5T1GA

Chromo shadow domain of cbx1 in complex with a histone peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
EKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromobox protein homolog 1
publication title chromo shadow domain of CBX1 in complex with a histone peptide
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 13
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2016-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01393 Chromo_shadow Chromo shadow domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5t1gA00
4ZKBB 1WVLA 2KVMA 2RA4A 1PDQA 5E4WC 2MP1A 3IFDA 5EQ0A 1DZ1A 4LMQD 1G6ZA 4IUVA 2EE1A 4O42A 4ZAIA 5E4XA 2L12A 2L1BA 4UAIA 1TVXA 1WTRA 5COYA 1WTOA 2HDMA 1AP0A 2EOTA 2B2VC 2DY8A 3UI2A 1Q3LA 3KUPA 1SDFA 2KEEA 4ZLTF 3G7LA 5CBAE 1WD0A 1EL0A 5DNFA 1QNKA 1X3QA 5D65A 4XT3B 1B4OA 1RODA 2B2TA 1X3PA 4HCSA 4HEDA 2BDNA 2Q8TA 1ZXTA 2X69A 2NZ1D 3QO2A 1G2SA 1IKMA 1DONA 3H91A 2MJ8A 1KNEA 2B2UA 5T1IA 2B2YC 1X32A 1WTWA 1J8IA 1B3AA 1XYIA 2KEDA 1IL8A 1DOMA 1G2TA 1B2TA 1HFGA 2NYZD 2X6GA 5CBEE 3Q6SA 5D14A 1AZQA 2L9HA 3LWEA 1PFBA 3HP3A 3DEPA 1F9RA 1C8CA 2B2VA 1HRJA 1XX8A 1ESRA 4MHEA 2CVRA 1ICWA 1JICA 1NCVA 3D6WA 3MTSA 1G91A 1ILQA 2EPBA 2H1EA 2K28A 2J7ZA 4XDXA 1MSHA 1WD1A 2KUMA 3MWYW 1HA6A 1HHVA 1O7YA 3F2UA 4HAEA 1NAPA 5EPLA 3I91A 2B2WC 2HDLA 1RTNA 2L11A 2R3ZA 1S4ZA 1DOLA 2KECA 2JP1A 1HFNA 4CJ1B 2FJ2A 2B2YA 4ZKCB 1IKLA 4IUTA 2JYOA 1LV9A 1B50A 3KBXA 2FFKB 1RJTA 2M2LA 1F9SA 2X6LA 4HSVA 1U4RA 1CA5A 2HUGA 1BBXC 1BO0A 3DM1A 1BF4A 1HUNA 1CM9A 1VMPA 3TZDA 4R8IA 1M8AA 1ILPA 1O7ZA 1AZPA 1F9QA 1MGSA 1ML0D 3GV3A 4OIKA 2MPMA 5EJWA 1SSOA 2SDFA 1A15A 1MSGA 3IL8A 4IUQA 2D9UA 3N52A 4XT1B 1PFMA 4CJ0B 4DN4M 4RWSC 3FPUB 1QE6A 1MI2A 4R9WA 5CORA 1B53A 1PLFA 2K05A 1NR2A 2KOLA 2N55A 3FDTA 4ZK9B 2RSNA 3I3CA 2K01A 1SAPA 1F2LA 2B2WA 2MGSA 2Q8RE 4X3TA 1NR4A 5AFWA 4QUFA 1WTQA 3SVMA 2IL8A 4CJ2C 1JE4A 4NW2A 1CA6A 1U4LA 2RVLA 3P7JA 1EIGA 1QG7A 1F9PA 1WTPA 2K1BA 5JJZA 1BNZA 2NWGA 5EKIA 5EPJA 5CMDA 4X3SA 2K04A 1WTXA 1DOKA 2FINB 3I90A 4RA8A 1PFNA 1RTOA 2N88A 2XIWA 2L4NA 2K03A 4X3KA 5T1GA 3TN2A 4OIJA 1E0BA 1EOTA 3I8ZA 1GUWA 3GV6A 1U4MA 4IUPA 4X3UA 2HCIA 1KNAA 4RAUC 2B2TC 1WTVA 1HUMA 1VMCA 2FMMA 3DEOA 1U4PA 3ONAB 1O80A 2HCCA 4IUUA 2FHTA 2RSOA 2DY7A 4IURA 4MN3A 4QUCA 4U68A 5EPKA 1RHPA 1EIHA 3R93A 2VXWA 1EQTA 2B2UC 1J9OA
chains in the Genus database with same CATH superfamily
2JE6I 1LLRD 2Y0SB 5IY0A 2GA4B 2RA4A 5F2DA 4O0AA 4JI7Q 4JI3L 4O42A 4H02A 4N9PA 4KJOA 1WTOA 1AP0A 5FLMG 1Q90A 5CV9A 3PIP3 4GKKL 3CU7A 4GLXA 1EL0A 3P75A 5IYCG 2F0VA 3H0GG 4LF9Q 2QEXA 1SNCA 1K8AC 4BA1I 2WB1B 1PZJD 2MJ8A 3S17B 3PO3G 4BBRG 5T1IA 4L6TB 2B2YC 4QIWE 4WRDA 4DGZA 1HR0W 2B63H 1QB5D 3LGJA 3TSSA 3IKJA 3KJOA 5JEAJ 4EQNA 4NXMQ 4I65A 2Z0SA 3QOLA 4Q5VA 3HOZB 4BY7B 1I4QA 2CVRA 3D6WA 3MTSA 4OONA 2EJFC 1R9TB 1TWHH 1GUNA 3OYYA 3F2UA 4HAEA 3CXCA 3MZ5A 1D5XC 2P5ZX 3O13A 3NENA 4FXGC 1MIUA 1RJTA 3EVQA 1F9SA 1BO0A 1HUNA 4RFBA 4DXGA 5A2QE 3S15B 1TKWB 4YCVA 3ND8A 1MI2A 3CCEA 4H7BA 1PLFA 1NR2A 2YU9H 3FDTA 4X66Q 1IZ6A 4H13C 3E9HA 2ICEC 1XNQL 1YNJD 1U5KA 3GDEA 3L0OA 1U0LA 4PMWA 5M3MB 4B9XA 4FVMA 5CMDA 3A8JE 1XTCD 1S5ED 2EY1A 1SFOH 3HG9A 3I7FA 3HKZG 4JW0A 1JOOA 4LFAQ 4HIKA 2JA9A 4OIJA 2WP8J 4LK1C 1STNA 1BOSA 3WOEA 1XTDA 3K59A 1HNXQ 3R8BA 3J81j 4X3UA 2B2TC 2F0OA 3DM3A 1N34L 2FHTA 4MN3A 4U68A 3S1QB 1IW7C 2R93B 1VS0A 1A62A 1Q1BA 3A74A 3K7UC 1SBBB 5LMNL 2E8GA 2IHEA 2BOSA 2L12A 5M3FH 4EX5A 4WJWA 1HZ9A 4BA2I 2HT1A 2Y0SG 3BVZA 3K57A 4JI1Q 2BDNA 5JOBA 3K5NA 2M00A 5HGTA 3DXJC 4MTNA 1UE7A 1GO3E 4L8JA 4TSSA 4RGOS 5JPNC 4DR1Q 3OSOA 1PRTD 2WB1G 2BCOA 2EVBA 4OXPA 5KNBA 2VUMB 2D2CC 1CQFA 1J6QA 3KDFB 2H1EA 2PYKA 5IGEA 2F0TA 4B3SQ 2F0UA 3HOWB 1I50H 1JQYD 2WFWA 1NAPA 3LX0A 4L5QA 5IGGA 1CI3M 1BKBA 1TU2B 2F0PA 2Q2IA 3HOZG 1KABA 4A3DB 4ZKCB 4BY7G 5GROA 5C3EB 2A73B 1UWVA 1FGUA 3F2BA 1N9WA 1S5BD 1V1PA 1PH8A 2UUBL 1QUQA 4HTHA 4J15A 2F0EA 1GHKA 4AQYQ 1V8QA 3PUZA 4ZRZA 1MGSA 1SSOA 1EQVA 2DN8A 3CKIB 1B53A 2UUCQ 3I3CA 3CW2C 3RLFA 1LTID 2AQ3B 5ELFA 1W2BA 4BBSH 5BN5A 1JOKA 5I9OA 4DAMA 4DV7Q 3NTKA 5JJLA 5EKIA 4X3SA 3NQIA 2E75C 5JVG3 1Q12A 1SYFA 1HR0L 2B8FA 4NKLA 2DJFC 3VYSA 5M3MG 1O80A 2B63B 1SYEA 2MFIA 4A3GB 1GVPA 2AKWB 3U58A 2UXDL 1I3QH 1VF7A 4G7ZC 5IT9E 2EE1A 1I94L 1DCZA 1TWHB 2F4VL 1EY4A 4C3HH 2KEEA 2RBMA 1Z47A 4DF7A 1E24A 2R93G 4LW1A 5CYUA 4LWCA 3FMCA 2K5WA 2KHIA 2CH4A 1LT3D 2PI2A 3HKSA 3P1HA 3T53B 1Y1VH 2R92H 4IOCA 4LF8L 3GTOH 3GTPH 1HZBA 4JC0A 3M3YB 3DWQA 5FO7B 3HP3A 4JYAQ 3NWTA 5IYDG 1C8CA 2K14A 2YU9B 2OT2A 3G48A 1FYCA 2NUCA 1GUOA 5M5YH 1M1KC 3FPPA 5FJ8G 3MVVA 2NBFA 2R3ZA 2KECA 4GLVB 2KBNA 2J0TD 1E2ZA 2RKSA 3SEBA 4CJ1B 2VQFL 5E3FA 1SFOB 2VUMG 3PO2H 3NTIA 2XRQD 4C56C 2M2LA 3RZOH 4KKTA 2QDBA 5J39A 1EWIA 1K8OA 3HOWG 3GTMH 1SE8A 2VL6A 3S24A 2RCFA 1DGSA 1TWAH 2ALYB 2ZTCA 2CQAA 3NP8A 4A3DG 2CWPA 5C3EG 2QCPX 4KHVA 2K5DA 1BCPC 4A3LG 2Q8RE 3HEJA 3OTOL 2ZTDA 2UXBQ 4NW2A 3GD7A 1A6XA 2IHFA 2XN9C 2E76C 1XMQL 4DV4L 3I4NH 4A3BH 5ELBA 4XQNA 1ET9A 4RCNA 4O2DA 2KA7A 3RNUA 1HZAA 3I56A 2XIWA 4PMCA 1SNMA 4DUYL 1VQBA 1JB3A 5IT9c 5A2QL 3A5ZB 2J4XA 3R93A 2R7FA 1FR3A 1YHAA 2KVMA 3IFDA 1A3TA 1JR0D 4GKJL 1NUCA 4A3EH 4DAYB 2B3GA 5BN4A 2B63G 4JBKA 2E2HH 4A3GG 1I50B 3KLWA 3VR4A 4K2LA 1L0XB 1JE5A 1SR3A 1B1ZA 1GOZA 4XT3B 1PH5A 3SK5A 4JI2Q 4B3MQ 3TP7A 5D3IB 1ZXTA 2X69A 1EOVA 1GKHA 4A3IH 1IHZA 1KNEA 3U50C 1XNRQ 1X32A 1FD7D 5BR8Q 4B08A 4IFDJ 4TRDA 2BA1A 3OMGA 2Q2HA 3PUXA 4LFBL 5JEAH 1F9RA 1IBKL 3T51B 1V43A 1PMRA 2NVXH 2AUKA 2NN6H 3NBHA 2EQSA 2OTLA 4QY7A 1FNVA 1TQOA 1R4QB 4KK7A 1RTNA 1EIFA 1C4QA 4GOPA 2GVBA 1XJVA 4I7AA 1B50A 3S1RH 5LMUL 1Z7TA 1CFMA 2LS01 4S3SA 3T1YQ 4YY3Q 4ME3A 5IGDA 3IFTA 1M8AA 4LJZC 3UDFA 5KIXA 4BY1H 3M4YA 1A15A 3IL8A 2D9UA 4FNFA 2ZJPA 3I4MH 1I4GA 4DN4M 4RWSC 1FNUA 3HOUB 1S5DD 4N8X1 2SEBD 5JJKA 3PIO3 1VQDA 3HOVH 1LTBD 2LXJA 2UU9Q 1PRTB 1QVCA 1L0YB 5LL6X 2K1BA 4C3HB 1VQLA 3K6OA 3A8KE 1XXGA 3P20A 3ICEA 2L4NA 3K7AH 3VR2A 1STYA 4G57A 4X3KA 3BYYB 1K83H 2XVSA 4K0KQ 4DNRB 1P16A 1U4MA 4JV5L 1Y1VB 3KK7A 2Z4IA 2R92B 4IURA 4GNXC 1EIYB 3GTPB 5LHY1 5CV7A 5CV5A 1BBWA 3QR8A 3K80C 1PDQA 3TP5A 4FP5D 4Y7NH 4C1NK 5M5YB 2PNRC 3L9AX 4XQQA 2DY8A 4A93B 2F0KA 4JK1C 3X3MA 3R3OA 5KRUA 4DU9A 4DK0A 3E0JA 1ENCA 3HS0C 4PZ6A 1B4OA 1VQOA 4HCSA 3PO2B 2A8VA 2JSOA 3AFPA 3S1NH 1H9JA 4KHZA 3GTMB 2RDFA 1PH1A 4HMIA 1TY2A 1TWAB 2D5DA 1Z9FA 2KCTA 5DAUA 4G7OC 3X3NA 2KCCA 4P71A 3Q6SA 4POGA 1LTLA 1C0AA 2PW5A 2HQLA 3ND9A 2KQ3A 3DHQA 4K8IA 4XDXA 2Z6KC 4DV3L 3DUZA 5IT9L 1B9MA 4DAPA 1E1TA 4KD4A 2UUAL 3E6ZX 1D1IA 3I72A 1FNWA 3I4NB 4RG1A 4A3BB 1HFNA 1VQCA 1CKMA 5KEEA 4ZYSA 4LF4L 4LFCQ 3RN2A 3T13A 1EFID 2X6LA 1FGBD 5ELCA 1DJRD 1TT2A 2JQOA 2QDLA 4A3FH 1D6EC 4OX9L 1VQKA 1F9QA 1ML0D 1K73C 2K5VA 1RD9D 1N33L 1Y14B 2A6ED 2H4OA 2O5IC 3CHBD 2F0NA 5C0XJ 3U9SA 3FKIH 2K05A 5DLQE 2KOLA 1SNPA 3UE0A 5AFWA 3BG3A 4CDDC 3EBEA 3K58A 4CJ2C 4JVZA 1VQ7A 3QIAA 1EIGA 5M5XH 3BVGA 3CD6A 3HOUG 1SJHD 2FINB 1PH2A 1V1QA 4EQOA 3D0FA 2DNEA 1K28A 1KXLA 1Q46A 1PXUA 3TN2A 2PCFB 4HR7B 2CFMA 4FDBA 1X56A 2L5TA 2NVYH 3MXPA 2F0GA 5BN3A 4E6IA 3BVMA 1SNOA 1G51A 4C3HG 1NNXA 3A54A 1BCPF 4Z9CB 1TWCH 1RHPA 3MXGA 4HIDA 2SDFA 2VQEQ 1VQMA 4DR6Q 4HJ7A 1O7IA 3TS2A 1Q81C 5IOCA 1L1OA 2QF7A 1JWMD 1Y1VG 1EY5A 3ERSX 3NE5B 1E1OA 4ZAIA 3TP6A 2R92G 1YNND 1H9KA 2XSCA 2F0HA 1N34Q 1FVIA 3FRPB 5C4ZA 4K2KA 4R4CA 4JI0L 2HQEA 5CR3A 4H0LC 2A69C 1KTKA 2MO0A 2I5HA 1VF5C 2NTTA 3AFQA 1YIJA 3S1RB 2RHQB 4A93G 3NK9A 3T1HL 1SNQA 4XYQA 3D31A 2CW0D 3TREA 1TWFB 1A3VA 1CKNA 1H9MA 3DLLA 3I4MB 1C48A 4CDFC 3PO2G 1AZQA 2B29A 4AYBB 1BQQT 3H94A 1DD2A 4AIMA 3GTQH 2JXMB 1N8RC 3HOVB 3E3XA 4IPGA 5C4JH 1HHVA 1XPUA 1ZYRC 4JI6Q 3AYHB 1KHIA 4K14A 4EVOA 1AH9A 1HNWL 2D0PA 2FJ2A 1EY9A 2E74C 1CZGA 1W6JA 3K7AB 1U4RA 1CA5A 1S72A 1JOQA 1NBWA 4DR5L 2K5NA 2HHHL 4YHHQ 3TEHB 1TR5A 3HFZB 3Q23A 3I4NG 1EEFD 2FXQA 4IUQA 4A3BG 2SNMA 1GHJA 3CCQA 1ESFA 3GTKH 1PFMA 4P75A 3TRZA 1W6KA 1RF2D 3PF5A 1PTOD 3JAMi 1WYDA 2K75A 2K01A 1KDBA 4QUFA 3KF8A 5GADC 4FO2A 2OQ0A 5JJIA 1Q7YC 2EYHA 5JJZA 3I73A 2NVTB 1OXUA 3KOJA 2N88A 4NXNQ 1K8MA 4JI4L 2K03A 2A68C 3OOCA 1I6VC 3W5OA 1JCKB 4HN7A 5NUCA 3KF6A 3MXNB 1E22A 3I8ZA 2E5LL 3PUYA 4NPSA 1V1PB 1WTVA 2L0CA 3D8GA 3MFYA 1Q82C 1C9OA 5G3LF 5IWAL 2A74C 1Y8PB 4JBJA 2F0IA 4ZKBB 4C3JH 1HPCA 2XTIA 2IT1A 3G71A 2O5JC 4WFN3 4DR2L 4CGYB 1PH3A 5E1FA 2B2VC 4XTCS 4CBVA 4OO1H 1HXYD 4FXDA 4R4QA 1FJGQ 1AFPA 1A2UA 1IXRA 4RKLA 5GQOA 4OWXB 1STGA 1RODA 4HEDA 2LY7A 2NN6G 4M8AA 3D3RA 4K8JA 3M4OH 1B9NA 1Q8IA 3JC66 1QOHA 4HJAA 1WTWA 1N36Q 5IP7H 4OWWB 4HMJA 3STBC 4IFDH 3S16B 2F3WA 3K5MA 3FKIB 4IOAA 4LF5L 3GTLB 3GP7A 2F4IA 4X62L 4B3TL 2EY5A 2BH8A 1PTOH 1WTHA 2R7ZH 4ZUIA 1MSHA 3HKZE 4LF6L 4DV2Q 4LF7L 2KUMA 2ZM6L 4DV5L 4DV1Q 1O7YA 3I4MG 3SR1A 5HURA 5M5XB 1VQAA 1AE2A 2V1CC 4DUZL 4AYBG 1OO9B 5ELNA 4ME5A 2B2YA 2XGTA 2BH2A 1LACA 2UXCQ 4QCLA 3AMUA 2B39A 2BA0A 4X64L 3HOVG 1LTTD 4RHSA 1AZPA 4ODGA 5IGCA 4BXXH 1EYCA 2KJXA 4JI7L 2AMCB 5FLXE 1TWCB 1B3QA 1VQEA 2OCEA 1MJEA 1F77A 1WTQA 2E2DC 2JA6H 1EZ6A 2Y0SE 2ZXPA 2K4KA 4LUZA 4LF9L 1CA6A 1RIPA 1QG7A 2QILA 1EWHA 2EDGA 2K7VA 1AEXA 3M4QA 3HZXA 3JAME 1JJCB 4C3IH 4J6HA 3S2HH 3A56A 1VQGA 1SMYD 3GV6A 4NXML 2WB1E 4K6DA 1ASYA 1MD2D 1UEBA 2L55A 2F0LA 4RAUC 3VR3A 4RKBA 1SYCA 2DY7A 4ULLA 3GTJH 3MFGA 4N8FA 2F0QA 2VB3X 1PHJA 1D7QA 3E5SA 2IX1A 2SOBA 4CKCA 2A6HC 1D2BA 3GTQB 3EFXD 2VB2X 5COYA 5C4JB 4DV6Q 1I5FA 1K3RA 2IPKD 4X65Q 5CBAE 2F0DA 4F87A 1SRUA 4G4KA 3VYTA 4NP5A 2B2TA 2ATWA 1DONA 3H91A 4JG2A 1VQ4A 4FF2A 3FP9A 4X66L 1EWCA 1STBA 5M9OA 1JMCA 2G5DA 1AE3A 1MBYA 1T5XD 2I5MX 1T9HA 3DEPA 1YNXA 4O1NA 5K36H 4LFAL 4NB3A 4DKAC 1CKOA 2EIFA 3FKIG 1BBUA 2BE5C 1HNXL 4FF3A 1JB7A 3IRBA 1HTLD 1IKLA 5FLXc 4PMBA 5I6YA 4AH6A 3NXWA 4H44C 1DM0B 1CM9A 4C2MH 5EJWA 3RZDH 1MSGA 2KHSA 2C35B 1LTSD 2VNUD 1I4XA 1F2MA 3KLSA 1EU4A 1UEAB 5C0XH 3M7GA 2EJGC 3CC7A 3JAMc 1NR4A 4L5RC 3KDFA 2M9VA 2PQAB 4KMUC 2A1AA 4GLAC 1ZKOA 4JI1L 3DMUA 2RF4A 2XRSD 4ZUJA 2EYPA 3L3OC 2NVQH 4XXEA 4A3CH 4NDXA 4IPHA 3G6EA 1X54A 4EGVA 3ULLA 3QJYA 4CDEC 4KHPQ 1EOTA 4GOPB 5KNCA 4LNQA 4DR1L 1EYGA 4G7HC 1TS3A 3OPOA 2AQ2B 3V05A 3BZDB 1EZ8A 1SYGA 3M4PA 4IUUA 3K5OA 2GVAA 2EY2A 3KLRA 3I4LA 2ZXOA 4B3SL 2B2UC 5GAEC 5M3FB 3CRLC 1PTOB 3J81i 2R7ZB 1OXXK 1TVXA 3BDLA 2K32A 2RDGA 4YWKA 3KBGA 3PMFA 1XMOQ 4F88A 5IGBA 3BS1A 4AQYL 1YJNA 1X3QA 5H1SE 4JI5Q 3J80c 3RLOA 4MTKA 2ICIA 3QO2A 1G2SA 4OEMB 2DGYA 2RQXA 2UUCL 3C1EA 1RCVD 1NTGA 2EXZA 1Q86C 1YBYA 1G2TA 3RMHA 1H9SA 4CHTB 1SXTA 3R2TA 3OHXC 2Z6BA 1ICWA 5DM73 2JA6B 4ID6A 3TQYA 2RDHA 5EGTA 1TY0A 2B2WC 5FO8B 1N32Q 3HOYH 1YNJC 2JP1A 4RMFA 5GAGC 3NSWA 4V0BA 5ELOA 4DPGA 2VS1A 2FFKB 2PMZB 4HSVA 3CCLA 3S2HB 1II3A 4R1JA 3H3VH 1STAA 2O2LD 3TZDA 4KY5A 1V1OA 1K0RA 2AWNA 3MAQA 1NMFA 3UDXA 5JPMC 4DR3Q 3VDYA 5CV6A 2E2IH 1PH9A 3UDIA 3GTJB 2QGQA 1R4PB 4BBSB 1SAPA 1F2LA 2MGSA 1DXMA 4K6LA 4DR7Q 3J7AF 4MZ9A 4DV0Q 3FEWX 2RVLA 4X6AH 5C44H 3P7JA 1JT8A 1WTPA 3KFUA 2IWHA 5I4DA 5EPJA 3PQIA 1BDOA 4C1NI 2ZXRA 3SK6A 3W1BA 2D0OA 2CWAA 2F3IA 3CCRA 4ABNA 2WIIB 3Q24A 5IIFA 3C3LA 4N9TA 4JYAL 1J5EQ 1U4PA 2HCCA 4HCEA 2RSOA 3IAYA 1A8VA 3CRKC 4B3RQ 1I3QB 5EPKA 2JA8H 3NBIA 5IE8A 5FLXL 1D5MC 1BR9A 5TSSA 4YCWA 3F2DA 4IALA 4IUVA 3M7NA 5IP7G 4XIGS 2L1BA 1PRTC 1STEA 2EOTA 1M4VA 2PNHA 3H09A 1GUSA 3J7ZC 3A5UA 2GN5A 2G9HD 3SK4A 5FKAC 1X9NA 1IBLQ 5M3FG 5IGFA 2PZWA 5FOBB 2R7ZG 3JAML 3BJUA 1KRSA 3J81E 1HJPA 3GTOB 2F0JA 3A8IE 4XQJA 4R8NA 1VDZA 3CMEA 2IW3A 4NMZA 4GN5A 1IW7D 4A3KH 3F1ZA 2X6GA 3RZDB 2UXBL 4A4IA 5JAVA 5EBCA 2L9HA 2K5HA 4JI8Q 1XX8A 1UE6A 1GXDC 1Q8KA 5C6AA 1AW7A 4IO9A 5LL6S 4BXXG 2A5HA 3MWYW 4BY7H 3MXUA 3D4WA 1L1OB 1R9TH 3U4ZA 3NHHA 3RZOB 4JI3Q 3Q0AA 3OMCA 2ES2A 2MO1A 4RH6A 3C2PA 1SYDA 2JYOA 3HOXH 2JA6G 5I2XA 1RKNA 4GKKQ 1WOCA 4QIWB 4MIUA 3GTGH 1O7ZA 1NSNS 1LT4D 4UY8C 1D5ZC 5JVH3 1JJGA 4XT1B 3S15H 2JN4A 1IYUA 4F8MA 2HIVA 4EQPA 3J80L 2F52A 4JBWA 1CKNB 3OW7A 2N8NA 1BVSA 1MJCA 4JI2L 3RR5A 1F9PA 2C9OA 3KJPA 4CKEA 1WTXA 4KI0A 2K33A 3CC4A 4BBSG 2OXPA 1XNRL 5BR8L 3MEFA 1ENAA 1L2FA 4IJHA 2HIXA 3KLSX 3LNNA 2I07B 2HCIA 4MNOA 3DEOA 4K5VA 3DWPA 4KN7C 3H15A 2R7DA 2VXWA 2K50A 2DJGC 3T4AC 4OHJA 4A3EB 3I70A 1Y69U 1B7YB 1E2WA 1S5CD 4PNYA 1STHA 3ZYYX 4JI4Q 1W3SA 1WJJA 2MP1A 4P2CB 1DZ1A 2E2HB 2NN6I 3PF4A 1VQ8A 1T5EA 2PQEA 3J81c 4KY7A 2R93H 3D4DA 2B8GA 1Q3LA 3ITPA 1LO5D 3KF8B 1KL9A 4R4IA 3T1YL 1QZGA 3HOYB 1KAWA 5DNFA 1KRTA 5L37A 4YY3L 4A3IB 1XNQQ 1YEZA 1A2TA 4QQBX 1MHWC 1EFWA 3CPWA 1S40A 3CMAA 2NZ1D 3EN2A 4GNXA 2WACA 1TXYA 1CK1A 2JA5H 4DR2Q 5K36G 1PYSB 4P74A 3OWFA 2DUDA 2KEDA 1IL8A 1DOMA 3KF6B 3E0EA 4JBMA 3S1MH 5CBEE 3W2DA 2NVXB 2UU9L 5D14A 1NY4A 1YJWA 5IP9H 4YCUA 4IPDA 1ESRA 1CQVA 1ILQA 1JORA 1RDPD 3N6RA 1DYQA 4HJ5A 5C44B 1VQFA 1NJIC 1S4ZA 1SE2A 3VR6A 4K0KL 5ELDA 2BE5D 3UDGA 4UDUC 3HOWH 2F1MA 5LMNQ 4RGNA 5CGKA 4LAAA 1LV9A 4P73A 1SN8A 4HSPA 1YHQA 5CC4A 2RCNA 3S2DH 1IBML 2F3VA 2MUYA 4BY1B 5C3EH 4LF6Q 2I46A 1TS5A 5AJ3L 1ONLA 3PIPA 4DV5Q 1ILPA 2IY5B 4A3CG 3ER0A 4KKUA 3FVQA 5J1ZA 1EY7A 2Z6KA 4DK6C 2JA8B 2JA7H 1X65A 2RSNA 4DNTB 4X3TA 2ENBA 5KGUA 3Q8DA 1HNZL 2JJQA 2YTXA 3AU7A 1PV4A 3PUVA 1HA5A 3QB3A 1K83B 2PO4A 3T56B 4RA8A 1KLGD 1PFNA 1VQ6A 2IX0A 4UHVA 1BCPD 2Z4HA 4CKBA 1QNUA 4QUCA 2UUBQ 4A3KB 1JWSD 3RD4A 4A3MH 2LXKA 4Y7NB 1EYDA 2OWOA 4A3GH 5EQ0A 4UP9A 1BXTA 4FYDA 4LMQD 3NTHA 1UNSA 3M85A 3PV0A 1NE3A 4LFCL 1HZCA 2R6GA 1WFQA 2HDMA 1ET6A 1E7ZA 4ZLTF 3G7LA 4PV1C 3S1NB 3Q22A 4A3EG 1QNKA 3GQBA 1KLUD 1G6PA 1KIXA 3I55A 2CCZA 3HOXB 1CSQA 2WAQB 3NPPA 4QF4A 1QUQB 1HR0Q 3CCVA 3GTGB 3TMEA 3HOYG 1D1KA 4A3IG 1B2TA 2PZUA 3B6YA 1LTAD 3I2ZA 1F2ZA 5KYIA 2E2JH 3PGZA 1CTMA 1PRTF 1HH2P 4IJLA 4M1UB 4BWGB 3M3YH 2J7ZA 1YI2A 1CSPA 4ILWA 4KN4C 1G291 1FL0A 3J80i 1LUZA 5JEAG 2EYMA 1HA6A 1SJED 3ZJYC 3F8TA 5EPLA 2UXDQ 3S14H 1DOLA 1I94Q 4DAVA 1QVGA 4IN3A 4JCVE 4A3FB 2F4VQ 3KBXA 1F2YA 4WJ4A 4JOIC 5C44G 2MQHA 2D62A 3J81L 2VQEL 4DR6L 4OIKA 1LYLA 2I0QA 1UAPA 3ERQA 5IYBH 4DR4L 1QE6A 3M9BA 1CHPD 1PVOA 3CQZH 4BY1G 1NMGA 3EJIA 4LF8Q 3URYA 1UE1A 3SVMA 1G8ZD 2LKVA 3C1FA 5KNDA 1KC8C 4QMGA 2EYOA 2F0WA 4R4OA 3HGBA 1TS4A 2YYZA 2JA8G 2PZTA 2CKZB 3W3AA 4YWLA 3SXHA 3TDQA 1RTOA 2NVYB 1O7LA 2NTSA 3L7ZC 5HY6A 1S5FD 5FO9B 1UE5A 2AQ1B 1OXTA 1H95A 2JA5B 4K5XA 2VQFQ 1XPRA 3SDZA 1VMCA 2FMMA 2K6AA 2QW7A 1KAAA 1QILA 4QL5A 5G3LD 3ULJA 2K52A 4J8QA 4DK3C 3FHWA 3S1MB 3CF5A 1KQSA 3U9OA 2YTVA 1ASZA 4JI6L 2SNSA 4AYBE 1G6ZA 1SEBD 2V4DA 2XWJB 5E4XA 2OQKA 1WTRA 4A3KG 4DXFA 5C4XH 1YITA 2N49A 3NWSA 3F2CA 3CCSA 2PPBC 3OTOQ 2LMCB 2Z9HA 1VQIA 1TWGH 1QWYA 5D65A 4XYOA 1Y8OB 3D6CA 4YHHL 1KDAA 3U4VA 3GO5A 1I6HH 1PH7A 3DWAA 1YJ9A 1XMQQ 4DV4Q 3MXNA 5C5LA 3S2DB 1VCIA 4OGQC 4RHRA 3A7LA 3TZUA 2NYZD 3RN5A 4UP8A 4KV6A 1E3PA 4L63B 1B8AA 3HOXG 1PFBA 2Q8IB 4DUYQ 4K5WA 2WAQG 2JA7B 3MC0B 2B2VA 1IYVA 2A6EC 4APVA 4LUVA 1HQMC 3G4SA 4A3JH 1WD1A 1I4RA 3MEHA 4NXNL 2Z1CA 3C46A 2JEBI 4PQXA 4GKJQ 2QA4A 2JK8A 5ISRA 1JC7A 3J7YW 2Z8LA 3SE0A 4HJ9A 2WKDA 3K0YA 4JOIA 3DM1A 1LT6D 3GTKB 4IUNA 3J80E 4YWMA 3NQTA 4OWTB 3GV3A 1X6OA 1PZID 1HTPA 3N52A 2VY3A 2WAQE 4A3FG 4R9WA 5CORA 4A3MB 1V9PA 3V96A 1Q1EA 3VYUA 3WWVA 1FJGL 3CPFA 3HOUH 3SGIA 1BUVT 1JE4A 1H9SB 2WINB 3NUCA 3J7AV 1D8LA 1U4LA 2PW7A 1EQQA 4LFBQ 4IQZA 1IBKQ 1SYBA 5M5WH 4OO1I 1QJOA 2K04A 5EKKA 2ID0A 1YNNC 1WCMH 2F03A 5EKLA 1N36L 1U9RA 3OW2A 1YVCA 3QWNA 1B44D 1UUPA 3OIPA 3OIQA 3KYHC 1GUWA 1PYWD 2HD3A 1VQHA 4C3JB 5LMUQ 4IFDI 1LT5D 4DV2L 1EY8A 4DV1L 5C5MA 2CW0C 1WVLA 2L15A 3A55A 4FF4A 2E2JB 2JA5G 3NBHB 1SE4A 3VA5A 2KCNA 2UXCL 1P8LA 1WI5A 3QOJA 3S14B 1VQ5A 3K8AA 3TBIB 1Y1WH 3M4OB 5IP9G 4A93H 4LUOA 4GZYC 1JJ2A 1LTRD 2CHBD 4TQUS 4GOPC 1HQRD 2OEOA 4ZCKA 5D3DA 3BZCA 2ZT9C 5FLMH 5ELEA 2LFNA 1BCPB 2PI2E 5IYCH 3H0GH 4JV5Q 3R2IA 3PCOB 1MKHA 2YTYA 1ICFB 3CQZB 4GN3B 2N3SA 1LABA 3K81C 3CCUA 5DM63 1PTOC 2A69D 2OTJA 3PO3H 4BBRH 5CV8A 2G9DA 2ASBA 1SNDA 2L11A 1M90C 2LSSA 2JA7G 3WOFA 1L0WA 3WDNA 3AEVA 2MHVA 2KCMA 1SMXA 4A76A 1B70B 1X3GA 4HIMA 1GM5A 1BF4A 5C4HA 4TKOB 1EQRA 5GAHC 4Q0FA 2I5LX 4DV7L 1JWUD 1IL2A 1XWEA 3BU2A 4L5SA 3T16A 3VR5A 1SE3A 4DV6L 3TS0A 3CAMA 4ZK9B 2TSSA 1ZYRD 2WKCA 2N78A 2NZOA 5KYLA 4X65L 3OWEB 2QKIC 1X3FA 1A0IA 5C4XB 3BZKA 1BNZA 2NWGA 4C3IB 4A3MG 2H5XA 2O4XA 1TWGB 4DV3Q 5A35A 2AUJD 1VQ9A 3NEMA 4UPAA 1EU3A 2VW9A 1TS2A 5T1GA 3D4RA 2UUAQ 3HRZC 1I6HB 3G6JB 1QZHA 2CQOA 5HGQA 1GJXA 2JEAI 4LF4Q 2R61A 3MHBA 5FK9C 3VYRA 1HUMA 2IX3A 4R4TA 3A7AB 4WJ3M 1CZWA 4IZ8A 1Z6HA 4A75A 3ULPA 1PA6A 1PYBA 1J9OA 4OX9Q 5E4WC 1N33Q 1EUJA 1IYJB 2DNCA 4KKSA 2PQAA 4A3JB 3QG1A 4C3JG 1X3EA 1AN8A 3LWUA 3KUPA 1C7YA 2A68D 1LTGD 2CH4W 3PIOA 3PUWA 1K8GA 1X3PA 1O78A 2Q8TA 4OO1G 1I4PA 1IKMA 4DNIA 5C3WA 2ZTEA 2B2UA 2OF1A 5DEHA 1J8IA 1XYIA 5I2YA 1GUTA 1HFGA 1Y8NB 5C0XI 2VZAA 1HRJA 1SROA 1TWFH 3BDOA 4IFDG 2ZJQA 1NCVA 1G91A 2K28A 4PZ8A 3VA7A 4HJ8A 3V2TA 3SK8A 3EROA 2QEJC 3CCMA 4ALPA 4KHPL 4B9WA 5IYBG 1EY0A 5M5WB 3SHLA 3AQQA 4RGTA 1WCMB 4CDCC 1XPOA 4UP7A 3L2PA 1A63A 2Q2UA 3S17H 4C2MB 3STBD 1BBXC 4P72A 4JI0Q 5I9PA 1EYAA 2TMPA 4PZ7A 1TIID 4GN4B 2MPMA 4GNXB 4ZQ3A 3I4OA 4CJ0B 4L5TA 4DK1A 2MNAA 1SMYC 2EXDA 1VQNA 4QJFA 4TVAB 3BYTB 1ENFA 4IPCA 2IJ0A 3HOZH 4FF1A 4KLKA 4DAYA 2F0FA 2N55A 3T1HQ 3UE1A 2EY6A 2B2WA 1XMOL 1IBMQ 1PZKD 2NVQB 5AJ3Q 5CV4A 4JI5L 2EZVA 4POFA 1KDCA 4QB4A 4GS3A 1L1OC 3J7A5 1DOKA 1A3UA 3I90A 1Y1WB 2F0MA 1PFSA 5EAYA 2NVTH 1E0BA 3K0XA 5K5PA 1K3BC 5J3BA 3TP8A 1HNZQ 1HNWQ 5C4XG 4PG3A 2XNAC 4IUPA 1CT1D 1VQJA 3ONAB 4C3IG 4OL7A 4DR5Q 2HHHQ 1EIHA 2NZHA 1EQTA 2AHOB 4QGUA 1LM0A 3AB9A 3H0GB 4B3ML 1H9RA 2EYFA 1N32L 3RLNA 3EA6A 2YV5A 1ZEQX 4F7XA 4UAIA 1OTCA 1OXVA 5M3MH 1PH4A 4HIOA 3PO3B 4BBRB 3UI2A 1EEID 1SDFA 5E7NA 2EYJA 1WD0A 4KTAA 2RHSB 2AWOA 4OELB 4A3JG 4DR3L 1QVFA 5C3XA 2PMZE 3H3VI 4RGMA 2ZJRA 1GUGA 1B3AA 1K9MC 5IODA 2WV6D 1S3OA 3S1QH 3EQLC 2A6HD 4U673 4DR7L 4DV0L 3LWEA 2E5LQ 4V190 5EBDA 4J1MA 3S16H 3K5LA 4MHEA 2Q2TA 1JICA 2EPBA 1VQPA 2A19A 4KD3A 4KY6A 5IWAQ 1CHQD 4WORA 3GTLH 4DA2A 3EIVA 3E9IA 4FXKC 3I91A 2HDLA 3S9WA 4KJNA 1HCZA 1J5EL 4IUTA 1PH6A 3CP0A 3MA2B 5LMNW 5IYDH 2NB0A 4EQ5A 4B3RL 2HUGA 5J22A 1CUKA 1YHBA 1GD7A 1VMPA 4R8IA 2E2IB 3H3VC 5FJ8H 3CC2A 1WCMG 4RCOA 3FPUB 1I4HA 2VUMH 1PTOF 4JPBW 3HKZB 2EJMA 1OXSC 2C5CA 2IL8A 2KHJA 5C0XG 3PSIA 1IBLL 4LF5Q 4X62Q 4B3TQ 1QCBD 4DR4Q 1K0SA 1RL2A 4A3DH 1E2VA 4I7ZC 3W1GA 4LF7Q 3RUZA 2ZM6Q 3BDCA 3CCJA 2K5QA 1X55A 4BS9A 4A3LH 4DUZQ 5I6WA 2XWBB 3H6MA 4Y52H 4JI8L 2BDOA 1KNAA 4DFAA 2F0SA 1EY6A 2KENA 1KD1C 1YZ6A 2FMCA 1SLJA 4X64Q 1Y1WG 3NELA 4YIJA 3A0JA 2EYLA
chains in the Genus database with same CATH topology
2JE6I 1LLRD 2Y0SB 2GA4B 2RA4A 5F2DA 4O42A 4N9PA 4KJOA 1WTOA 1AP0A 1Q90A 5CV9A 3PIP3 3CU7A 1EL0A 3P75A 2F0VA 1SNCA 4BA1I 2WB1B 1PZJD 2MJ8A 3S17B 5T1IA 4L6TB 2B2YC 4WRDA 4DGZA 1QB5D 3TSSA 3IKJA 5JEAJ 4EQNA 4I65A 3QOLA 4Q5VA 3HOZB 4BY7B 1I4QA 2CVRA 3D6WA 3MTSA 2EJFC 1R9TB 1GUNA 3F2UA 4HAEA 3MZ5A 1D5XC 3O13A 4FXGC 1RJTA 3EVQA 1F9SA 1BO0A 1HUNA 4RFBA 4DXGA 5A2QE 3S15B 1TKWB 3ND8A 1MI2A 4H7BA 1PLFA 1NR2A 3FDTA 4H13C 2ICEC 1YNJD 4PMWA 5M3MB 4B9XA 4FVMA 5CMDA 3A8JE 1XTCD 1S5ED 2EY1A 3HG9A 1JOOA 4OIJA 2WP8J 4LK1C 1STNA 1BOSA 3WOEA 3K59A 3R8BA 4X3UA 2B2TC 2F0OA 2FHTA 4MN3A 4U68A 3S1QB 1IW7C 2R93B 1Q1BA 1SBBB 2L12A 2BOSA 4WJWA 4BA2I 3BVZA 3K57A 2BDNA 5JOBA 3K5NA 2M00A 5HGTA 3DXJC 4L8JA 4TSSA 4RGOS 5JPNC 3OSOA 1PRTD 2BCOA 2EVBA 5KNBA 2VUMB 2D2CC 1CQFA 2H1EA 2PYKA 5IGEA 2F0TA 2F0UA 3HOWB 1JQYD 1NAPA 3LX0A 5IGGA 1CI3M 1TU2B 2F0PA 1KABA 4A3DB 4ZKCB 5C3EB 2A73B 1S5BD 1V1PA 4HTHA 2F0EA 1GHKA 1V8QA 3PUZA 4ZRZA 1MGSA 1SSOA 1EQVA 2DN8A 3CKIB 1B53A 3I3CA 3RLFA 1LTID 2AQ3B 5ELFA 5BN5A 1JOKA 5I9OA 3NTKA 5EKIA 4X3SA 3NQIA 2E75C 5JVG3 1Q12A 1SYFA 2B8FA 4NKLA 3VYSA 1O80A 2B63B 1SYEA 4A3GB 1VF7A 4G7ZC 5IT9E 2EE1A 1DCZA 1TWHB 1EY4A 2KEEA 2RBMA 1Z47A 4DF7A 5CYUA 3FMCA 2K5WA 1LT3D 3P1HA 3T53B 3M3YB 3DWQA 5FO7B 3HP3A 3NWTA 1C8CA 2YU9B 2OT2A 1FYCA 2NUCA 1GUOA 3FPPA 3MVVA 2NBFA 2R3ZA 2KECA 2J0TD 1E2ZA 2RKSA 3SEBA 4CJ1B 1SFOB 5E3FA 3NTIA 2XRQD 4C56C 2M2LA 4KKTA 2QDBA 5J39A 1K8OA 2CQAA 3NP8A 2QCPX 4KHVA 2K5DA 1BCPC 2Q8RE 3HEJA 4NW2A 3GD7A 1A6XA 2XN9C 2E76C 5ELBA 4XQNA 1ET9A 4RCNA 2KA7A 2XIWA 4PMCA 1SNMA 1JB3A 5A2QL 2J4XA 3R93A 1FR3A 2KVMA 3IFDA 1A3TA 1JR0D 1NUCA 5BN4A 1I50B 3VR4A 4K2LA 1L0XB 1B1ZA 1GOZA 4XT3B 3SK5A 3TP7A 5D3IB 1ZXTA 2X69A 1IHZA 1KNEA 1X32A 1FD7D 4B08A 4IFDJ 4TRDA 2BA1A 3OMGA 3PUXA 5JEAH 1F9RA 3T51B 1V43A 1PMRA 2AUKA 2NN6H 3NBHA 1FNVA 1TQOA 1R4QB 4KK7A 1RTNA 1C4QA 1B50A 1Z7TA 1CFMA 2LS01 4S3SA 5IGDA 3IFTA 1M8AA 4LJZC 5KIXA 1A15A 3M4YA 3IL8A 2D9UA 4FNFA 1I4GA 4DN4M 4RWSC 1FNUA 3HOUB 1S5DD 2SEBD 3PIO3 1LTBD 1PRTB 1L0YB 5LL6X 2K1BA 4C3HB 3K6OA 3A8KE 1XXGA 3P20A 3VR2A 2L4NA 1STYA 4G57A 4X3KA 3BYYB 2XVSA 4DNRB 1U4MA 1Y1VB 3KK7A 2Z4IA 2R92B 4IURA 3GTPB 5LHY1 5CV7A 5CV5A 1PDQA 3TP5A 4FP5D 4C1NK 5M5YB 2PNRC 3L9AX 4XQQA 2DY8A 4A93B 2F0KA 4JK1C 3X3MA 3R3OA 5KRUA 4DU9A 4DK0A 3E0JA 1ENCA 3HS0C 1B4OA 4HCSA 3PO2B 2JSOA 1H9JA 4KHZA 3GTMB 2RDFA 4HMIA 1TY2A 1TWAB 2D5DA 5DAUA 4G7OC 3X3NA 2KCCA 3Q6SA 2PW5A 3ND9A 2KQ3A 3DHQA 4K8IA 4XDXA 3DUZA 5IT9L 1B9MA 4DAPA 4KD4A 3E6ZX 1D1IA 3I72A 1FNWA 3I4NB 4A3BB 1HFNA 5KEEA 4ZYSA 3T13A 1EFID 2X6LA 1FGBD 5ELCA 1DJRD 1TT2A 1D6EC 1F9QA 1ML0D 1RD9D 2A6ED 2H4OA 2O5IC 3CHBD 2F0NA 5C0XJ 3U9SA 2K05A 2KOLA 1SNPA 5AFWA 3BG3A 3K58A 4CJ2C 3QIAA 1EIGA 3BVGA 1SJHD 2FINB 4EQOA 2DNEA 1PXUA 3TN2A 2PCFB 4HR7B 2L5TA 3MXPA 2F0GA 5BN3A 4E6IA 3BVMA 1SNOA 4C3HG 3A54A 1BCPF 4Z9CB 1RHPA 3MXGA 2SDFA 5IOCA 2QF7A 1JWMD 3NE5B 1EY5A 4ZAIA 3TP6A 1YNND 1H9KA 2XSCA 2F0HA 3FRPB 5C4ZA 4K2KA 2HQEA 5CR3A 4H0LC 2A69C 1KTKA 1VF5C 2NTTA 3S1RB 3NK9A 1SNQA 4XYQA 3D31A 2CW0D 1TWFB 1A3VA 1H9MA 3I4MB 1C48A 1AZQA 4AYBB 1BQQT 3H94A 1DD2A 2JXMB 3HOVB 1HHVA 1ZYRC 4EVOA 4K14A 2FJ2A 1EY9A 2E74C 1CZGA 1W6JA 3K7AB 1U4RA 1CA5A 1JOQA 1TR5A 3Q23A 1EEFD 4IUQA 2SNMA 1GHJA 1ESFA 1PFMA 1W6KA 1RF2D 1PTOD 2K01A 1KDBA 4QUFA 3KF8A 4FO2A 2EYHA 5JJZA 3I73A 2NVTB 1OXUA 2N88A 1K8MA 2K03A 2A68C 3OOCA 1I6VC 1JCKB 4HN7A 5NUCA 3I8ZA 3PUYA 1V1PB 1WTVA 2L0CA 3D8GA 3MFYA 5G3LF 2A74C 1Y8PB 2F0IA 4ZKBB 1HPCA 2IT1A 2O5JC 4WFN3 4CGYB 5E1FA 2B2VC 4XTCS 4CBVA 4OO1H 1HXYD 4FXDA 1AFPA 1A2UA 4RKLA 1STGA 1RODA 4HEDA 2LY7A 2NN6G 4M8AA 3D3RA 4K8JA 1B9NA 1Q8IA 1QOHA 1WTWA 4HMJA 4IFDH 3S16B 2F3WA 3K5MA 3FKIB 3GTLB 3GP7A 2F4IA 2EY5A 1PTOH 4ZUIA 1MSHA 2KUMA 1O7YA 3SR1A 5HURA 5M5XB 1OO9B 4ME5A 2B2YA 1LACA 4QCLA 3AMUA 2B39A 2BA0A 1LTTD 4RHSA 1AZPA 4ODGA 5IGCA 1EYCA 2KJXA 5FLXE 1TWCB 1F77A 1WTQA 2E2DC 1EZ6A 2ZXPA 1CA6A 1QG7A 2QILA 1EWHA 2EDGA 2K7VA 1AEXA 3HZXA 3JAME 4J6HA 3A56A 1SMYD 3GV6A 4K6DA 3VR3A 1MD2D 4RAUC 2L55A 2F0LA 4RKBA 1SYCA 2DY7A 4ULLA 3MFGA 2F0QA 2VB3X 3E5SA 2IX1A 2SOBA 4CKCA 2A6HC 1D2BA 3GTQB 3EFXD 2VB2X 5COYA 5C4JB 2IPKD 5CBAE 2F0DA 4F87A 4G4KA 3VYTA 4NP5A 2B2TA 1DONA 3H91A 4FF2A 1EWCA 1STBA 5M9OA 1MBYA 1T5XD 3DEPA 4O1NA 5K36H 2BE5C 4FF3A 1HTLD 1IKLA 4PMBA 5I6YA 3NXWA 4H44C 1DM0B 1CM9A 5EJWA 1MSGA 2KHSA 1LTSD 2VNUD 1I4XA 1F2MA 3KLSA 1EU4A 1UEAB 5C0XH 3M7GA 2EJGC 1NR4A 2M9VA 4KMUC 1ZKOA 3DMUA 2XRSD 4ZUJA 2EYPA 3L3OC 4XXEA 4NDXA 4EGVA 3QJYA 1EOTA 5KNCA 4G7HC 1TS3A 3OPOA 2AQ2B 3V05A 3BZDB 1EZ8A 1SYGA 4IUUA 3K5OA 2EY2A 3KLRA 3I4LA 2ZXOA 2B2UC 5M3FB 3CRLC 1PTOB 2R7ZB 1OXXK 1TVXA 3BDLA 2K32A 2RDGA 3KBGA 3PMFA 4F88A 5IGBA 3BS1A 1X3QA 2ICIA 3QO2A 1G2SA 2RQXA 3C1EA 1RCVD 2EXZA 1G2TA 3RMHA 1H9SA 4CHTB 1SXTA 3R2TA 3OHXC 1ICWA 5DM73 2JA6B 4ID6A 2RDHA 5EGTA 1TY0A 2B2WC 5FO8B 1YNJC 2JP1A 3NSWA 4V0BA 2FFKB 2PMZB 4HSVA 3S2HB 1II3A 1STAA 2O2LD 3TZDA 4KY5A 1V1OA 2AWNA 3MAQA 5JPMC 5CV6A 3GTJB 1R4PB 4BBSB 1SAPA 1F2LA 2MGSA 1DXMA 4K6LA 3J7AF 3FEWX 2RVLA 3P7JA 1WTPA 2IWHA 5I4DA 5EPJA 1BDOA 4C1NI 2ZXRA 3SK6A 4ABNA 2WIIB 3Q24A 5IIFA 3C3LA 4N9TA 1U4PA 2HCCA 4HCEA 2RSOA 3IAYA 3CRKC 1I3QB 5EPKA 3NBIA 5FLXL 1D5MC 1BR9A 5TSSA 4IALA 4IUVA 3M7NA 4XIGS 2L1BA 1PRTC 1STEA 2EOTA 1M4VA 3H09A 1GUSA 2G9HD 3SK4A 5FKAC 5IGFA 2PZWA 5FOBB 3JAML 3J81E 3GTOB 2F0JA 3A8IE 4XQJA 4R8NA 1VDZA 2IW3A 4NMZA 1IW7D 3RZDB 2X6GA 5JAVA 5EBCA 2L9HA 1XX8A 1GXDC 5C6AA 1AW7A 5LL6S 2A5HA 3MWYW 3MXUA 3D4WA 3NHHA 3RZOB 3Q0AA 3OMCA 4RH6A 3C2PA 1SYDA 2JYOA 5I2XA 1RKNA 4QIWB 4MIUA 1O7ZA 1NSNS 1LT4D 1D5ZC 5JVH3 4XT1B 1IYUA 4F8MA 4EQPA 3J80L 4JBWA 3OW7A 1F9PA 2C9OA 4CKEA 1WTXA 4KI0A 2K33A 2OXPA 1ENAA 3KLSX 3LNNA 2I07B 2HCIA 3DEOA 4K5VA 3DWPA 4KN7C 2VXWA 3T4AC 4OHJA 4A3EB 3I70A 1Y69U 1E2WA 1S5CD 4PNYA 3ZYYX 1STHA 4P2CB 2MP1A 1DZ1A 2E2HB 2NN6I 1T5EA 2PQEA 4KY7A 3D4DA 2B8GA 1Q3LA 3ITPA 1LO5D 3HOYB 5DNFA 4A3IB 1A2TA 2NZ1D 2WACA 1CK1A 5K36G 3OWFA 2KEDA 1IL8A 1DOMA 5CBEE 3W2DA 2NVXB 5D14A 1ESRA 1CQVA 1ILQA 1JORA 1RDPD 3N6RA 1DYQA 5C44B 1S4ZA 1SE2A 3VR6A 5ELDA 2BE5D 4UDUC 2F1MA 4RGNA 5CGKA 4LAAA 1LV9A 4HSPA 5CC4A 2F3VA 2MUYA 4BY1B 2I46A 1TS5A 1ONLA 1ILPA 4KKUA 3FVQA 5J1ZA 1EY7A 2JA8B 2RSNA 4DNTB 4X3TA 2ENBA 5KGUA 3AU7A 3PUVA 1HA5A 3QB3A 1K83B 2PO4A 3T56B 4RA8A 1KLGD 1PFNA 2IX0A 1BCPD 2Z4HA 4CKBA 1QNUA 4QUCA 4A3KB 1JWSD 3RD4A 4Y7NB 1EYDA 5EQ0A 1BXTA 4FYDA 4LMQD 3NTHA 1UNSA 3M85A 3PV0A 2R6GA 2HDMA 1ET6A 4ZLTF 3G7LA 4PV1C 3S1NB 3Q22A 1QNKA 3GQBA 1KLUD 3HOXB 2WAQB 3NPPA 4QF4A 3GTGB 3TMEA 1D1KA 1B2TA 2PZUA 1LTAD 1F2ZA 5KYIA 1CTMA 1PRTF 4M1UB 4BWGB 2J7ZA 4ILWA 4KN4C 1G291 5JEAG 1HA6A 2EYMA 1SJED 5EPLA 1DOLA 4DAVA 4IN3A 4A3FB 3KBXA 1F2YA 2D62A 3J81L 4OIKA 1UAPA 3ERQA 1QE6A 1CHPD 3EJIA 3URYA 3SVMA 1G8ZD 2LKVA 3C1FA 5KNDA 4QMGA 2EYOA 2F0WA 3HGBA 1TS4A 2YYZA 2PZTA 3W3AA 3SXHA 3TDQA 1RTOA 2NVYB 1O7LA 2NTSA 3L7ZC 1S5FD 5FO9B 2AQ1B 1OXTA 2JA5B 4K5XA 3SDZA 1VMCA 5G3LD 2FMMA 2K6AA 1KAAA 1QILA 4J8QA 3S1MB 3U9OA 2SNSA 1G6ZA 1SEBD 2V4DA 2XWJB 5E4XA 1WTRA 4DXFA 3NWSA 2PPBC 2LMCB 1QWYA 5D65A 4XYOA 1Y8OB 3D6CA 1KDAA 3GO5A 3DWAA 3MXNA 5C5LA 3S2DB 1VCIA 4OGQC 4RHRA 3A7LA 3TZUA 2NYZD 4KV6A 4L63B 1PFBA 2Q8IB 4K5WA 1IYVA 2JA7B 3MC0B 2B2VA 2A6EC 1HQMC 1WD1A 1I4RA 3MEHA 2Z1CA 3C46A 2JEBI 4PQXA 5ISRA 1JC7A 3J7YW 2Z8LA 3SE0A 2WKDA 3K0YA 3DM1A 1LT6D 3GTKB 4IUNA 3J80E 3NQTA 3GV3A 1PZID 1HTPA 3N52A 4R9WA 5CORA 4A3MB 3V96A 1Q1EA 3VYUA 1BUVT 1JE4A 1H9SB 2WINB 3NUCA 3J7AV 2PW7A 1U4LA 4IQZA 1SYBA 4OO1I 1QJOA 2K04A 5EKKA 2ID0A 1YNNC 2F03A 5EKLA 1U9RA 3QWNA 1B44D 1UUPA 3OIPA 3OIQA 1GUWA 1PYWD 4C3JB 4IFDI 1LT5D 1EY8A 5C5MA 2CW0C 1WVLA 3A55A 4FF4A 2E2JB 1SE4A 3VA5A 2KCNA 3QOJA 3S14B 3TBIB 3M4OB 4GZYC 1LTRD 2CHBD 4TQUS 1HQRD 2OEOA 5D3DA 2ZT9C 5ELEA 2LFNA 1BCPB 3R2IA 3CQZB 1LABA 5DM63 1PTOC 2A69D 5CV8A 2G9DA 1SNDA 2L11A 3WOFA 3WDNA 2MHVA 1BF4A 5C4HA 4TKOB 4Q0FA 1JWUD 1XWEA 3T16A 3VR5A 1SE3A 4ZK9B 2TSSA 1ZYRD 2WKCA 5KYLA 3OWEB 2QKIC 5C4XB 1BNZA 2NWGA 4C3IB 2O4XA 1TWGB 5A35A 2AUJD 1EU3A 5T1GA 1TS2A 3D4RA 3HRZC 1I6HB 3G6JB 1GJXA 2JEAI 2R61A 3MHBA 5FK9C 3VYRA 1HUMA 2IX3A 3A7AB 1CZWA 4IZ8A 1Z6HA 1J9OA 5E4WC 2DNCA 4KKSA 4A3JB 3QG1A 4C3JG 1AN8A 3LWUA 3KUPA 2A68D 1LTGD 3PUWA 1X3PA 1O78A 2Q8TA 4OO1G 1I4PA 1IKMA 5C3WA 2B2UA 2OF1A 5DEHA 1J8IA 1XYIA 5I2YA 1GUTA 1HFGA 1Y8NB 5C0XI 1HRJA 3BDOA 4IFDG 1NCVA 1G91A 2K28A 3VA7A 3V2TA 3SK8A 3EROA 2QEJC 4B9WA 1EY0A 5M5WB 3SHLA 4RGTA 1WCMB 4C2MB 1BBXC 5I9PA 1EYAA 2TMPA 1TIID 2MPMA 4ZQ3A 4CJ0B 4DK1A 1SMYC 3BYTB 1ENFA 2IJ0A 4FF1A 4DAYA 2F0FA 2N55A 2EY6A 2B2WA 1PZKD 2NVQB 5CV4A 2EZVA 1KDCA 4QB4A 1DOKA 1A3UA 3I90A 1Y1WB 2F0MA 1E0BA 5K5PA 3TP8A 2XNAC 4IUPA 1CT1D 4C3IG 3ONAB 4OL7A 1EIHA 1EQTA 3AB9A 3H0GB 1H9RA 2EYFA 3EA6A 4F7XA 1ZEQX 4UAIA 1OXVA 3PO3B 4BBRB 3UI2A 1EEID 1SDFA 2EYJA 1WD0A 4KTAA 2AWOA 5C3XA 4RGMA 1GUGA 1B3AA 5IODA 2WV6D 3EQLC 2A6HD 4U673 3LWEA 4V190 5EBDA 4J1MA 3K5LA 4MHEA 1JICA 2EPBA 4KD3A 4KY6A 1CHQD 4WORA 4DA2A 4FXKC 3I91A 2HDLA 3S9WA 4KJNA 1HCZA 4IUTA 3MA2B 2NB0A 2HUGA 5J22A 1VMPA 4R8IA 2E2IB 3H3VC 4RCOA 3FPUB 1I4HA 1PTOF 3HKZB 2EJMA 1OXSC 2C5CA 2IL8A 5C0XG 1QCBD 1E2VA 4I7ZC 3RUZA 3BDCA 2K5QA 4BS9A 5I6WA 2XWBB 3H6MA 2BDOA 4DFAA 1KNAA 2F0SA 1EY6A 2FMCA 4YIJA 2EYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKB B;  1WVL A;  2KVM A;  2RA4 A;  1PDQ A;  5E4W C;  2MP1 A;  3IFD A;  5EQ0 A;  1DZ1 A;  4LMQ D;  1G6Z A;  4IUV A;  2EE1 A;  4O42 A;  4ZAI A;  5E4X A;  2L12 A;  2L1B A;  4UAI A;  1TVX A;  1WTR A;  5COY A;  1WTO A;  2HDM A;  1AP0 A;  2EOT A;  2B2V C;  2DY8 A;  3UI2 A;  1Q3L A;  3KUP A;  1SDF A;  2KEE A;  4ZLT F;  3G7L A;  5CBA E;  1WD0 A;  1EL0 A;  5DNF A;  1QNK A;  1X3Q A;  5D65 A;  4XT3 B;  1B4O A;  1ROD A;  2B2T A;  1X3P A;  4HCS A;  4HED A;  2BDN A;  2Q8T A;  1ZXT A;  2X69 A;  2NZ1 D;  3QO2 A;  1G2S A;  1IKM A;  1DON A;  3H91 A;  2MJ8 A;  1KNE A;  2B2U A;  5T1I A;  2B2Y C;  1X32 A;  1WTW A;  1J8I A;  1B3A A;  1XYI A;  2KED A;  1IL8 A;  1DOM A;  1G2T A;  1B2T A;  1HFG A;  2NYZ D;  2X6G A;  5CBE E;  3Q6S A;  5D14 A;  1AZQ A;  2L9H A;  3LWE A;  1PFB A;  3HP3 A;  3DEP A;  1F9R A;  1C8C A;  2B2V A;  1HRJ A;  1XX8 A;  1ESR A;  4MHE A;  2CVR A;  1ICW A;  1JIC A;  1NCV A;  3D6W A;  3MTS A;  1G91 A;  1ILQ A;  2EPB A;  2H1E A;  2K28 A;  2J7Z A;  4XDX A;  1MSH A;  1WD1 A;  2KUM A;  3MWY W;  1HA6 A;  1HHV A;  1O7Y A;  3F2U A;  4HAE A;  1NAP A;  5EPL A;  3I91 A;  2B2W C;  2HDL A;  1RTN A;  2L11 A;  2R3Z A;  1S4Z A;  1DOL A;  2KEC A;  2JP1 A;  1HFN A;  4CJ1 B;  2FJ2 A;  2B2Y A;  4ZKC B;  1IKL A;  4IUT A;  2JYO A;  1LV9 A;  1B50 A;  3KBX A;  2FFK B;  1RJT A;  2M2L A;  1F9S A;  2X6L A;  4HSV A;  1U4R A;  1CA5 A;  2HUG A;  1BBX C;  1BO0 A;  3DM1 A;  1BF4 A;  1HUN A;  1CM9 A;  1VMP A;  3TZD A;  4R8I A;  1M8A A;  1ILP A;  1O7Z A;  1AZP A;  1F9Q A;  1MGS A;  1ML0 D;  3GV3 A;  4OIK A;  2MPM A;  5EJW A;  1SSO A;  2SDF A;  1A15 A;  1MSG A;  3IL8 A;  4IUQ A;  2D9U A;  3N52 A;  4XT1 B;  1PFM A;  4CJ0 B;  4DN4 M;  4RWS C;  3FPU B;  1QE6 A;  1MI2 A;  4R9W A;  5COR A;  1B53 A;  1PLF A;  2K05 A;  1NR2 A;  2KOL A;  2N55 A;  3FDT A;  4ZK9 B;  2RSN A;  3I3C A;  2K01 A;  1SAP A;  1F2L A;  2B2W A;  2MGS A;  2Q8R E;  4X3T A;  1NR4 A;  5AFW A;  4QUF A;  1WTQ A;  3SVM A;  2IL8 A;  4CJ2 C;  1JE4 A;  4NW2 A;  1CA6 A;  1U4L A;  2RVL A;  3P7J A;  1EIG A;  1QG7 A;  1F9P A;  1WTP A;  2K1B A;  5JJZ A;  1BNZ A;  2NWG A;  5EKI A;  5EPJ A;  5CMD A;  4X3S A;  2K04 A;  1WTX A;  1DOK A;  2FIN B;  3I90 A;  4RA8 A;  1PFN A;  1RTO A;  2N88 A;  2XIW A;  2L4N A;  2K03 A;  4X3K A;  5T1G A;  3TN2 A;  4OIJ A;  1E0B A;  1EOT A;  3I8Z A;  1GUW A;  3GV6 A;  1U4M A;  4IUP A;  4X3U A;  2HCI A;  1KNA A;  4RAU C;  2B2T C;  1WTV A;  1HUM A;  1VMC A;  2FMM A;  3DEO A;  1U4P A;  3ONA B;  1O80 A;  2HCC A;  4IUU A;  2FHT A;  2RSO A;  2DY7 A;  4IUR A;  4MN3 A;  4QUC A;  4U68 A;  5EPK A;  1RHP A;  1EIH A;  3R93 A;  2VXW A;  1EQT A;  2B2U C;  1J9O A; 
#chains in the Genus database with same CATH topology
 2JE6 I;  1LLR D;  2Y0S B;  5IY0 A;  2GA4 B;  2RA4 A;  5F2D A;  4O0A A;  4JI7 Q;  4JI3 L;  4O42 A;  4H02 A;  4N9P A;  4KJO A;  1WTO A;  1AP0 A;  5FLM G;  1Q90 A;  5CV9 A;  3PIP 3;  4GKK L;  3CU7 A;  4GLX A;  1EL0 A;  3P75 A;  5IYC G;  2F0V A;  3H0G G;  4LF9 Q;  2QEX A;  1SNC A;  1K8A C;  4BA1 I;  2WB1 B;  1PZJ D;  2MJ8 A;  3S17 B;  3PO3 G;  4BBR G;  5T1I A;  4L6T B;  2B2Y C;  4QIW E;  4WRD A;  4DGZ A;  1HR0 W;  2B63 H;  1QB5 D;  3LGJ A;  3TSS A;  3IKJ A;  3KJO A;  5JEA J;  4EQN A;  4NXM Q;  4I65 A;  2Z0S A;  3QOL A;  4Q5V A;  3HOZ B;  4BY7 B;  1I4Q A;  2CVR A;  3D6W A;  3MTS A;  4OON A;  2EJF C;  1R9T B;  1TWH H;  1GUN A;  3OYY A;  3F2U A;  4HAE A;  3CXC A;  3MZ5 A;  1D5X C;  2P5Z X;  3O13 A;  3NEN A;  4FXG C;  1MIU A;  1RJT A;  3EVQ A;  1F9S A;  1BO0 A;  1HUN A;  4RFB A;  4DXG A;  5A2Q E;  3S15 B;  1TKW B;  4YCV A;  3ND8 A;  1MI2 A;  3CCE A;  4H7B A;  1PLF A;  1NR2 A;  2YU9 H;  3FDT A;  4X66 Q;  1IZ6 A;  4H13 C;  3E9H A;  2ICE C;  1XNQ L;  1YNJ D;  1U5K A;  3GDE A;  3L0O A;  1U0L A;  4PMW A;  5M3M B;  4B9X A;  4FVM A;  5CMD A;  3A8J E;  1XTC D;  1S5E D;  2EY1 A;  1SFO H;  3HG9 A;  3I7F A;  3HKZ G;  4JW0 A;  1JOO A;  4LFA Q;  4HIK A;  2JA9 A;  4OIJ A;  2WP8 J;  4LK1 C;  1STN A;  1BOS A;  3WOE A;  1XTD A;  3K59 A;  1HNX Q;  3R8B A;  3J81 j;  4X3U A;  2B2T C;  2F0O A;  3DM3 A;  1N34 L;  2FHT A;  4MN3 A;  4U68 A;  3S1Q B;  1IW7 C;  2R93 B;  1VS0 A;  1A62 A;  1Q1B A;  3A74 A;  3K7U C;  1SBB B;  5LMN L;  2E8G A;  2IHE A;  2BOS A;  2L12 A;  5M3F H;  4EX5 A;  4WJW A;  1HZ9 A;  4BA2 I;  2HT1 A;  2Y0S G;  3BVZ A;  3K57 A;  4JI1 Q;  2BDN A;  5JOB A;  3K5N A;  2M00 A;  5HGT A;  3DXJ C;  4MTN A;  1UE7 A;  1GO3 E;  4L8J A;  4TSS A;  4RGO S;  5JPN C;  4DR1 Q;  3OSO A;  1PRT D;  2WB1 G;  2BCO A;  2EVB A;  4OXP A;  5KNB A;  2VUM B;  2D2C C;  1CQF A;  1J6Q A;  3KDF B;  2H1E A;  2PYK A;  5IGE A;  2F0T A;  4B3S Q;  2F0U A;  3HOW B;  1I50 H;  1JQY D;  2WFW A;  1NAP A;  3LX0 A;  4L5Q A;  5IGG A;  1CI3 M;  1BKB A;  1TU2 B;  2F0P A;  2Q2I A;  3HOZ G;  1KAB A;  4A3D B;  4ZKC B;  4BY7 G;  5GRO A;  5C3E B;  2A73 B;  1UWV A;  1FGU A;  3F2B A;  1N9W A;  1S5B D;  1V1P A;  1PH8 A;  2UUB L;  1QUQ A;  4HTH A;  4J15 A;  2F0E A;  1GHK A;  4AQY Q;  1V8Q A;  3PUZ A;  4ZRZ A;  1MGS A;  1SSO A;  1EQV A;  2DN8 A;  3CKI B;  1B53 A;  2UUC Q;  3I3C A;  3CW2 C;  3RLF A;  1LTI D;  2AQ3 B;  5ELF A;  1W2B A;  4BBS H;  5BN5 A;  1JOK A;  5I9O A;  4DAM A;  4DV7 Q;  3NTK A;  5JJL A;  5EKI A;  4X3S A;  3NQI A;  2E75 C;  5JVG 3;  1Q12 A;  1SYF A;  1HR0 L;  2B8F A;  4NKL A;  2DJF C;  3VYS A;  5M3M G;  1O80 A;  2B63 B;  1SYE A;  2MFI A;  4A3G B;  1GVP A;  2AKW B;  3U58 A;  2UXD L;  1I3Q H;  1VF7 A;  4G7Z C;  5IT9 E;  2EE1 A;  1I94 L;  1DCZ A;  1TWH B;  2F4V L;  1EY4 A;  4C3H H;  2KEE A;  2RBM A;  1Z47 A;  4DF7 A;  1E24 A;  2R93 G;  4LW1 A;  5CYU A;  4LWC A;  3FMC A;  2K5W A;  2KHI A;  2CH4 A;  1LT3 D;  2PI2 A;  3HKS A;  3P1H A;  3T53 B;  1Y1V H;  2R92 H;  4IOC A;  4LF8 L;  3GTO H;  3GTP H;  1HZB A;  4JC0 A;  3M3Y B;  3DWQ A;  5FO7 B;  3HP3 A;  4JYA Q;  3NWT A;  5IYD G;  1C8C A;  2K14 A;  2YU9 B;  2OT2 A;  3G48 A;  1FYC A;  2NUC A;  1GUO A;  5M5Y H;  1M1K C;  3FPP A;  5FJ8 G;  3MVV A;  2NBF A;  2R3Z A;  2KEC A;  4GLV B;  2KBN A;  2J0T D;  1E2Z A;  2RKS A;  3SEB A;  4CJ1 B;  2VQF L;  5E3F A;  1SFO B;  2VUM G;  3PO2 H;  3NTI A;  2XRQ D;  4C56 C;  2M2L A;  3RZO H;  4KKT A;  2QDB A;  5J39 A;  1EWI A;  1K8O A;  3HOW G;  3GTM H;  1SE8 A;  2VL6 A;  3S24 A;  2RCF A;  1DGS A;  1TWA H;  2ALY B;  2ZTC A;  2CQA A;  3NP8 A;  4A3D G;  2CWP A;  5C3E G;  2QCP X;  4KHV A;  2K5D A;  1BCP C;  4A3L G;  2Q8R E;  3HEJ A;  3OTO L;  2ZTD A;  2UXB Q;  4NW2 A;  3GD7 A;  1A6X A;  2IHF A;  2XN9 C;  2E76 C;  1XMQ L;  4DV4 L;  3I4N H;  4A3B H;  5ELB A;  4XQN A;  1ET9 A;  4RCN A;  4O2D A;  2KA7 A;  3RNU A;  1HZA A;  3I56 A;  2XIW A;  4PMC A;  1SNM A;  4DUY L;  1VQB A;  1JB3 A;  5IT9 c;  5A2Q L;  3A5Z B;  2J4X A;  3R93 A;  2R7F A;  1FR3 A;  1YHA A;  2KVM A;  3IFD A;  1A3T A;  1JR0 D;  4GKJ L;  1NUC A;  4A3E H;  4DAY B;  2B3G A;  5BN4 A;  2B63 G;  4JBK A;  2E2H H;  4A3G G;  1I50 B;  3KLW A;  3VR4 A;  4K2L A;  1L0X B;  1JE5 A;  1SR3 A;  1B1Z A;  1GOZ A;  4XT3 B;  1PH5 A;  3SK5 A;  4JI2 Q;  4B3M Q;  3TP7 A;  5D3I B;  1ZXT A;  2X69 A;  1EOV A;  1GKH A;  4A3I H;  1IHZ A;  1KNE A;  3U50 C;  1XNR Q;  1X32 A;  1FD7 D;  5BR8 Q;  4B08 A;  4IFD J;  4TRD A;  2BA1 A;  3OMG A;  2Q2H A;  3PUX A;  4LFB L;  5JEA H;  1F9R A;  1IBK L;  3T51 B;  1V43 A;  1PMR A;  2NVX H;  2AUK A;  2NN6 H;  3NBH A;  2EQS A;  2OTL A;  4QY7 A;  1FNV A;  1TQO A;  1R4Q B;  4KK7 A;  1RTN A;  1EIF A;  1C4Q A;  4GOP A;  2GVB A;  1XJV A;  4I7A A;  1B50 A;  3S1R H;  5LMU L;  1Z7T A;  1CFM A;  2LS0 1;  4S3S A;  3T1Y Q;  4YY3 Q;  4ME3 A;  5IGD A;  3IFT A;  1M8A A;  4LJZ C;  3UDF A;  5KIX A;  4BY1 H;  3M4Y A;  1A15 A;  3IL8 A;  2D9U A;  4FNF A;  2ZJP A;  3I4M H;  1I4G A;  4DN4 M;  4RWS C;  1FNU A;  3HOU B;  1S5D D;  4N8X 1;  2SEB D;  5JJK A;  3PIO 3;  1VQD A;  3HOV H;  1LTB D;  2LXJ A;  2UU9 Q;  1PRT B;  1QVC A;  1L0Y B;  5LL6 X;  2K1B A;  4C3H B;  1VQL A;  3K6O A;  3A8K E;  1XXG A;  3P20 A;  3ICE A;  2L4N A;  3K7A H;  3VR2 A;  1STY A;  4G57 A;  4X3K A;  3BYY B;  1K83 H;  2XVS A;  4K0K Q;  4DNR B;  1P16 A;  1U4M A;  4JV5 L;  1Y1V B;  3KK7 A;  2Z4I A;  2R92 B;  4IUR A;  4GNX C;  1EIY B;  3GTP B;  5LHY 1;  5CV7 A;  5CV5 A;  1BBW A;  3QR8 A;  3K80 C;  1PDQ A;  3TP5 A;  4FP5 D;  4Y7N H;  4C1N K;  5M5Y B;  2PNR C;  3L9A X;  4XQQ A;  2DY8 A;  4A93 B;  2F0K A;  4JK1 C;  3X3M A;  3R3O A;  5KRU A;  4DU9 A;  4DK0 A;  3E0J A;  1ENC A;  3HS0 C;  4PZ6 A;  1B4O A;  1VQO A;  4HCS A;  3PO2 B;  2A8V A;  2JSO A;  3AFP A;  3S1N H;  1H9J A;  4KHZ A;  3GTM B;  2RDF A;  1PH1 A;  4HMI A;  1TY2 A;  1TWA B;  2D5D A;  1Z9F A;  2KCT A;  5DAU A;  4G7O C;  3X3N A;  2KCC A;  4P71 A;  3Q6S A;  4POG A;  1LTL A;  1C0A A;  2PW5 A;  2HQL A;  3ND9 A;  2KQ3 A;  3DHQ A;  4K8I A;  4XDX A;  2Z6K C;  4DV3 L;  3DUZ A;  5IT9 L;  1B9M A;  4DAP A;  1E1T A;  4KD4 A;  2UUA L;  3E6Z X;  1D1I A;  3I72 A;  1FNW A;  3I4N B;  4RG1 A;  4A3B B;  1HFN A;  1VQC A;  1CKM A;  5KEE A;  4ZYS A;  4LF4 L;  4LFC Q;  3RN2 A;  3T13 A;  1EFI D;  2X6L A;  1FGB D;  5ELC A;  1DJR D;  1TT2 A;  2JQO A;  2QDL A;  4A3F H;  1D6E C;  4OX9 L;  1VQK A;  1F9Q A;  1ML0 D;  1K73 C;  2K5V A;  1RD9 D;  1N33 L;  1Y14 B;  2A6E D;  2H4O A;  2O5I C;  3CHB D;  2F0N A;  5C0X J;  3U9S A;  3FKI H;  2K05 A;  5DLQ E;  2KOL A;  1SNP A;  3UE0 A;  5AFW A;  3BG3 A;  4CDD C;  3EBE A;  3K58 A;  4CJ2 C;  4JVZ A;  1VQ7 A;  3QIA A;  1EIG A;  5M5X H;  3BVG A;  3CD6 A;  3HOU G;  1SJH D;  2FIN B;  1PH2 A;  1V1Q A;  4EQO A;  3D0F A;  2DNE A;  1K28 A;  1KXL A;  1Q46 A;  1PXU A;  3TN2 A;  2PCF B;  4HR7 B;  2CFM A;  4FDB A;  1X56 A;  2L5T A;  2NVY H;  3MXP A;  2F0G A;  5BN3 A;  4E6I A;  3BVM A;  1SNO A;  1G51 A;  4C3H G;  1NNX A;  3A54 A;  1BCP F;  4Z9C B;  1TWC H;  1RHP A;  3MXG A;  4HID A;  2SDF A;  2VQE Q;  1VQM A;  4DR6 Q;  4HJ7 A;  1O7I A;  3TS2 A;  1Q81 C;  5IOC A;  1L1O A;  2QF7 A;  1JWM D;  1Y1V G;  1EY5 A;  3ERS X;  3NE5 B;  1E1O A;  4ZAI A;  3TP6 A;  2R92 G;  1YNN D;  1H9K A;  2XSC A;  2F0H A;  1N34 Q;  1FVI A;  3FRP B;  5C4Z A;  4K2K A;  4R4C A;  4JI0 L;  2HQE A;  5CR3 A;  4H0L C;  2A69 C;  1KTK A;  2MO0 A;  2I5H A;  1VF5 C;  2NTT A;  3AFQ A;  1YIJ A;  3S1R B;  2RHQ B;  4A93 G;  3NK9 A;  3T1H L;  1SNQ A;  4XYQ A;  3D31 A;  2CW0 D;  3TRE A;  1TWF B;  1A3V A;  1CKN A;  1H9M A;  3DLL A;  3I4M B;  1C48 A;  4CDF C;  3PO2 G;  1AZQ A;  2B29 A;  4AYB B;  1BQQ T;  3H94 A;  1DD2 A;  4AIM A;  3GTQ H;  2JXM B;  1N8R C;  3HOV B;  3E3X A;  4IPG A;  5C4J H;  1HHV A;  1XPU A;  1ZYR C;  4JI6 Q;  3AYH B;  1KHI A;  4K14 A;  4EVO A;  1AH9 A;  1HNW L;  2D0P A;  2FJ2 A;  1EY9 A;  2E74 C;  1CZG A;  1W6J A;  3K7A B;  1U4R A;  1CA5 A;  1S72 A;  1JOQ A;  1NBW A;  4DR5 L;  2K5N A;  2HHH L;  4YHH Q;  3TEH B;  1TR5 A;  3HFZ B;  3Q23 A;  3I4N G;  1EEF D;  2FXQ A;  4IUQ A;  4A3B G;  2SNM A;  1GHJ A;  3CCQ A;  1ESF A;  3GTK H;  1PFM A;  4P75 A;  3TRZ A;  1W6K A;  1RF2 D;  3PF5 A;  1PTO D;  3JAM i;  1WYD A;  2K75 A;  2K01 A;  1KDB A;  4QUF A;  3KF8 A;  5GAD C;  4FO2 A;  2OQ0 A;  5JJI A;  1Q7Y C;  2EYH A;  5JJZ A;  3I73 A;  2NVT B;  1OXU A;  3KOJ A;  2N88 A;  4NXN Q;  1K8M A;  4JI4 L;  2K03 A;  2A68 C;  3OOC A;  1I6V C;  3W5O A;  1JCK B;  4HN7 A;  5NUC A;  3KF6 A;  3MXN B;  1E22 A;  3I8Z A;  2E5L L;  3PUY A;  4NPS A;  1V1P B;  1WTV A;  2L0C A;  3D8G A;  3MFY A;  1Q82 C;  1C9O A;  5G3L F;  5IWA L;  2A74 C;  1Y8P B;  4JBJ A;  2F0I A;  4ZKB B;  4C3J H;  1HPC A;  2XTI A;  2IT1 A;  3G71 A;  2O5J C;  4WFN 3;  4DR2 L;  4CGY B;  1PH3 A;  5E1F A;  2B2V C;  4XTC S;  4CBV A;  4OO1 H;  1HXY D;  4FXD A;  4R4Q A;  1FJG Q;  1AFP A;  1A2U A;  1IXR A;  4RKL A;  5GQO A;  4OWX B;  1STG A;  1ROD A;  4HED A;  2LY7 A;  2NN6 G;  4M8A A;  3D3R A;  4K8J A;  3M4O H;  1B9N A;  1Q8I A;  3JC6 6;  1QOH A;  4HJA A;  1WTW A;  1N36 Q;  5IP7 H;  4OWW B;  4HMJ A;  3STB C;  4IFD H;  3S16 B;  2F3W A;  3K5M A;  3FKI B;  4IOA A;  4LF5 L;  3GTL B;  3GP7 A;  2F4I A;  4X62 L;  4B3T L;  2EY5 A;  2BH8 A;  1PTO H;  1WTH A;  2R7Z H;  4ZUI A;  1MSH A;  3HKZ E;  4LF6 L;  4DV2 Q;  4LF7 L;  2KUM A;  2ZM6 L;  4DV5 L;  4DV1 Q;  1O7Y A;  3I4M G;  3SR1 A;  5HUR A;  5M5X B;  1VQA A;  1AE2 A;  2V1C C;  4DUZ L;  4AYB G;  1OO9 B;  5ELN A;  4ME5 A;  2B2Y A;  2XGT A;  2BH2 A;  1LAC A;  2UXC Q;  4QCL A;  3AMU A;  2B39 A;  2BA0 A;  4X64 L;  3HOV G;  1LTT D;  4RHS A;  1AZP A;  4ODG A;  5IGC A;  4BXX H;  1EYC A;  2KJX A;  4JI7 L;  2AMC B;  5FLX E;  1TWC B;  1B3Q A;  1VQE A;  2OCE A;  1MJE A;  1F77 A;  1WTQ A;  2E2D C;  2JA6 H;  1EZ6 A;  2Y0S E;  2ZXP A;  2K4K A;  4LUZ A;  4LF9 L;  1CA6 A;  1RIP A;  1QG7 A;  2QIL A;  1EWH A;  2EDG A;  2K7V A;  1AEX A;  3M4Q A;  3HZX A;  3JAM E;  1JJC B;  4C3I H;  4J6H A;  3S2H H;  3A56 A;  1VQG A;  1SMY D;  3GV6 A;  4NXM L;  2WB1 E;  4K6D A;  1ASY A;  1MD2 D;  1UEB A;  2L55 A;  2F0L A;  4RAU C;  3VR3 A;  4RKB A;  1SYC A;  2DY7 A;  4ULL A;  3GTJ H;  3MFG A;  4N8F A;  2F0Q A;  2VB3 X;  1PHJ A;  1D7Q A;  3E5S A;  2IX1 A;  2SOB A;  4CKC A;  2A6H C;  1D2B A;  3GTQ B;  3EFX D;  2VB2 X;  5COY A;  5C4J B;  4DV6 Q;  1I5F A;  1K3R A;  2IPK D;  4X65 Q;  5CBA E;  2F0D A;  4F87 A;  1SRU A;  4G4K A;  3VYT A;  4NP5 A;  2B2T A;  2ATW A;  1DON A;  3H91 A;  4JG2 A;  1VQ4 A;  4FF2 A;  3FP9 A;  4X66 L;  1EWC A;  1STB A;  5M9O A;  1JMC A;  2G5D A;  1AE3 A;  1MBY A;  1T5X D;  2I5M X;  1T9H A;  3DEP A;  1YNX A;  4O1N A;  5K36 H;  4LFA L;  4NB3 A;  4DKA C;  1CKO A;  2EIF A;  3FKI G;  1BBU A;  2BE5 C;  1HNX L;  4FF3 A;  1JB7 A;  3IRB A;  1HTL D;  1IKL A;  5FLX c;  4PMB A;  5I6Y A;  4AH6 A;  3NXW A;  4H44 C;  1DM0 B;  1CM9 A;  4C2M H;  5EJW A;  3RZD H;  1MSG A;  2KHS A;  2C35 B;  1LTS D;  2VNU D;  1I4X A;  1F2M A;  3KLS A;  1EU4 A;  1UEA B;  5C0X H;  3M7G A;  2EJG C;  3CC7 A;  3JAM c;  1NR4 A;  4L5R C;  3KDF A;  2M9V A;  2PQA B;  4KMU C;  2A1A A;  4GLA C;  1ZKO A;  4JI1 L;  3DMU A;  2RF4 A;  2XRS D;  4ZUJ A;  2EYP A;  3L3O C;  2NVQ H;  4XXE A;  4A3C H;  4NDX A;  4IPH A;  3G6E A;  1X54 A;  4EGV A;  3ULL A;  3QJY A;  4CDE C;  4KHP Q;  1EOT A;  4GOP B;  5KNC A;  4LNQ A;  4DR1 L;  1EYG A;  4G7H C;  1TS3 A;  3OPO A;  2AQ2 B;  3V05 A;  3BZD B;  1EZ8 A;  1SYG A;  3M4P A;  4IUU A;  3K5O A;  2GVA A;  2EY2 A;  3KLR A;  3I4L A;  2ZXO A;  4B3S L;  2B2U C;  5GAE C;  5M3F B;  3CRL C;  1PTO B;  3J81 i;  2R7Z B;  1OXX K;  1TVX A;  3BDL A;  2K32 A;  2RDG A;  4YWK A;  3KBG A;  3PMF A;  1XMO Q;  4F88 A;  5IGB A;  3BS1 A;  4AQY L;  1YJN A;  1X3Q A;  5H1S E;  4JI5 Q;  3J80 c;  3RLO A;  4MTK A;  2ICI A;  3QO2 A;  1G2S A;  4OEM B;  2DGY A;  2RQX A;  2UUC L;  3C1E A;  1RCV D;  1NTG A;  2EXZ A;  1Q86 C;  1YBY A;  1G2T A;  3RMH A;  1H9S A;  4CHT B;  1SXT A;  3R2T A;  3OHX C;  2Z6B A;  1ICW A;  5DM7 3;  2JA6 B;  4ID6 A;  3TQY A;  2RDH A;  5EGT A;  1TY0 A;  2B2W C;  5FO8 B;  1N32 Q;  3HOY H;  1YNJ C;  2JP1 A;  4RMF A;  5GAG C;  3NSW A;  4V0B A;  5ELO A;  4DPG A;  2VS1 A;  2FFK B;  2PMZ B;  4HSV A;  3CCL A;  3S2H B;  1II3 A;  4R1J A;  3H3V H;  1STA A;  2O2L D;  3TZD A;  4KY5 A;  1V1O A;  1K0R A;  2AWN A;  3MAQ A;  1NMF A;  3UDX A;  5JPM C;  4DR3 Q;  3VDY A;  5CV6 A;  2E2I H;  1PH9 A;  3UDI A;  3GTJ B;  2QGQ A;  1R4P B;  4BBS B;  1SAP A;  1F2L A;  2MGS A;  1DXM A;  4K6L A;  4DR7 Q;  3J7A F;  4MZ9 A;  4DV0 Q;  3FEW X;  2RVL A;  4X6A H;  5C44 H;  3P7J A;  1JT8 A;  1WTP A;  3KFU A;  2IWH A;  5I4D A;  5EPJ A;  3PQI A;  1BDO A;  4C1N I;  2ZXR A;  3SK6 A;  3W1B A;  2D0O A;  2CWA A;  2F3I A;  3CCR A;  4ABN A;  2WII B;  3Q24 A;  5IIF A;  3C3L A;  4N9T A;  4JYA L;  1J5E Q;  1U4P A;  2HCC A;  4HCE A;  2RSO A;  3IAY A;  1A8V A;  3CRK C;  4B3R Q;  1I3Q B;  5EPK A;  2JA8 H;  3NBI A;  5IE8 A;  5FLX L;  1D5M C;  1BR9 A;  5TSS A;  4YCW A;  3F2D A;  4IAL A;  4IUV A;  3M7N A;  5IP7 G;  4XIG S;  2L1B A;  1PRT C;  1STE A;  2EOT A;  1M4V A;  2PNH A;  3H09 A;  1GUS A;  3J7Z C;  3A5U A;  2GN5 A;  2G9H D;  3SK4 A;  5FKA C;  1X9N A;  1IBL Q;  5M3F G;  5IGF A;  2PZW A;  5FOB B;  2R7Z G;  3JAM L;  3BJU A;  1KRS A;  3J81 E;  1HJP A;  3GTO B;  2F0J A;  3A8I E;  4XQJ A;  4R8N A;  1VDZ A;  3CME A;  2IW3 A;  4NMZ A;  4GN5 A;  1IW7 D;  4A3K H;  3F1Z A;  2X6G A;  3RZD B;  2UXB L;  4A4I A;  5JAV A;  5EBC A;  2L9H A;  2K5H A;  4JI8 Q;  1XX8 A;  1UE6 A;  1GXD C;  1Q8K A;  5C6A A;  1AW7 A;  4IO9 A;  5LL6 S;  4BXX G;  2A5H A;  3MWY W;  4BY7 H;  3MXU A;  3D4W A;  1L1O B;  1R9T H;  3U4Z A;  3NHH A;  3RZO B;  4JI3 Q;  3Q0A A;  3OMC A;  2ES2 A;  2MO1 A;  4RH6 A;  3C2P A;  1SYD A;  2JYO A;  3HOX H;  2JA6 G;  5I2X A;  1RKN A;  4GKK Q;  1WOC A;  4QIW B;  4MIU A;  3GTG H;  1O7Z A;  1NSN S;  1LT4 D;  4UY8 C;  1D5Z C;  5JVH 3;  1JJG A;  4XT1 B;  3S15 H;  2JN4 A;  1IYU A;  4F8M A;  2HIV A;  4EQP A;  3J80 L;  2F52 A;  4JBW A;  1CKN B;  3OW7 A;  2N8N A;  1BVS A;  1MJC A;  4JI2 L;  3RR5 A;  1F9P A;  2C9O A;  3KJP A;  4CKE A;  1WTX A;  4KI0 A;  2K33 A;  3CC4 A;  4BBS G;  2OXP A;  1XNR L;  5BR8 L;  3MEF A;  1ENA A;  1L2F A;  4IJH A;  2HIX A;  3KLS X;  3LNN A;  2I07 B;  2HCI A;  4MNO A;  3DEO A;  4K5V A;  3DWP A;  4KN7 C;  3H15 A;  2R7D A;  2VXW A;  2K50 A;  2DJG C;  3T4A C;  4OHJ A;  4A3E B;  3I70 A;  1Y69 U;  1B7Y B;  1E2W A;  1S5C D;  4PNY A;  1STH A;  3ZYY X;  4JI4 Q;  1W3S A;  1WJJ A;  2MP1 A;  4P2C B;  1DZ1 A;  2E2H B;  2NN6 I;  3PF4 A;  1VQ8 A;  1T5E A;  2PQE A;  3J81 c;  4KY7 A;  2R93 H;  3D4D A;  2B8G A;  1Q3L A;  3ITP A;  1LO5 D;  3KF8 B;  1KL9 A;  4R4I A;  3T1Y L;  1QZG A;  3HOY B;  1KAW A;  5DNF A;  1KRT A;  5L37 A;  4YY3 L;  4A3I B;  1XNQ Q;  1YEZ A;  1A2T A;  4QQB X;  1MHW C;  1EFW A;  3CPW A;  1S40 A;  3CMA A;  2NZ1 D;  3EN2 A;  4GNX A;  2WAC A;  1TXY A;  1CK1 A;  2JA5 H;  4DR2 Q;  5K36 G;  1PYS B;  4P74 A;  3OWF A;  2DUD A;  2KED A;  1IL8 A;  1DOM A;  3KF6 B;  3E0E A;  4JBM A;  3S1M H;  5CBE E;  3W2D A;  2NVX B;  2UU9 L;  5D14 A;  1NY4 A;  1YJW A;  5IP9 H;  4YCU A;  4IPD A;  1ESR A;  1CQV A;  1ILQ A;  1JOR A;  1RDP D;  3N6R A;  1DYQ A;  4HJ5 A;  5C44 B;  1VQF A;  1NJI C;  1S4Z A;  1SE2 A;  3VR6 A;  4K0K L;  5ELD A;  2BE5 D;  3UDG A;  4UDU C;  3HOW H;  2F1M A;  5LMN Q;  4RGN A;  5CGK A;  4LAA A;  1LV9 A;  4P73 A;  1SN8 A;  4HSP A;  1YHQ A;  5CC4 A;  2RCN A;  3S2D H;  1IBM L;  2F3V A;  2MUY A;  4BY1 B;  5C3E H;  4LF6 Q;  2I46 A;  1TS5 A;  5AJ3 L;  1ONL A;  3PIP A;  4DV5 Q;  1ILP A;  2IY5 B;  4A3C G;  3ER0 A;  4KKU A;  3FVQ A;  5J1Z A;  1EY7 A;  2Z6K A;  4DK6 C;  2JA8 B;  2JA7 H;  1X65 A;  2RSN A;  4DNT B;  4X3T A;  2ENB A;  5KGU A;  3Q8D A;  1HNZ L;  2JJQ A;  2YTX A;  3AU7 A;  1PV4 A;  3PUV A;  1HA5 A;  3QB3 A;  1K83 B;  2PO4 A;  3T56 B;  4RA8 A;  1KLG D;  1PFN A;  1VQ6 A;  2IX0 A;  4UHV A;  1BCP D;  2Z4H A;  4CKB A;  1QNU A;  4QUC A;  2UUB Q;  4A3K B;  1JWS D;  3RD4 A;  4A3M H;  2LXK A;  4Y7N B;  1EYD A;  2OWO A;  4A3G H;  5EQ0 A;  4UP9 A;  1BXT A;  4FYD A;  4LMQ D;  3NTH A;  1UNS A;  3M85 A;  3PV0 A;  1NE3 A;  4LFC L;  1HZC A;  2R6G A;  1WFQ A;  2HDM A;  1ET6 A;  1E7Z A;  4ZLT F;  3G7L A;  4PV1 C;  3S1N B;  3Q22 A;  4A3E G;  1QNK A;  3GQB A;  1KLU D;  1G6P A;  1KIX A;  3I55 A;  2CCZ A;  3HOX B;  1CSQ A;  2WAQ B;  3NPP A;  4QF4 A;  1QUQ B;  1HR0 Q;  3CCV A;  3GTG B;  3TME A;  3HOY G;  1D1K A;  4A3I G;  1B2T A;  2PZU A;  3B6Y A;  1LTA D;  3I2Z A;  1F2Z A;  5KYI A;  2E2J H;  3PGZ A;  1CTM A;  1PRT F;  1HH2 P;  4IJL A;  4M1U B;  4BWG B;  3M3Y H;  2J7Z A;  1YI2 A;  1CSP A;  4ILW A;  4KN4 C;  1G29 1;  1FL0 A;  3J80 i;  1LUZ A;  5JEA G;  2EYM A;  1HA6 A;  1SJE D;  3ZJY C;  3F8T A;  5EPL A;  2UXD Q;  3S14 H;  1DOL A;  1I94 Q;  4DAV A;  1QVG A;  4IN3 A;  4JCV E;  4A3F B;  2F4V Q;  3KBX A;  1F2Y A;  4WJ4 A;  4JOI C;  5C44 G;  2MQH A;  2D62 A;  3J81 L;  2VQE L;  4DR6 L;  4OIK A;  1LYL A;  2I0Q A;  1UAP A;  3ERQ A;  5IYB H;  4DR4 L;  1QE6 A;  3M9B A;  1CHP D;  1PVO A;  3CQZ H;  4BY1 G;  1NMG A;  3EJI A;  4LF8 Q;  3URY A;  1UE1 A;  3SVM A;  1G8Z D;  2LKV A;  3C1F A;  5KND A;  1KC8 C;  4QMG A;  2EYO A;  2F0W A;  4R4O A;  3HGB A;  1TS4 A;  2YYZ A;  2JA8 G;  2PZT A;  2CKZ B;  3W3A A;  4YWL A;  3SXH A;  3TDQ A;  1RTO A;  2NVY B;  1O7L A;  2NTS A;  3L7Z C;  5HY6 A;  1S5F D;  5FO9 B;  1UE5 A;  2AQ1 B;  1OXT A;  1H95 A;  2JA5 B;  4K5X A;  2VQF Q;  1XPR A;  3SDZ A;  1VMC A;  2FMM A;  2K6A A;  2QW7 A;  1KAA A;  1QIL A;  4QL5 A;  5G3L D;  3ULJ A;  2K52 A;  4J8Q A;  4DK3 C;  3FHW A;  3S1M B;  3CF5 A;  1KQS A;  3U9O A;  2YTV A;  1ASZ A;  4JI6 L;  2SNS A;  4AYB E;  1G6Z A;  1SEB D;  2V4D A;  2XWJ B;  5E4X A;  2OQK A;  1WTR A;  4A3K G;  4DXF A;  5C4X H;  1YIT A;  2N49 A;  3NWS A;  3F2C A;  3CCS A;  2PPB C;  3OTO Q;  2LMC B;  2Z9H A;  1VQI A;  1TWG H;  1QWY A;  5D65 A;  4XYO A;  1Y8O B;  3D6C A;  4YHH L;  1KDA A;  3U4V A;  3GO5 A;  1I6H H;  1PH7 A;  3DWA A;  1YJ9 A;  1XMQ Q;  4DV4 Q;  3MXN A;  5C5L A;  3S2D B;  1VCI A;  4OGQ C;  4RHR A;  3A7L A;  3TZU A;  2NYZ D;  3RN5 A;  4UP8 A;  4KV6 A;  1E3P A;  4L63 B;  1B8A A;  3HOX G;  1PFB A;  2Q8I B;  4DUY Q;  4K5W A;  2WAQ G;  2JA7 B;  3MC0 B;  2B2V A;  1IYV A;  2A6E C;  4APV A;  4LUV A;  1HQM C;  3G4S A;  4A3J H;  1WD1 A;  1I4R A;  3MEH A;  4NXN L;  2Z1C A;  3C46 A;  2JEB I;  4PQX A;  4GKJ Q;  2QA4 A;  2JK8 A;  5ISR A;  1JC7 A;  3J7Y W;  2Z8L A;  3SE0 A;  4HJ9 A;  2WKD A;  3K0Y A;  4JOI A;  3DM1 A;  1LT6 D;  3GTK B;  4IUN A;  3J80 E;  4YWM A;  3NQT A;  4OWT B;  3GV3 A;  1X6O A;  1PZI D;  1HTP A;  3N52 A;  2VY3 A;  2WAQ E;  4A3F G;  4R9W A;  5COR A;  4A3M B;  1V9P A;  3V96 A;  1Q1E A;  3VYU A;  3WWV A;  1FJG L;  3CPF A;  3HOU H;  3SGI A;  1BUV T;  1JE4 A;  1H9S B;  2WIN B;  3NUC A;  3J7A V;  1D8L A;  1U4L A;  2PW7 A;  1EQQ A;  4LFB Q;  4IQZ A;  1IBK Q;  1SYB A;  5M5W H;  4OO1 I;  1QJO A;  2K04 A;  5EKK A;  2ID0 A;  1YNN C;  1WCM H;  2F03 A;  5EKL A;  1N36 L;  1U9R A;  3OW2 A;  1YVC A;  3QWN A;  1B44 D;  1UUP A;  3OIP A;  3OIQ A;  3KYH C;  1GUW A;  1PYW D;  2HD3 A;  1VQH A;  4C3J B;  5LMU Q;  4IFD I;  1LT5 D;  4DV2 L;  1EY8 A;  4DV1 L;  5C5M A;  2CW0 C;  1WVL A;  2L15 A;  3A55 A;  4FF4 A;  2E2J B;  2JA5 G;  3NBH B;  1SE4 A;  3VA5 A;  2KCN A;  2UXC L;  1P8L A;  1WI5 A;  3QOJ A;  3S14 B;  1VQ5 A;  3K8A A;  3TBI B;  1Y1W H;  3M4O B;  5IP9 G;  4A93 H;  4LUO A;  4GZY C;  1JJ2 A;  1LTR D;  2CHB D;  4TQU S;  4GOP C;  1HQR D;  2OEO A;  4ZCK A;  5D3D A;  3BZC A;  2ZT9 C;  5FLM H;  5ELE A;  2LFN A;  1BCP B;  2PI2 E;  5IYC H;  3H0G H;  4JV5 Q;  3R2I A;  3PCO B;  1MKH A;  2YTY A;  1ICF B;  3CQZ B;  4GN3 B;  2N3S A;  1LAB A;  3K81 C;  3CCU A;  5DM6 3;  1PTO C;  2A69 D;  2OTJ A;  3PO3 H;  4BBR H;  5CV8 A;  2G9D A;  2ASB A;  1SND A;  2L11 A;  1M90 C;  2LSS A;  2JA7 G;  3WOF A;  1L0W A;  3WDN A;  3AEV A;  2MHV A;  2KCM A;  1SMX A;  4A76 A;  1B70 B;  1X3G A;  4HIM A;  1GM5 A;  1BF4 A;  5C4H A;  4TKO B;  1EQR A;  5GAH C;  4Q0F A;  2I5L X;  4DV7 L;  1JWU D;  1IL2 A;  1XWE A;  3BU2 A;  4L5S A;  3T16 A;  3VR5 A;  1SE3 A;  4DV6 L;  3TS0 A;  3CAM A;  4ZK9 B;  2TSS A;  1ZYR D;  2WKC A;  2N78 A;  2NZO A;  5KYL A;  4X65 L;  3OWE B;  2QKI C;  1X3F A;  1A0I A;  5C4X B;  3BZK A;  1BNZ A;  2NWG A;  4C3I B;  4A3M G;  2H5X A;  2O4X A;  1TWG B;  4DV3 Q;  5A35 A;  2AUJ D;  1VQ9 A;  3NEM A;  4UPA A;  1EU3 A;  2VW9 A;  1TS2 A;  5T1G A;  3D4R A;  2UUA Q;  3HRZ C;  1I6H B;  3G6J B;  1QZH A;  2CQO A;  5HGQ A;  1GJX A;  2JEA I;  4LF4 Q;  2R61 A;  3MHB A;  5FK9 C;  3VYR A;  1HUM A;  2IX3 A;  4R4T A;  3A7A B;  4WJ3 M;  1CZW A;  4IZ8 A;  1Z6H A;  4A75 A;  3ULP A;  1PA6 A;  1PYB A;  1J9O A;  4OX9 Q;  5E4W C;  1N33 Q;  1EUJ A;  1IYJ B;  2DNC A;  4KKS A;  2PQA A;  4A3J B;  3QG1 A;  4C3J G;  1X3E A;  1AN8 A;  3LWU A;  3KUP A;  1C7Y A;  2A68 D;  1LTG D;  2CH4 W;  3PIO A;  3PUW A;  1K8G A;  1X3P A;  1O78 A;  2Q8T A;  4OO1 G;  1I4P A;  1IKM A;  4DNI A;  5C3W A;  2ZTE A;  2B2U A;  2OF1 A;  5DEH A;  1J8I A;  1XYI A;  5I2Y A;  1GUT A;  1HFG A;  1Y8N B;  5C0X I;  2VZA A;  1HRJ A;  1SRO A;  1TWF H;  3BDO A;  4IFD G;  2ZJQ A;  1NCV A;  1G91 A;  2K28 A;  4PZ8 A;  3VA7 A;  4HJ8 A;  3V2T A;  3SK8 A;  3ERO A;  2QEJ C;  3CCM A;  4ALP A;  4KHP L;  4B9W A;  5IYB G;  1EY0 A;  5M5W B;  3SHL A;  3AQQ A;  4RGT A;  1WCM B;  4CDC C;  1XPO A;  4UP7 A;  3L2P A;  1A63 A;  2Q2U A;  3S17 H;  4C2M B;  3STB D;  1BBX C;  4P72 A;  4JI0 Q;  5I9P A;  1EYA A;  2TMP A;  4PZ7 A;  1TII D;  4GN4 B;  2MPM A;  4GNX B;  4ZQ3 A;  3I4O A;  4CJ0 B;  4L5T A;  4DK1 A;  2MNA A;  1SMY C;  2EXD A;  1VQN A;  4QJF A;  4TVA B;  3BYT B;  1ENF A;  4IPC A;  2IJ0 A;  3HOZ H;  4FF1 A;  4KLK A;  4DAY A;  2F0F A;  2N55 A;  3T1H Q;  3UE1 A;  2EY6 A;  2B2W A;  1XMO L;  1IBM Q;  1PZK D;  2NVQ B;  5AJ3 Q;  5CV4 A;  4JI5 L;  2EZV A;  4POF A;  1KDC A;  4QB4 A;  4GS3 A;  1L1O C;  3J7A 5;  1DOK A;  1A3U A;  3I90 A;  1Y1W B;  2F0M A;  1PFS A;  5EAY A;  2NVT H;  1E0B A;  3K0X A;  5K5P A;  1K3B C;  5J3B A;  3TP8 A;  1HNZ Q;  1HNW Q;  5C4X G;  4PG3 A;  2XNA C;  4IUP A;  1CT1 D;  1VQJ A;  3ONA B;  4C3I G;  4OL7 A;  4DR5 Q;  2HHH Q;  1EIH A;  2NZH A;  1EQT A;  2AHO B;  4QGU A;  1LM0 A;  3AB9 A;  3H0G B;  4B3M L;  1H9R A;  2EYF A;  1N32 L;  3RLN A;  3EA6 A;  2YV5 A;  1ZEQ X;  4F7X A;  4UAI A;  1OTC A;  1OXV A;  5M3M H;  1PH4 A;  4HIO A;  3PO3 B;  4BBR B;  3UI2 A;  1EEI D;  1SDF A;  5E7N A;  2EYJ A;  1WD0 A;  4KTA A;  2RHS B;  2AWO A;  4OEL B;  4A3J G;  4DR3 L;  1QVF A;  5C3X A;  2PMZ E;  3H3V I;  4RGM A;  2ZJR A;  1GUG A;  1B3A A;  1K9M C;  5IOD A;  2WV6 D;  1S3O A;  3S1Q H;  3EQL C;  2A6H D;  4U67 3;  4DR7 L;  4DV0 L;  3LWE A;  2E5L Q;  4V19 0;  5EBD A;  4J1M A;  3S16 H;  3K5L A;  4MHE A;  2Q2T A;  1JIC A;  2EPB A;  1VQP A;  2A19 A;  4KD3 A;  4KY6 A;  5IWA Q;  1CHQ D;  4WOR A;  3GTL H;  4DA2 A;  3EIV A;  3E9I A;  4FXK C;  3I91 A;  2HDL A;  3S9W A;  4KJN A;  1HCZ A;  1J5E L;  4IUT A;  1PH6 A;  3CP0 A;  3MA2 B;  5LMN W;  5IYD H;  2NB0 A;  4EQ5 A;  4B3R L;  2HUG A;  5J22 A;  1CUK A;  1YHB A;  1GD7 A;  1VMP A;  4R8I A;  2E2I B;  3H3V C;  5FJ8 H;  3CC2 A;  1WCM G;  4RCO A;  3FPU B;  1I4H A;  2VUM H;  1PTO F;  4JPB W;  3HKZ B;  2EJM A;  1OXS C;  2C5C A;  2IL8 A;  2KHJ A;  5C0X G;  3PSI A;  1IBL L;  4LF5 Q;  4X62 Q;  4B3T Q;  1QCB D;  4DR4 Q;  1K0S A;  1RL2 A;  4A3D H;  1E2V A;  4I7Z C;  3W1G A;  4LF7 Q;  3RUZ A;  2ZM6 Q;  3BDC A;  3CCJ A;  2K5Q A;  1X55 A;  4BS9 A;  4A3L H;  4DUZ Q;  5I6W A;  2XWB B;  3H6M A;  4Y52 H;  4JI8 L;  2BDO A;  1KNA A;  4DFA A;  2F0S A;  1EY6 A;  2KEN A;  1KD1 C;  1YZ6 A;  2FMC A;  1SLJ A;  4X64 Q;  1Y1W G;  3NEL A;  4YIJ A;  3A0J A;  2EYL A; 
#chains in the Genus database with same CATH homology
 2JE6 I;  1LLR D;  2Y0S B;  2GA4 B;  2RA4 A;  5F2D A;  4O42 A;  4N9P A;  4KJO A;  1WTO A;  1AP0 A;  1Q90 A;  5CV9 A;  3PIP 3;  3CU7 A;  1EL0 A;  3P75 A;  2F0V A;  1SNC A;  4BA1 I;  2WB1 B;  1PZJ D;  2MJ8 A;  3S17 B;  5T1I A;  4L6T B;  2B2Y C;  4WRD A;  4DGZ A;  1QB5 D;  3TSS A;  3IKJ A;  5JEA J;  4EQN A;  4I65 A;  3QOL A;  4Q5V A;  3HOZ B;  4BY7 B;  1I4Q A;  2CVR A;  3D6W A;  3MTS A;  2EJF C;  1R9T B;  1GUN A;  3F2U A;  4HAE A;  3MZ5 A;  1D5X C;  3O13 A;  4FXG C;  1RJT A;  3EVQ A;  1F9S A;  1BO0 A;  1HUN A;  4RFB A;  4DXG A;  5A2Q E;  3S15 B;  1TKW B;  3ND8 A;  1MI2 A;  4H7B A;  1PLF A;  1NR2 A;  3FDT A;  4H13 C;  2ICE C;  1YNJ D;  4PMW A;  5M3M B;  4B9X A;  4FVM A;  5CMD A;  3A8J E;  1XTC D;  1S5E D;  2EY1 A;  3HG9 A;  1JOO A;  4OIJ A;  2WP8 J;  4LK1 C;  1STN A;  1BOS A;  3WOE A;  3K59 A;  3R8B A;  4X3U A;  2B2T C;  2F0O A;  2FHT A;  4MN3 A;  4U68 A;  3S1Q B;  1IW7 C;  2R93 B;  1Q1B A;  1SBB B;  2L12 A;  2BOS A;  4WJW A;  4BA2 I;  3BVZ A;  3K57 A;  2BDN A;  5JOB A;  3K5N A;  2M00 A;  5HGT A;  3DXJ C;  4L8J A;  4TSS A;  4RGO S;  5JPN C;  3OSO A;  1PRT D;  2BCO A;  2EVB A;  5KNB A;  2VUM B;  2D2C C;  1CQF A;  2H1E A;  2PYK A;  5IGE A;  2F0T A;  2F0U A;  3HOW B;  1JQY D;  1NAP A;  3LX0 A;  5IGG A;  1CI3 M;  1TU2 B;  2F0P A;  1KAB A;  4A3D B;  4ZKC B;  5C3E B;  2A73 B;  1S5B D;  1V1P A;  4HTH A;  2F0E A;  1GHK A;  1V8Q A;  3PUZ A;  4ZRZ A;  1MGS A;  1SSO A;  1EQV A;  2DN8 A;  3CKI B;  1B53 A;  3I3C A;  3RLF A;  1LTI D;  2AQ3 B;  5ELF A;  5BN5 A;  1JOK A;  5I9O A;  3NTK A;  5EKI A;  4X3S A;  3NQI A;  2E75 C;  5JVG 3;  1Q12 A;  1SYF A;  2B8F A;  4NKL A;  3VYS A;  1O80 A;  2B63 B;  1SYE A;  4A3G B;  1VF7 A;  4G7Z C;  5IT9 E;  2EE1 A;  1DCZ A;  1TWH B;  1EY4 A;  2KEE A;  2RBM A;  1Z47 A;  4DF7 A;  5CYU A;  3FMC A;  2K5W A;  1LT3 D;  3P1H A;  3T53 B;  3M3Y B;  3DWQ A;  5FO7 B;  3HP3 A;  3NWT A;  1C8C A;  2YU9 B;  2OT2 A;  1FYC A;  2NUC A;  1GUO A;  3FPP A;  3MVV A;  2NBF A;  2R3Z A;  2KEC A;  2J0T D;  1E2Z A;  2RKS A;  3SEB A;  4CJ1 B;  1SFO B;  5E3F A;  3NTI A;  2XRQ D;  4C56 C;  2M2L A;  4KKT A;  2QDB A;  5J39 A;  1K8O A;  2CQA A;  3NP8 A;  2QCP X;  4KHV A;  2K5D A;  1BCP C;  2Q8R E;  3HEJ A;  4NW2 A;  3GD7 A;  1A6X A;  2XN9 C;  2E76 C;  5ELB A;  4XQN A;  1ET9 A;  4RCN A;  2KA7 A;  2XIW A;  4PMC A;  1SNM A;  1JB3 A;  5A2Q L;  2J4X A;  3R93 A;  1FR3 A;  2KVM A;  3IFD A;  1A3T A;  1JR0 D;  1NUC A;  5BN4 A;  1I50 B;  3VR4 A;  4K2L A;  1L0X B;  1B1Z A;  1GOZ A;  4XT3 B;  3SK5 A;  3TP7 A;  5D3I B;  1ZXT A;  2X69 A;  1IHZ A;  1KNE A;  1X32 A;  1FD7 D;  4B08 A;  4IFD J;  4TRD A;  2BA1 A;  3OMG A;  3PUX A;  5JEA H;  1F9R A;  3T51 B;  1V43 A;  1PMR A;  2AUK A;  2NN6 H;  3NBH A;  1FNV A;  1TQO A;  1R4Q B;  4KK7 A;  1RTN A;  1C4Q A;  1B50 A;  1Z7T A;  1CFM A;  2LS0 1;  4S3S A;  5IGD A;  3IFT A;  1M8A A;  4LJZ C;  5KIX A;  1A15 A;  3M4Y A;  3IL8 A;  2D9U A;  4FNF A;  1I4G A;  4DN4 M;  4RWS C;  1FNU A;  3HOU B;  1S5D D;  2SEB D;  3PIO 3;  1LTB D;  1PRT B;  1L0Y B;  5LL6 X;  2K1B A;  4C3H B;  3K6O A;  3A8K E;  1XXG A;  3P20 A;  3VR2 A;  2L4N A;  1STY A;  4G57 A;  4X3K A;  3BYY B;  2XVS A;  4DNR B;  1U4M A;  1Y1V B;  3KK7 A;  2Z4I A;  2R92 B;  4IUR A;  3GTP B;  5LHY 1;  5CV7 A;  5CV5 A;  1PDQ A;  3TP5 A;  4FP5 D;  4C1N K;  5M5Y B;  2PNR C;  3L9A X;  4XQQ A;  2DY8 A;  4A93 B;  2F0K A;  4JK1 C;  3X3M A;  3R3O A;  5KRU A;  4DU9 A;  4DK0 A;  3E0J A;  1ENC A;  3HS0 C;  1B4O A;  4HCS A;  3PO2 B;  2JSO A;  1H9J A;  4KHZ A;  3GTM B;  2RDF A;  4HMI A;  1TY2 A;  1TWA B;  2D5D A;  5DAU A;  4G7O C;  3X3N A;  2KCC A;  3Q6S A;  2PW5 A;  3ND9 A;  2KQ3 A;  3DHQ A;  4K8I A;  4XDX A;  3DUZ A;  5IT9 L;  1B9M A;  4DAP A;  4KD4 A;  3E6Z X;  1D1I A;  3I72 A;  1FNW A;  3I4N B;  4A3B B;  1HFN A;  5KEE A;  4ZYS A;  3T13 A;  1EFI D;  2X6L A;  1FGB D;  5ELC A;  1DJR D;  1TT2 A;  1D6E C;  1F9Q A;  1ML0 D;  1RD9 D;  2A6E D;  2H4O A;  2O5I C;  3CHB D;  2F0N A;  5C0X J;  3U9S A;  2K05 A;  2KOL A;  1SNP A;  5AFW A;  3BG3 A;  3K58 A;  4CJ2 C;  3QIA A;  1EIG A;  3BVG A;  1SJH D;  2FIN B;  4EQO A;  2DNE A;  1PXU A;  3TN2 A;  2PCF B;  4HR7 B;  2L5T A;  3MXP A;  2F0G A;  5BN3 A;  4E6I A;  3BVM A;  1SNO A;  4C3H G;  3A54 A;  1BCP F;  4Z9C B;  1RHP A;  3MXG A;  2SDF A;  5IOC A;  2QF7 A;  1JWM D;  3NE5 B;  1EY5 A;  4ZAI A;  3TP6 A;  1YNN D;  1H9K A;  2XSC A;  2F0H A;  3FRP B;  5C4Z A;  4K2K A;  2HQE A;  5CR3 A;  4H0L C;  2A69 C;  1KTK A;  1VF5 C;  2NTT A;  3S1R B;  3NK9 A;  1SNQ A;  4XYQ A;  3D31 A;  2CW0 D;  1TWF B;  1A3V A;  1H9M A;  3I4M B;  1C48 A;  1AZQ A;  4AYB B;  1BQQ T;  3H94 A;  1DD2 A;  2JXM B;  3HOV B;  1HHV A;  1ZYR C;  4EVO A;  4K14 A;  2FJ2 A;  1EY9 A;  2E74 C;  1CZG A;  1W6J A;  3K7A B;  1U4R A;  1CA5 A;  1JOQ A;  1TR5 A;  3Q23 A;  1EEF D;  4IUQ A;  2SNM A;  1GHJ A;  1ESF A;  1PFM A;  1W6K A;  1RF2 D;  1PTO D;  2K01 A;  1KDB A;  4QUF A;  3KF8 A;  4FO2 A;  2EYH A;  5JJZ A;  3I73 A;  2NVT B;  1OXU A;  2N88 A;  1K8M A;  2K03 A;  2A68 C;  3OOC A;  1I6V C;  1JCK B;  4HN7 A;  5NUC A;  3I8Z A;  3PUY A;  1V1P B;  1WTV A;  2L0C A;  3D8G A;  3MFY A;  5G3L F;  2A74 C;  1Y8P B;  2F0I A;  4ZKB B;  1HPC A;  2IT1 A;  2O5J C;  4WFN 3;  4CGY B;  5E1F A;  2B2V C;  4XTC S;  4CBV A;  4OO1 H;  1HXY D;  4FXD A;  1AFP A;  1A2U A;  4RKL A;  1STG A;  1ROD A;  4HED A;  2LY7 A;  2NN6 G;  4M8A A;  3D3R A;  4K8J A;  1B9N A;  1Q8I A;  1QOH A;  1WTW A;  4HMJ A;  4IFD H;  3S16 B;  2F3W A;  3K5M A;  3FKI B;  3GTL B;  3GP7 A;  2F4I A;  2EY5 A;  1PTO H;  4ZUI A;  1MSH A;  2KUM A;  1O7Y A;  3SR1 A;  5HUR A;  5M5X B;  1OO9 B;  4ME5 A;  2B2Y A;  1LAC A;  4QCL A;  3AMU A;  2B39 A;  2BA0 A;  1LTT D;  4RHS A;  1AZP A;  4ODG A;  5IGC A;  1EYC A;  2KJX A;  5FLX E;  1TWC B;  1F77 A;  1WTQ A;  2E2D C;  1EZ6 A;  2ZXP A;  1CA6 A;  1QG7 A;  2QIL A;  1EWH A;  2EDG A;  2K7V A;  1AEX A;  3HZX A;  3JAM E;  4J6H A;  3A56 A;  1SMY D;  3GV6 A;  4K6D A;  3VR3 A;  1MD2 D;  4RAU C;  2L55 A;  2F0L A;  4RKB A;  1SYC A;  2DY7 A;  4ULL A;  3MFG A;  2F0Q A;  2VB3 X;  3E5S A;  2IX1 A;  2SOB A;  4CKC A;  2A6H C;  1D2B A;  3GTQ B;  3EFX D;  2VB2 X;  5COY A;  5C4J B;  2IPK D;  5CBA E;  2F0D A;  4F87 A;  4G4K A;  3VYT A;  4NP5 A;  2B2T A;  1DON A;  3H91 A;  4FF2 A;  1EWC A;  1STB A;  5M9O A;  1MBY A;  1T5X D;  3DEP A;  4O1N A;  5K36 H;  2BE5 C;  4FF3 A;  1HTL D;  1IKL A;  4PMB A;  5I6Y A;  3NXW A;  4H44 C;  1DM0 B;  1CM9 A;  5EJW A;  1MSG A;  2KHS A;  1LTS D;  2VNU D;  1I4X A;  1F2M A;  3KLS A;  1EU4 A;  1UEA B;  5C0X H;  3M7G A;  2EJG C;  1NR4 A;  2M9V A;  4KMU C;  1ZKO A;  3DMU A;  2XRS D;  4ZUJ A;  2EYP A;  3L3O C;  4XXE A;  4NDX A;  4EGV A;  3QJY A;  1EOT A;  5KNC A;  4G7H C;  1TS3 A;  3OPO A;  2AQ2 B;  3V05 A;  3BZD B;  1EZ8 A;  1SYG A;  4IUU A;  3K5O A;  2EY2 A;  3KLR A;  3I4L A;  2ZXO A;  2B2U C;  5M3F B;  3CRL C;  1PTO B;  2R7Z B;  1OXX K;  1TVX A;  3BDL A;  2K32 A;  2RDG A;  3KBG A;  3PMF A;  4F88 A;  5IGB A;  3BS1 A;  1X3Q A;  2ICI A;  3QO2 A;  1G2S A;  2RQX A;  3C1E A;  1RCV D;  2EXZ A;  1G2T A;  3RMH A;  1H9S A;  4CHT B;  1SXT A;  3R2T A;  3OHX C;  1ICW A;  5DM7 3;  2JA6 B;  4ID6 A;  2RDH A;  5EGT A;  1TY0 A;  2B2W C;  5FO8 B;  1YNJ C;  2JP1 A;  3NSW A;  4V0B A;  2FFK B;  2PMZ B;  4HSV A;  3S2H B;  1II3 A;  1STA A;  2O2L D;  3TZD A;  4KY5 A;  1V1O A;  2AWN A;  3MAQ A;  5JPM C;  5CV6 A;  3GTJ B;  1R4P B;  4BBS B;  1SAP A;  1F2L A;  2MGS A;  1DXM A;  4K6L A;  3J7A F;  3FEW X;  2RVL A;  3P7J A;  1WTP A;  2IWH A;  5I4D A;  5EPJ A;  1BDO A;  4C1N I;  2ZXR A;  3SK6 A;  4ABN A;  2WII B;  3Q24 A;  5IIF A;  3C3L A;  4N9T A;  1U4P A;  2HCC A;  4HCE A;  2RSO A;  3IAY A;  3CRK C;  1I3Q B;  5EPK A;  3NBI A;  5FLX L;  1D5M C;  1BR9 A;  5TSS A;  4IAL A;  4IUV A;  3M7N A;  4XIG S;  2L1B A;  1PRT C;  1STE A;  2EOT A;  1M4V A;  3H09 A;  1GUS A;  2G9H D;  3SK4 A;  5FKA C;  5IGF A;  2PZW A;  5FOB B;  3JAM L;  3J81 E;  3GTO B;  2F0J A;  3A8I E;  4XQJ A;  4R8N A;  1VDZ A;  2IW3 A;  4NMZ A;  1IW7 D;  3RZD B;  2X6G A;  5JAV A;  5EBC A;  2L9H A;  1XX8 A;  1GXD C;  5C6A A;  1AW7 A;  5LL6 S;  2A5H A;  3MWY W;  3MXU A;  3D4W A;  3NHH A;  3RZO B;  3Q0A A;  3OMC A;  4RH6 A;  3C2P A;  1SYD A;  2JYO A;  5I2X A;  1RKN A;  4QIW B;  4MIU A;  1O7Z A;  1NSN S;  1LT4 D;  1D5Z C;  5JVH 3;  4XT1 B;  1IYU A;  4F8M A;  4EQP A;  3J80 L;  4JBW A;  3OW7 A;  1F9P A;  2C9O A;  4CKE A;  1WTX A;  4KI0 A;  2K33 A;  2OXP A;  1ENA A;  3KLS X;  3LNN A;  2I07 B;  2HCI A;  3DEO A;  4K5V A;  3DWP A;  4KN7 C;  2VXW A;  3T4A C;  4OHJ A;  4A3E B;  3I70 A;  1Y69 U;  1E2W A;  1S5C D;  4PNY A;  3ZYY X;  1STH A;  4P2C B;  2MP1 A;  1DZ1 A;  2E2H B;  2NN6 I;  1T5E A;  2PQE A;  4KY7 A;  3D4D A;  2B8G A;  1Q3L A;  3ITP A;  1LO5 D;  3HOY B;  5DNF A;  4A3I B;  1A2T A;  2NZ1 D;  2WAC A;  1CK1 A;  5K36 G;  3OWF A;  2KED A;  1IL8 A;  1DOM A;  5CBE E;  3W2D A;  2NVX B;  5D14 A;  1ESR A;  1CQV A;  1ILQ A;  1JOR A;  1RDP D;  3N6R A;  1DYQ A;  5C44 B;  1S4Z A;  1SE2 A;  3VR6 A;  5ELD A;  2BE5 D;  4UDU C;  2F1M A;  4RGN A;  5CGK A;  4LAA A;  1LV9 A;  4HSP A;  5CC4 A;  2F3V A;  2MUY A;  4BY1 B;  2I46 A;  1TS5 A;  1ONL A;  1ILP A;  4KKU A;  3FVQ A;  5J1Z A;  1EY7 A;  2JA8 B;  2RSN A;  4DNT B;  4X3T A;  2ENB A;  5KGU A;  3AU7 A;  3PUV A;  1HA5 A;  3QB3 A;  1K83 B;  2PO4 A;  3T56 B;  4RA8 A;  1KLG D;  1PFN A;  2IX0 A;  1BCP D;  2Z4H A;  4CKB A;  1QNU A;  4QUC A;  4A3K B;  1JWS D;  3RD4 A;  4Y7N B;  1EYD A;  5EQ0 A;  1BXT A;  4FYD A;  4LMQ D;  3NTH A;  1UNS A;  3M85 A;  3PV0 A;  2R6G A;  2HDM A;  1ET6 A;  4ZLT F;  3G7L A;  4PV1 C;  3S1N B;  3Q22 A;  1QNK A;  3GQB A;  1KLU D;  3HOX B;  2WAQ B;  3NPP A;  4QF4 A;  3GTG B;  3TME A;  1D1K A;  1B2T A;  2PZU A;  1LTA D;  1F2Z A;  5KYI A;  1CTM A;  1PRT F;  4M1U B;  4BWG B;  2J7Z A;  4ILW A;  4KN4 C;  1G29 1;  5JEA G;  1HA6 A;  2EYM A;  1SJE D;  5EPL A;  1DOL A;  4DAV A;  4IN3 A;  4A3F B;  3KBX A;  1F2Y A;  2D62 A;  3J81 L;  4OIK A;  1UAP A;  3ERQ A;  1QE6 A;  1CHP D;  3EJI A;  3URY A;  3SVM A;  1G8Z D;  2LKV A;  3C1F A;  5KND A;  4QMG A;  2EYO A;  2F0W A;  3HGB A;  1TS4 A;  2YYZ A;  2PZT A;  3W3A A;  3SXH A;  3TDQ A;  1RTO A;  2NVY B;  1O7L A;  2NTS A;  3L7Z C;  1S5F D;  5FO9 B;  2AQ1 B;  1OXT A;  2JA5 B;  4K5X A;  3SDZ A;  1VMC A;  5G3L D;  2FMM A;  2K6A A;  1KAA A;  1QIL A;  4J8Q A;  3S1M B;  3U9O A;  2SNS A;  1G6Z A;  1SEB D;  2V4D A;  2XWJ B;  5E4X A;  1WTR A;  4DXF A;  3NWS A;  2PPB C;  2LMC B;  1QWY A;  5D65 A;  4XYO A;  1Y8O B;  3D6C A;  1KDA A;  3GO5 A;  3DWA A;  3MXN A;  5C5L A;  3S2D B;  1VCI A;  4OGQ C;  4RHR A;  3A7L A;  3TZU A;  2NYZ D;  4KV6 A;  4L63 B;  1PFB A;  2Q8I B;  4K5W A;  1IYV A;  2JA7 B;  3MC0 B;  2B2V A;  2A6E C;  1HQM C;  1WD1 A;  1I4R A;  3MEH A;  2Z1C A;  3C46 A;  2JEB I;  4PQX A;  5ISR A;  1JC7 A;  3J7Y W;  2Z8L A;  3SE0 A;  2WKD A;  3K0Y A;  3DM1 A;  1LT6 D;  3GTK B;  4IUN A;  3J80 E;  3NQT A;  3GV3 A;  1PZI D;  1HTP A;  3N52 A;  4R9W A;  5COR A;  4A3M B;  3V96 A;  1Q1E A;  3VYU A;  1BUV T;  1JE4 A;  1H9S B;  2WIN B;  3NUC A;  3J7A V;  2PW7 A;  1U4L A;  4IQZ A;  1SYB A;  4OO1 I;  1QJO A;  2K04 A;  5EKK A;  2ID0 A;  1YNN C;  2F03 A;  5EKL A;  1U9R A;  3QWN A;  1B44 D;  1UUP A;  3OIP A;  3OIQ A;  1GUW A;  1PYW D;  4C3J B;  4IFD I;  1LT5 D;  1EY8 A;  5C5M A;  2CW0 C;  1WVL A;  3A55 A;  4FF4 A;  2E2J B;  1SE4 A;  3VA5 A;  2KCN A;  3QOJ A;  3S14 B;  3TBI B;  3M4O B;  4GZY C;  1LTR D;  2CHB D;  4TQU S;  1HQR D;  2OEO A;  5D3D A;  2ZT9 C;  5ELE A;  2LFN A;  1BCP B;  3R2I A;  3CQZ B;  1LAB A;  5DM6 3;  1PTO C;  2A69 D;  5CV8 A;  2G9D A;  1SND A;  2L11 A;  3WOF A;  3WDN A;  2MHV A;  1BF4 A;  5C4H A;  4TKO B;  4Q0F A;  1JWU D;  1XWE A;  3T16 A;  3VR5 A;  1SE3 A;  4ZK9 B;  2TSS A;  1ZYR D;  2WKC A;  5KYL A;  3OWE B;  2QKI C;  5C4X B;  1BNZ A;  2NWG A;  4C3I B;  2O4X A;  1TWG B;  5A35 A;  2AUJ D;  1EU3 A;  5T1G A;  1TS2 A;  3D4R A;  3HRZ C;  1I6H B;  3G6J B;  1GJX A;  2JEA I;  2R61 A;  3MHB A;  5FK9 C;  3VYR A;  1HUM A;  2IX3 A;  3A7A B;  1CZW A;  4IZ8 A;  1Z6H A;  1J9O A;  5E4W C;  2DNC A;  4KKS A;  4A3J B;  3QG1 A;  4C3J G;  1AN8 A;  3LWU A;  3KUP A;  2A68 D;  1LTG D;  3PUW A;  1X3P A;  1O78 A;  2Q8T A;  4OO1 G;  1I4P A;  1IKM A;  5C3W A;  2B2U A;  2OF1 A;  5DEH A;  1J8I A;  1XYI A;  5I2Y A;  1GUT A;  1HFG A;  1Y8N B;  5C0X I;  1HRJ A;  3BDO A;  4IFD G;  1NCV A;  1G91 A;  2K28 A;  3VA7 A;  3V2T A;  3SK8 A;  3ERO A;  2QEJ C;  4B9W A;  1EY0 A;  5M5W B;  3SHL A;  4RGT A;  1WCM B;  4C2M B;  1BBX C;  5I9P A;  1EYA A;  2TMP A;  1TII D;  2MPM A;  4ZQ3 A;  4CJ0 B;  4DK1 A;  1SMY C;  3BYT B;  1ENF A;  2IJ0 A;  4FF1 A;  4DAY A;  2F0F A;  2N55 A;  2EY6 A;  2B2W A;  1PZK D;  2NVQ B;  5CV4 A;  2EZV A;  1KDC A;  4QB4 A;  1DOK A;  1A3U A;  3I90 A;  1Y1W B;  2F0M A;  1E0B A;  5K5P A;  3TP8 A;  2XNA C;  4IUP A;  1CT1 D;  4C3I G;  3ONA B;  4OL7 A;  1EIH A;  1EQT A;  3AB9 A;  3H0G B;  1H9R A;  2EYF A;  3EA6 A;  4F7X A;  1ZEQ X;  4UAI A;  1OXV A;  3PO3 B;  4BBR B;  3UI2 A;  1EEI D;  1SDF A;  2EYJ A;  1WD0 A;  4KTA A;  2AWO A;  5C3X A;  4RGM A;  1GUG A;  1B3A A;  5IOD A;  2WV6 D;  3EQL C;  2A6H D;  4U67 3;  3LWE A;  4V19 0;  5EBD A;  4J1M A;  3K5L A;  4MHE A;  1JIC A;  2EPB A;  4KD3 A;  4KY6 A;  1CHQ D;  4WOR A;  4DA2 A;  4FXK C;  3I91 A;  2HDL A;  3S9W A;  4KJN A;  1HCZ A;  4IUT A;  3MA2 B;  2NB0 A;  2HUG A;  5J22 A;  1VMP A;  4R8I A;  2E2I B;  3H3V C;  4RCO A;  3FPU B;  1I4H A;  1PTO F;  3HKZ B;  2EJM A;  1OXS C;  2C5C A;  2IL8 A;  5C0X G;  1QCB D;  1E2V A;  4I7Z C;  3RUZ A;  3BDC A;  2K5Q A;  4BS9 A;  5I6W A;  2XWB B;  3H6M A;  2BDO A;  4DFA A;  1KNA A;  2F0S A;  1EY6 A;  2FMC A;  4YIJ A;  2EYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...