  1FGB D;  2DGY A;  3GTQ B;  4CGY B;  1SRU A;  2LS0 1;  4JI3 Q;  4ZLT F;  2E5L Q;  2RVL A;  1WVL A;  1K83 B;  1FJG Q;  4A3F G;  1NCV A;  5C3E H;  5CV5 A;  1MGS A;  3S9W A;  4WRD A;  2JXM B;  2XVS A;  1VDZ A;  2ZTE A;  3NE5 B;  2E2J B;  4I7Z C;  4C3H H;  2JA8 H;  1ENA A;  1PFS A;  3TRZ A;  4O0A A;  2P5Z X;  1L1O C;  4X65 Q;  1PH8 A;  5IYC H;  2NZO A;  2K50 A;  2BH2 A;  4WJ3 M;  4A93 H;  3FKI B;  4J15 A;  4JI7 L;  1JB7 A;  1CKO A;  3KLS A;  3CAM A;  1LLR D;  1WCM G;  5ELF A;  1N32 L;  4RKL A;  1STY A;  2CQA A;  2KCT A;  4IOA A;  5M3M H;  1EEF D;  2EPB A;  5JEA G;  5IGB A;  4P2C B;  3K7A H;  2Z8L A;  2R92 G;  3TP5 A;  3MVV A;  4R4I A;  1SFO B;  1K8A C;  1DOK A;  3J7A 5;  4I7A A;  2MUY A;  3KYH C;  2RCN A;  2JA6 H;  3OTO L;  5K36 H;  1SR3 A;  5M5W H;  5HGT A;  5DAU A;  1JIC A;  2RDH A;  2VXW A;  3STB D;  3C2P A;  4IUN A;  2K03 A;  3PMF A;  1HHV A;  2B63 G;  1K3R A;  1R9T B;  1HXY D;  4IUQ A;  1BDO A;  4BBS G;  2D62 A;  4FF4 A;  2I5M X;  1KAA A;  1MD2 D;  1SLJ A;  4JI2 L;  4ZQ3 A;  5IT9 c;  2CWP A;  2YTY A;  1EY7 A;  4IPG A;  1RDP D;  2OTL A;  1D7Q A;  4XIG S;  4LFC Q;  3S17 H;  2EE1 A;  1EIH A;  2QKI C;  1X6O A;  1TKW B;  2I5L X;  4LF4 Q;  1XNQ Q;  4BBR H;  2L11 A;  4M8A A;  1PHJ A;  5EPJ A;  3I4N H;  2DJG C;  4YWM A;  4DKA C;  3J7A F;  2FFK B;  1G2S A;  2JJQ A;  1XNR Q;  3PUY A;  5M5X H;  3QR8 A;  1BBU A;  5I6W A;  2Y0S E;  1BCP C;  4R1J A;  2QEX A;  2QCP X;  3ER0 A;  4C3I B;  1B53 A;  1NJI C;  3STB C;  2KEC A;  1V1P A;  4BA1 I;  2AWN A;  1JC7 A;  1VCI A;  2AUK A;  5ELB A;  1H9K A;  1JJG A;  4DV2 Q;  2WAC A;  1DCZ A;  4F8M A;  1KAW A;  1SNP A;  4RWS C;  2F0U A;  4WOR A;  1SJE D;  1MHW C;  3HOZ G;  2XGT A;  3IL8 A;  2O5J C;  3TS0 A;  3BZD B;  4IN3 A;  1JQY D;  1EIG A;  3Q24 A;  4YY3 Q;  4DAY A;  1A2U A;  2JSO A;  1HA6 A;  2WII B;  3CME A;  1PFB A;  3SK8 A;  1VQG A;  3FEW X;  1I4G A;  1T5E A;  2HDM A;  5CBA E;  3E5S A;  4RGT A;  3S16 B;  1SNM A;  5ISR A;  2NZ1 D;  3E3X A;  1AE2 A;  4JC0 A;  2EYL A;  4UAI A;  1GUS A;  4JBJ A;  3S15 B;  3GV3 A;  1I50 B;  1SEB D;  2HQL A;  3G7L A;  1N34 Q;  4S3S A;  5EQ0 A;  4JI6 L;  1SMY D;  1ENF A;  2D0P A;  2CKZ B;  3RLN A;  3D6W A;  1FNV A; 
#chains in the Genus database with same CATH homology
 2KJX A;  2WKD A;  1AEX A;  4ZAI A;  1OXS C;  1PTO D;  1TS5 A;  3K7A B;  4G4K A;  1MI2 A;  1SE2 A;  3MEH A;  4U68 A;  3I3C A;  5KNC A;  2DNE A;  1TR5 A;  5IOC A;  2CVR A;  1E0B A;  5J1Z A;  2FJ2 A;  5M5X B;  1EU4 A;  4H13 C;  3SR1 A;  2WB1 B;  3VA7 A;  1C48 A;  2VUM B;  3R93 A;  1TWH B;  1SJH D;  1U4M A;  1I4Q A;  2F1M A;  2ZT9 C;  2RBM A;  3SVM A;  4IUT A;  2X6G A;  3H3V C;  1JWS D;  2F0L A;  3IFT A;  3MZ5 A;  3AU7 A;  3Q6S A;  5AFW A;  1TS4 A;  5KIX A;  1QJO A;  1Z7T A;  1EY0 A;  2J4X A;  2Z4H A;  4F87 A;  3GTL B;  1H9R A;  1BO0 A;  2EOT A;  1EY9 A;  2E76 C;  2GA4 B;  1KNA A;  5I4D A;  1TS2 A;  2IL8 A;  1II3 A;  2KOL A;  4PV1 C;  5COR A;  1DZ1 A;  1RTO A;  3QOL A;  5D14 A;  4DXF A;  5D3I B;  5TSS A;  1EY8 A;  4BA2 I;  2FIN B;  3P20 A;  3HG9 A;  5FK9 C;  5EBD A;  3U9S A;  1EY6 A;  3C46 A;  2KQ3 A;  2TMP A;  1EWC A;  3NQI A;  4Y7N B;  2B39 A;  1CA5 A;  1EQV A;  1KDA A;  3BVG A;  1E2V A;  2E2H B;  4K2K A;  4FF3 A;  3I4M B;  1CM9 A;  3GTO B;  5EBC A;  1ONL A;  4BWG B;  4IUV A;  3H94 A;  2EYP A;  2E75 C;  2IX3 A;  4RHS A;  3HS0 C;  2XWB B;  2JEA I;  1Z6H A;  3VR4 A;  1HQM C;  1WTX A;  2K1B A;  2NN6 G;  4DK0 A;  1BR9 A;  3HGB A;  3QJY A;  1G2T A;  1SYD A;  3BDO A;  4DFA A;  5DEH A;  3MWY W;  4B9W A;  3I72 A;  2FMM A;  5BN5 A;  3K5L A;  3OWF A;  1WTQ A;  4FXG C;  3HOW B;  5EGT A;  1HA5 A;  1LV9 A;  3R2I A;  5IGG A;  4KV6 A;  5C4H A;  2ID0 A;  5KNB A;  1HFN A;  3MFG A;  1YNJ D;  3K5M A;  3K5O A;  3H0G B;  1EYA A;  3MXU A;  3M3Y B;  4KKU A;  1Y8O B;  1PRT F;  4A3F B;  1RJT A;  4TRD A;  2G9D A;  3NXW A;  1IYV A;  3BVM A;  5JVG 3;  2HCC A;  2O5I C;  3BYY B;  4BY7 B;  3D4D A;  3HKZ B;  4IUP A;  4ABN A;  1BBX C;  3QB3 A;  3TN2 A;  2KED A;  4RA8 A;  4B08 A;  1J8I A;  5JVH 3;  3SHL A;  4CJ1 B;  1Y1W B;  1DXM A;  2M9V A;  5KEE A;  1M4V A;  3I90 A;  1RCV D;  5C0X H;  1B50 A;  1K8O A;  3I4L A;  3NBI A;  4ZUI A;  3J7Y W;  1LT6 D;  3TBI B;  4HED A;  1U4R A;  3L7Z C;  4HAE A;  2IPK D;  2BDO A;  2I46 A;  3AB9 A;  3D31 A;  1PZK D;  1BF4 A;  2AUJ D;  3TDQ A;  4IFD I;  4C56 C;  4DF7 A;  2F0E A;  2F0D A;  5LL6 S;  2WKC A;  5K5P A;  2D2C C;  2R3Z A;  1IYU A;  2V4D A;  3DUZ A;  2LKV A;  2IWH A;  1PRT B;  3HOV B;  5M5Y B;  3NWS A;  4OIK A;  1TQO A;  1EZ8 A;  4ZYS A;  3P1H A;  2E2D C;  1QWY A;  1STH A;  1Y69 U;  3OW7 A;  4KHV A;  1CT1 D;  1QOH A;  3HOZ B;  2Z1C A;  3DWA A;  5FO9 B;  4ZUJ A;  4R8I A;  4Q5V A;  2JYO A;  5CR3 A;  1F9R A;  4LAA A;  2K5Q A;  3VYT A;  1VF5 C;  3DEP A;  5C0X I;  3MTS A;  2F3W A;  1X32 A;  5CV7 A;  1SNC A;  4RCO A;  1LTT D;  3MFY A;  5CMD A;  2DN8 A;  1TY2 A;  2OEO A;  1QNK A;  3CHB D;  3D4W A;  2QIL A;  1WTO A;  3TP7 A;  1LT4 D;  1PXU A;  2RKS A;  4OO1 H;  1HTL D;  5J39 A;  2F0K A;  2ZXO A;  4UDU C;  4QMG A;  1PDQ A;  2D5D A;  4I65 A;  3K5N A;  5C6A A;  4A93 B;  4K6D A;  4M1U B;  4XYO A;  1B1Z A;  3MA2 B;  1DD2 A;  2AQ1 B;  4KD4 A;  3SE0 A;  4QUC A;  3DEO A;  3R3O A;  1PLF A;  1S5E D;  4V19 0;  5C3E B;  1B4O A;  3ONA B;  4EQP A;  5KND A;  4ODG A;  3TME A;  1TVX A;  4G57 A;  5IOD A;  3OIQ A;  5JPM C;  4DN4 M;  2G9H D;  4PMC A;  2K01 A;  4J6H A;  2M00 A;  3PV0 A;  2A5H A;  3ERQ A;  4A3K B;  5C3W A;  2WAQ B;  3QOJ A;  3W3A A;  1RHP A;  4MN3 A;  1LTI D;  5G3L D;  2O4X A;  1S5C D;  1SNO A;  3J81 E;  1RKN A;  2KUM A;  2QEJ C;  3NTH A;  4FP5 D;  4L6T B;  5C5L A;  1JOR A;  5JEA J;  4CKC A;  4IQZ A;  1GHJ A;  1H9S A;  3LX0 A;  5NUC A;  2RDG A;  2R93 B;  3GV6 A;  4BY1 B;  1ZKO A;  5EKI A;  1V43 A;  1E2Z A;  1TU2 B;  1C4Q A;  1PTO C;  1A3T A;  1B2T A;  1ML0 D;  3DWQ A;  2EYF A;  3S1R B;  1H9J A;  2F0I A;  3TP6 A;  2B2Y C;  3LWE A;  2PMZ B;  2F0V A;  4V0B A;  2A69 C;  2EY5 A;  2EDG A;  3GQB A;  3IFD A;  5EJW A;  1LAB A;  5CV9 A;  4XQQ A;  4XT1 B;  1J9O A;  2EY2 A;  4OIJ A;  2Y0S B;  5M3M B;  3T53 B;  1KTK A;  1FR3 A;  1IKM A;  1HFG A;  4RHR A;  2KCN A;  4DAP A;  3OWE B;  1XYI A;  1A6X A;  1Q90 A;  2JA8 B;  1YNN D;  2VB3 X;  1EL0 A;  3URY A;  3NHH A;  2XRQ D;  4X3U A;  1PFN A;  2WIN B;  3T16 A;  3E0J A;  1Q1B A;  2B2V A;  4KJN A;  3J81 L;  2IX0 A;  2I07 B;  4ULL A;  1HUN A;  1B9N A;  1B44 D;  4PQX A;  3BDC A;  5ELE A;  4N9T A;  3SK6 A;  3U9O A;  2XIW A;  1A3V A;  4QB4 A;  1V1O A;  1KAB A;  4DAV A;  1GUW A;  3PUZ A;  3T4A C;  3A56 A;  2QF7 A;  2A6H C;  3E6Z X;  3OHX C;  4KI0 A;  1JOO A;  1KLG D;  2MP1 A;  1SDF A;  3RLF A;  5JJZ A;  2MGS A;  3TP8 A;  4RGM A;  2F4I A;  3W2D A;  1UUP A;  2B2W A;  1TWF B;  3FDT A;  4KD3 A;  2WP8 J;  5E3F A;  1IW7 C;  4K14 A;  1TWA B;  1DM0 B;  4O1N A;  2FHT A;  2PCF B;  1S5B D;  3MC0 B;  1A15 A;  1Q1E A;  5JOB A;  1STN A;  2SOB A;  4ME5 A;  2PPB C;  1UEA B;  1CHP D;  1IHZ A;  2HCI A;  2O2L D;  1CK1 A;  2A73 B;  3H09 A;  1RD9 D;  3K0Y A;  1ZXT A;  3GO5 A;  2F3V A;  4PMW A;  4WJW A;  1A3U A;  2B2T A;  2JEB I;  4XXE A;  2A74 C;  3M4O B;  1ZYR D;  1CFM A;  4A3I B;  1QCB D;  1FYC A;  1GUT A;  2L12 A;  1WTR A;  2IT1 A;  4KMU C;  3R2T A;  3P7J A;  1BQQ T;  2K33 A;  1F2M A;  5M5W B;  5D3D A;  2PZT A;  5BN4 A;  2ZXR A;  3ND9 A;  3HOU B;  4A3G B;  2EJG C;  2IX1 A;  4LMQ D;  1DJR D;  3V2T A;  5A2Q L;  5FLX E;  2NYZ D;  3VR3 A;  4K8I A;  2RA4 A;  5FO8 B;  2H4O A;  4AYB B;  1JB3 A;  3PUV A;  1M8A A;  2LY7 A;  2CW0 C;  4KK7 A;  4Q0F A;  4NP5 A;  2RSN A;  4TSS A;  3OPO A;  1KNE A;  2B8F A;  5G3L F;  2BDN A;  4FXK C;  5E1F A;  1UAP A;  2EYM A;  4OO1 I;  3ND8 A;  2PZU A;  4Z9C B;  1S5F D;  1CQV A;  2ZXP A;  1XXG A;  2XWJ B;  3TSS A;  3L9A X;  4HN7 A;  3PUX A;  1CA6 A;  3BS1 A;  5A2Q E;  2R6G A;  1DON A;  2F0M A;  1LTS D;  3FRP B;  1R4Q B;  1Z47 A;  4HMJ A;  4MIU A;  1SYF A;  1YNJ C;  2VNU D;  4A3J B;  1F9Q A;  2AWO A;  2CW0 D;  2EY1 A;  3SK5 A;  1ESR A;  1AP0 A;  5C5M A;  4CHT B;  1HPC A;  4RH6 A;  3DM1 A;  5C4J B;  4EGV A;  4FF2 A;  4H7B A;  3RZD B;  3ZYY X;  2E2I B;  2L1B A;  1SSO A;  3RUZ A;  3D4R A;  5C0X J;  1LTA D;  5CV6 A;  1WD0 A;  3Q23 A;  3MAQ A;  2K05 A;  4RKB A;  3GD7 A;  2E74 C;  1ROD A;  4PMB A;  1KDC A;  1BUV T;  4IZ8 A;  4HR7 B;  2K04 A;  4KY7 A;  2F0O A;  1JE4 A;  5C4X B;  1KLU D;  2F0F A;  1F9S A;  1SYC A;  1JOK A;  2L4N A;  1NR2 A;  4X3S A;  4E6I A;  5I9P A;  3VR5 A;  3MXP A;  1ET6 A;  3T13 A;  1CQF A;  2HQE A;  4FXD A;  1JWM D;  1JR0 D;  2VB2 X;  4C3H G;  3VA5 A;  2EJM A;  4XQN A;  2MHV A;  1LTG D;  1E2W A;  1IW7 D;  4K8J A;  2R61 A;  4HCS A;  4K5V A;  2CHB D;  4KY5 A;  1TII D;  1PTO B;  2B63 B;  3T51 B;  1OXV A;  1VMC A;  2FMC A;  1X3Q A;  4KJO A;  2B2U A;  1B9M A;  1GUG A;  5ELC A;  1S5D D;  1H9S B;  3EFX D;  1GXD C;  2B2T C;  1F2Z A;  3S1M B;  4A3E B;  2NN6 H;  5LHY 1;  1OO9 B;  3VR2 A;  1PRT D;  1G91 A;  3BDL A;  1FNU A;  2L55 A;  2LMC B;  5CC4 A;  2EXZ A;  1AZP A;  2R7Z B;  3WOE A;  4HMI A;  1O7L A;  1I4R A;  1STB A;  4FNF A;  1STG A;  2PYK A;  4KTA A;  2MPM A;  1K8M A;  3S1N B;  4KY6 A;  3K58 A;  1IKL A;  2A68 C;  4ZRZ A;  2AQ2 B;  1BCP F;  4K5X A;  2F0G A;  3SDZ A;  2NBF A;  4O42 A;  4KKS A;  1Q3L A;  1BOS A;  1W6J A;  5HUR A;  3S2D B;  2KHS A;  2F0H A;  2F03 A;  5IIF A;  1EFI D;  2KEE A;  2C9O A;  4X3K A;  4IAL A;  3C3L A;  2NB0 A;  3M7N A;  4CJ2 C;  3AMU A;  3EA6 A;  3NUC A;  5T1G A;  2K28 A;  1EY5 A;  4IFD J;  1AZQ A;  3M4Y A;  1AW7 A;  4JBW A;  1D5M C;  1I4P A;  4RCN A;  1Y8P B;  2J0T D;  1SMY C;  2SNM A;  2IW3 A;  2A6E D;  2PNR C;  4G7O C;  2MJ8 A;  1RTN A;  3FVQ A;  5I6Y A;  1BCP B;  1GUO A;  3P75 A;  1U9R A;  1ZYR C;  4LK1 C;  2SDF A;  1QIL A;  2F0W A;  1MBY A;  3T56 B;  1O78 A;  3CU7 A;  3K6O A;  5KGU A;  3WDN A;  1NAP A;  1U4P A;  3PO2 B;  3BG3 A;  4A3D B;  4R9W A;  2LFN A;  3OMC A;  1PFM A;  5FOB B;  5IGE A;  1LT3 D;  2K5W A;  1BNZ A;  3HEJ A;  2PO4 A;  3EQL C;  3QWN A;  3OIP A;  3I8Z A;  1CZG A;  4HSP A;  1T5X D;  4EVO A;  3A8J E;  4R8N A;  1TY0 A;  3I4N B;  1D5Z C;  4J8Q A;  3CKI B;  5I2X A;  5E4X A;  2RQX A;  2PQE A;  4IFD H;  3L3O C;  1SNQ A;  3V96 A;  2F0Q A;  5C0X G;  3IKJ A;  1NUC A;  2B2W C;  2NUC A;  1TT2 A;  3PIP 3;  3MXN A;  5IGD A;  1R4P B;  5FO7 B;  3LNN A;  5DNF A;  1O7Y A;  3S1Q B;  1V1P B;  3J7A V;  4DNR B;  1ENC A;  2ENB A;  3HZX A;  3VR6 A;  5E4W C;  3KLS X;  2QDB A;  4CJ0 B;  1TWG B;  4WFN 3;  1YNN C;  4HSV A;  4NDX A;  4BBR B;  2PW5 A;  1FD7 D;  1EYD A;  2H1E A;  3M7G A;  4C1N K;  1STA A;  3KBG A;  4PNY A;  2PW7 A;  3UI2 A;  1EOT A;  2NVX B;  1LO5 D;  2RDF A;  1ESF A;  3ERO A;  1I4H A;  3C1F A;  3SK4 A;  1TS3 A;  2EYH A;  2X69 A;  3RMH A;  1F2L A;  2JA7 B;  1ICW A;  2XSC A;  5M9O A;  2AQ3 B;  3JAM E;  1JOQ A;  4A3M B;  4JK1 C;  1LT5 D;  3PUW A;  3FPU B;  4K6L A;  2NTT A;  1GUN A;  4EQO A;  4N9P A;  1CI3 M;  4GZY C;  2TSS A;  4ZK9 B;  2K7V A;  1I3Q B;  1U4L A;  4OO1 G;  1ILQ A;  5IGF A;  2XRS D;  3GTP B;  2EVB A;  2EY6 A;  1XWE A;  4XQJ A;  1C8C A;  3FPP A;  4QIW B;  4U67 3;  5FKA C;  1EU3 A;  3PIO 3;  3S17 B;  5CV4 A;  3TZD A;  2L9H A;  3J80 E;  2NN6 I;  2XNA C;  1DYQ A;  2A6E C;  2A68 D;  3FMC A;  3V05 A;  4K5W A;  1QNU A;  2M2L A;  1G8Z D;  2B2V C;  4X3T A;  4RGN A;  3HP3 A;  4IUR A;  5IT9 L;  1D6E C;  3EVQ A;  2BOS A;  1SYE A;  3A8I E;  1PTO F;  2B8G A;  1PRT C;  4NW2 A;  5BN3 A;  3VYR A;  5EPK A;  4CKB A;  5LL6 X;  1CZW A;  1F2Y A;  1QG7 A;  1XTC D;  3JAM L;  2EZV A;  3NK9 A;  3NWT A;  3KK7 A;  2F0N A;  1SBB B;  3K59 A;  2HDL A;  3GTJ B;  4F7X A;  4C3H B;  1AFP A;  3H91 A;  1EY4 A;  3GTM B;  4DXG A;  2YYZ A;  1WTW A;  4KHZ A;  3RZO B;  4IFD G;  3GP7 A;  4KN4 C;  2R92 B;  1EEI D;  1F77 A;  1QB5 D;  1Y8N B;  3A7L A;  5FLX L;  4CBV A;  4ILW A;  4L8J A;  1Y1V B;  1LTB D;  3GTK B;  3ITP A;  2B2U C;  3CQZ B;  1LAC A;  4BBS B;  3KLR A;  1CHQ D;  1WCM B;  2WV6 D;  2OF1 A;  1B3A A;  4EQN A;  2K32 A;  4QCL A;  2EYO A;  1D1K A;  2K5D A;  1PMR A;  3PO3 B;  3QO2 A;  4BS9 A;  2ICI A;  4XT3 B;  1BXT A;  3I73 A;  4K2L A;  3KUP A;  4TQU S;  4NMZ A;  2F0S A;  1OXT A;  2DY7 A;  3I70 A;  1STE A;  3NBH A;  1Q12 A;  1SE3 A;  2EJF C;  4C3I G;  2BE5 D;  2F0J A;  4H44 C;  5JPN C;  3M85 A;  5EKK A;  5DM7 3;  1Q8I A;  3RD4 A;  4H0L C;  4XYQ A;  4DNT B;  3DMU A;  2ICE C;  3SXH A;  3TZU A;  4FVM A;  5CBE E;  4L63 B;  3J80 L;  4OHJ A;  3O13 A;  1IL8 A;  1UNS A;  3HOX B;  2NTS A;  2DNC A;  3DXJ C;  3OSO A;  1SE4 A;  3NP8 A;  4ZKC B;  4J1M A;  1D5X C;  2J7Z A;  5C3X A;  4CKE A;  3A54 A;  3NPP A;  1G29 1;  3A8K E;  3HRZ C;  2Z4I A;  1H9M A;  2BA0 A;  4KN7 C;  1O80 A;  4C2M B;  1RF2 D;  1PZJ D;  5D65 A;  3KBX A;  3R8B A;  4OGQ C;  4QUF A;  5I2Y A;  1VMP A;  1MSG A;  2L5T A;  5C44 B;  5COY A;  4OL7 A;  3VYU A;  4B9X A;  1CTM A;  1JCK B;  1GHK A;  4DK1 A;  2RSO A;  1PZI D;  1G6Z A;  5CGK A;  1ET9 A;  1OXX K;  1OXU A;  1L0X B;  4XDX A;  4F88 A;  2SEB D;  3NTK A;  1ZEQ X;  2IJ0 A;  3NQT A;  4RGO S;  1AN8 A;  5F2D A;  3A7A B;  3BYT B;  5K36 G;  3A55 A;  1F9P A;  1D1I A;  2JA6 B;  3KF8 A;  2N55 A;  1EYC A;  2BE5 C;  2C5C A;  2BCO A;  2Q8R E;  3HOY B;  2X6L A;  2F0P A;  2OT2 A;  1EWH A;  1GJX A;  1NR4 A;  4TKO B;  1O7Z A;  2JE6 I;  5EPL A;  1MSH A;  2XN9 C;  1I4X A;  3QG1 A;  5M3F B;  1DOL A;  2OXP A;  3Q0A A;  2NWG A;  5JEA H;  1S4Z A;  1ILP A;  3X3N A;  3SEB A;  1X3P A;  2N88 A;  4RFB A;  1WTV A;  1SXT A;  2BA1 A;  2Q8T A;  4C1N I;  4IUU A;  1W6K A;  1GOZ A;  1VF7 A;  3BVZ A;  2HUG A;  1SYG A;  1HTP A;  5KRU A;  3N52 A;  4ZKB B;  1I6H B;  2NVQ B;  1FNW A;  3S14 B;  2A6H D;  4ID6 A;  2YU9 B;  1L0Y B;  1EZ6 A;  4DU9 A;  3S2H B;  4YIJ A;  4A3B B;  2F0T A;  2KA7 A;  5C4Z A;  5JAV A;  4LJZ C;  4MHE A;  1HUM A;  2NVY B;  5ELD A;  1JWU D;  1TWC B;  3IAY A;  2JP1 A;  5T1I A;  2L0C A;  3D6C A;  2Q8I B;  2K6A A;  4FYD A;  1HQR D;  3CRL C;  2EYJ A;  1XX8 A;  1BCP D;  3OMG A;  2DY8 A;  2KVM A;  2D9U A;  4HTH A;  5IT9 E;  3G6J B;  3H6M A;  3I91 A;  3DHQ A;  5I9O A;  3D3R A;  5DM6 3;  1D2B A;  1HRJ A;  3NSW A;  5KYI A;  1DOM A;  1NSN S;  3MXG A;  1PYW D;  4FF1 A;  3F2U A;  1EQT A;  1WTP A;  4DA2 A;  3X3M A;  1PTO H;  3N6R A;  3OOC A;  1WD1 A;  3D8G A;  3CRK C;  4QF4 A;  4XTC S;  1HCZ A;  3QIA A;  3GTG B;  4G7H C;  4FO2 A;  3C1E A;  2A69 D;  5KYL A;  2B2Y A;  2SNS A;  5IGC A;  5EKL A;  3LWU A;  2JA5 B;  1SYB A;  4KKT A;  5CV8 A;  5A35 A;  4DGZ A;  3WOF A;  1A2T A;  1V8Q A;  2PZW A;  4C3J G;  4HCE A;  4G7Z C;  3DWP A;  3VYS A;  1LTR D;  4NKL A;  2NVT B;  1I6V C;  3NTI A;  1SND A;  1SAP A;  4RAU C;  5J22 A;  1KDB A;  3MHB A;  4C3J B;  3K57 A;  3EJI A;  5CYU A;  3Q22 A;  1QE6 A;  2KCC A;  1FGB D;  3GTQ B;  4CGY B;  2LS0 1;  4ZLT F;  2RVL A;  1WVL A;  1K83 B;  1NCV A;  5CV5 A;  1MGS A;  3S9W A;  4WRD A;  2JXM B;  2XVS A;  1VDZ A;  3NE5 B;  2E2J B;  4I7Z C;  1ENA A;  3FKI B;  3KLS A;  1LLR D;  5ELF A;  4RKL A;  1STY A;  2CQA A;  1EEF D;  2EPB A;  5JEA G;  5IGB A;  4P2C B;  2Z8L A;  3TP5 A;  3MVV A;  1SFO B;  1DOK A;  2MUY A;  5K36 H;  5HGT A;  5DAU A;  1JIC A;  2RDH A;  2VXW A;  3C2P A;  4IUN A;  2K03 A;  3PMF A;  1HHV A;  1R9T B;  1HXY D;  4IUQ A;  1BDO A;  2D62 A;  4FF4 A;  1KAA A;  1MD2 D;  4ZQ3 A;  1EY7 A;  1RDP D;  4XIG S;  2EE1 A;  1EIH A;  2QKI C;  1TKW B;  2L11 A;  4M8A A;  5EPJ A;  3J7A F;  2FFK B;  1G2S A;  3PUY A;  5I6W A;  1BCP C;  2QCP X;  4C3I B;  1B53 A;  2KEC A;  1V1P A;  4BA1 I;  2AWN A;  1JC7 A;  1VCI A;  2AUK A;  5ELB A;  1H9K A;  2WAC A;  1DCZ A;  4F8M A;  1SNP A;  4RWS C;  2F0U A;  4WOR A;  1SJE D;  3IL8 A;  2O5J C;  3BZD B;  3Q24 A;  1JQY D;  1EIG A;  4IN3 A;  4DAY A;  1A2U A;  2JSO A;  1HA6 A;  2WII B;  1PFB A;  3SK8 A;  3FEW X;  1I4G A;  1T5E A;  2HDM A;  5CBA E;  3E5S A;  4RGT A;  3S16 B;  1SNM A;  5ISR A;  2NZ1 D;  2EYL A;  4UAI A;  1GUS A;  3S15 B;  3GV3 A;  1I50 B;  1SEB D;  3G7L A;  4S3S A;  5EQ0 A;  1SMY D;  1ENF A;  3D6W A;  1FNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...