5T1JA

Crystal structure of the tbox dna binding domain of the transcription factor t-bet
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
192
structure length
192
Chain Sequence
KLRVALSNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGSMPGNRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEPEAACSASNTHVFTFQETQFIAVTAYQNAEITQLKIDNNPFAKGFREN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-box transcription factor TBX21
publication title Crystal structure of the DNA binding domain of the transcription factor T-bet suggests simultaneous recognition of distant genome sites.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 29
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00907 T-box T-box
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.820 Mainly Beta Sandwich Immunoglobulin-like Transcription factor, T-box 5t1jA00
1H6FA 5BQDA 2X6VA 4S0HA 5FLVA 1XBRA 4A04A 2X6UA 5T1JA
chains in the Genus database with same CATH superfamily
4RRPG 1QX1A 1LEIB 4Y4KA 4K9JA 5ICYA 4LCCB 4FKHA 1P7QB 1GMIA 3PWUB 4NWTH 2BY3A 3MGTB 4U1SB 5J56B 1MG3C 3RJOA 2ESVA 5CLWA 2WBXA 3V4PH 3WEXA 4UM8A 2HT4C 4OCSH 3JT2A 3VFPA 2G60L 2A83B 3QUZC 2AW2A 4RFNB 1AQDB 3OR7A 5J12C 4XBPB 1DBKL 3QG7L 3T0VA 3ZE1E 1CGVA 1ZTXE 4Z7QF 4XB3A 2FEDD 5B4MD 1T6VN 3ATFA 5E9AA 3OJDB 2EDMA 3KXFE 3Q6GH 4XMLL 5DJAB 3VXOB 4EMZA 3GPEA 3PS6A 3SPCA 5T3ZL 3BIBX 3H54A 4LSQH 1S9XB 5GS3A 5HHOE 4B60A 3MAWA 4EKXA 4FFZH 5CAYB 3M46A 1RZGB 1R24B 4TUKL 5DD5H 3G5YB 5AKSA 3LVEA 1WFIA 3D6GA 5INCA 5MEPA 1DO6A 2NDGA 2E9IA 3TBYA 1L3WA 3N1FC 4FNPA 4LHQB 2E27H 3SE6A 3PJSB 1KTDA 5EBMA 1IBBA 1XB3A 4HEPG 2FO4B 2FT7A 3D4ZA 4J27A 3BRGC 1QR1B 1AMXA 4JQIA 4A66A 4HJSA 4ABVA 2K7QA 4HT1H 2IH8A 4LSRH 3BP5A 2VQUA 1YEGH 3PAZA 4LGPB 1PG7L 1QFWL 1CYXA 4XNAA 4IMLA 3TZVC 4LLVA 2A6IA 3DECA 4ODHH 4QHLA 2Y24A 3JV4B 1DBJL 1G1KA 2OTWB 2NY5L 3OKMB 1A6TA 2KZBA 4S2SB 5F6IB 1PMYA 2CIKB 4WJG3 3FQNA 1BBJA 2FYVA 2V2XA 4Z76B 1U8QA 3GHPA 4JREC 1E5ZA 2R2CA 4JRYE 3ULAB 3F04A 5H37G 4BFRA 3SBRA 4GXVL 5DJ6B 4AUUA 1IAIH 1XF3B 2EDKA 2ZXDA 3RGVC 5I16B 3MUJA 5HGAA 3W9DA 2EDOA 5LBSL 3UH8A 3CV5A 3T3PF 1CFNA 3HEIB 5HHPA 3KZ8A 4ONOA 4PRHD 1I53A 1CDJA 3CXDL 1EA9C 1KJ2L 3P30H 4M7LL 5HGDA 3SDAC 4DO5A 2ADYA 1SY6A 1FHGA 4FOMA 1AD0B 3DWTA 4L1DA 4O02H 5CEXA 3L95B 1FG2B 3F12A 3PWLB 5J11C 4I77L 5GSRB 4HHAB 2NR6A 4P3DA 2KLTA 2ZUQB 3Q01A 4KXAA 3GJFA 5CGYC 2CSPA 2L7QA 3P9LB 5JNYA 1FH5H 3HG3A 1MCIA 3P73B 3WFEH 2J4WL 4ZSOB 1KCUL 3GKWH 4Q9CA 4GRLD 4WI7A 5HYSA 4MBOA 3QQDA 4LPUA 1IKFL 2YJLA 3K4AA 2WWMC 1KOAA 2Z7YA 5ABAA 2M83A 3L5XH 5CJXA 2YD4A 3OWRA 1KBGH 2DLIA 3OMNB 2OR9H 5BZWA 1LXMA 2NY3B 2BLFA 3N42F 5B3SB 5E8PA 1IBGH 1EFXB 3FOLB 2XZAH 1AGCB 3M7OA 5B1AB 4ILDA 2R23B 3V9FA 3GTNA 1S5HB 1AR1C 1KCKA 3CN3A 2J12B 1N4XL 4HMDA 3B7YA 4U31A 4P2RE 3MLRL 2QVMA 3VG9C 4RWYL 3RPIB 1C1EH 2ZSVB 3INUL 3V5HA 4FNTA 1HEJC 1UM5H 2NXYB 4EN3D 3KPSD 1IVTA 2AEQL 1LDPL 3LKPB 3RUGE 3B2XA 1S2EA 3IU4L 2D03L 4ANWA 5IFJB 4MMXC 2SODB 1F8TL 3IDIB 1GAFL 1A6ZA 1IC0A 4ELME 1JZ4A 4PEEA 1VESA 4LZKA 3BXNA 5ADPH 5EPMB 2QSCH 3F85A 3OL2A 5L9DL 1P7KA 4APXB 1CWVA 2G3ZA 5D6DC 5EEUA 3SQRA 2ZICA 3WKPA 4TRPL 3UYPB 1FGVH 1G9MC 1C16A 3J27A 2FT6A 3ZQWA 3LDBB 4CC4C 3LN5B 1YNLH 4OLZL 3V2AR 1R3HB 4PGCA 1KEGH 4ZPVB 3MA7A 1SRDA 4Y7MA 2XETA 1LVEA 3QRGH 5J5EA 1OSZA 5BW7A 4IS6A 4U1MA 1UB5A 1OAYH 1TQWA 1ZPLA 4AQEB 3RPBA 5JHLH 3LKOA 3QDJE 1UURA 3T9WA 4PFEA 1NC4B 3ARFD 3L4UA 1MREH 3ZKNC 2Y6TE 3E6FA 3BRFA 1ZEAL 1KTRL 5JIPA 1YMMD 4Y5XC 2CLRA 3L81A 3CH1B 4ACPA 1FO0L 1A3RH 1I85C 1USZA 5EU7C 5CFAA 2J8UA 4KRPD 2VC2H 4MJIE 2OMVB 4J6RL 2DWEA 1PU0A 4ODVL 2C1PB 1VIWA 5CZXC 1YNTF 1R3IL 2FIKB 2WTPA 4KI1A 1BREA 4NT6B 1YPZA 2ALWA 3DROA 3NIGB 3QWRD 1QWUA 1P69B 1FORL 1MRDL 2E6JA 5KUKA 1D9KD 4KK8D 2CDGB 3ABGA 2JCCA 4E41A 1YN6B 4OZIA 3QCVH 2AJYH 4AYMC 3G5XB 1N70A 4NPYB 4XVSH 1QKZL 2OYMA 3HUJB 3WXWL 4PRID 2I9LA 4HCIA 2AP2A 1NIBA 5TH2B 5IROA 3DTDA 4HWBA 1U4FA 3X1GA 5I0XA 4YLBA 1J18A 4YSOA 4YXKL 3ZYIA 3C6LA 3WTXA 4H8WH 1P6AB 1W0VB 4OCXH 3MREB 2A73B 2AXWA 4UWQB 3NMEA 4WNSA 3ROLB 1NAMB 1IE5A 4NRZA 6FABL 3BO8A 4CADA 2DOCA 4FQXA 5HDQL 2FNWA 1A1NB 4LOUD 3BYYA 3TBSB 3UBHA 4D9RD 2Z4QA 3VFNB 4DEWA 3LRSB 3GB7B 3MOBH 5JPMC 2XNAB 3LKSB 3AREA 3U9PL 4ZFGH 3VD0A 4KDTC 1NBYB 2JELH 2OXHA 1VFAA 2NY0D 4OUUA 4YO0B 3WYRA 4AUJA 6TAAA 2DIAA 3CVHH 1IQWH 5DQJB 1PNCA 3I74A 4PJEF 4GAYA 4FN0A 2JKIS 3LIZH 4ZAKA 3UZVA 1QRND 3IXTB 3X1FA 4AYFB 1MIEH 1L6PA 3K2MC 1TVBB 1QFPA 4BQ9A 1YEIH 4X7CC 5E99H 5ETUA 2YPKB 2VXSL 1UJ3A 1X5AA 3SYCA 4BK4A 1JGVH 3CZEA 3HNTH 1X5XA 4HISA 4EXKA 4CGUB 2CRMA 2RH0A 4J1UB 2BSTB 1RZKH 4Y9GA 2E47A 2XICA 4PY7A 2BNRD 3BVUA 3QSKB 1SDDA 5DEGB 3WHXB 2OP4H 1PX3A 2D31B 2APSA 5I1GH 5DXWA 4XWOD 3BGMB 2LFEA 5ALCL 3LEXB 4P46C 4PJGA 4KC3B 4BH8B 3HE6A 2B4CL 4MD5A 3HC0A 2UWEE 4OI7A 1WK0A 3JVGC 5C07D 5TF1L 4AEIL 1BZ7B 1BZOA 4X7EC 4WEEA 2DQCL 2WXJA 4M7LT 1KMGA 3SOTA 3FAWA 4GMTH 1QSVA 3PJLA 1H3WM 2V9UA 3ARYA 4N0CD 3C5ZD 1LGVA 4I18A 2C26A 3ARGC 2YLHA 2EDFA 3KYMB 4LLYA 2BSRB 4GKNB 4PJHB 5BRZE 2EH7H 1OSPH 3PDOB 3KR3L 3VXNB 1GSKA 2IAND 3ARDD 4FQCL 3R06A 2A1WH 1ES0B 3C8KA 1COBA 4HIIB 5IBUB 5AZEL 1DFBH 3FTVA 4PJ7F 4HJ1A 2Y07H 4HK0B 4QRPB 1IJNA 4MZIA 4BE5A 3D39D 4PB9H 3S0PA 3V7AG 1X5GA 3EYOA 5AVXB 3GM8A 3GSOB 3NCCB 3SKOA 1RK0B 1WWBX 5DJ8B 3V0IA 5DT1H 1T7YA 1U41A 3BUQA 3EUDA 3S35L 1KIPA 2W88A 4L2LA 2EKSA 3TM6A 3ZDZB 4N68A 2F8VA 3MRFA 2QSTA 3W57A 5G55A 4KO6A 4LCWA 4DP6X 1KXQE 2C7UA 2XIIA 3BVNA 2WNWA 4P4KC 1UADC 3IVKB 1FNGB 5D70H 2WZ5A 2E75C 4QD2E 1G43A 4IKLA 1IC1A 4XI5C 1BXXA 3UTSD 1XIWC 4PG2C 4O02B 4WFFE 3L5WA 1KB3A 1KCVL 2CRZA 1OHZA 5F0JB 4L8DB 5EIVA 4JZOB 3QIUC 8CGTA 2ERJC 4TVPH 5GHWH 3T0DA 3I6KB 4PJFE 3WFBL 5LGHH 3I50H 5KYXA 1JGIA 1VCBC 5C0CA 3Q9PA 1FQ9C 3PREA 1FSKC 4TSBH 1MEXL 4MWFB 5INDA 3VI3F 2BP0B 3X12A 5JQHC 3UJJL 2QGCA 5DRZA 4MNQA 2HG5A 3S2CA 1E4JA 4FD0A 1IGTA 3KPNA 3QT2A 2NUPA 5DRWA 3SKNA 3Q8AA 4AQ1A 2YN5A 1KGCE 2Q9OA 3NP4A 4PJCF 3KHQA 3G9AB 4FG6D 4NO3A 1HDMA 2R2EA 4YHLH 4U0QB 1N3NA 1K6QH 2O61A 5AW2B 4FQ1L 2WWNA 4HWEL 3ARBB 1WTLA 3JWDL 2WZPD 2FBRA 2W07B 5DVPA 3U0WL 3UJIL 3UMNA 2X6MA 1R33A 1N0LA 3V7MA 1SXBA 1FFPB 3IJEB 4OCWH 3MRLB 2H32A 4Z7UF 4Z7OF 2YRLA 5KSAB 2VWEC 2BMKA 2VLRD 4OD3L 2VDQH 4NERA 2R0WH 4XPAL 2DIJA 2HTLC 1CXEA 4B9GA 3NJJA 5E1AB 3GXNA 3HG1B 1KN4H 4U7SA 1XBRA 4MAYD 1F90H 4QRSB 4G5AA 4X5QA 3QJHB 5EUKB 5ITFB 4A7GF 2F53A 4EDXB 4K5NA 3EGDB 2FWUA 3SYQA 5FOBA 4FXGA 2NY1D 2P24A 2X4SA 3S34H 1CD8A 1MCPH 2WQVA 4JEGB 4NZFA 2DYPB 4OLWL 3DSNB 3CLWA 4ZFFA 4WHDA 4OLVL 4DP1X 4OCRL 1ZLUK 1XR8A 3D4GA 1OK0A 1IFHH 3N1MC 5KJ7E 3AUWB 3NA9H 1ZLEA 5K59E 1Z7JA 5CZRA 1SGKA 4FNQA 3RFZC 2ICWJ 1QO3B 3AS2A 1V3JA 1ZHNA 2VC2B 4QHPA 3MRDA 4XO8A 5T3ZD 3V4VA 2I60H 1KLUA 2NY2C 4G9FD 2HVJB 2XT1B 1RHHB 2X12A 1RZIB 4TL4A 5DJDB 2AK1H 5EC1B 4WO4B 2RHEA 2K8MA 3STBA 5ISZB 1T2JA 2NY7H 1YECL 4YPGB 2I32A 3GBML 1JPTL 1JZDC 5E6ZA 1JCVA 4WU7B 4ELKB 1DVZA 4URKA 4NQVA 5DMKA 4FQ2L 2F61A 4NHUA 1TTRA 5JMOC 1MCBA 3GIZH 1QSED 1I3RB 1BYNA 2V8LA 2AEOA 5K9JH 1W72A 2O72A 2V5YA 2E9WA 1JPEA 3C9NB 3H56A 5DJZA 4L4JA 2GSGA 1VF5C 1A6UL 5EN3A 1BBDH 2BSDA 2ZD0A 4PBXA 2ICCA 3D7PA 4KRLB 5L7XH 1E27A 4HIHB 1T83C 1J1OH 1SXZA 2ADJA 3T0EE 1IM9B 1HL8A 1I8IB 2GITA 3N91A 4N28A 3K8KA 3BAEH 3H4FA 3LY6A 5F1NB 1EXGA 3IMUA 3WDIA 3MRGB 5T5FH 1HCYA 1AY1H 2P47B 1R17A 2P1YA 4LIQL 3IAQA 3SGJC 2C9SA 2VZUA 2LHAA 3FFCB 1MWOA 4ODBD 4DGIL 4WEBL 2WB1A 5KG9A 2EABA 3O6LH 5KSVB 3UDWC 3OGCA 3FB5A 5FM4A 2ESVE 4ODWB 4JN2A 4GUPB 1YN7A 1A21A 2B15A 3PV6A 1FNHA 3DMMD 4W9ZA 1J9RA 2OJEB 2EH8L 1KXVC 1U8PA 4LCYB 1NCCH 3CVHB 5IVOA 1D2PA 3LZRA 2JJSA 4DKDC 1K9TA 2NCEA 4HC1A 4JO2L 3QZWA 2QQLH 4XVUD 3SSGA 3WLBB 2XZQH 3EFDH 3VGEA 2XTJE 5AB2A 4XX1E 4MRCA 1YEHH 2CCVA 5FAAA 3M7FB 4JM0A 4Z5RA 3DGGB 4BH7B 5E7FA 3MV9D 4GRMB 1NCTA 2GCYB 1PQZB 1TZHA 2ADIA 4HS6B 2VH5L 5LDUA 4NUPA 4PVLA 2VDLH 2X0UA 5J6SA 1I8LA 1E4XH 1TQBC 4FQHB 5ES4B 4OZGB 2BFVL 2KKQA 3I6SA 2DLGA 3D51A 5IMKB 1GVIA 3WOVA 2ADFL 4QHKJ 4PRHA 3X13A 3INOA 5TK2A 4FF9A 4RESB 3F8UB 2FQEA 1J8HA 3BUIA 4HEMA 2EDYA 1HCFX 3ZTNL 4QXTB 1UQSB 1DVFA 3MRHA 1C8PA 5CN1A 1IE4A 3P77B 2DBLL 3PU7A 1J12A 1S3RA 4M02A 1EAPA 4XC3L 3QDAA 3RX9A 1HOCA 2DI9A 4NQUA 4NQED 5A2KH 4GRLA 3TEXA 5E6ID 1B4RA 4XPGH 4NQXA 4Z7IA 2YPVA 2P5EB 4JR9L 1S3KH 1UATA 4PJIA 3RVUD 4FQLL 4X5XB 4C59B 1E7VA 3U2IA 4PR5A 5BZDB 2RGSA 5BV7B 5IWLA 1SLVA 5IHZA 5JDJA 3GINA 4PRAB 4R84A 5CP7A 3PGDA 4GBXB 5BXFA 2PPDA 4MX7B 4YHZL 4XMKL 4R7VA 1OPOA 1G1CA 2CO6B 3O0RH 1H15A 3N0AA 4EN3A 5EU6B 3EJTA 1MCRA 4TNWK 3D07A 1OP3K 4LSDA 4Z3IA 4AJ0A 2R4SH 3TA4D 4TULH 4ZNCD 3HNVL 4OIFA 1RUKL 3ZDXB 2X1QA 4X0KB 1FPTH 2EDJA 4YEEA 5FW7A 3NCEB 4AV4A 1Q1JL 2X05A 3VFSA 4H2AA 4HJ0C 1QBLH 2FBOJ 3FBKA 4J3WA 4UQ3A 3AFLA 1O75A 1AZRA 2WVTA 4UV4H 3QQ9C 2AXFA 2VXVL 4YHKL 4F20A 2ITDA 2XC8A 1LK2A 1CICB 3OX8B 3IFPA 2DQIH 5IV2A 3U2SB 1KN2H 4GSRA 2YGVA 3KYKH 3MCYA 5DK0A 3ZRSA 3G5VA 3T4YB 2ZCKH 3KGRA 3MJ9A 4C47A 5E8NA 4P23A 5LLIC 4WSGA 4FL4B 1ZDSA 2BRRH 3ARFA 3DX7B 3TT3H 3PIQB 4AVIA 4W9JC 4ZS7H 5EZLB 4GNKB 3TYFA 4NCC1 5I30H 4LLMB 3MBXL 4G8GB 3QDGD 4UAOC 4G6KH 2F5AH 5I82A 3IDNB 1N8OE 3KPRD 4Y2DA 3RWDA 1JZ7A 4AYGA 4M43L 4M61A 3QEQB 3EO1B 2OTPA 3PP4L 4L9LB 4MCZB 3NZHL 1XGPA 4S1SL 1KPRA 1FFRA 3N41F 1HHKA 2EICA 3H3BC 1NAML 3JV6B 2MPAL 2CDEA 1BQHB 2QV4A 3D9AH 5J6GB 4AK2A 3MCKA 3QWRA 4QRRB 1D9KA 1U3HD 4QRTB 4DKEL 3SQBA 1KB5A 2FJGA 2ZQKA 3DRTB 4F9PA 3AXHA 4PWJA 3WJLA 2P5WB 3SCMB 4YZFF 4ZOEA 1CFMA 3RRQA 2C4XA 2BSSB 3GUTA 5EEWA 1U33A 3QI9A 3O4LE 3RY5A 3LTVA 1KCRL 4N8PA 2X1PA 1UTDA 4HU2A 3GRWA 3KJ6L 4OGQC 4XP4H 4BSVB 3APCA 3SJVD 3O2VH 1FIGH 2DBJA 3CMOL 2PP7A 3CUPA 1U42A 1YPZE 2FAUA 2VJ8A 4DQOH 3ZZLA 2BNQD 2H1LM 4OUOA 1UFGA 2V3FA 1V5JA 3HR5A 3MLVH 5T1MB 5HGHA 2JCCE 5G5DB 3KL0A 2DMCA 3APDA 3QIBB 2R15A 4OCSL 5TDPA 4WUUD 2XN9D 5D1ZC 2HT3D 3B4NA 2FWOA 2KZWA 3OPUA 3P9WB 2AF2A 5D71H 3CPLA 4JBSA 3N85L 2XWZA 5TF0A 2AJVH 2JKXA 5B1KA 2ZJSH 3EO9L 3Q6GL 3X3GL 4NIKB 4IRSD 1QRNA 4BQ6A 5KEZA 1V27A 4KMTH 2DLEA 3WAJA 3C87A 3LKRB 1JNNL 4WKZB 2OR7A 3OAZH 3LCYA 4I3RH 4V1DB 3VRIB 2YS4A 4JHUA 1LO0H 2K7PA 4N2MA 5LAXB 1ZLVK 4YSCA 1NLDL 5DD3L 1FZMB 2DM2A 4Q9QH 2GJ6B 3RKPA 4F15C 4OGYL 2VM3A 1L0PA 2WOYA 1T22A 3AG4B 1YEWA 4K4KA 1CFBA 3GMNA 4FMFA 3STLB 1WWWX 2CO7A 1JF1A 1PVHA 4Z18A 1VPOH 1T66C 2BNRA 3FJTA 1PYWB 3KDMA 5GS0D 4TUJB 2LGNA 3IMBA 3OPZL 2MOGA 3IDUA 2WSKA 3Q2VA 5IJCC 3EYSH 1YEGL 5FECB 2P5PA 2BIQA 1T80A 1BZ9B 2R69H 4KKCD 4W70A 5FKPB 5JXEC 3QS3A 1H0DB 1KT2B 1N64H 4FHBD 4R7NB 4NOBA 4PLKD 1N5YH 1H6TA 5HHME 5CJQH 4BFNA 3H0TB 3IJYB 4YR6A 5IJKA 1ZLWK 1XQ4A 5D7JC 3WL9B 2QHRH 1EAOA 1SUJA 1T04A 1SLUA 3KVPA 1W0YT 4AVJA 3QRLA 1IKOP 2VISB 5DJ0B 1T21A 4WHCA 2D2CC 4HG4K 4ZXBA 2DEWX 3NFPB 1WIUA 3MXVH 5F9JA 1BYPA 3MA9H 3C08H 1E90A 5ANME 3STZB 2RD0A 5CUSH 4CC0A 1KCSL 3NH7H 2YBRB 4QI3A 3MZTA 1LJMA 4I3SH 4NKQB 4ABUA 1UZGA 1AGEB 3ARTA 3RZWA 2IANA 3ARDA 4N0UE 2G75A 5C0NC 4XXDA 4PJGE 4DO4A 2VJ0A 5DFVD 1I4FB 1MAML 5K69A 4JM4H 2WP3T 4JFVA 1ZSHA 4EIGB 1MRFH 4GXUN 3ATAA 5IVXF 3ZUCA 5L4IA 2AQTA 2EUVA 3WEOA 3UROR 4X9YA 1YEKH 4I1PA 4YQXH 3H55A 2CM5A 1YYLL 3DXAE 3EH4B 3TVMB 4N2GA 1ZS8A 2BC4A 3L5XL 1P5UA 1S7RB 1CI5A 2W0FB 4PYGA 1QYGL 5GIRB 1UA6L 3DJRA 2ICEC 3FB7B 1S7XA 4JFFB 3PWVA 5BOZG 1NCWH 1PGRB 1SBSL 2JJWA 3AUVA 4PJ9C 5L0QC 3P0VL 3MLPA 2EYRB 2QQNH 4G6FD 5D2NA 2VLJA 5F88B 4ZUUA 2LE9A 1TQVA 4BEIA 4CVXB 4KKLD 4RMQA 3UCQA 2DW5A 2DB8A 4FQIH 4QNPF 5AVTB 1UUNA 5DK2A 1IARB 2NMSA 4Y88A 3QJUB 2UY7B 1BMZA 1PG7W 3UBXI 2FBJL 2WTRB 2VAAB 2R29A 3NSCA 3OKNB 1X9UA 4TNVK 4KRNA 5CM1A 1JYXA 1DE4B 1NUDA 1PJ9A 4G6AC 4RGNB 1HNGA 2LU7A 2QSCL 3Q5OA 3BAIA 5H8DA 3H9SD 4CRPA 1HU8A 2L7EA 3HNSH 1GPOL 3F5WA 1F4HA 1XV8A 4DVRL 4FFWC 1ET8A 4OF3A 1SUHA 4GQQA 3HBQA 2WY3B 2Z7UA 5DYFA 1ZTXH 4OT1L 3FN9A 2IOIA 5E5MB 2GT9B 1P7QD 4D0BA 1BIIB 1MDTA 1JIBA 3O8XC 3QRGL 3S96B 3ZE0E 3ASNB 5MEND 2J1KA 1F2QA 4XH2B 3BMVA 2VABB 4O2CA 2NTFA 1RI8A 3OKLB 3NFSH 5DEJA 3QIWD 3X14B 5JHLL 1YEFH 4QXGL 1ACYH 1XWVA 3S7GA 3MGOA 2W59A 1FBIH 3KGUA 4AYEC 4LT7A 1V7MH 3KYOA 4FYQA 1S7UB 2C1OA 3GXUB 3TFKC 4N2HA 5DI8A 1O6SB 3K4ZA 4UM9A 5LB1A 1N2RA 43CAA 2VC2L 3WXVH 4ZFZB 3DO7A 1F18A 1AXTH 4PGBA 4EI5B 1I8KB 5GJTH 4OBSA 2KLRA 1QFOA 4M6OH 4UIMA 3ETSA 5AOLA 3KPMB 2GSIB 5EO1A 4AL8C 4MAYA 1C5DA 4ZMYA 3NN8A 1GTNA 4HS8H 1QLEH 5HGBA 4JFEB 1OK8A 3ZRCC 3MHZA 1N7MH 4GKZB 1YY8B 2E9GA 1RZJH 2YBGA 4G3YL 3MROB 4RX4D 1NUFA 1GY2A 4B97A 5KVEL 4IBUA 4CN4A 3K71A 5BO0D 2HPTA 4XVSL 5T1DL 5JXAH 4WFEE 2BIMA 4Q6IB 3U30B 3R7RA 5C2BH 1OCZB 1Q94A 1IGYA 3GSNA 3O3BB 2AMUA 3UC0H 4B7IA 5AAPA 4FA7B 5KJ4A 3RI5K 5CR8A 5KAQG 2WXPA 4U0RB 4PV9B 2IOOA 2AKRA 2YFOA 3DV4A 5CJ8A 1R3KA 1NQBA 5LCVA 3QNYB 3L54A 4M5ZH 3ARSA 2HLEB 1XHHA 5CP3A 2IAMB 3BI9X 5I6OA 4J6IA 3BSGA 3KGTA 3L45A 3RTQC 2DQTL 4YDIH 4X98A 3V79C 3QVAA 4MD0A 2AEWA 5AG9A 4S11A 1QSEA 1P2CA 5BRPA 3K81A 1WT5A 3SQOL 1NMAH 1CS6A 5DJCA 3H42L 4M7KH 4WLCA 3UJTH 4Z8FH 5ILTH 2X4NB 4MMYB 3MFFB 1UZ6F 5BO1H 5L8LB 3GMOA 4GKLA 4DUVA 5CBAA 1HHJB 3MOAH 4G7SB 2O93L 1BOYA 1NCUA 4UQIM 4LGRB 4AEHH 4B53A 3VU1A 3ZXAC 4WK0B 3K74B 3NJKA 2E4FA 3F7YA 2IH1A 1BPLB 1B0GB 1UXSB 2IFFL 3JZYA 4K5MA 1ZA3A 1MIEL 3WNPA 5BS0B 1GRWA 1YEIL 1A6VH 4H88L 3PWNB 4B3VA 1SN2A 4IRJD 3A5VA 3WTYA 4OM0H 4JKPH 4EZJA 1VGKA 3VFOB 2Q3AA 2WXGA 3TNMB 1UC6A 2CR0A 3R0NA 1XCWA 4M9OA 4XPFH 3SGKC 5F3BB 4JO4H 2H1PH 2IMNA 1GL4B 1JWUA 3G5ZB 4LNRB 1IGFL 1YQ2A 3HN3A 1BQRA 4UNTA 1EFXD 3TO2B 3KVQA 2FGWH 1TZOA 1A14L 3U9UB 5CJOL 2F19H 3VMNA 2GFBA 4FMVA 3ZZSA 2EP6A 3DMMA 4ZW7A 1CF1A 1JPSL 1P5VB 4BK5A 1R3JA 5TPWH 4U3SA 2Y36L 3KYNA 4MDRA 4MJ2A 3Q2NA 4Z0XB 1J9CT 3DTUB 2NXYD 4HUKB 4J3XA 5FFLA 4H8HA 4MB5A 4Y16B 4NP9A 4MA3B 4LRNH 1RHFA 3B3IB 3C09B 2XUWA 1ZD6A 4L3CA 4OSUL 3BN3B 1RUPH 1JUFA 1OM9A 2Y2YA 3F7VB 3LV3A 4L5FE 2EIKB 1CG9A 4GMTL 4M1CD 2WIIA 3B9EA 5EBWA 3WEMA 3ZYJA 4QMEA 1KSRA 3S5LB 1UWYA 2VXTH 3MV7E 3OM3B 2X10A 4JN1L 4FLRA 4IGBD 1F6AA 3B9KB 4RNRA 3KLHD 3MYJB 5C6TH 2HH0H 5IB3A 4C56B 3WE1A 5FYKE 4LBAA 4AW7A 1TVDA 2BVOA 4Q9RH 3B1TA 4U7KA 1A8JH 3LPWA 1ADQL 5BV7L 1DR9A 2EDDA 1ACXA 4JHAL 2Y07L 5SWQA 2NCMA 4AXWA 1WC7B 3LMJH 1G6RB 2WN3A 1QVOA 5D1QC 4Q7DA 3S3SA 4LCIH 1LDSA 2DM7A 1XR9B 4G8FA 1YEJL 2CHNA 5GGTL 4YEFA 1A7RH 3S8GB 1IGIL 3FO1B 3PJNA 4QRUA 2B9AA 4U6HB 2OMZA 1I8UA 5HHQB 3IJHB 4AE0A 1KTJA 4L4TD 2A9NL 4D0CA 1QWHA 2R0LH 4WENB 4NQEA 5FUZL 3VWKA 4UZGA 3T4AB 3TIEB 1LD9B 5LHDA 4MJ6B 3P4MA 4WTXA 3HI5L 3UTZB 3V6FB 1CB4A 1G87A 5JHMA 5KSBF 1QI5A 3T2NH 4LVNC 5F7YC 4UIKH 3RVVD 1GJWA 2A9ML 5L6YL 3B3BA 3O6FC 3ZTCC 1A7QH 3ZL2A 1NIAA 2CRIA 3VGGA 1J8HE 4M93B 2GJRA 3U0TB 3RWJA 3BE1H 4TVPL 8PAZA 3QNZB 1FL3A 1IEAB 2OMXB 5JW3H 4JFZL 5IVZB 4U2YA 4Q0XH 3BWZA 3FQ2A 5A6MA 3GWJA 4PUBH 4XMTA 3D48R 2JI1A 2O6FA 5HDLA 5DZJA 1FNFA 4PP1C 4GIPD 4PRPA 1H8SA 1U8MA 3DBSA 1N10A 4YC2B 1S9KC 2IPTH 4GUCA 4PWFA 1UZ8A 2XXFA 1QUPA 4PJIE 1TFHA 1MCWW 2GBVA 2X42A 1SJXA 3GLEA 3P3UA 1I1AB 4QF1A 5JLZB 3QPXH 4XCFH 3S4SA 3FTUA 5C0AB 3LSOB 2NUTA 2CKNA 4J3VA 1WAPA 4OZHB 3AT9A 5KSUA 3B43A 1CQKA 1MUJB 2XBZA 3IGUA 4BFFA 2DI8A 1ICTA 4JPVH 3ILEA 1OP4A 3DX9B 5I8EB 1S7VB 3OHMB 3QFDB 3R8QA 4PIRF 2CM6A 4ONHA 4P2OB 4RMRA 2BP5M 4E5XB 1Z3GL 1G7MB 2G0KA 3KPOA 2F7QA 3RWIB 1CXLA 5JQ6H 2OBGA 3DARA 4R0LC 4Y4FB 5CR1A 1UT1A 4TOYL 3PP3H 3LRLA 1FFOB 3MNWB 5IBUG 3QWNA 5SWZE 2BCKB 2WW8A 2Z93A 2IQ9L 5EU5B 4S1DC 5FUCC 3KPRA 1WBYA 4PJAE 3TA3C 3V0VA 2YUZA 4A2MA 4KJYA 4K15A 2VL5A 2GKIA 4GH7B 3VXRA 3MKKA 5HHOB 5B38A 4MDJB 4NKOB 1KLFB 2VR8A 3OXSB 3FU7A 2YEZB 4M4RB 4XO4A 1UVQB 4QWWD 4J28A 3UTTA 3K5SA 3P9MB 3WN5C 3LZLA 1AHWA 4OM1L 2HJFB 3KGSA 4JO5A 2JKLA 5D5MA 4YHNA 3VDCA 4DO6A 4P57A 4WHYH 5EU3B 4AZ8B 1LM8V 2AI0H 2AK1L 2HFGL 2P9RA 5GGVH 4ADIA 1U8KA 4GRWE 1OCRB 2R8SL 3O3DA 1BDYA 2CPCA 3O9WC 2Z8WC 5DURB 1G7PA 4FULA 2APTA 4H40A 3SJVA 3ZHLA 4IQHA 1OWWA 4JM2F 5D96C 1OB1B 1C5BL 1IV8A 1X5JA 3BD5A 4JFOA 1EEZB 3KHOA 1RD6A 2ZXAA 5TQ0L 2DMBA 2MKLC 4KK6C 5JZ7C 5BQ7A 3V4UL 3SKMB 2B3IA 2HZHA 5L7XL 4MCNA 3V9EA 3VWJC 4WUUA 5JIKA 2KUTA 1MFEL 2XY1A 2A74A 4QRPD 5J6HB 4JFPA 2H6PA 3VU2A 2M26A 1Z9SA 4TTDC 2XA3A 4FFYL 3HS0A 4HK3J 1KYDA 4QXUH 1YYML 1AY1L 2UX6A 3EJRA 3MRCA 3QXDA 1NIFA 1TF4A 3TASA 2Z4TA 1G7IA 4QHUA 4YX2H 5AAWA 4IRSA 5IK3B 4L37B 1FAIH 4X6DF 4Z78B 4NS0A 5LDSA 5CGBA 5D9SA 3FFDA 4PJDA 4RA3A 2Z64C 3CFUA 3Q13A 4BZ2A 4HOXA 5HP5A 3KWWB 5CLZA 2P46B 4N2FA 3WIHH 5C3TA 5B8CC 2ADGB 2YD2A 4EEEA 4D9RE 1U36A 4AE1A 2MPVA 5I2IA 5AVWB 4ZQTA 1KGJA 1XXDC 1CGSL 1U4EA 5F7WC 4I8DA 4F7TA 3D2UA 3IRCA 3B7RL 4WI5A 3IGFA 5AZUA 5FB8A 2FUQA 3CFCL 2QQLL 4GB9A 4JVUA 1E8WA 3A23A 2J56A 2F1EA 1VENA 1BVOA 5DQ9B 3RDTD 4NDMA 5C0FA 3QK0A 2CIIB 2X7LB 5E4EB 1NCAH 4X7TB 1KGXA 3ZE2F 2XI9A 3S37L 1JGEB 5K9OA 4LO9A 2G5BA 3RUGB 3TNNB 4YAQA 3FH7A 4QRQA 4XPBL 3IMWA 1KC5L 1IMHC 5G4MA 4NX0A 1HSAA 2DF3A 2HAZA 3V52H 4ICXA 4M62H 4K23H 3Q9QA 2EIJB 3TPUA 1O9ZA 4L1HA 2GY7B 4G43B 2JJVA 2VZSA 3MX0B 1AZCA 3W2DH 2GK0B 3H2PA 2W5PA 2Z92B 2JKRM 4JW3A 1A25A 4XP5H 3HLAA 2HKAA 5FYLL 4H8QA 4K7PH 4EOWL 1OPGH 3ILDA 3DVGB 3WBDA 1MCOH 3ARBD 4TSCL 4J4PC 4LDOB 3AGVA 1KACB 2LAGB 4CN1A 15C8L 1NC2A 1MXGA 4POYA 2W8CA 3UIYA 5ESQA 2ZYSA 5F9DC 1Q90A 3QUYD 4PGEB 4I48A 1HZKA 4N2BA 5KSAD 3H53A 3M1OA 3OV6A 4WW2A 2N0MA 1J48A 1EBPA 1IKNC 4OQTL 3QDJB 4ZYKB 3UO1L 3QJQB 2NY4C 5T33H 1LO2L 3QHZH 4I9XA 4KK5D 4W68A 3ZKMC 1DN0B 2J88L 2P45B 3T1FB 3HG1D 4Z3EA 5A16A 5HYJA 1HH9A 1TCRA 2GC7C 3IFNL 4P9MH 5DFWH 5HHNA 3ARRA 4GQ9H 5E5RB 4C4KO 1FL6A 2Z91B 4ZNEA 5EZPA 3WO4C 1R4XA 2L7JA 3THMH 2DYPD 3M8OL 4JX0A 1QEWA 4NN5C 4P07A 2WQRA 4PJ8C 3O0RL 3ZW3A 4WDIA 5MEOA 3FNKA 2WBWB 3TN0B 3QJSB 5HY9A 4OGXH 3S8FB 1CDGA 3BH4A 4DWHA 1KIUA 2BVPB 3LEVL 3VI4A 1G9MH 5CEYA 4PCYA 2ICWA 2HFFB 5K39B 4A7VA 1ZIAA 5D7KD 4JE0A 4AWJC 3HRZB 4PRBB 2NZ9C 3F7LA 3O41A 4YXHH 3OAYH 2AGJL 3H9SA 4O9HH 3RNKB 2AV1B 4ABQA 4CU8A 4WO4D 5IMLA 4ZZKA 2ITEA 5ISZD 1IM3D 5H4ZA 2QKIB 2Q7AA 4NNYA 1OTSD 1PD0A 2HRLA 2VLJE 1E5YA 2XYBA 4I1RA 2O6PA 1HH6B 4U3CA 1LEIA 1P7QA 3RA7H 4I13B 5FCSH 1HHHA 2G0LA 2MOQA 2PCFB 3BJ91 1Q9WB 5HHXL 4UTBA 3LQZA 5H2BB 3ZMNA 4U1SA 5KANG 2ZCKL 3C75A 4OFKA 2OZ4H 4HGWB 5HPOA 2VR6A 3CNKA 2H9GA 3NRPA 1R3LA 3VD2A 3SDDC 4MS6A 1IM9D 2A83A 4KI5E 1AQDA 2K70A 4XBPA 3EO0B 3WNIA 2ZUSA 4PWHA 1NWPA 2X2JA 4HXBL 4FTVD 2BSEA 2E7LC 3C8DA 5E1HB 2CHZA 3OJDA 5DJAA 3VXOA 2VCOA 2CHXA 4ZFOL 1RJCA 1H3VA 2X4RA 4UT9L 3QZPA 2XIDA 1ZT4B 3FFCD 1S9XA 5EF3A 2EEAA 2NQ3A 5C7XH 4X7SL 1RZGA 3G5YA 3D30A 1NEZB 2WINB 1N19A 2XWJB 3L13A 2B7DT 4UZUA 3RAJH 5BOJA 2VYRE 3PJSA 1KXTB 3E1F1 4RX4A 5FX3A 2FO4A 25C8H 1QR1A 2X4OB 1YC8A 5IFHL 2WYIA 3X11B 4TXVB 3D5OF 5FO9B 5CD5C 2W94A 3SGDI 3QQNA 1CD0A 3PGCB 5E2WH 5DGQA 4PB0L 3BUDA 1GYCA 1LQBC 2A9AA 3JV4A 4GW4B 4XNBA 3OKMA 2OTWA 5MERB 4XP4L 4BGDA 1Q72H 1CDHA 2CIKA 2PW1B 1AZUA 3APNA 3O2VL 1FIGL 4Z76A 2UWEB 5TDNB 5M7QA 1J5HA 5IQLA 4ALAL 3BPOC 5ABZA 2GYSA 5DJ6A 5MHSE 1XF3A 2VO5A 2Y9RT 2WTOA 5I16A 3J8F7 2UYLA 3LZFH 4QCIA 2DTMH 1O7VA 3O4OC 1J0KA 1MPAL 1A5FL 4KK9C 5C0BB 5C8JB 3D8MA 1AD0A 3IT8D 4HAGA 5KVGE 2CUAA 1FG2A 3L95A 3PWLA 5GSRA 4HHAA 2ZJSL 3FOMB 4J3OH 1I8AA 1KBVA 4OF8A 4F7MB 3VNZA 2FH8A 3IKKA 3ALPA 1H19A 1N6QH 4NSKA 4FYSA 4JZJC 1R5IB 3P9LA 3DBXA 4U33A 3T3PE 4YXLL 2TRHA 3QUZB 4I9WD 3P73A 1NBCA 4ZSOA 1BFVH 5I1JL 3QORC 4Q9QL 2P5ED 3MBEB 4XR8C 3QNFA 4Y4HA 5FO2A 2DKMA 3DGDA 3UTQA 4NENB 4QRAA 3ULVL 1HWHB 1EFXA 3FOLA 4AIZB 1AGCA 1RK1B 1DZBA 4GBXD 2R23A 5SX5K 2KYIA 3T8MA 5AFAA 5CXPA 1S5HA 5CJXC 3ZHFA 2ZT9C 1CFSB 3RPIA 1IC4L 1Y1UA 1G6RL 2PP9A 1DZ0A 4R3SB 5EU6D 3S9DB 5E94A 3RVTC 3LKPA 3MZGB 2YAEA 3W37A 3F01A 1ZVSB 3B9VA 3UOAB 4J12A 5IFJA 4JHWH 1ASPA 3NDZE 4A7SA 5CEZE 3IDIA 2PWEA 3BPCB 2E46A 2IDTA 5JO5B 4OF0A 1DDTA 1M3IA 2QSQA 3QDHA 5EPMA 1KLGA 4FLSA 4HPYL 3NRFA 3HMXH 4DGYH 5ACLA 5BVJB 1FC1A 4MGXA 5B3JF 4APXA 1ZGLM 4GP5B 1GTFA 3NH7L 1U92B 3UYPA 2JKNA 5TE6L 2BZ7A 4JREB 3QQ4B 5FFOA 3LN5A 1PZSA 2WZ0A 1SJVA 2YK1L 1CICD 1R3HA 2O5XH 3JWNG 4ZPVA 3EZJB 2D2OA 4YBHA 4BZ1H 4TVPD 3UPCA 4PLJD 3V0FA 1AE6L 3L3OB 2Z31B 3RGVB 3PL6C 1OTUC 1NFDB 4Z7AA 3HZYB 4AQEA 1UD2A 2CALA 4I4WB 4JFQB 1ZK9A 2HMIC 4E42A 3H6JA 1YEKL 3BKJL 4TNVF 3I02B 1NC4A 5ALBH 3SDAB 4G5ZH 4LCVA 3NACL 1QPXA 3DJTA 2D73A 4QYOB 3M1CA 2YKKA 4OFIA 1UWGL 4G8GD 1AOZA 3ULUL 4Y2OB 4WV1B 4Z95L 4PS7A 1IGCL 3FHAA 3HI6H 3LKNB 2IH3B 2OMVA 3RZCC 5C86A 5CJ5A 1RKRA 1SHWA 4IHBA 2C1PA 3FPYA 1AXIB 5C97A 3CAFA 4LSPH 1TT6A 3DK0A 1T20B 2FLMA 3WIFB 4NT6A 3SO5A 4EO5A 4QR7A 3V6OC 3VD3A 1BEXA 1JK9B 5J89A 4QRRD 5CMAB 5EIIG 2CDGA 3RVXD 2FATH 1YN6A 3GXFA 3G5XA 4GFTB 2F15A 1YC7A 2AK4B 4NPYA 2XWRA 4AQOA 3HUJA 3QPKA 3SCMD 1NMCC 2YA1A 1AR1B 5DS8B 5TH2A 1JRHH 2W9EL 3HNSL 4NQEE 1G7JB 2PCPB 4GQZA 5FWQA 3WKYA 4GAJH 1J1XL 3HR6A 3UAEA 4XT1C 1MCJA 3TTYA 4LEXL 1HHGA 2PYFB 1G4MA 1W0VA 1ZTXL 3LQMA 1IZKA 4HGMA 2H0PA 4QXVA 5A7BA 3MREA 5IROC 1A7NH 2A73A 3U4BH 4UT6L 4TQPA 4N9GB 5E6YA 3ROLA 5AVVB 1NAMA 3RY6C 1Q9OB 3HKZA 2EEXA 3C6LC 1MHPH 1BGXL 3U82B 2CJSA 2E7MA 3MXWH 5HVWA 1A1NA 2D0HA 3TBSA 3VAEA 5H94A 4DPRA 3VFNA 1A0QL 3QIBD 1YEFL 3GB7A 4WIQA 1AACA 2IH9A 4YFEA 1GJIA 2XNAA 3LKSA 3RX8A 4E0RA 3HC2A 4FI8A 4TNGA 2R2HB 2UUDH 5C0DB 1V7ML 4DW2H 4PRPE 4AGMA 1HYRC 5E2VL 1WYJA 5E5LA 4AGPA 1FDLL 1OZUA 4LBEB 2ENSA 2ITCB 4H13C 4X5WA 5K1JA 3E38A 4JO3H 3RI5F 1E6OL 3ARUA 3WXVL 4DK5A 3T0EB 4MXVF 3IXTA 4BQCA 1SF5A 2RIKA 3U46B 3EYQD 3MUGB 3BGAA 4FQQB 4AYFA 1TVBA 4BKLA 2JXMB 3BP4B 4O4YL 5GJTL 4DGVH 4V1DD 2YPKA 1BD2E 4GFXA 4OGAD 3SOBL 5DVOA 2JKTM 4HS8L 3EH5B 3KBPA 5DJYB 5C9JB 1VFBB 2HLFC 4YSDA 3JWOL 1I9IL 4MA8L 3HTLX 5KWYC 5MI0C 4HWUA 4J1UA 1LP9F 2BSTA 3V4PA 3Q06A 2XWXA 4G8EB 3D18B 4JY5L 3UAJD 2YPLB 4GSDL 2EZ0D 4AEEA 2H2PD 5JXAL 4MB4A 3BPLC 4TQEH 1AS8A 5DEGA 3UO8B 3WHXA 2YQGA 2D31A 3NABH 4NKIL 1A2YB 1V7NL 3CIQA 4CMHB 4XXWC 2OA9A 2XA8L 1LMKA 5F89B 1RV6X 3LEXA 5F7FA 4ODSL 3UIZA 1TFPA 4N8VG 3T77A 1MRCH 3QUXC 3NIDB 4BH8A 2BHZA 4NBZB 3BCDA 4GSQA 5FW6A 2ICES 3G9VA 4D3CL 4JPKH 1BZ7A 1LTXA 5F21B 4FFZA 4DK6A 2GG1A 3BN9D 1MLCB 5FM5M 2XTJB 1NTDA 3A6CH 3G6JB 3VXRE 1JGLH 3HE6C 3MJ8B 1CLYH 1CTMA 3HHMA 4MXWH 4YDIL 2NNRA 5A2FA 4JANB 5HD8C 3VQLA 4ZD3H 1HIMH 2ZX5A 1SDAB 1Z6JT 4NZ8A 3KYMA 1E4WL 2BSRA 4GKNA 4PJHA 3TF7C 4HP5A 1X4ZA 3PDOA 4M7KL 3UTTE 3VXNA 3OF6A 2N01B 2NNXA 5A3ID 1ES0A 4HIIA 5I1CH 1CU4L 5D5ME 1SMOA 2C9PA 4LSSH 4X5LA 3PYCA 1CLCA 1F13A 1NANH 4HK0A 5BCAA 5EFIB 5I26A 3HG4A 3VFTB 1D5XB 3L9BA 3QWOB 3LRKA 5JPMB 5DVKA 1A6VL 3GSOA 4P5TC 1RK0A 1IQDB 2XFGB 5DJ8A 1WD9A 2PNDA 2EILB 4N5EC 2CUHA 3QWQB 4UB0H 2P8PB 5I19H 4W9IC 2XPZA 1N67A 4JO4L 1SN5A 3IDXH 4Y5YB 3AY4C 5EU4B 2FECL 2W60B 5EORH 4UZSA 3P2TA 3RG1C 1IFGA 4AW4A 2XN0A 3IVKA 4YK4B 1FNGA 3B5HA 2ZOKB 1UT2A 1YEDB 5HHPB 2V17L 3VH8A 4O02A 1PLCA 4BA8A 2C9XA 5HGDB 3GIVB 2BX5A 2HJKA 2Q76B 4GG6A 3E3QE 1NZRA 2ZXWB 4NPKA 1OCWL 2AQ3A 7PCYA 5CEXB 3GHBL 3GZOA 4WFHE 2DAVA 3I6KA 5C09D 3WLWD 5L8JB 1A3QA 3QPQC 3PY9A 4F3FB 1SXNA 3KH3A 1E3FA 4J3BA 3R7QA 4K07A 1DJSA 2W95A 4MWFA 4E36A 4TPRH 1RUQL 2BP0A 3VXUE 1GCFA 2HH0L 4N2EA 2BRQA 4XMVA 3RB5A 3FT4B 3NP3A 5BZWB 1NUGA 2DY2A 2I24N 2QV2A 4X6FB 4PVBA 4G70B 4OCYH 4ZUVA 3ZJAA 4F8PA 5E8PB 5I1AB 3TJEH 2AJ3B 4NJ9H 5AVZB 3GLAA 5FW8A 4LCIL 3ARGB 3ARBA 4ZBJA 4WEUD 2G30A 4NXKA 4L8BB 4DP5X 4XOEA 3KD4A 1A7RL 3BVDB 2P8MB 2Y1VA 4DGWC 3OLEA 1MFBH 5FO7B 4HPOL 5IBLD 1FFPA 3H85A 3IJEA 1A4JB 4U2ZA 3SE8L 3MRLA 1TZAA 3NK3A 3GS0A 5KSAA 1HILB 1KWKA 2UV3A 1WTGT 4OLXH 5I1IH 2AQSA 3OLGA 1HYSD 4L4VE 3VB8A 3E6HB 1T7XA 3HG1A 4JRLA 5KBNC 3RIAK 1L7IH 5C7ZA 4JCWA 2YUVA 3RU8H 4QRSA 4HFWB 3QJHA 5EUKA 5ITFA 1HI6B 2V2TA 3L7EB 4EDXA 3A6OA 4JFED 3EGDA 6PCYA 5DC9B 5KAQF 4Z7UE 1JMZA 4Z7OE 1N68A 2EC8A 1EZLA 2WC7A 1J0IA 2DYPA 4P4KB 5GZND 5JHLA 5I6XC 4OI8A 2X89D 4UQCA 1VLXA 1G0YR 2E7HA 35C8H 3BQUC 3NPZB 4U1MB 5HSFA 1MY5A 2GEQA 2YD3A 4KHTL 5ECJE 4W93A 1SOXA 2OI9C 3BZ4B 1MAKA 2WLHA 1KB9J 3GMLB 1XAUA 5DA0B 1X3DA 3PWPB 1A65A 1QO3A 1TU2B 2W1NA 3QIUB 4F7EB 4BIKA 4YWGL 5L2KD 2XJLA 5DO2C 5HYJE 1M1SA 4D0DB 1FRGH 4UMGA 2HVJA 2DZEA 2EIDA 1RZIA 2XQYG 5DJDA 4RMTA 3IRPX 1NUNB 4WO4A 3ZGHA 3U4AA 3O4LB 4B7LA 3D0AA 5ISZA 4DH2A 2IAMD 3F6LA 1FSKB 2OX5B 4YPGA 2CK0H 3R18A 1JZGA 2I7OA 4ERSH 1RL1A 1VEMA 4P2QB 1I3RA 3A47A 3T5WA 4XAKD 32C2B 2KT6A 3C9NA 1SZNA 1V3KA 5CS7A 4DN3L 2RTTA 2RALA 3VI4E 1EO5A 2E6PA 3T6VA 3PHAA 1KULA 1KTKE 3B8SA 1LYQA 3FQ4A 3H8NA 1CJYA 2YRBA 2D7MA 5F7EH 1KUMA 2JB6B 5CILL 1I8IA 3HI1A 4K7FA 1NM9A 4H44C 2FT8A 5GSVB 3ZO9A 1W0WA 2ICWI 2X09A 2I9LB 3IK2A 1YJDC 3MRGA 1CR9L 4KOBA 3VGFA 2W65B 1TETH 4PMFA 3FHQA 3FSZA 1JXDA 3FFCA 1ORQB 2K3HA 1ED3B 2FEDC 5B4MC 2DH2A 3R1GL 1JNJA 2PMZA 4CADB 1GSMA 3AM8A 1NAKL 7FABH 2ZPKH 3L2NA 4ODWA 3MLTB 3QULB 4OCLC 1UH3A 4P59H 1MIMH 4E9QA 3GSQB 4U3HA 4EIUA 5EIQA 1OAZH 2Q86B 5HYEA 2OJEA 2DQUL 3K6FA 5AKVA 2PUQT 4LCYA 3CVHA 5CZVH 4F1ZA 1OOWA 1FFNA 5DZ9A 5IEKB 4OUUB 4Y16D 3LIZA 3BD3A 3UAAA 3WLBA 4PN6A 4MVBD 3TC9A 3OAWA 5C9KA 4LQ1A 3QBTB 5E6SB 3ZHDA 1OP9A 2JJSC 4ZAKB 2X2IA 4FXKB 1B0WA 4LP8A 3DGGA 4BH7A 1L0YA 1Q0XH 3L1OL 2JVUA 4GRMA 2GCYA 1PQZA 2GIMA 5ETUB 3B9KD 4M7ZC 3SY0B 4C56D 5LKNA 3FDWA 5LGYA 3W2DL 2GQHA 3KCWA 3DIFB 4QTHA 1UKQA 3AVEA 4FQHA 4K0OA 3CZUB 4OZGA 3ULVD 1WA2X 4FI6A 2DYSB 3DOHA 4KAQH 5IMKA 5I0YA 4RAVB 4BA0A 3DTXB 1GZHC 3S88L 5ANMB 5J0BA 4PY7B 5DHMC 1SJEB 2NYYD 3BSZH 1SPDA 2B16A 4NHCH 2ED6A 2HVKB 3HVNA 5FCUL 2XKNA 2HTKD 2HX7A 4N0UB 4XMWA 4CMMA 4QXTA 2ZXCA 1D2OA 1UQSA 3IE9A 3JZ7A 1MJ7H 3A3YB 4YX2L 4HMCA 1M05B 3EJSA 4UANA 2P8LA 1AP2B 4IBLT 3ZYOA 4IOFD 1NKOA 5ITBH 2A77L 2VDNH 4D8OA 3VSTA 2GUYA 3WIHL 4H0GA 2Y06H 3BKCH 4WUKL 3CVCA 3IGLA 3N9GH 1T89A 2VUOA 4G1EB 3DXAB 4RGOL 2P5EA 2FZ3A 3W82A 2JH2A 2UZIH 4TS6A 1EANA 2YD6A 1CYWA 1S78D 3F00A 4WGVB 2X41A 4LLYB 4KKBD 5BZDA 2F5BH 3O6MH 4L3FA 2W0KA 2DQDH 2Y1YA 4PRAA 5IJBC 5CHNB 2DDQH 1U8CB 1D6VL 2Z34A 4HQQL 5AALA 1MOEA 4KFZC 5TGBB 3C5XA 4IBWA 2ZWKA 2B1HL 3ET9F 2N1TE 2E4TA 5DD1H 3DYMA 1MHCB 3NSYA 3O3EA 1ZIBA 4YUEH 1EZUA 3FF8A 4R4BB 4Y5VC 5DHEA 2EUWA 3VXMB 1RMFL 5B1JC 1T1YB 1HAUA 3ULUD 4CW1A 2I26N 3OB0K 4JKWA 4R5TA 1KIPB 2WPGA 4K23L 1JHKH 4X0KA 2QR0B 3MRFB 1EO8L 4DZBB 1I1AD 4B9PA 5EEVA 4UMSA 5FDWB 5C0AD 1GC1C 5I74B 3RFRA 3BAKA 1MCOL 1CICA 4KQ3L 4YJZL 1F41A 1DBMH 2XQYK 3OX8A 4OFYA 2VLME 4UV7H 4L9DA 3ZE0B 1L9TA 1IX2A 4JQVC 3T4YA 4P2OD 2EUXA 5EBLB 4Y4FD 3ZGIA 1BQLL 4XODA 5GGQL 1I7UB 1O7DC 3QE5A 3DX7A 1IRAY 5D4QA 1I9EA 3MRJB 3PIQA 5T33L 2CR6A 4M56A 5EZLA 4Z7WB 1ZLSL 5I6PA 1FNSH 1LWJA 1T1WA 3OJMB 4G8GA 5EEYA 3IDNA 1EMTL 1F2XK 1GY1A 4BUHA 2H0FA 1E4KA 2Y2WA 3EO1A 3QEQA 4L9LA 4MCZA 4X9GA 1Q4NX 4OIBA 4PGJA 3KPNB 1XMEB 5HHOD 2JQMA 3JV6A 2GW5A 2V6HA 3THML 4IIQC 1ZT7B 3BVWA 4KRPC 2H7WA 5A40E 1BQHA 4GRWH 4NO3B 4JJOA 5I1KH 3ABZA 4LMQE 1PAMA 3KWXA 4Y89A 4OGXL 1PD1A 1TJXA 2VT0A 5GRXG 4YHOH 1ZJBA 2ZZUT 4QRRA 4FHKA 1G9ML 4GI8A 4PTTA 4QRTA 4L23A 4HJEA 3N1GC 3G6AB 3DRTA 4DP2X 2WVVB 4O2FA 1UWXK 5EZOH 2O5ZH 4LMQI 2BH0A 2P5WA 1WFMA 1E7UA 3FT3B 4YXHL 4QXWA 4ZUTB 4KK8C 1E6JH 3QR0A 3AY2A 5KTEL 1RULL 2B1OA 3T2QA 3RL1B 5EUOB 4HH9B 1JG9A 3HG5A 3AG2B 5DURD 4BSVA 3DUSB 5DJXA 5IB2B 4M29A 1IZJA 2WCPA 2NX5E 1KV3A 5I18H 2YMOA 5IT2L 4JRYD 3DX3A 2CRYA 4RVBA 3NIGE 4YE4H 1PZBA 3CE1A 2CWRA 4HKBB 3L2MA 5T1MA 5G5DA 1DJGA 4N0FB 1FCGA 1KG0B 3QIBA 4FP8L 3HUJE 4PPTA 3BUBA 5E2TL 1ZSDA 1X7SA 4ODTH 2CMRL 3C2SA 4Q4IA 2FL5B 2VLKE 4AL8H 3CFQA 4LOUC 3QDMA 4NAQA 1VFOA 2MIZA 3WKML 4BDVB 1PD6A 3FZUD 3Q8BA 2PWHA 1J11A 1A6WH 2HB0A 4CA4A 1OXYA 2WAQA 1I82A 1X5ZA 2BNUB 3NSDA 3BUPA 4PM1A 3ME0B 4UI2A 3LNGA 3ESPA 3U25A 5D4HA 4AEFA 3LKRA 4Q6KA 1DQDL 5I71B 4V1DA 3VRIA 4K94H 5AQ0A 3TV3L 3CFEB 5LAXA 1PSKL 5E0QA 3U1SH 2YD5A 1EZSA 1FZMA 2OMNA 1MCKA 2GJ6A 3RAJL 4NQVB 4S1RH 3WENA 5I75C 1O6TA 1PPIA 1QFUH 3STLA 4LLQB 3LH9A 2CUIA 2W0LA 1L4IA 1PYWA 1QTPA 2ENYA 2OSLB 4TUJA 5FGCB 3BVTA 5K9KB 2DN7A 3T2PA 3SKUD 2F18A 3RBSA 3QCTH 4ATTA 5FECA 3GLDA 1BZ9A 5FKPA 5T5FA 4JQIL 5E2WL 1H0DA 1KT2A 1AKPA 4MJ5A 1OF2B 3P4LA 4P2RD 3V0DA 2BDNL 1JN6B 2E9BA 4IJ3C 4R7NA 2V5SA 4XHJD 3A4DA 1Q72L 4HCRL 4KH2A 3L3JA 1F11B 3H0TA 3IJYA 1ID5I 4J5VA 3SD5A 5HI3C 4XWOC 3WL9A 1ILUA 1NJ9B 4UYQA 5DMIH 4U6VH 3GBNL 2VISA 5DJ0A 4PHXA 3GI8L 4RMBA 5KVDH 2I5YH 4PS3A 3NFPA 4NUJB 3US0A 1YVLA 2H1XA 4LARH 3STZA 3HJEA 1FYTB 2NOYA 3MLWH 2WKGA 3MV7B 4MYPA 3FT2B 2YBRA 4NLAA 2WUBH 3KLQA 1AGEA 4FQJH 1N0XH 3F7KA 2X53A 3GSUB 3DURB 4BUGA 4N0CC 3C5ZC 3VXQB 3FRUB 1FYHB 2XWDA 3CN2A 4HSQA 5FK9B 3ZU8A 4FABH 5FS5A 1TJGL 3HFMH 4KNUA 1X5YA 3HG0A 3JTTB 2GEEA 5EWIH 5F7HA 1BFVL 1PS3A 1JP5A 3QDJD 1GOHA 4NGHL 3VDAA 3TVMA 2APBA 1DQLH 4XMZA 3K6IA 1Q0YL 1S7RA 2W0FA 2L04A 1TZHB 4QHNA 1ZGLP 3Q05A 3ZUNC 4PJHE 4HLZG 2MSPA 3FRPA 3CHRA 5GIRA 3FB7A 4JFFA 2DKSA 3LN4B 4LVHC 4MJID 5DD0H 5A2IH 5KS9F 3GSXB 1WEJH 5AZ2H 1WWCA 2EYRA 4ZMZA 1WICA 5F88A 4NNPL 4CVXA 3JQOB 1ZE3C 4XN2A 3TN0D 2GC4C 4LVEA 2VDOH 4RAUB 2VR5A 2UY7A 2JJTC 5D2NC 2EE6A 2ZXQA 3FQWB 2WTRA 4JHWL 2VAAA 4F7KA 3LPOA 1S8DB 1BFTA 3OKNA 1CFTB 3ZDZE 5F6HI 2DWSA 3OAUL 1G7QA 3WNKA 2OL3H 1UWEH 2XZZA 5AVYB 2X3CA 5A7EA 1IAII 2EC9U 5LJYH 5D7JB 3P4OB 3GRBA 5E5MA 5C2UB 1AQKL 2GT9A 2WWKT 1BIIA 5F44A 3S96A 3GS4A 4BZ1L 1J5OL 1IT9H 1SYSB 3LKQB 1LNUB 4GG6E 4JPWH 5IHZB 1MI5E 2LFGA 2IWKA 1DO5A 2MHAB 2IC2A 2DWXA 4XH2A 5BXFB 5CP7B 3MNMA 2VABA 1MCQA 1EVTC 1EEQA 1L0XA 3X14A 4NZTH 4JM2C 2ROXA 2V2WB 3L9YA 1CGUA 5F70A 1HHIB 4Y19E 5ALBL 4FG6C 2Y22A 4G5ZL 1BZEA 2IBZY 4DN4L 2WQXA 4XPHH 1CBVH 1S7UA 4H1LH 5F9OH 3IYLW 3GPSA 4S1QL 3QCUL 2XRAH 1IEHA 1O6SA 4QT5B 1DP0A 3DO3A 4KXZH 4ZFZA 3B6SB 4LSUH 1TMCB 4WWKD 4EI5A 1I8KA 1NPJA 3CFBB 2C3HA 3KPMA 4MZRA 5SWZB 1Z3RA 2J73A 4JFEA 5HDBE 4PJAB 5BZXA 2AXFB 4GKZA 1QBBA 1YY8A 1ZKAA 2ITDB 4ONGH 3MROA 3VX1A 3DGCR 1KNOA 4YHIB 2F7PA 3CQFA 4ECNA 4OFVA 4MAYC 5I1DB 5IV2B 2X89A 4AKPA 1ETZA 1CK0H 2AQRA 1XAKA 2K1MA 4IKIA 4Q6IA 4RFOH 5AWNH 5TE4H 1EJOH 1UHVA 5CSGA 1HJBC 1KGWA 2NY1C 3F05A 2VMFA 4JDTL 3O3BA 4IDJH 3T2LA 1CLZH 2ZOWA 4R4ND 5EMYA 3RKDD 1URLA 4QTFA 4UT7L 1E8YA 4ZW6A 1HSBB 2QELA 3E8UH 2WLZA 4PV9A 4HWBL 3TYFB 4R2GB 3F6JA 3VFMB 2TSBA 2RACA 3QNYA 1JV2B 5FDYA 1AANA 2GPZA 2ZWZA 3CQQA 4XO9A 2ATPB 1QHOA 5KYUB 2IAMA 4LSVH 4W4OC 2BERA 4GRWB 4OD1H 1DBBL 4R4FH 2EXYD 5C70A 2YN3A 2XJKA 3I6GB 3IFLH 3LB6D 4ZX5A 1OGAB 1SHXA 1V55B 2PPCA 1R5WB 1UM4L 1JNLH 5EOQH 3MJ7B 2NLJB 4ORGA 5BRZD 3EFOB 2X4NA 4MMYA 4ZMXA 1PFCA 1ZCRA 3SGEH 3ETBF 5I17B 1HHJA 1F58H 3D3VB 3IF1B 4FFVD 4JO3L 3FT0A 1IC7H 1ZHKB 3O45B 4BCYA 1V05A 2CJ3A 1B0GA 1UXSA 1KYOK 5LWYL 1HX0A 2YKLH 3NSJA 5A2LH 4AKQA 5BS0A 2QVIA 1YUHB 5IGXL 4PREB 3PWNA 4AX3A 5D72L 4RBPK 3PDDA 1TCMA 4JG5A 3FUIA 2PTTB 4XBEL 3REVB 3TNMA 3VFOA 4DEPC 2PW2B 2NY5C 3MBED 5F3BA 2LLLA 3WFDH 5DRNB 1F0LA 5CEZH 1BVKB 1TJHL 3MPCA 2JI2A 4N1EA 4XVTH 3TO2A 5HGHB 4H8VA 3U9UA 3U83A 1JD9A 4ZQKB 4UOW1 4E68A 1G0XA 3ML8A 2AXHA 2BCMA 4WI9A 3B37A 1P5VA 1TTBA 2XQYA 4YBQD 4WFFD 2QLVB 3BSHA 3VB9A 1NLBL 4JLRB 4NQSA 4GPVA 1OQXA 4Y16A 1R9FA 2QPEB 4MA3A 1MFVA 4HUMB 4RRPM 3F7VA 3LH2H 3P11L 3P3SA 1JHLL 4G7QB 1WF5A 4ISVB 2X4TB 1TO4A 2XG5B 1JGLL 4EIBA 1GHFH 4YNYB 4MASA 1O9WA 4YDVA 3NVQA 1CGXA 1RJZB 4XVUC 3S5LA 4N0YH 1ZA6B 2H3KA 3DSFH 3B9KA 5IBTL 3H9ZA 3MYJA 2YXWA 1YO4A 5D7IB 2CJUL 5LVEA 3AS1A 2TAAA 2J1ZA 2C7FA 2FQGA 3ISRA 5T1KB 2OQJB 3T0WA 3NPSB 4P5SA 1YNKH 5TFSH 3H6AA 1E5CA 2VDPB 3LS4H 3PXLA 1I3GH 4OJAA 1JF1B 4P5KB 1R0AL 4X8XA 1KGCD 2VRQA 3RTQB 4MAUH 4P2CG 1WC7A 2Z31D 3NA4A 4W9FC 1GZQB 4PWEA 2IXQB 2NRDA 3NIFB 4PVNA 4KTEL 1XR9A 2UXFA 3O81A 4HMEA 4HUWB 4XBMA 5T3XH 4WI8A 4DCQB 3FO1A 2FD6L 4G9DB 3QJTB 4U6HA 5I19L 1VDGA 2DQFB 3H9HA 1T4WA 1RY7B 3IJHA 4G7YH 1OTTD 4PI0A 4PHZA 5DHYB 5HHQA 3SDYL 5CGYD 3TOPA 4E9RA 4FTDA 1NA8A 3T4AA 3TIEA 1LD9A 2IV9A 2N59A 4TF4A 3V6FA 5PAZA 2BINA 1NH6A 1J8SA 3UP1A 3GO1L 4AYSA 5E6IC 5E70A 5GRJH 5E0FA 3T0XA 5J3HD 3ES6B 4YGAB 3TURA 1RZFH 4HHGA 3RVUC 3U0TA 1T1XB 3E9TA 4LRIC 1H6EA 5TJWK 3QNZA 1IEAA 2OMXA 4KX9A 1AI1H 2A3TA 5FXCH 4G7VH 4JKLA 1O0VA 4R7DA 4ZUWB 1AR1D 3TEYA 4ZO9A 2IGLA 2IPUG 3A22A 3WS3B 4KUZL 1FIEA 3GSWB 5JR1L 2ZKMX 3OZ9H 1GA2A 4NWUH 4XC1L 1K8IB 1BF8A 3O2WL 3PABA 3V0GA 2OR8A 5F3HB 5HYQB 1CE6B 2K0RA 3RQ3A 2HXAA 1EHNA 5C0RL 4N87A 2XWBB 1AAJA 5DC2A 3RIAF 4HVBA 4N26A 4TVUA 1I1AA 4KTDL 5IKCA 1VJSA 4A6YH 1SXSA 3D0VB 2ZF9A 4HUXB 2AABH 3ECWA 4HD5A 3LSOA 3I3EA 5C0AA 4OZHA 4JAMA 3ABKB 2CXGA 2QADB 2VLJB 2WQSA 2WNXA 3UYRL 1MUJA 1OLZA 2XX0A 2ZCHH 3BX7C 1SXCA 4OR1A 4XX1G 4KO9A 5DMJB 5HI5D 3D12B 3KLDA 3HC4H 3DX9A 5I8EA 1S7VA 3QFDA 4AMKL 2OMTB 4K3DL 1ZGLB 1AQ8A 4P3CL 4E5XA 1G7MA 2IFGA 3RWIA 2FWSA 2MOVA 5CD3B 3Q2CA 2HX8A 2UXTA 2X4UB 4K71C 3SYAA 3T0ED 1XF4B 4OLXL 1GOGA 3VRJB 1XX9C 1VERA 1M6OB 2LTQC 4ZX4A 4U05A 4JDVB 1FFOA 4M00A 3BZEB 4GAGL 3MNWA 4L29B 3F5WB 2VXUL 3NAAL 2HKHH 2BCKA 3L1FA 5EU5A 3OQ3B 4MXQC 4OFYD 2PP8A 2PR9A 4XCEA 4F58L 3TO4B 5HI4D 1U8OB 4MDJA 4NKOA 1KLFA 1BXUA 3ZTDC 3OXSA 1FLRH 1EJFA 3BD4A 2F6AA 2YEZA 3PNRB 5ESAB 3E80A 3EYUL 3P1VA 4M4RA 5J1TC 35C8L 1UVQA 4U1KB 3EXLA 1FGNL 3BFWA 1JGUL 2ESVD 5DVNA 2NTFB 2VO8A 4Z7QB 1AJ7L 1NIEA 3DLQR 4I1NB 4LVNB 4H1LB 3MVSA 2ZKXA 4JB9H 2HJFA 3O6FB 2LLGA 4AQ8C 2XQ0A 3GK8H 2EADA 4TNEA 4XAWH 3TCTA 5HVHC 1FRGL 4OFQA 1D7CA 2DEYX 2JNZA 4NZJA 5EU3A 3TBWB 1U3HC 3GSVB 4N6RB 4AZ8A 1U3JA 2APWA 3QEQE 43CAB 2XTJD 2VAJA 4J3OG 4RDBA 3ZDYF 2N4IA 5IIEA 1EVUA 3G6DL 3V4VL 1OE1A 2CK0L 1EUUA 4POZC 1OB1A 1RU9L 1JGDB 2A38A 4DNLA 1EEZA 3GLZA 4L1SA 2R9HD 3DHPA 1HKFA 2C3VB 4QRRE 1O7SA 2EVJA 3SKMA 3CFDB 3A6BH 1SM3H 1W72L 2VDRH 1PZUB 2DQGH 2YMXL 2GTQA 2P5WE 3LNDA 5J6HA 2R1YB 4PJBF 3W0WB 3QC6X 5B7FA 3UG5A 2PWGA 1Q94B 1TNMA 2QBWA 2F58L 3GSNB 4NZUL 1CL7L 4X99B 2BY2A 5CN2A 3BEWB 2HT3C 1M2VB 5IK3A 5JPNC 4L37A 1ANUA 4F5CA 1Z9PA 1UCTA 1M7IA 2B4CC 4R0LB 4ZTPH 3RY4A 2I9TB 2IWFA 3KWWA 2CKBH 1VGEH 3LEYH 4KROD 3T3PB 2CBOA 2Q6WB 5GXBB 2ADGA 4HOMA 1AO7B 5AAWC 7FABL 1TJIL 3HPJA 4IRSC 4L5FL 3HAEH 4Y8DC 4P59L 5JORB 1CIUA 2AMGA 2XVKA 3MLSH 2I25N 3QYCA 3BUYB 4AQAB 1L7TH 3CSYB 3IWUA 3BAYA 5FYKL 3QDME 2EIMB 4J3OD 4R7LA 4H4NA 4NQQA 1TZIB 3GMOB 1G9NL 3OAYK 2FB4H 4JO8A 2B0SH 3EZ8A 4AYID 1T03L 3ZBMA 5FYJU 1OAUH 5IB5A 2NR6D 2WXHA 4HC1L 2CIIA 2K6WA 4X4XB 1TTFA 3EDFA 2IH1B 2MNUA 1C7TA 4X7TA 5ACMA 1ZA3B 1XGZA 5FGRA 4AIEA 3MO1B 3WN5B 1JGEA 2BS9A 3RUGA 1NGPH 3N42B 5CWSB 3TNNA 5M94B 4KKCC 5LXGH 1F45A 4I0PA 2GJ6E 3MOQA 3G04B 3GI9L 4PLKC 4OZFH 4FFTA 4G43A 5FO8B 3MX0A 4YSRA 4OY9A 2GK0A 3RWHB 2FJUB 2Z92A 5FIEA 5DWPA 1U93B 1ITBB 5FYJE 1TLMA 3PFUA 5D96B 4X6CF 1IGMH 3LQAL 4HIPA 2GFBB 3CU7A 2O5NA 1F4XH 3AWEA 3DVGA 5G2NA 2WJ7A 5AUMA 1A1OB 1OP5H 3PNWB 2Y69B 4UM9B 1MJ7L 1IJ9A 1KXHA 3DIDA 4QYAA 1WWAX 4FGMA 5AKTA 4PGEA 2YD0A 4GAAA 4YDKH 2ZNWA 1IC5H 5DFVC 1CVRA 1MZZA 5DTFB 3T6ZA 4ZYKA 3LV3B 4WSJA 1RH8A 3VFVB 3BKCL 3VYNA 4WI0B 3N9GL 2K9FB 1JZ2A 2CGRL 1DN0A 1WAAF 2BSBA 3MSPA 3T1FA 1I9RH 5JIIA 4W9HC 1ITCA 5FHBH 3GEWB 2KERA 2Z91A 1DFXA 4U1GC 4XP6H 4JCLA 4P4KD 3M07A 4XHQA 3APFA 5E1IA 1RIHH 3SE9H 2Q10A 1YAIA 1RUMH 4KVNL 4KY2A 3NCYS 3CHXA 4TVSa 4XI5D 4W1TA 5C0GB 3B5GA 2BVPA 3VFWB 5K39A 2HFFA 2J57A 3JWDC 1PEWA 4HDIB 3QIUD 1J1PL 4KKLC 4LAQH 1RVFH 3HRZA 4PRBA 2FWLB 4WO0A 3RNKA 1GS8A 2AV1A 3MDJA 4JFFE 3MRBB 3BVXA 3O4LD 3VWKB 4FYTA 5DMGD 1E4XI 3FTXA 3I6LE 2APXA 5F97E 3ULVF 2QKIA 4XWGH 3OJVC 2Y1ZA 2GIXA 1OE2A 2YXVA 4XCYB 5DZNA 4DVBB 1F4WH 1QACA 2B2XH 2VGLM 1I9JH 1ZLDA 1X7TA 2PCFA 3CDGA 4FJ6A 1Q9WA 1OAQL 4EUPH 4PSRA 4YBLC 5H2BA 3QJFA 4U1IA 4ODXB 3PV7A 4HGWA 4JFXB 2XPGB 3ENEA 4RMWA 4LCCC 2J8OA 3W56A 3NCBB 3O2DH 1FL3B 4UDTB 4RGNE 5HPMB 3GJFK 3LRGA 2YEQA 4WTZA 1B2WL 3ISWA 3EO0A 3PGFH 5CLXA 3MJ9L 3SY6A 1BIHA 4AV5A 3F2LA 4PBWD 1WCQA 3WJJA 2VSDA 3QIWC 1HTYA 4XP9L 4KJPD 3P40A 3SPVB 2VW7A 2O5YH 2OYKA 3QA3B 4OTXL 1XH3A 1BD2B 1NEZA 2WINA 4FQXD 1UACH 4NAMA 4NO0B 2XWJA 1SFHA 1WA0X 1N6VA 2DQJH 1A3LH 5KSUB 1KXTA 3IDGB 4GSUA 4NO5B 4DOHE 5B22A 2BWDA 1BAGA 1CDYA 1EEYB 3FCTB 1NKGA 2DMKA 3X11A 5I1HH 4LDEB 5FO9A 3WO4B 4Z6AT 1KWGA 5EA0L 1PL3A 2QL1A 1H3PH 1E6JL 4NN5B 3PGCA 3GT6A 3ULUF 4GW4A 5K9QG 1TEYA 2BPBA 4ZAKD 5MERA 1AZZC 2PW1A 5D2LF 1NGWB 2IPKB 4ZMQA 2X2YA 2UWEA 3IN2A 5DZOA 5TDNA 5KZCD 4X6EB 5C6WH 1UD3A 3L4VA 2QGEA 2W0PA 4E9SA 1KGYE 4RWHA 1RFDL 1KF9B 1MWAH 2WYTA 3M1BB 4GKSB 3VXRB 1BF2A 4NZDA 1MJ8L 5B38B 3FQXB 5I15H 1KTLB 3NQKA 4W9GC 1WS7A 3GYRA 3LZNA 4M5YH 4N8CH 43C9B 2KC0A 5I5JA 1U91A 4DAGH 1E50A 2NSQA 5C0BA 5C8JA 1J05B 3EHBB 3F58L 3UTTB 1RLWA 2PXYC 2VZVA 1AXSB 4OU3A 2PCYA 1AHWB 1QFWM 4DUXA 3FOMA 3EOTL 4F7MA 3TWCH 1XF5B 2X6AA 4FADA 4YZWA 3TYGL 3ZE1F 1WHOA 1JWMB 1R5IA 2ZYIA 3SDDB 4Z7NE 3WD5H 3QUZA 2DQHH 4OV6F 1GGCH 4K94L 1H9VA 1QW9A 5DD6B 1L9PA 4AIXA 4X5PA 5I9QC 3DXAD 3R4RA 5D7EA 3S3JA 5IJDC 1C9SA 3MBEA 1XF1A 2UVEA 3HOGA 4HJJL 2X6VA 4PJ7B 2Q20A 4L3EA 4E9TA 4IRJC 4NENA 1TQTA 1KXQA 3UAFA 3ELAT 4FZ8L 4AIZA 4MNGE 1RK1A 2VDPL 4PGZA 5F93C 1VA9A 4FJZA 5DEZA 4KUCD 2WGXA 3FF7A 4M03A 2PPFA 1XGYH 4UOQA 5E00B 4R3SA 5BS0E 4G8IB 1ZVSA 1GGIH 3M88A 3QXDB 2F54E 1E42A 5I8KH 3BPCA 4CSSA 5DMIL 2CKBB 3HE7C 1C8QA 4A37A 5JO5A 1WZLA 3WIHA 5SWSB 4IU3B 3WNLA 4QRFA 5BVJA 3FFDB 1P53A 4KQ4L 1ETB1 2BVUA 1FA4A 5HBBA 1EBAA 2RQEA 3VXUB 2AJXH 1U92A 2O1AA 4D9QE 1XCTB 3Q6FB 2UUDK 1QSFE 1RIUL 1YQVH 2JTDA 3QQ4A 4M1CC 1A6AB 1E2VA 4ATWA 1AIZA 3FL7A 4ZW3A 3FCGA 4IGBC 2C3XA 3BPOB 3HS8A 3D2UB 3L3OA 3RGVA 4M8VA 2PPEA 1NFDA 3HZYA 2O6CA 3HFML 3VI3B 4F2FA 1JS4A 2D3NA 3HN8A 4G1MB 4I4WA 4JFQA 3D06A 3KPTA 3O4OB 4JG0L 4NDMB 4WY7H 5EWIL 2WLMA 2MCMA 3I02A 3ZR6A 2YMTA 3SDAA 2QGDA 4N5UA 4ZJ9A 2DIEA 4R90H 4QYOA 3E8VA 4E9YA 4N2LA 5I0ZA 4NM4H 2H26B 2H2SD 4OZFB 1F3JA 3D25A 5DO8A 4OJCA 3TGXA 4PJCB 2VMDA 2Z35B 5TE7H 1NDTA 3LKNA 4UTAH 2IH3A 4QLWA 1CLOH 2BFGA 4G2AA 2EKJA 3NJLA 4QOKE 1GR7A 4L4VB 4NKMB 3TCLB 4YHML 2ZF8A 1T20A 2W9DL 3QORB 5I1LB 3WIFA 3WE6B 4MDIB 5F7AA 1HJCA 1JK9A 3MLYH 4KO7A 4YDLC 2R2BB 5CMAA 1Z2KA 2IQAA 4XBGB 4AGLA 4Z7UB 3N04A 4Z7OB 4LLWA 4B6ZA 3SDXF 2AK4A 3ETTA 4WI3A 1W8OA 1I8MB 3BQVA 2GAZB 1ASOA 1N9PA 2CHDA 3RVVC 3MCLL 2WLIB 4PCSA 1E67A 4WFED 5LN8A 2J43A 5DS8A 4YHYB 2WAHA 4I48B 3EG9B 5GJSH 4RZKA 1G7JA 2R29L 2PCPA 4F8NA 4KKZA 4ELMF 4PP2A 3BDYL 1DVTA 1CPUA 5KUMA 1IB5A 2PYFA 2VNCA 5HYJB 2BVQB 1JZIA 1G94A 1XSIA 3AS3A 1Q9OA 3VCLA 1IT9L 1FP5A 4KITB 1LEGB 4JPWL 1WCBB 4FC3E 4Z3HA 2LVCA 1JXKA 3ECUA 1ZXQA 2VMCA 5D6DA 4N25A 2A9DA 2MH4A 4WDIB 4PLNC 2R2HA 3C5JB 4FZEH 3LX9A 5GRUH 4U1LB 3FTWA 5C0DA 4ZTOL 4HBCH 4JO1L 4XPHL 3VI4B 4OJDH 3RB7A 4LBEA 1CFVL 3G7TA 1N6UA 3DC0A 3D0LB 3PL6B 3MRQB 4GI6A 1VSCA 3SDCB 3T0EA 2LR4A 2Y6SD 4JPIB 4XVJL 2XZCH 3MUGA 4M1DH 4FQQA 4HF5L 2JXMA 3BP4A 2EQDA 2UZYB 1U8HA 4NUGL 3X1BA 1B3JA 2HT2D 1EIBA 1K4DB 4JHBA 4XN1A 3T3MF 3HB3D 5C0AE 2JKWA 5C9JA 1VFBA 4NM8L 2X70B 1IU1A 1KJ3H 4ONGL 1VHPA 3RZCB 3VYPA 2DQEL 4HKXB 4G8EA 4MXVE 3D18A 1XSOA 1DJWA 1HHHB 3AQXA 2YPLA 2ZIDA 5DFAA 1G5GA 3Q8FA 4UINL 3LQZB 1BVNT 3PCYA 2WXOA 3ZY7A 1M1XB 4RFOL 5FPIA 1ACCA 2DICA 3NRQA 4UQAA 3VUAA 3SZKC 1A2YA 1ZANH 2MQ0A 1UKTA 1KYOJ 4XNYH 2H9GB 1R3LB 3NCYP 4IDJL 4C83B 5F89A 5GS2D 1DJZA 4F80A 4ZMNA 1A7BA 3FO2B 3VXSB 3V0WH 1L9SA 2J5WA 2IBBA 3E8UL 3GSNL 4QWWC 2FHBA 1P4IH 3FUEA 4MMZC 2R0ZH 2MTPA 5KVGL 1WGOA 1MLCA 3DK2A 3E2HC 3HFFA 3BLBA 2X4RB 3G6JA 1NMCB 3K2KA 3SE4C 3VD7A 5HYIA 1KJMB 4LSVL 1UM6L 3MJ8A 4M1GH 5D93B 5LCVL 2V4LA 5T1LB 3U6XS 4JANA 2F2HA 4MS8C 2HA1A 4FXTA 2YAOA 3MV7D 5D55A 4OF7A 1YJDH 3OHXC 4JHZA 5E24E 5GGVY 3IJ9A 5FYKD 1OT1A 4HXAL 2FJFB 4LSTH 1SMDA 5EOCL 3RBGA 4XMPH 2D7OA 5AG8A 2DM3A 1DEEA 1N5AB 2OJZL 4ZDHB 1MHHB 5AW3B 3I84A 1U9KA 2ODHA 5DUJA 5EFIA 1MFDL 5IP4A 3VFTA 1D5XA 3QWOA 4KHXH 4HCRA 2D3LA 1DANU 2IF7A 3VQ2C 1IBFA 2CO3A 3UEZA 2G9HB 5JPMA 5HJ3A 2MTAA 4QTIH 2K3TA 4EBQL 2OCCB 1IQDA 2UZXB 2V33A 3H3PH 1RURH 2EJ1A 3C2AH 2P8PA 2WXRA 5E08H 1MWAB 7TAAA 2AEPH 4GP4B 4Y5YA 1UA3A 4DKFH 5EU4A 5CEZL 4FQPA 3GF8A 1NL0H 4X6BB 2W60A 5FKAB 1NCHA 2WB7A 3MTXA 1C5CL 4WWID 4X4MA 4LE8A 2OTUA 1LO3L 2ZOKA 4TYUA 3CU1A 3RNQB 4RH4A 2WBJB 3FKUS 1YEDA 3A21A 2VDMB 3US9A 1XGQB 2UYLB 4A2HA 4QCIB 2OK0L 1E30A 1MF2L 3GIVA 4CKVX 2Q76A 3QJZA 3W38A 5IQ7H 3X17A 3SYPA 1J8HD 4HFUH 4YLQT 2B1AH 4LK4A 1BQKA 2AERT 5J57B 1DVFD 3BPLB 2AJSH 4F3FA 4F5CE 4ZUSB 2FGZA 3WY2A 5DF0A 4NSKB 3WFCH 2UWEF 3FONB 5JXED 2TSAA 2BS8A 3DBXB 3GHEL 4P2YA 4X50A 1VB9A 3WNMA 2QKSA 3QUXB 1VEPA 3P0YH 3RDTC 3L4ZA 3JVGA 3Q2WA 3TJHD 2BHFA 2D7TH 3FT4A 4QGTA 3BOVA 2NQCA 5DC0A 4X6FA 5DHVH 4LFHG 4Y4HB 4XO5A 3VFUB 1I3GL 4S0HA 3UTQB 2QZQA 1EHLH 1T2QL 5I1AA 1ZWIB 3K80A 3PG2A 3VXPB 4S10A 2AJ3A 3CFMA 1MCDA 3IGAB 4K7PX 4X0NA 1Y6NR 3ARGA 2I69A 2IJ0C 4L8BA 1A7PH 1HCVA 2P8MA 5AAMC 5FO7A 5E94B 2RQ8A 1A4JA 3K72B 4KY1H 4K7PY 3ARBC 3HMXA 3V0HA 1I7RB 1HILA 4WZ9A 4O5LL 5ADOH 4KZEL 5D7SH 3OZKA 3GRGA 1KLGB 1OM3H 2ITFA 3E6HA 3P69A 3QUYC 4P5TB 4GAFB 1WZAA 3VE0B 2WSPA 2FECI 5SWZD 1YDPB 1RUAL 4K5PA 1T0MB 3CVIL 5KSAC 3LYRA 4HFWA 1HI6A 3L7EA 4BZ1A 3X2QB 5IESH 1FH2A 4KK5C 1RZFL 12E8H 3RVWD 5H37H 5TQ2L 3MODL 4P4KA 1WA1X 2MCPH 3FH8A 1OGPA 2EYSB 3HKFA 3N55A 3NGBC 4JFHE 5LAPA 2YUXA 4G7VL 4APQB 3IN0A 4KKAD 2E8ZA 4HAFA 2DWTA 1XIWA 2QQKH 4ONFH 4PG2A 4P23D 4XNQB 1BV8A 3OZ9L 3BZ4A 4NWUL 4E42B 3GMLA 1GC1H 5ACZB 4PJFF 4LFHD 3PWPA 3QIUA 1TU2A 2BIOA 3MXVL 4F7EA 3US1A 1RIVL 3S36H 4D0DA 4R2GD 4LOFA 3FN0L 2BSCA 1EJ8A 3N41B 2UVFA 3VA6A 3ZT6A 4RLDA 4Y2DD 3VD4A 2H8PB 3O4LA 1NWOA 3D85A 2OX5A 3MRPB 1BJMA 1GIGH 1GW6A 3A4FA 2AABL 5DU7A 4K3HA 4X80H 1AKJB 3IEAA 4JFYB 4P2QA 5CIPH 2ZCHL 1OGAD 1EQWA 4Y8AA 1H3GA 2FLRT 32C2A 5LBGA 2AJUH 2NX5B 3RYMA 4HGKC 3V8OA 2BO0A 3CLFH 2X2UA 1IFRA 3HC4L 4X5RA 2OLDA 1OTSC 2WIMA 2XV2A 4MSWB 1S7WB 5E1QA 2JB6A 2CU9A 1S5IL 4XCCL 5GSVA 1R1CA 3D34A 2VLKB 4L8SC 3QI9D 2W65A 2W80C 4LQFH 2APFA 4XZUB 4N85A 1TLKA 1QNIA 4M3HA 4U1HB 4EPSA 3CFNA 1JDAA 1L9QA 1ORQA 3RL2B 1HHGB 1ED3A 1DQML 4LASH 4PJ5E 1H9DA 3PQYB 5IUCA 4MBRA 1P9MC 4NN7B 3VQMA 1QLRB 3BT2L