5T1JA

Crystal structure of the tbox dna binding domain of the transcription factor t-bet
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
192
structure length
192
Chain Sequence
KLRVALSNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGSMPGNRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEPEAACSASNTHVFTFQETQFIAVTAYQNAEITQLKIDNNPFAKGFREN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the DNA binding domain of the transcription factor T-bet suggests simultaneous recognition of distant genome sites.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords T-box transcription factor TBX21
total genus 29
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00907 T-box T-box
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.820 Mainly Beta Sandwich Immunoglobulin-like Transcription factor, T-box 5t1jA00
5BQDA 5T1JA 2X6UA 4A04A 1H6FA 1XBRA 5FLVA 2X6VA 4S0HA
chains in the Genus database with same CATH superfamily
1HKFA 4N2MA 3IF1A 4R97B 4ECNA 3DTUB 2FX8L 1B3JA 3UH8A 4ZQTA 1VZHA 2GC7C 2WOYA 3L4TA 3ILEA 5JW3L 1U2YA 2NY6D 1YUHA 1ONQA 5E2TH 1JE6A 2ICWB 2APSA 3L1OL 2YC1B 1O7DE 1WBXA 5FCUL 4UV4L 1QFWL 3EH5B 3FU3A 4F2ME 1RZJH 3ZGIA 4F80A 3CFBB 1I7TA 4OB5L 2NW3B 3V0AC 3KH4A 3RPKA 1W0WA 4PJHB 4ZXBD 5L9DH 3EOYG 4NKMA 3AY4C 4JG1L 2E8ZA 1Z66A 1JUFA 2BHFA 3EGXA 1ZWIB 3K8MA 4FQ1H 1XEUA 5DS8A 5ELIA 5I1LA 2B20A 1JGIA 4PW4A 1MCKA 4PY7A 5KVMC 5DD3L 3UG4A 3B9EA 3IJEA 1MCWW 1CFNB 1WEJL 3LKQB 5IHBA 4M6ML 3O11B 5K9KA 4JCLA 1X3DA 2X1XR 3V6FA 5EBGA 2DM3A 4JM2F 1U93A 1IM9D 1ZCRA 4I0PD 5AB2A 3PHOA 3P4NB 1CG9B 2ZWKA 3DJ9A 4S1SL 4X9YA 2MCPL 5AAPA 2O61B 2OL3L 2YQ3A 3T8XA 2AJUL 1RFDL 5DD6B 1UWXK 2AQ3A 4OZFG 4PGDA 3GSWB 4U3SA 5F7KC 3T77A 2OSXA 3BPOB 1OAQL 2BSTB 4YL9A 4B27A 3JXAA 4QRTA 3VYPA 4H1LG 4KQ4H 2OX5B 1UQSB 2HTLD 1ZT7A 2VMDA 4KUZH 5E5RB 4ZMTA 4YC2B 1XEDA 3GLDA 4PD4K 1ZLWH 5T1DH 3UTZB 3ILDA 3KPLB 2YFOA 3MN8A 2EIEA 3IJHA 4MD5A 3X3GH 4FEIA 4U49A 5IVNA 4ZK8A 2X89D 3BLBA 2VLRA 1K3IA 3BZ4A 1HWHB 2BY2A 3Q6FB 1E6JH 3O3AA 3OGOE 1XB8A 1MFVA 5HYJA 2YA2A 2AI0L 4XN8A 2X2JA 3MRHA 1JTOA 4S10A 5C9JB 1EHKB 4NPKA 5EN2A 3LB6D 3KWUA 1NKOA 1HCFX 3FFDB 3TV3H 2F53E 1BYPA 4OIFA 2R0ZH 1OSEA 2E7CA 5C07E 4DUXA 4H25A 3ARTA 5D9SA 3RIKA 3U46A 4OLVH 1E5CA 4BDVB 1R47A 3SDAA 1OF2A 1OTTC 3MRIA 2BS71 2FLMA 2UY7A 2FSEA 1RP9A 1RZJL 3HHMA 2BIHA 5BV7L 2B1HH 4Y4HC 5AALA 3RGVD 4X50A 1SUJA 2KUTA 3D3VA 3PWUA 5DZPA 4DZ8A 3F84A 5CCGE 5IHUL 4L4VB 5D1ZD 4OD1H 2PCFA 3SDCC 3VVVA 3F00A 5JW3H 2EXWC 2X4PA 4LFHG 1BAFL 2IMMA 5K59E 2X4UA 4G1MB 5D9SB 4Z18A 1ITCA 2B0SH 1HXMB 1GGUA 1M2OA 4JKPH 2XWCA 4GH7B 4ODWB 2P24A 4LHUD 2UYLA 1MWAA 3T1FA 3UTSB 4XMVA 1JZFA 2ENPA 2D9CA 4TRPH 1NZRA 3U1SL 3MNWB 5DEGA 3HVNA 1P7KA 1BP3B 4EXKA 1DTUA 4YMPA 1SGKA 1KIRB 1RULH 4IK7A 2YAQA 3UBXI 3TV3L 4I1RA 4Y5VA 2D03H 3SE3C 2BJML 5LUMA 1VFUA 4J4PC 1TO5A 2F7OA 3W5NA 3KL0A 5F3BA 2EXYC 1GY1A 1URIA 4GIPD 2OMNA 3Q1EA 4WEMB 3HBZA 3FF8A 2VIRA 5F0MB 4JM2C 5DZVA 1JHLH 3PWJA 4OFYD 4JDVA 2KZ1B 3AXIA 1IC7H 3UAEA 5AFAA 2HMIC 3PJLA 3CNKA 4KK9D 4G8IB 3H42L 3HFMH 3WKNA 2I25N 4G6JH 1A3LH 1MCJA 1NL0H 5C3LD 4OZHF 1UM6H 3V6FB 1R3HB 2H3KA 1MRCH 5T1DL 4JFUA 2BP8B 5DU7A 2FBRA 4QHPA 3RZCD 4RBPK 5C0CA 4N0RA 5K1NA 1CVSC 1D7BA 2R4RL 3QHFL 2PXYD 5IBTL 3AB0C 5T1JA 3B9AA 1BLNB 2AJUH 2G2PA 4FERA 1MJ7L 3GSVA 4XN4A 1QBMH 1YC7A 3QEQB 2FIKA 4GKLA 5JUEH 3JZYA 3QO0B 4X4YB 1OOAA 3IJ8A 5DS2A 1NOLA 4L8CA 4M7LH 3NJXA 3RZWA 3WDJA 2VR7A 2YPVH 2ZYHA 4PTTB 5A2IH 5JXAL 2P80D 1QSFD 4PAZA 3U4BL 4EIBA 1VGEL 4F15B 2GEQA 3IVKA 1NAMB 1EEYB 4MMYA 4B0MM 5TPWL 2F7PA 3EYOA 2WBXA 1J12A 5TF1L 3UZQA 5IBUB 4AH2B 5BW7A 1YY9C 1D5BB 3IFPB 4N2EA 3NIFE 1FCGA 3SZ6A 2OMXA 1ZS8A 32C2B 5E23A 5M94B 2WTPA 3H54A 5F44A 4EZKA 5SWQA 2C4FU 1BZOA 3QXDA 5HGDB 3WNNA 3U6RB 3E8UL 2OMWA 2DWSA 4H8WC 3DX7B 4FNLL 4PJ7B 4BUQA 4JZJB 1HDMA 1IBGL 3PQYE 4XWGL 4HJ0D 3UTSD 4FA8A 1AOZA 1JV2A 4G8FB 4WTWA 5KBMA 2Q10A 2Q3AA 3LN5B 4D3CH 3FUIA 3RTQA 1OK8A 2V2TB 1IB5A 4JRYE 1DCLA 2O4EA 3QDGD 1JRHH 1AG6A 1Z5HA 4X5RA 4A7VA 5ISZD 5BRZE 4RFOH 3LKNB 4U1NB 2X2HA 4KJWC 4P9HL 2JKXA 4YDKL 4TYUA 5HHQB 1PG7L 2XN9B 3PXJA 4LKXB 3I75B 1A14H 4K5MA 4QRFA 2F1BA 3QWRA 5C97A 2WOBA 3QFDA 1B0WA 5HYFA 4H88L 1A7QH 1MG3C 3CFDA 2BS9A 2FDBP 4G6AD 4LL4A 5GS0C 1MLBA 2HUEA 4Y2OA 5E2WH 3H8NA 1ZHLB 4WFHE 5L6YL 1OM3L 4P3CH 3INOA 3JWOH 1WO2A 4YHLL 3NQIA 3VXTB 5EEZA 4GKZB 3IDJB 4Z7QF 2H26A 3OLDA 3WS3A 4FYRA 3JUZA 2VLKD 3RZCB 2DKMA 3AXLB 5FYJU 4F7EB 3HOGA 4Z5RB 5I18H 5I74B 4HMEA 1DBML 2C9QA 4OSUL 2RA1A 3ATAA 3S37L 4QJ5B 5J6HA 4MNHB 1A1MA 2ZF9A 3QJHA 1IQWH 4JO3L 1B9ZA 1DDTA 3JWNE 3QH3A 2GFBA 2QADC 3GZPA 1J8KA 4LVNB 2VDKB 5JW4M 4FFZA 3IWVA 2VAAA 3JTTA 4NO5A 1BQ5A 4NNYA 1AE6H 2VLJA 3FTYA 3WKMH 1FH5L 5C0AD 1QKZL 1I85A 3FQRB 3U7WL 2ZAGA 3D3VD 4G9FB 3TBSB 3TEYA 2RB8A 2AABL 2EIZB 1MFNA 2VXQH 5I5RA 5D7IE 2VE6A 3BVNA 2LE9A 4N9OB 2SEBB 2EH8H 2X9YA 3QO1A 4U3HA 3O6LL 2NX5D 1JZ5A 1MVUB 2QEJA 1T7ZA 5K9QI 1CIUA 1IAIM 4GAGL 5T3XH 3N41B 1BJ1H 4K5OA 2GJ6E 3TA3C 4DKEL 3V0WL 3VD5A 4KX8A 1ZK9A 2P5PA 3UIYA 3L3JA 2EDKA 2BRRH 3T0VA 1UT9A 3KDMB 1XD1A 3IGAA 4LESA 3OPZL 1WAAA 2A9AA 2CLVB 3KPSB 4HX1A 3U0PB 3R0MA 2J6WA 1E40A 4OLEA 7TAAA 1UKSA 2AABH 4NKMB 5EU6A 4F9LC 2FWLB 5FYJE 1ZK5A 4A2HA 2AVGA 1Z5LA 2OXHB 4U2ZA 2CIIB 5K1JA 1G7QB 3DOSA 3CMOL 5GGRA 4XH2A 4Q9QL 3RL2B 1JD7A 2B4CC 4GLRI 4JRLA 3EOAA 3ARGC 4JDEA 3BWAA 3BISA 1K85A 2J88L 4CVZB 4F58H 4MJIE 4EI6B 3WEAA 2YOCA 1GSMA 1PAZA 3FPXA 1MVYA 2NMSA 3D34A 4L29B 2VH5H 1A1OB 2AXGB 1L9OA 1AGDB 4YL4A 2ETWA 4CKQA 1SXZA 4DVBA 2Y1ZA 4KITB 4KK6C 4N0FB 3KPRD 3WYRA 1NCAH 3FO2B 5F7EH 1GJIA 1JERA 4PTUB 5AL8A 3DTXA 1FZJA 3MRQA 4P8QA 3CDZB 5BOZG 2W81C 2IALB 4ZS6D 3O4LB 2YJLA 4HMDA 1GOHA 1KTCA 2XU9A 4F7TA 1VB9A 2EYTA 3QNYB 4RZCB 3VFVA 5L2JA 1E28A 2IG2H 5D1XE 2V2WB 4HK3N 5ILTL 1E2WA 5TDNA 2DQEL 3WXVH 2OTUB 2TRHA 2N59A 1HHJA 1DFBL 4OZFH 3FYIB 5D6DC 4QF1A 3RWFB 5GZOC 1WLHA 3FQNA 4IOFD 5C0AB 5C0GA 3TX4A 3B2PA 3MJ9H 4OW6A 3QI9C 2DQGL 3D85D 4FKEA 2EKSB 4YDKH 4EN3C 4HVBA 1MI5B 3HPJA 4UT9H 1S2EA 1F58L 2EYSB 3LCYA 1OAYL 3ZKMD 2XSKA 4Q9QH 1TVBA 1BVLA 2IADA 4AQ1B 2A9MH 4FJZA 4CVUA 3HLKA 2Y6SC 4RMVA 4D3CL 3KYNB 1TR7A 1IRAY 5D71H 1A21A 3SBPA 3GS4A 5C7XL 1NBCA 2Z91B 1LNUB 2VZTA 2WP3O 4HBCL 1I31A 1WFOA 1MF2L 1JTPA 2VRKA 3KLLA 25C8L 2OJZL 4X2UA 1NCBL 3KYOB 5F88A 4XO8A 4HBQA 1Z2KA 2R1WB 4GKOA 1YJDC 4NP4L 4EXPX 4UAHA 4K7FA 5J89A 1UD5A 4X5QA 5MHSD 2R4SL 3SKMA 3QIWC 1LD9B 3WI9A 1QHOA 4HPYL 1G87A 1I3RA 1CDIA 2QFPA 4WI3A 1WAPA 1YEKL 4K55A 2MSPA 3MCYA 5TH2A 5LGYA 2W91A 4RQQB 5T1LB 1KT2B 4AIEA 4HZLA 3KS0H 4RLDA 3LSOA 2IAMA 4LASL 5J12C 4FF9A 2PP9A 3M1OA 5DS1A 3C60A 4BWUA 4XVJH 4G8EB 4MS6A 1CFQA 1MCPL 3LS5H 2R2HB 3AVEA 4PJGF 4I13B 3WTTA 2BSSB 4AG4H 2HLAB 3L7EB 3U30C 2NY2C 3STLA 2B1OA 2ATPA 3S2AA 3HI6L 3E8VA 5AZEH 1M4KA 1FHGA 2FT6A 4G7RB 4R7DB 4YWGL 3MRBA 4R4BB 3R0NA 1C16A 1TCMA 1PQZB 4C47A 5FK9A 4PWHA 3IU3B 4PJ5D 4QKXB 3G5YB 2R15A 1AP2B 1CK0L 3FQTA 4OLWL 4X99B 1ETJA 5D70H 3HE7C 5MENE 2DLIA 5HHQA 2XT1B 3L7FA 3N44B 1V3MA 2AITA 3KD4A 3T5WA 1MCWM 1QRND 5FA3A 1X5FA 4JQVC 5HDOA 3ARVA 5SX5H 4N8VB 5SX5K 3F7VB 4FJ6A 5CCJA 3N42B 4I48B 4K2UL 4Z7NB 1U3HA 3LNEA 1BBJA 2G2RB 4FLQA 4E68A 3CBRA 3F6JA 4C55A 2PF6A 4OZHA 4IIQA 3BKYH 4RGOL 4FFYL 4UTBL 3KR3H 1JZ8A 3A4DA 3VXTA 5I0YA 3QQ3A 1REIA 2C3GA 1OT2A 5DRZB 1BD2E 3UTTB 3NTCH 2D7TL 5KBDA 4PTUA 3IBEA 1ETB1 2OTWA 4A7TA 1DQDL 1ZS8B 2GBAA 3O4LA 4QHUA 4KPHL 3HJ0A 1BXXA 3CVHA 5HGDA 1U41A 3L9RA 4CJ0A 1J1XH 1NMBL 1GAFL 1MJUL 4PRPD 3N3EA 1ZS2A 4MMYB 1TYEB 5CP7A 1SVCP 4KKPA 3C5SA 4NRXB 1BPLB 2CLZB 1CGYA 4MAYA 5KSAA 4RSVA 1EGJL 2W38A 2XETA 5E6IC 4LPUA 4HWUA 4XCEB 1UD2A 4L4VD 4KU1A 3L5JA 4XNXL 2HP4A 5GGTL 3O2DL 2X1WL 3I3EA 5EDSA 3HI1B 2Y2YA 3MLUH 4D9RD 4D9RE 2X4RA 2CO1A 3RA7L 4WFED 1PYWA 3S34L 2WAHA 2EABA 3WKQA 2MJWA 5I1CH 1D6EB 1Z7JA 1ZTMA 4WGKA 1S7RB 2DN7A 3U4BH 3X3FH 3K6SA 4ODXA 5CN3A 3ZTDC 1HL9A 1CN4A 3OKLB 4UTCA 1SN0A 3SDXF 3CFMA 4AE0A 4XMTA 3RNKA 4L0ZA 2VR3A 4IIZA 1SOQA 1W15A 2J7LA 1RIHL 5EC2A 1I3VA 2A73A 4KH9A 3VXME 4XXWC 3WFCH 2BOBA 2VDOH 1N5AB 1Z9LA 2VQUA 3MXVL 1KG0B 2ED8A 1U8QA 3L4YA 4EZLA 4P5KA 3FW6A 5HYQB 3T6QC 3RWDB 2CM5A 3GM8A 4XPBH 2DV6A 3SB3A 4KUZL 3B6SA 1A7RL 4OBRA 5ID0B 1P9MC 4PJ6A 4YO0A 1TFHA 1A3LL 4FNSA 4Y1TA 3IETA 3R4RA 5SV4A 3FU8A 3BRDA 1WFUA 4PWIA 5D4IA 3U4AA 3SE3A 1IKFH 3M45A 2IQAA 2JJVA 5J6HB 4ZO8A 3TJEH 3OKNA 1HILA 4KOCA 1LL1A 2XWBB 4JFZL 3D06A 1XF2A 3B9KC 1EX0A 1PBYA 2QKSA 4LLVA 4KZDH 1FYTE 5KJRL 3A47A 3P4MB 4O2EA 4ZUSB 3US1A 4ODVH 2HFTA 5CFHA 3L5XL 4OLYH 4GT7A 5DD3H 4ODTL 4YVUA 4M61A 3IDYB 2NY3B 3RUGF 5CILL 4Z7QB 4WCYH 4JO5A 3OQRA 5JHLA 4QMEA 5FECA 3HZMA 2IDUA 4EIZC 2BP0B 4DKFL 5KBKA 4MJIB 1KGUA 1H3WM 2BM3A 2NX5A 4K9EL 4NZRH 3BGMA 1CI5A 5F6IB 3FB6B 4UTAH 1O0VA 5JMRA 2C9AA 4OV5A 1I4FA 5DZJA 3SZKC 4OD1L 5A2BA 4JDVB 4OF7A 5FM4A 4AWJC 3V6ZB 2NR6A 5C08E 4ODSL 4CSSA 4KRPB 3P54A 2IQ9H 1EZVX 2ITFA 3QIWD 3BUPA 3RDTD 4F7CA 5FYLL 2P52A 3FYEB 3TBTB 3GXMA 2Y7MA 3EH2A 1OV8A 3ECBB 1PFCA 2EECA 2GG1A 1T1ZB 5D2LA 2UUDK 3BZ4B 2WZ5A 1RZQA 1NFIA 3ET9F 3T0ED 3QVAA 4DKDC 4PGCB 5LXGL 2A1WL 4WDIB 5J1TC 5I17A 1CS6A 1MVFA 2HA1A 1HSAA 4P0DA 4ICWA 1KBWA 1CD0A 3KG5A 2CO6A 2K3HA 3PL6B 3ZRSA 2JJSC 3GEWB 2NYKA 3IJ9A 1J9RA 2A9CA 3S4SA 4Z23A 3JT2A 2YZ8A 1QW9A 1T1ZA 2WB7A 2G0LA 1QNIA 1SLUA 3K3QA 5EEUA 4Q9RH 1HZKA 5KYNA 2VXQA 5LGHL 2A4EA 3FBKA 1FAIH 4MGXA 3FT3B 3LAFA 4TTDC 5GRUL 2F1AA 5ANHA 4Q2ZB 1XR8B 4TUJB 4LARL 1A4JB 2XWJB 1XH1A 2JKLA 4XNMA 3QO0A 3NA9H 4YBLB 2VDRL 1OAQH 2CKBL 5EF1A 1JGDB 1DUYA 4G9DB 3L5XH 4OLYL 1H9DA 5AUMB 3WLWC 2AJVL 1OTSC 3E80A 3MRPB 4IMKA 1ZLUK 1T03H 1RL1A 1E42A 1TZHB 2C9XA 4PW3A 4KZEL 1RU9H 3GJFK 4HHAA 5FOJA 1G9NH 2VDNB 3T8VA 5E4AA 4KXZH 4WHYH 1TPXC 2Z92A 4OCLC 3KPNA 5KG9A 2H32A 1CU4H 2NZ9C 5IM7A 1OT4A 5EOTA 4ZMWA 1PGRB 4LLDB 3HN3A 1E50A 4PJ7A 2F18A 1XR8A 3QUKB 5F0LB 3QBTB 1LMIA 1T80A 2ZZUT 4N90E 3PV7A 4JG1H 1YZZA 2D3JA 1KN2L 2MH4A 2H7WA 4QHKI 4NZFA 3TP4A 4M8RA 4PM1A 3VRJA 3U83A 3S3DB 2MRYA 1RHHB 3GKWL 2JXMA 4G8GD 4Y5VC 1MAMH 5K59F 5FGCB 1L0QA 2GJZB 1CFBA 3QJUB 4BXVA 3WD5H 1JZ3A 2EH7L 2XY2A 1W8EA 5C0DA 1GIGL 2XXCB 2LABA 3OD3A 4GSDL 2W60A 2EINB 4R7LA 3TA3D 5J6GA 2DMCA 2W5PA 3SIKA 5EC1A 1DHKA 3MCLH 1MAJA 1G1CA 2MNJB 4LLAA 3LYRA 1EANA 1J0KA 2EE0A 3FSAA 1Z6JT 2R0LH 5DD5L 4WFGE 5C0EB 1CGTA 3I6GA 4L3EE 3REWB 4NNXB 3M07A 1FO0L 5KOMC 1W0WB 4PJHA 2MCG1 1X7QA 3MCKB 2X41A 1AZCA 4PJBB 4CVWA 2PPFA 2EE2A 4F91B 2E7DA 2NXZD 5IMLB 1PFOA 2ADGA 1QWUA 1QLFA 5DFVC 3ROLB 2GT9A 2NSMA 4X7TA 1E5ZA 5GRXG 1C16B 2ZUSA 3U25A 2LLGA 1G0DA 2FWSA 2MNUA 2RFXA 4NRYA 3WG7B 4AIXA 1AR2A 1ZV9A 4MJ4A 4UYQA 4MNGE 3PGCB 2J71A 2VDLH 4H20H 4IBSA 4JG5A 3DYPA 3OJMB 3WO3B 5I1JH 5FO8A 5AVVB 1U8PA 1T1YB 2CO4A 1SVZA 5FA3B 3S4SB 3TO4B 1XMWA 3I9AA 5DJZB 3FC8A 2FWUA 4KH2A 4U1IB 5J6SA 2D7TH 1IBDA 2D0FA 3MRMB 2WP3T 4I18B 4LMQE 3ULUH 1I3GL 2X0UA 3F7LA 2QR0A 4LHUA 3DROA 4GG6A 3IPEA 3U2SA 4Y1AD 4ELMA 2DICA 4TQ8A 5BO0D 2WXRA 3S5ZA 3ZRFC 1W72B 2XX0A 2UYLB 1N5YL 1XCWA 3MLZH 1FN4B 1NC4D 2H1PH 1OHZA 1E6OH 2XWTB 3NFNB 2PCYA 3CFIC 3ML9A 4HIXL 4PH8A 2EACA 4YH6A 1GW6A 3RBSA 1BF8A 5KSVA 1FNGA 2ZUXA 3WEXA 5MI0C 1AZUA 5G5DA 1XGTB 2NUPB 3L4XA 1JPSH 4L0PB 5J7CC 1S7VA 1D5RA 5IVXE 2VLME 5T3XD 5HDQL 1OPGL 1ZANH 2CO2A 3L2NA 3LQAL 2J8HA 4LDEB 4P2OC 4PS4H 4M03A 1WD8A 3IDYC 4GRMB 4GRLB 1JG9A 4LDCA 1DE4A 1RZKL 1FL5B 3AWFA 4ORZC 3RJQB 4UOZA 3FNKA 3ALXA 8PAZA 1M71A 3NAAH 4CDHA 3FOLA 3LRSB 4LKCB 5TE6L 5DD1L 1AOHA 3NZSA 3DX8A 4G9FE 4ZDHB 2F74B 3V5DB 3OR6B 2P26A 4M6NL 2F15A 1MRFL 2CRMA 1C5CL 4XVUD 2Q87A 4YDLC 1TQSA 3QZMA 5FPIA 1KY7A 2I5YL 3DO7B 3IAPA 1NMAL 4QHNA 3ARPA 4PRAA 4KJPC 5LCVL 1HOEA 4UT9L 3ZL4H 2R69A 3ZKND 1OM9A 1A6UH 2Y0SA 4J5VA 4WEBL 4KI5C 2G9HA 2G5BA 1ZE3H 3OBAA 1ILSA 3M1BA 2AXFB 4Y2DA 4AVJA 3DETC 2B4CH 5DHDA 3V4PB 4Y7MA 1QYGL 3PP4H 3DV6B 3KNBB 3RWJA 1MSPA 1EEZB 5EZLB 5IQ7L 4QRRB 3CLEL 3GBDA 4HBCH 1D5XB 4FZ8H 4O2CA 1KG0A 2E7LC 4H8PA 3OAWA 4OGYL 2BS8A 4PCKA 3RWDA 4FKHA 2LLLA 2NR6D 4NENA 4YDZA 1NUFA 4OZHE 2XTJE 5GRWA 3MAWA 3RZCC 4GQZA 3GMLB 1USQA 4AVHA 4BZYA 2H47C 4Q0XL 3QJSB 1RJLA 5HPOA 2N1KA 4U4BA 4BFKA 2X70B 3EZJB 1COBA 5TK4A 2ICCA 1LO4H 4X6DB 2UZXA 3D4GA 3GJFH 3LHPH 3MNDA 5E6UB 4IU2B 2DQGH 2A38A 2FUTA 3SQOH 2ZUYA 5IB4A 1RZGB 4TOYL 5GISL 1H3GA 3B5GA 3LQAC 3SCMB 1WSST 4NO0B 2ZUQC 2R0WH 1OLLA 4UT7L 3PG2A 5ICUA 5F6IC 2XVKA 3D05A 4L3ED 3QXWA 3IE4A 4MKMA 1CCZA 2DI7A 2DQMA 1SDAB 3HVDA 1J0JA 2DIBA 2XV0A 4HQQL 3BWAB 4OCNC 2X05A 4MMZC 4AXWA 1MLCB 3LXAA 5BXFB 4JRFA 1H3VA 3KHOA 1XCQB 1E9QB 3BGFB 3Q8EA 5FWQA 4PFEA 2VC2L 5LBVA 2J8OA 3APFA 4EDWH 1MUJB 5C07D 4QRAA 2PNDA 1CLZL 2HVJB 2Q3XA 1FNFA 1I1CA 2PWFA 3AS0A 3K2MC 1FFPA 3C6SB 4R96B 4NKOB 1EVUA 4D9QD 3QJRB 4G6ML 1BVOA 1R5VA 1D7FA 2TRYA 3G5ZB 4M1DH 1KT2A 1J1XL 1NMBH 4XGZB 5DVLA 2WD0A 5JIKA 3RDTA 4GRWE 3F5WB 5EEXA 4YVNA 4JFFE 5CGBA 4FYTA 5EZIL 3QNXA 5DHXB 5DHMC 1PQZA 2YPLA 5CU9A 1RZKC 5D72H 4C83B 4W6WB 5EO9A 4M1GL 3HPJB 1QBAA 4R7DA 4G5AA 1CGXA 3FUKA 2CBMA 1JDDA 4ZTOL 3LKSB 2G9KA 3V5HB 1NC4A 5C92A 4HCFA 3OB0H 3UP1A 3GMOA 1W8NA 1WIPA 1YEEH 1MQKH 3EJTA 4ZDHA 3NUKA 1H9VA 2R9HD 3LB6C 2RCSH 3V5DA 5IEKA 1KLGB 1I1AC 2XCMC 4X99A 5C8JB 1NJ9A 4Z0BL 4M6AA 2QTEA 4R2GD 4PGBA 3L7FB 4AJWA 4ETQB 4NQEA 2JSFA 3GSXA 5JW4R 4WNSA 2CUAA 2RBLA 4J28A 5HHOE 3KCPA 3AMKA 3D9AH 4O51A 1NM9A 2SODB 2APWA 3OGCB 5IQ9A 1G7MA 1JTTA 1D9KB 3C5JB 1RK0B 1A6VH 3AG1B 2VJ8A 3TO2A 4A67A 2E6JA 3BJ91 2H3NA 4AV5A 3KWXA 3AREB 5ECGA 2R29A 1JZJA 1TT6A 4Z7UF 3WS3B 4AYID 4ZO9A 2QKIB 5E4IA 1EEZA 5EZLA 1MDTA 3O6FC 3LSOB 1YMMD 4S2SB 2XWEA 2L4OA 1S7SB 1F8TL 4IRZH 3TTSA 4BZ1L 1Q9WB 4GIAA 4XRCA 1L9SA 5KTEL 4NB7A 1VKXB 4WI4A 2RH0A 5F7HA 2OXHA 1P9MA 5GQBA 1IFHH 5J1AA 4DZBA 4ZFOL 1U8PB 2WWOA 1N2RB 2Z8VC 3AT8A 4R4ND 2WXMA 4UINL 1I8MB 4YHIA 1O9VA 1JIBA 5JQIB 2W9EH 2NLJB 6FABH 4CN1A 2DLHA 4C56E 2ZXDA 3CIAA 4BIKA 3GGWB 1TIUA 3EYOB 2KBGA 2AW2A 4QTIH 1CL7I 4LPCA 4HOXA 1CD8A 1T1WA 5E8DL 5KBNC 1MHHA 3THMH 1S7WB 4XP9H 1W72A 5F9DC 4JY4A 2R56L 1JGEB 2VR6A 2X4OA 4N2FA 1T5XA 1KF9B 4TLKA 4NN7C 1P1ZB 4FLRA 3J2PA 4LVEA 1KJ2H 5DRXA 1K8DB 2YO3A 2XPYA 1JZ7A 4P5MB 2DEXX 2PP8A 3QFJA 4JLRB 4W9EC 1XMEB 4PIBA 5SWQB 3K5RA 3T6XA 3MGAA 2ZJSL 3HZKA 1OQXA 4F8TA 1DJWA 1UD8A 3QDAA 3GC3A 5DYOA 1KB5L 2ZOTA 1BFTA 2ZXWB 4PGEB 1H6EA 4WV1A 3NBNA 3KDMA 2A9BA 1ETZA 1TENA 4XAWH 3ZBMA 4N2AA 5C0GB 4J3OC 4O5LL 5IB5B 1L9QA 2RFXB 3V4LA 2BZDA 3HE6C 4GP5B 5L7XH 4DVRH 2DTMH 4XR8C 1MCCA 2XTJD 5AOMA 2ZKXA 1F4XH 3SHSA 3R06A 3RL1A 1BVKB 3RPIB 3WXVL 5IMLA 4X6CB 2CIIA 2PKDA 4DJMA 3NMEA 3CD4A 5E5MA 2O26U 4ESKA 5CEYB 2ESVE 4JO2L 1DJHA 4LCCA 3LVTA 1DLHA 5CJXA 3BVVA 5DJZA 3JV6B 4HKBB 4K8RC 3QHZH 4K5NA 2JI2A 5JA9A 1OKEA 3QCUH 4XPTL 3PGCA 3T3PB 4P9HC 3VXSA 5JHDA 3N91A 3MFGB 3GIZL 6PAZA 1KTDB 5B3NA 2VDNL 4ZFGL 2A0LC 2D3VA 4N1CA 1BA9A 4G8IA 4LT7A 1Y6KR 4PP2B 4WW2B 5HVHB 2N7SA 1N64L 1KLUA 3BZDA 4WW1B 4RMBA 2G5UA 4RFNC 3MRMA 5MI0B 2LLNA 3PV6A 5D6CA 1ANUA 4LCUB 5CSZB 4K3EH 2AVFA 5G4NA 1BYOA 5FO7A 1EJOL 2FJSA 2JKJA 3VNYA 2HH0H 1SOKA 1PAMA 5EU3A 1FG9C 1ZA3B 2BP8A 3JWNC 3C8DA 4PB0L 1MCNA 5D5MF 3S5LA 3TCLB 2ZX5A 3N42F 1FFQA 1T0PB 1UM6L 4LBEB 1MNNA 1PVHA 1FL5A 3DVNB 3OPZH 1GZHC 3BPCA 1AANA 1RZ8A 5KWYC 1YEIL 2WZ0A 3O4LE 4DO4A 1LILA 3VFMA 4DFHA 2BSED 5ANME 1NOFA 1ZJBA 2ZXBA 5D7EA 1RD6A 3EO1B 3AG4B 2OS7A 5H4ZA 4PS8A 4KRPC 3G6AA 3WUWG 1XTLA 1TQTA 4MCZB 1HXYB 2KYIA 4UU9B 3GBML 4P46B 5HDBE 1Z0MA 3UMNA 2WLIA 3SGEI 3IXAB 5BMFH 3U9WA 1ZT1B 4JKKA 1ADWA 3O9WA 4FXGA 4LVNC 3EJCA 4ONHB 5CNHA 4UNVA 5IJDC 2WKOA 2F8XC 3O8XA 4TSAH 4RESB 3OKOA 4XTRD 4KK5D 3VFMB 2DB8A 5I5IA 2H1PL 4IBQA 4N20A 1FFOB 3NZ8A 1KWGA 2Q1EA 3M1BB 4JZJA 1ED3B 4HCRA 4S0TD 1DVSA 3ZE0E 1DN2A 4N9GA 4RISH 5GS1C 2HKFL 2QLVB 2FBJH 1QZNA 2KERA 4QD2E 5CGYD 3QUYA 1KGXA 1I3GH 1KGIA 1TJGH 3TV8A 4HIEB 4MAYC 1DFXA 1AQDA 2Z1KA 1U58B 3WIHL 3ARFD 1MCOL 1W16A 4MNGA 2OMUA 2NY4C 3GJFA 1X5LA 5DJXA 4WK4B 3B9KA 4FTVB 4Y16C 4OCSH 4BFOA 4MCZA 4YX2H 1VJSA 4B9JA 1NCDL 3U4EA 1JF1B 4OV5B 3QDJA 2CR0A 3APMA 5E2UL 4Y2OB 4NQCD 3CUPA 3QJQB 3W3BA 2ORBL 2JLLA 3FMGH 3FQXA 4GB9A 3RI5F 3NZ8B 2GITB 1RZJC 3SDCB 2YXVA 5L6YH 2ERJC 3WUWA 5KAQF 3MJ8A 4GQQA 4IBLT 2MNWA 3JSSA 1FJ1A 4Z95H 4PREA 1G7HA 4MA3A 2BHUA 3ECBA 3LTVA 3RWHA 1WPCA 1HQRA 5I1AA 3TGXA 4HJIA 2VDLB 4EN3B 4R4FL 4TQHA 1JDCA 1M7IA 3NPZB 3N6YA 2ZOLA 4G6AC 4X8GA 5GS0D 1PD0A 5KANG 4C57C 1NCUA 3KPRA 1IKFL 1Z9NA 3RRQA 2F9BT 1NMAH 1W0YT 1N26A 5E0FA 1HOCB 1KXHA 1F0LA 5H94B 2CDEA 2GCYA 2XKNA 3GUFA 3UBXG 2VZVA 3HE6D 2CA3A 3L3OA 1L9MA 3TN0B 3MV7A 1QFOA 1MWAB 1KTDA 4JEGB 4RBPH 2EDNA 1AO7B 3PP3K 2ZP0T 1YYMH 1JSYA 3ZE2E 5DK2B 3UJJL 3V0VA 3MV8A 5FCUH 2ADYA 1DSWA 4N3TA 3B4NA 3QORD 1DBAL 4OFVA 3KDPB 5CZVH 1A3ZA 1LO3L 3WNPA 1KIRA 3ZR5A 2BOBB 1W0VA 3CSYB 4JDZB 4PS4L 4QT5B 1L5GB 4GT0A 4AYEC 1TUPA 1UA7A 4RMSA 1YAZA 1ZDSA 2EDWA 3JV5A 3MMEA 3Q1SH 3QAZC 4M5ZH 1B2YA 4BFGA 2CO7A 2Y4SA 4JGMA 5B3JE 3ULUC 4UQ2A 1WZ1H 2V9RA 3CFKB 4MBOA 2XXGA 2G2NA 1DVYA 1BZDA 2OJEB 4PRDA 2FX7H 3MVSA 3L1EA 4JY5H 3SDXA 3D3VE 3QZLA 1OE3A 3PWJB 4L37B 3IETB 5EIIA 1RZ7H 1PCXA 2FATH 1JL8A 1IKOP 3TT1H 4P2QD 4NXKA 1DYZA 1NFDA 1NEZG 2OM5A 4O4YL 5A1AA 4LVHC 1RUQL 5DC2A 1F97A 4XNXH 1SF3A 2RQEA 1E30A 2VXVH 3HNVL 1Q38A 4PJXF 5IROA 3IGUA 4DIXA 4KWUA 1EFXB 2D8KA 1QQDB 3CZGA 3SDXB 1P1ZA 2CKBA 4LAQL 3LRHA 4MDJA 2HT4D 5C86A 4Y4KB 3UTPE 2GIXA 4HFUH 2H32H 2Z0BA 1S78D 1PX3A 3NP3A 3MX0A 3HE7B 2UXVA 3UAAA 1H8NA 1T83C 2HLEB 3DX6B 3MBEA 3QUZC 3CHQA 2IV9A 4PEEA 3S35L 3BAIA 1KGCD 1PG7W 3OQ3B 1NGPL 2ZAIA 1QPKA 1JVOA 1A7NH 3UYOD 4JFQA 1F90L 3W5MA 3B9VA 1TYRA 2WXHA 1BD2D 3L8QA 2IANA 1XGQA 2VDPL 3R7QA 1DJZA 3QG6A 1AP2A 1ZLDA 3VD4A 2GI0A 2APXA 3ISYA 4DESA 4LHJB 3VFWA 2H2SD 2APFA 1KNOB 3BIKB 3P4NA 4IS6A 2ZCLL 2OK0H 3W2DH 1AQMA 1RZ7L 1FO0B 2CGRH 4PJIF 3AABA 1HQ4A 4I48A 3RNKB 2LU3A 3D30A 3KPQA 2M1KA 4YSRA 4AENA 1PZCA 2C34A 4OLUH 2QGCA 5DQJA 1JZGA 3ATDA 2X09A 4LNRB 2WWNA 4NJ9L 5D70L 3VQ2C 2Y22A 2NLJA 2DLGA 1T0MB 3TU6A 4BFIB 3BAXA 4HFUL 1VERA 3HW7A 3EH4B 4OT1L 4BFBD 1Z0NA 5INCA 3SDYH 2VQTA 1WFMA 3AQYA 1T1WB 3CZKA 4PJGA 2R1YA 4P23A 1AKPA 5C09D 2CLZA 4AYGA 3I50L 4H1LH 1SJXA 1G7JA 3HZMB 1TTAA 3ARDA 12E8H 1A4AA 3T3ME 3KJ6H 4JPVL 2DWYA 4Z76A 3HG3A 3JVGA 4O4YH 3TCLA 5LVEA 3POHA 1AGEB 1GZQB 4UDTA 2BINA 4PJFA 1UB6B 4XVJL 1U4EA 1CU4L 3I6SA 2R2BA 2WQWA 2ZUVA 4UCFA 3WTUA 3ULVD 2NY3D 3KHQA 5DR5L 3PJNA 1N6VA 3WAKA 4EVNB 5HHVL 5F1NB 5JR1H 4OUUB 43CAB 3O3EA 5CD5D 3ME0A 4B41A 3OAUH 1SEBA 4Y4KD 5I0WA 1II4E 3SE4C 4AQ8A 4UF7C 3QUZD 4LSDA 4A6YB 1AD9A 5C71A 2EO7A 4G5ZH 1NLBL 1WT5A 1I7RB 3X3GL 1RAMA 1J18A 1O6TA 3OKOB 3VQLA 1QSEA 3OKMA 2IEPA 4A2MA 5L4JA 4CRPA 2HTLC 5AOZA 4OGAD 4FOMA 3N0PB 4QDGA 4UMGA 4POUB 3RWCA 4RAVB 1HHIB 4YZFE 1NUDA 1KPRA 1OE1A 5JPNC 3QUXD 5I6KA 1KB9J 3FQTB 4PJEF 2VR8A 3MRBB 4BCXA 2BIIA 3UO1L 3VFUA 4BWWA 4GBXC 2ARWA 3DNKA 1D6VL 2HJLB 2VYRE 1ZA3A 3SYQA 1Q1JH 4LSTH 1IIKA 4MQ7B 5D7LB 3TJHD 4WI6A 4LBEA 1QR4A 1FL3B 4MLSA 2I27N 4Z78A 3KPSE 4LLVB 5I16A 4FG6D 1QPXA 3AW5A 1HZLA 3ARFA 5TGBB 1NDGB 4G1EA 4PJ8D 4MLIA 2JIXD 5EORH 4DP7X 2DMGA 3BPOC 4MQSB 5FHBH 5GJSL 4KI5D 2YD8A 2WSPA 3TWCH 3VI3A 4MB1A 4XGZA 3PWLA 1LVEA 2XIDA 3KW8A 2PW2B 5EU4B 2AXWA 4FMVA 5EU6D 1FSKC 1ZE3C 1NCIA 3CV5A 4HWNA 5E9DE 4L5FL 4XHJD 5GS2D 4Z78B 1SJMA 3UYRL 3WXWH 3RY6A 3ZKQD 3G5ZA 3H9YA 3UZVB 4DEWA 1TTUA 2HJLA 3DOIA 4GMSL 3UAJD 1IEBA 3FRUB 5HD8D 3IGKA 1D7DA 2OFQA 1WBZA 2MPVA 3CVHB 2VSKB 1Q0XL 3MRDA 2F58L 4G43B 1IUZA 1DQDH 4YHOH 1BM7A 1JWUB 4HLZG 2IGFH 5D1QB 1EO8H 4I5BB 4IKIA 3BFOA 3ZYJA 4XPAL 2UZIH 3ULSB 4FNUA 2VXTH 4ODVL 5DC0A 3AACA 4PJ9A 4DT2A 3HS0A 1I3RB 4TSAL 3VI4E 2W65A 3QUZB 1PL3A 5T5FL 1U4FA 3QIUD 5F71A 1NEUA 4G42A 1BFVH 1MIEL 3HG4A 4P49A 3H7LA 2WJ7A 3U9UB 2VKWA 4IHOA 1USZA 5DDHB 1W2KT 4LLUB 4WUUD 5GRVK 5I8EB 4TQEL 1GKEA 1UWYA 1G7MB 3VGBA 1MFEH 2BCKA 4LGRB 5GGVY 3FTWA 2VRAA 2PW1A 2VISB 3DK2A 3FFCE 1H6FA 5KVGL 3II1A 4JFFB 4XVOA 4HT1H 1KFAL 3KCPB 1FFRA 4Z7VA 4W6XB 4JFDA 1CK0H 3VVWA 3QJFA 1R3JB 5FCSH 5TQ0H 5D8JL 4R4BA 2Z4QB 3AQDA 1BVLB 3BP7A 1LMKA 1YQVL 5TFSH 1IGIL 5IESL 3IGLA 3J07A 1W80A 1CTMA 1I82A 1N9PA 4HCGA 3MRLA 1A9VA 3B5TA 4I0PA 4NWTH 2CJUH 4GY4A 3T9WA 1Q9OA 4G83A 2ROXA 4BFNA 1RHFA 3HE6A 3AG2B 4MXQD 1FLRL 2VTFA 2VR5A 4LRIA 4HHGA 4OCRH 4ZT1A 2XN0A 1LHZA 4WUKL 5JW5A 4C4BA 3CK0L 2Y36L 2F5AH 5EO0A 1FCCA 2G4EA 4F7PA 4PWEA 2AEQL 2FBOJ 2QPSA 3OXRB 2C4FT 3ZMRA 1MLBB 4PJ8B 2ZCKL 3VFSB 3H55A 5I1CL 2K4AA 3CXDL 4N2DA 3MCKA 1LD9A 3BPNC 2K0RA 2EE9A 3FT0A 1YYLL 2CU9A 3AU0A 4MA7H 4PWKA 3GIZH 4UTAA 3L4ZA 3QZWG 3S36X 3QARA 3SQRA 5EWIL 2XBZA 1KN4L 1YJDH 1ZPUA 4M8QB 5GGTH 3RZCA 1BZEA 1W9XA 1JYXA 2ZKMX 1AIZA 4M5ZL 2V4LA 5DEFA 1YEWA 1G4RA 1VCAA 4GKZA 4TPRH 5FS5A 4YDVA 3WTXA 5E8DH 2AEWA 3WY4A 1T20A 3D09A 4H26B 1X5GA 3TO4D 5EU7C 1UCBH 3RP1A 2QSVA 2BNUB 5IW1B 3W11D 2X1PA 4PJIE 1HQ4B 2AQRA 4H5SB 4OM0L 5DRWA 3LD8C 5FFLA 1DJYA 3VSVA 5MENB 3W57A 1LXMA 1FBIH 3N43B 4NC1C 3B56A 5GZOD 3WO4C 3U0TB 2FX9H 4MYWB 3FU7B 3S3BB 2EADA 3KWWB 3UL4A 3BEVB 2AK1L 3WFBH 3FU9A 4HC1A 4OCYH 4YSOA 2OCFD 4UWQB 4NAJA 3SGJA 1BZ9B 3PGFH 4M5YH 2GAZB 5SWSB 5D2NE 4N8VG 5CU5A 4MTMA 3P11L 4NI3A 4LSSL 4WI2A 3EFOA 4RZCA 5L2JB 4ENEC 3DX6A 5KW9L 4HJGB 2LVCA 2XC8A 3B7RL 5TDNB 1HE8A 1OWWA 2D31B 1WBZB 4K07A 1MVUA 4PJCF 1BQLL 1KCVH 4MDJB 3QH3B 3P4OA 1QLFB 1KPUA 4JRWA 2UZYB 3ILPB 1HC1A 1HXKA 3MREA 4XMPH 4KRMB 5DJYA 4JZJC 4PJBA 3U0PA 3CH1A 4GOSA 5FDWA 3CZNA 1HNGA 1G9NC 5FAAA 2J44A 1MUJA 2MOGA 5I8KL 3F7QA 2WNWA 3BW9B 5I9QB 4ZMZA 1PF3A 3MOBH 3CXDH 4YHNB 4ZUWB 5IF0B 3BVUA 3L3HA 1OAUH 1RERA 1T7VA 4UV7H 4ZNEE 1L7IH 2FQGA 3MROB 2VZUA 4LSPL 5AOIA 3F01A 5I6XC 3CFCL 3MRFA 4QRPA 3LS5L 4B7LA 1FLRH 1G7QA 2A6IA 3FK3A 2E0PA 5T8IA 4N0UE 1YEHL 1V7MH 4XHJC 2CAKA 3RWCB 2FZ3A 1RK1A 2OL3B 3KPQB 2Y7OA 1YEKH 3VM7A 3DV6A 1UEMA 3VJ6A 4M1DL 4H2AA 2OR7A 2HRLA 4KMLB 4ELMB 4LIQH 1RZFL 4Z7IA 3CX5K 2FH6A 3NRQA 4Y89A 7FABL 5D4HA 1XIWC 3U2JA 5JPNA 5CIPA 2RCSL 4IOIB 3CDZA 1W6LA 4MBRA 1IMHC 1Q4NX 4OJEH 2YUZA 1HINL 4QHLA 1IAKB 1ZY9A 2WVVA 3ARQA 1T3FA 3LH8A 5G5DB 1UWXH 3N1PC 1QFUL 1ZMYA 2X88A 2OMTB 3MSPA 3O8XC 2AAVA 4V1DA 3JBG7 4XVSH 1LEIB 2OSLA 1BQHB 5EULV 2VXQL 4N2OA 4XP1L 3TL5A 3ECVA 4IW4C 1IM9A 2KLRA 1EJOH 2DIAA 1SEBB 3RWHB 1D5BA 2FVNA 4WHTA 2ZX7A 5LCVA 1OARH 1WICA 1M71B 4NYLB 3JT0A 3C6LD 2B5IC 4M6OL 4L8CB 2GSIB 2Z8SA 3HJEA 3BT2H 4OD3L 3GSQB 1N64H 3FT3A 1BIIA 3NRPA 3ZGHA 1IC1A 1N0XL 3K80A 1S3KL 1CD9B 1THCA 3MLTB 4PRPE 4L3CA 4FP8L 1WRFA 3A4EA 5D96C 3PAUA 5AG8A 4Z7QE 1XF2B 5HHXL 4LF3A 1L0YA 4MA3B 4U31A 1UXWA 1YSOA 3IMWA 4B9ZA 4XO4A 4OGYH 1T2QH 4PBXA 2P45B 2IANE 4RDBA 5K39A 1NCAL 3CN0A 3E6FB 3O4OC 1I1AD 2ZUQB 3EJZC 2VWEE 2M8XA 4NQDB 2BFVL 5E2WL 3V5KA 4GAJL 3QG6B 4U0QB 4G71B 2WVSA 2J88H 1RLBA 1T7YA 2WQUA 3NIGB 4AKQA 3O8XB 5D96B 2V7HA 4GO9A 5IKCA 3VSTA 1IJ9A 5DHVA 3BVXA 4N6RB 2IVFC 5T5NF 4DWHA 1O9WA 1WHOA 3OWEA 4FNPA 4AK2A 3E3QC 4PBWD 5C9JA 4BH8A 4E36A 4JFHE 3P69A 4ZS7H 3UDWC 4AENB 5LXVA 4LCCC 4C56A 5C0JA 1OAKH 2I5YH 3SE8L 3LRMA 4TQPA 1PLCA 3F8UB 3BH8A 2E6QA 3TURA 2J20A 4GW1A 2O5YH 4J23A 1UYWH 3QQ4B 4P4RA 2A83A 4UDUA 4YXKL 4BDVA 4MNHA 4B9YA 1EAPA 1P4LA 4KVNL 4NUGL 4OM1H 4KQ4L 2YD3A 2QGEA 2E46A 3CVIL 1P4IL 2WTOA 3ARWA 3G5XA 4NQXA 3ZE1B 1PYWB 5C70A 3V4UH 4AQEA 1OHQA 4QTIL 4ZSOB 1KCSH 4NBYB 1QYGH 2EVJA 1A7OH 1F4WH 1R5IA 1T4KB 5DFWH 4DGVL 3MBEB 3TM6A 5DHYB 3I9GL 4K94C 4BK5C 1F6FB 3C75A 1NPNA 3V9EA 4WLCA 4PP1D 2WWMC 1MDAA 5AYTA 4PRBA 4BSVB 2FNWA 3LHAA 4PJDE 2X9WA 5FUCC 5EIIG 4UILH 5HHVH 3WUWB 1R5WA 2DM7A 1CLVA 3QWRD 4EBQL 1A6UL 3TPUA 1FZMB 1HWGB 1LP9A 1B9KA 3R8BB 4L48A 4UMSA 3ZL4L 4XNDA 3MKGA 2O5NA 4Q89A 4AYBA 4NFCA 3UC0H 4F27A 4TQIA 3WLBA 3X14B 4J8QA 4ERSH 4PJ9C 2EEFA 3RG1C 1JUFB 3EGXB 4L8DA 4AUYA 1UFUA 4NUJB 3FN9A 1R3LB 4GKNB 1FQ9C 3SKUD 4CC4C 4OB5H 4XC1L 4LOEA 1V7NH 2HMID 5GS0H 3LMJL 3UBXB 1QUPA 1BCIA 3T4AA 2AANA 5D1XB 2XWDA 3L2MA 3BLPX 1IGIH 3B83A 4TPRL 3AFLA 1N8ZA 4A2DA 5GRJH 2XFXA 4AQAA 1JFHA 4TNVK 3VB8A 2EYRA 4JKNA 2PMZA 3DETD 3T6VA 1L3NA 1GVIA 1KN4H 1QNZL 3ZKXC 3K8LA 4HT1L 3UERA 4X6FB 2GSGB 2V9UA 2VQ1B 2VLJD 4WUUE 1UJ3C 4YHLH 3MMEB 4QRTB 4M1CD 4WTZA 2HFEB 3GMNB 3I6KA 4WJ5A 5CZKA 3UYPA 4XP5L 1GCYA 1U3HC 3MI6A 3QW9A 3ALWA 2F53A 3VTAA 1R1CA 4P46A 3CLFL 3AU1B 3V7MA 3KGTA 4QGTA 4JX0A 1A3RL 4JFSA 5H35A 2YD9A 2VNCA 4Q9BA 2CGYA 3B2DC 4ODHH 5ALBL 4L3FA 5ADOL 2VLRB 3F7YB 4IRSD 3ULUL 1Q1PA 4B7IA 4EUPG 2DQHL 4NFDA 4KK6D 5IB5A 3U46B 1JRHL 2IGFL 3KLQA 3CZUB 5K39B 2EDXA 3QORC 1KLFA 2AK4D 2PR9A 3TNMA 1AI1L 1Z9PA 2I9TB 2J1YA 3DOHA 1GZHA 5M7QA 4KGJA 5I1LB 5E4OA 5AKVA 2Z7UA 1ADQL 3GHBH 4N2BA 4UQEA 4LOFA 1IBGH 5D6CB 1IE5A 3PPEA 1AQDB 4U3SB 4YSPA 2BIQA 1IBZA 1PY9A 4HWZA 4M4RA 1T66C 2QVFB 3VFNA 4D0DA 3FO1A 4YUEH 5IK3A 3L9YA 2JKTM 1N4XL 2XX1A 4NWUH 4QY8A 4XB7A 4BZ1A 2DJMA 2MQGA 3F58H 4KAQL 5IOPA 1ZVNA 4OZIF 3K6OA 1IBFA 2I69A 1S7WA 1MJ8H 3DVNA 4TNGA 4MA8H 4NCC1 4NQQA 3G5VA 1E65A 2I24N 2J4WH 2GAZA 3FKUS 5KBPA 4Z77B 1WZMA 1CXIA 5DD5H 2HPTA 1NWOA 3JV4B 3EADA 4KVPA 4XBMA 4U6YA 1MFBH 3U1PA 3STZB 5IFHH 2Z91A 3FO0L 5CSZA 5I1KH 1NKGA 5FM5M 4PJ7F 2KHAA 4AQ1A 5HTSA 5I6MA 3ZL2A 1OCZB 3QRGL 3IDXH 3VGAB 1U95A 1IVTA 3HMXL 2CDGB 4LO9A 4J3TA 2Z4TA 4RX4A 2EE3A 1BQHA 3TXAA 3A6BL 2CCWA 2L7EA 3FT2A 3IMTA 1EV2E 1NH6A 2BMKA 2VJ0A 1JGUL 2WYHA 3L95B 1F11A 2FT8A 5I0ZA 3A22A 1NBVH 2HJKA 5HI3C 5IMMA 2JELL 4NS0A 5JQ6H 4YNYA 3G6AB 1IC7L 3DX2A 2DQFA 1G7PA 1KOAA 3S5LG 4OCWL 2FGZA 1F6AA 1AG0A 1P6FA 2BP3A 2PCFB 4G8EA 4OLXL 1FAIL 3MJ7A 1NDMB 3T0BA 3ULVE 2OSYA 2BK8A 4J7RA 4Q9CA 3ETTA 5AWNL 1ZT4B 3CHXA 1NC2A 2KLSA 4I3RH 1JN6B 1KIUA 4IKNA 2JJTA 5ITFA 4JO4H 2R23B 4F8LA 5B38B 5FB8A 5KSBA 2NY7L 3P30H 3FCBA 5JXEA 2JJSA 2JE8A 4G43A 5JOPD 5HJGA 4AEIH 4JCWA 1OCWL 2XN2A 5IGXH 3MJWA 5AVRB 2A1WH 3O41A 2A9DA 4PJ5E 5T3ZL 4FXKA 1ZTXH 5CMAB 3QUZA 1DVTA 3GTTA 5CZRA 3U0WH 4M7ZC 4LEXH 1CDJA 3N0AA 4WW1A 3FQ2A 4JY6A 3L3IB 2NZ1A 3C9NA 1U91A 1UM4H 3L45A 4DOHE 1K4DB 1T6VN 3BAYA 3PV6B 1YYCA 3I50H 1B0GA 1ZXKA 2WUBH 1N3NB 3B3BA 4X7CC 3VE0B 1TFPA 3DIDA 2E9JA 2QKIA 2VDQH 1KJ3H 2C9PA 4OCSL 5LGHH 3CXHK 3PY9A 1A65A 1VPOH 3FCSA 1S7SA 4A38A 1OE2A 3MNVA 3CHSA 4FXKB 3TBVB 3TVMB 1YQ2A 1KTJA 1CMOA 3WS6A 1J5HA 1FPTH 5F7MC 1QZ1A 1SMAA 2IPTH 1S8DB 2OTWB 4ANWA 3O8XD 5MERA 1BF2A 2HVJA 3P0VL 3KLKA 4I0PB 3U9UA 3KWWA 2IBZX 3O9WD 3KXFA 5CO1A 5I71B 3OB8A 4DPCX 4I2XA 4ZXBB 2CLRA 5KS9E 1WCBA 2FH8A 2DKSA 3T2PA 1YDPB 1EDQA 1HEJC 1P4UA 3DHUA 1PEWA 3D52A 4FNTA 2EUXA 5I8CB 1QX1A 4KZDL 3UOAB 3BAEL 1S7QA 4AM0Q 3N1MC 2AK4A 3MJ6A 3KJ6L 3NEOA 4JPVH 4MAYB 1GJUA 3QYMA 1ZGLP 3EW3B 2R7EB 2CDFA 2FJHB 1TTBA 2BCKB 3L7EA 1TOXA 4HIIB 1M9SA 1KGWA 5TDOA 1KGCE 5C0FA 4P23C 1WUZA 4Y4HB 3TT3L 5B3SB 1LO2L 1F90H 5LAPA 3GFUA 5J3HD 2K1MA 4BJLA 1ZIAA 2UZYA 3DPDA 1Z9SA 5HDBF 1HH9B 1BEXA 5IFAH 1GYWA 1S7QB 5GSRA 4YSAA 1CD1B 3EYQD 4FABL 1FE8H 4IJ3C 1KBVA 3DTXB 5E99L 4G72B 5KVEH 5C8JA 1UWGH 1CDUA 3ASWA 3QUYD 2H8PA 5E1AA 3W0WD 4FFZL 4GAYA 2OL3H 5D5MA 3ZDYE 4ZZFA 5ICYA 5KJ4A 4RCAA 2GUOA 1EVTC 1U8KA 3H6AA 4YE4L 3B7YA 5IG7B 2QHRL 5MP6H 3HS8A 5F72S 2QDVA 4M8QA 2W80C 2WKOF 3WAJA 3FU7A 4A2FA 2N4IA 1RK0A 4E42B 4HLEA 2FATL 3CQPA 1YC8A 3SJVE 1FNSL 1KB5B 4N8CH 5I19L 4ZMXA 4RA3A 5F1IA 5F21B 1A7NL 2DEYX 1HH9A 1Z9OA 4DERA 3P2BA 4QXVA 5EZOH 3B1UA 5C3IA 1VZIA 5L2KD 3SKOA 2UVEA 1C12A 3QDMA 1ZT4A 3RU8H 2X6BA 5SWZA 4U7SA 4YSCA 1EH9A 2OMZA 3HLAB 3NJJA 5CKAA 1CXHA 3LKNA 4KJWD 3CSBA 2JQAA 1R24B 1QA9B 2K6WA 1LNUA 4JAMA 4QPEA 2Q86B 3L1OH 4BCYA 2H8PB 5ISZA 4HC1H 4NQUA 5GZND 3PJSB 1BD2B 3EOTH 2WYIA 4H0IA 2EEBA 4UBDC 4EKXA 1PD1A 3RFZB 3HG1E 3VNZA 4PQXA 3H6JA 3QRGH 4XNUL 2VLKB 1NCWH 4EI5C 3ILQD 4W4OA 2C3VA 5FV2A 2G5BB 1SDDA 1K2DB 1WFNA 2NCEA 2YD6A 9CGTA 1U33A 3CXHJ 1NAKL 1JDAA 3OHMB 2VDML 2R1XA 3WELA 4CC1A 4JO1H 5LDSA 1IU1A 2DWEB 3C6LA 3PJSA 3OX8A 1CO1A 4I77L 4GO6B 4WRLA 4FQIL 2ID5A 5JIHA 4Y4HD 2YMOA 4RGOH 5KVDL 1CGUA 3ZW3A 1U8IA 4UOJA 1SDYA 2XWTA 3NFNA 3MRNB 2WLKA 2DEWX 3OC5A 4XODA 1DDHB 3NFPB 1TO4A 3IJSA 4XH2B 2X6CA 3GMLA 4TSBH 1G5GA 1UWGL 1RXLA 2HRHA 4FQCL 4NZ8A 2CKBB 2WBKA 4Q6KA 4OJAA 5IW3A 3B1TA 4M7KL 1TJXA 4NC0B 3CPUA 4DNLA 5HVWA 4LNVA 3U48A 1CBVL 3VH8A 3FHAA 4N5UA 1OP5K 4GEJA 4LL9A 4EUPH 1F1DA 4DVBB 3QXTA 1CFTB 5BVJB 3PLYA 3G08B 4RAUB 3CN2A 3C87A 4N22A 5BS0E 5E51A 4ZS7L 1E9OA 2EDHA 2DQHH 4GW4B 4QRSB 4UQIM 5FKAA 4GBXA 4L4TE 4CW1A 1KCUL 4QHMB 1Z32X 1RIVL 4WWKB 5LKNA 1NMCB 1XSKA 2FHCA 1OGPA 4NQEE 1X7QB 1XCQA 4YDIL 2XKSA 1KXTA 3CDGA 4WU5A 1MCPH 1JV2B 4G8FA 3SPGA 3QK0A 3AJ7A 5DVNA 3VO0A 4DTGL 5H8DA 1GYCA 3HBGA 1AJ7L 1XCTB 3QDHA 4GUPB 5EU5A 4D94A 1F6AB 5EEYA 4C59B 5I66A 2MCMA 4NKDA 2EDQA 2JWYA 3MYJA 4TXVB 1JGLH 3VFUB 1MI5A 2F74A 4B3EA 1RP8A 5AQ0A 2I9TA 1AZRA 3ABKB 1ZA6B 3V0FA 4KFZC 1YY9D 2V5TA 4LMQI 1VIWA 3CC5A 4YX2L 1FZKB 4H8QA 1DVXA 2AP2A 4M3KB 4U1IA 4PGJA 3QYCA 3ZZ1A 2VN4A 4K9EH 4RFEA 5KN5A 5DUML 3PHSA 2CR3A 3S36L 1TJGL 2O5XH 1UM4L 5KVFE 1KJVA 1XGUA 4MJ5A 4LL1A 1Q72H 2DW5A 3QUKA 2DQTH 2VABA 1DVFD 3PWUB 4G8AC 4HPOL 3SDDC 1A9BB 1TLMA 3IU4H 4LASH 4Z0XA 1GH7A 1LDPH 2COVD 2Y7QB 1HYSC 1JNHB 2Z92B 4OGZA 3I3DA 3MRIB 3QDGB 4JUSA 5JHMA 1S9YB 3KMDA 4M8UA 3GI8H 5F70A 3M88A 3P30L 4RMTA 4DUVA 3QEQA 1IAII 2P9RA 5F1NA 3SKOB 1CT8B 3T4AB 4KDWA 1G7PB 2NY1D 1FFNA 2OJZH 3W1ZA 3NT0A 2V2XB 2RAMA 1KJMA 5DWPA 4A7SA 3D08A 2EIZA 3CVIH 5E6RB 1GTFA 1EAPB 1P4LB 3L4UA 2VQ1A 3U82B 1KCBA 1O9ZA 2JCWA 5C0RH 3O3DA 2OP4H 1BFSA 4TUJA 1JGUH 3O3BA 4KDTA 2PO6A 3OTTA 3MRGA 1IGTA 5EUOF 1Q90A 1AR1C 4LSQL 2F53B 1RIHH 2ICEC 1WS7A 4XP6L 5DJ0B 4NGHH 2E47A 1FC1A 3D87B 3SPVA 3MLXH 1PKQB 4XNAA 3CFEB 5H94A 4XMLL 3TYFB 2FHFA 5CFAA 1WWAX 4NO2A 1F3DH 1VFAA 2J1WA 1FYTB 5F7AA 1RJYB 2MHAA 3DMMC 4PGZA 5IQLA 3X3FL 3BT0A 1G5AA 4IBYA 2JCCA 3UEQA 3G5XB 1MFBL 4QXWA 2DYRB 1AD0A 1EO7A 3V0VB 2E4FA 1HQRB 5I1AB 5IVXA 1AFVH 4ATWA 4HWBL 4AEEA 4QRPE 2BSEA 5DI8A 2OP4L 5CCKH 3OJDB 4AEFA 3H85A 3H0TA 1SFDA 1U8OA 2W9DH 3P0YH 1LM8V 4ZJ9A 1Q8MA 2FIKB 4ODBD 3O3BB 5AW4B 1HOCA 4X4ZA 1HAWA 3BSGA 2WXQA 1S4IA 3EFDH 3H9SD 3OKDB 5IHHA 5FW7A 3FSVA 1UXWB 2NTSP 1JXKA 1KJ2A 4XX5A 3LS4L 1MWOA 3OAYK 3VGEA 5L7XL 3TH4T 4XVTL 3V6ZA 3NYKA 4L8DB 1DVFB 2J25A 5EBLB 1YECH 4ZMYA 2NT1A 3SKNA 5I1HH 4JFPB 1IFHL 1C08B 1FZOB 1NSNL 3NSFA 4ONGL 1G94A 3AQZA 3SDAB 3NN8A 2VRQA 4QRPD 1IGFH 4R7XA 1YCSA 2EIMB 1QBBA 3BP4A 3GSUA 3QDJB 3WNIA 5TQ2H 2PYFA 4PJ9D 4PVNA 5DLLA 4YEFA 1AE6L 5DEZA 1OW0A 2BSCA 3L16A 1YEJL 1IARB 5F7DA 4MMZB 2F54B 2NY1B 5H2BB 32C2A 3VXUD 1A47A 3IKCA 4W9KC 4RFEB 3VFRA 5KN5B 3H4HA 4UAOC 1KZQA 2WAQA 4PJAF 2APVA 3BO8B 1B88A 2E7MA 2EYRB 2VOTA 3G9VA 4CSZA 4X5PA 1JZ4A 2B08A 5GGRY 4PP2A 4WW2A 1HL8A 2VN6A 3C12A 1RK7A 4NSKB 5F96H 3UTSA 4OFIA 4GBXD 5B39A 5D7HA 4U7MA 2Y7QA 1KXQE 3QB7C 4Y1AA 1JGLL 4MA7L 1TXKA 3M7FB 2WUCH 4P3CL 4UQAA 2UVFA 4Y5VB 2IH8A 3LMJH 1N68A 1AO7A 4K8RD 3ZL1A 1Y1UA 4MAUL 3HI1A 3RHWF 2CA4A 2WQXA 4WUKH 1AQ8A 1FFNB 1DANT 2ZNXA 4MAUH 3RVWD 3RVWC 4K23H 4IDJL 1CICA 1Z3GL 1G6RL 2CJUL 1JP5A 2QELA 3A23A 5BOPA 2NRDA 1J88A 4J3OD 35C8L 2AFNA 3D39D 4NM4L 2GC4C 4ZMQA 5D7IF 3H9SB 2G3XA 1EEQA 1RJZB 1AGFA 3AAZA 3P4MA 2IMNA 4O2EB 5CJXC 1HFUA 4YSDA 4PRHE 3GNML 4L4VE 5ID1A 3P77B 4TF4A 5SWZD 1XIWA 2JVUA 3IS0X 4N5ED 4UAOB 2NW3A 2IFFL 3VXSB 4AKPA 4OIIH 2DYPD 1BQLH 1KCVL 1LO0H 1T0NA 4LCWD 2EC9U 2F54E 4A2EA 4EQ3A 2P5EE 3DWTA 4UIKL 5ICZA 1E0OB 2FCBA 1A9EB 3B7UX 1OF2B 2K6YA 3KXFD 3KXFE 3EFDL 5BQ7B 3NJNA 2IDFA 2IOIA 5E5UB 3Q8AA 4WSGA 1DBBL 1YEJH 2X87A 1NFIB 3BN3B 4FQIH 3SOTA 1UWEL 3WLWD 4DPRA 2AK4E 3PDOA 3KPMB 4P2OB 3AM8C 1OAKL 4P5KB 2P7TB 2B2XH 2EIKB 4AZ8B 3IFLL 2BDNL 4KJPD 4X98A 2C3HA 2YSSA 5HHNA 5LLIC 3BD5A 3MKKA 1J9QA 1UG9A 5GGTA 1Q0YH 2ZSWA 4FQXA 4MJJA 3ZHKA 1MJ7H 3FULA 4ONOA 3BX7C 3DRQB 3EDEA 3DX4A 3TBYB 4G6MH 1TJIL 1DSFL 4U6VL 1IL1B 1YEGH 3D51A 1MHEB 1TZAA 4R7NA 1FV1B 4AMKL 3NK4A 2OZ4A 1QEWA 2V5SA 5IBLD 3FH7A 4OV6F 3T1FB 2WZPA 5D2NC 3QPKA 5C0RL 1MH5A 3LH9A 3KBEA 4PV8A 1C5DB 3RB7A 4QRSA 5FKAB 3X1NA 5DDHA 3W38A 3BDYL 4AI7A 3MU3A 5IHZB 1YJDL 2LOEA 3EJJX 2ZOLB 1A25A 1OY3B 3HC4L 5L8LB 5LJYH 4KXZI 3CWGA 3PFQA 3ABLB 5FHAH 1MFUA 5FO7B 4B60A 3EDFA 3VWKA 2VH5L 4FA7B 4Z3FA 4N0CC 1S3KH 4Q4IA 4X7DC 4M7LL 1WP6A 5KYWB 4UT7H 5J0BA 3QEHB 1QSFE 3DSNA 5IJBC 4AJYV 2D03L 4JBSA 1M1SA 1CJYA 2BWQA 4XCCH 3SKMB 3BPCB 1RU9L 2AMGA 2BNRE 3L3HB 2E7HA 5LAXA 5JOPE 4HEPG 5CP3A 4HS3A 2R9HC 3QQXA 3A4FA 4KY1L 4AGPA 4TRPL 3EOBA 5I6NA 1UXLA 4NKIH 1HTYA 1PKOA 4Y19E 2X4SB 4PJAA 4ABWA 1OALA 4Y2DD 5SWZB 2LVEA 3A6CL 3MLTA 1CFQB 2NXYB 1HHHB 3NIFB 4GG8B 4PLKC 4FQQA 5J13B 1P4BH 1D9KA 5AVTB 1IILE 4JMXA 1VF5C 2CKNA 2GTZB 1GZPA 4X6DE 2CG9X 4N6QA 4B0MB 4EOWL 1HNYA 2WINB 4EDXB 4CBZA 1SQ2N 2ZX8A 2NW2B 3PP4L 4F7PB 3QFJE 4BK5A 5TDPB 4ZFOB 4OGXL 4KTGA 3VFPA 1A9BA 3F7RA 1E5BA 2BJMH 1U8QB 3IMVA 3QGVA 3V95A 3NZHL 3ZQXA 1XH2A 3MV11 4PCTA 3O9WC 4FXGC 4IBTA 3ZXAC 3KLHD 5CJ5A 4ZFQA 1VEPA 3II3A 2FEEL 4PJHE 3RIAK 5H37H 5B38G 4XPAH 4P2QA 1U8CA 2GY5A 1U93B 1GJWA 4U0RC 3GBEA 3IXTB 2OZNA 2IH9A 1T20B 3C2SA 2HX8A 4E42A 4N5EC 2BNUA 2IPTL 3BWZA 5L88L 1OT1A 5DD1H 3ELAT 3EXJA 1I1AA 1U3YA 4A39A 5CCHE 1I9RH 1F2QA 4OSUH 4IKKA 1K8DA 4L9LA 5JHDE 3L3KA 3LNHA 1LEKA 1UEYA 4Y9CA 2QSCH 3ARRA 3P0GB 4FXTA 3U0TA 4QHUB 3SO5A 3LH2L 3VE0A 3EDKA 4GYBA 2BZ7A 1AO7D 2DMKA 4X8CA 2UXGA 4JY4B 1VEOA 5E2VL 1Q9LA 4Z9KB 3WSQL 3F6LA 3M1CA 1IM3B 5HYJE 3H2PA 1WF5A 4IJ3B 3NIFF 3Q5TA 2ROYA 5F7FA 4NENB 5TGBA 1MHCA 1KB5A 4FHJA 4QCIA 4TS6A 1T89C 4JFEE 5F9AC 4QTFA 3N40F 2PYED 2ATKB 3NACH 3FPYA 1UM5H 4M93C 5KSAB 2K7QA 4FN0A 4NHCH 3V0GA 2ZCLH 1QSEE 3NJMA 1AGDA 3JTSA 1Q9OB 4JHZA 3EO0B 3MTXA 4G7QB 3SSGA 5LQBH 2AK1H 2VQ4A 1EDHA 4WWKD 3I84A 4YXHL 3BD3A 5BCAA 2J72A 5E9DB 5I75B 3O81A 4OFDA 3WKPA 3BZEA 1DBJL 3MRRB 1E28B 3HR6A 5B4MD 3R06B 3RL1B 2WKGA 2FQFA 4DOHB 5I76B 1CZ8L 1H3TA 1WV7T 3E3QE 4Q74A 1EFXD 3VX0A 3D25B 3D0AA 3HIZA 1SJVA 4G9FA 2AJYL 4ADIA 2JKWA 4U1MB 4KK5C 4TTGA 2CLVA 5HDRA 3T2NH 1PZ5A 2EKSA 2DMBA 4F9PC 5I0XA 5C0IB 1QFWI 4G42B 3L95A 4P59L 1AY1L 2DQCH 4JPSA 1E4WL 3P9MA 3Q8BA 4JREC 4XE0A 1QW8A 2V8LA 3GEFA 4MD0A 3F62A 4PN6A 3HZVB 4UOW1 5SX4I 3ZMNA 4PRIA 4RMUA 2V3DA 3RDTB 4JG0H 5KS9F 4PJHF 1DDHA 5DJDA 2ARJB 1PMYA 3CN1A 4RZKA 1BOGB 3CVBA 2F5AL 4FQ1L 4GSDH 1ACXA 3MLUL 5F1KC 4YBHA 4K7PH 3O2DH 1PZDA 4Y19D 4FFVD 5F6HI 3BRFA 1DVZA 3DVFA 4NO3B 2O6EA 3FF7A 4P59H 3PL6D 1GR7A 3MA7A 1EWHA 5DHVH 4UV4H 1N19A 1WWCA 4DP5X 3M6DA 4KQ0A 4ES9A 5C08D 2YRZA 3O4OB 2QR0B 1N59B 1RUAL 1CZ8H 2CHZA 3S8WA 2R1YB 4P23B 3EOAB 3OC8A 5T1LA 1NL0L 1F4HA 3CXFA 5TQ0L 3TJPA 1A1MB 1Y0LB 3WNMA 2J43A 3FO9A 2K9FB 5GRUH 1GPOH 5KSBE 3BKML 2PO6D 4F1SA 1UB6A 3HHRB 3LN9A 5LQBL 4F9LA 4PV9A 2D4FA 4I7ZC 4R83A 1HHKA 3HC3L 4I85A 1A6WH 1EBAA 1F02I 2A6KA 4N8CL 4Q4EA 4DEPB 2JCCE 3OR6A 1U3HD 3MUHL 4TVPE 3TEUA 2A6DA 2XPZA 3QXUA 2H6PA 4NQED 1P69B 3B9KD 2IADB 4BK4A 1R3IL 1HIML 3ME0B 3OLGA 3BJLA 1FZJB 2M83A 3MRQB 2ESVD 1X9RA 3TCTA 4GKSB 1I8IA 2D2CC 4G2AA 1WCBB 4WJ5B 1ACZA 1QTPA 4F7TB 1RUKH 1TZIB 1Y1DA 4YHPB 3RGBA 2F58H 5LO7A 1Q0XH 3UZVA 4AUJA 4XC3H 3ZMEA 1MFCL 4MB3A 1UC6A 1HHJB 5C09E 5F1OB 2WNKA 1X6LA 2QKIC 2Z3FA 3VFGL 4R5TA 2R7EA 1I7RA 1UZ8B 5KSBB 3KNBA 4HJJL 3RWJB 1B4JH 3G7TA 4KKCD 1O6SA 2G75B 2NY6C 4QRRD 1QSZA 3NOIA 1XBDA 4KFMA 1JFQL 1G6RA 3FHQA 2O6CA 4KK8D 3WIHH 4F7MB 1H6TA 1V5JA 1M7XA 3BZ5A 3HNVH 5CIPH 2QPDB 2JB5L 3L08A 4WFFE 2FBJL 5JIPA 1SJHA 1SY6H 4X6EB 4ERSL 3AROA 4ALAL 5H37G 3EG9A 3GMQA 3GMMA 5L8JB 4PWGA 1JGDA 4L4JA 4HALA 4PP1C 4BINA 3MNVB 5ABZA 3SDAD 1UT1A 5F7WC 4JG0L 2Z65C 3CHRA 5FO9B 2WV3A 5DQ9B 5IBUG 2XQBL 3MZGB 5BRZB 2AJSH 3OZLA 2WXGA 3TNNB 3S97C 3SCMD 1FZMA 3TJEL 5DA4A 3T0XA 5ENWA 2OI9B 1AY1H 3CU7A 1T22B 3P3YA 5GHWL 2CHWA 3L1FA 4Y9BA 1CDGA 1B2WL 5IHZA 4UQ2B 3W9EA 1XZ0B 2GIYA 4ACTA 3FCTA 4F33B 5C9KA 4BQCA 1XCXA 2Y9RT 2A99A 3G04A 3G5WA 4BKSC 2F08A 4UUJB 1ASPA 3GM0A 1P5UB 3CSYA 4JDZA 4KVNH 4OM1L 4B3VA 3FT2B 1M57B 3WLBB 2Y24A 3VGHA 3QE5A 2HJKB 4GMTL 4JE4B 2JTDA 5EFIB 1U95B 2EDFA 4UQCA 2BWIA 4X4KA 2WMPB 4CMMA 5CILH 3A6BH 1XAKA 1ZTXL 1ZGLA 5T3ZH 5KS9B 5IV2A 3A67H 3KVPA 2MTAA 4J3XA 2OBGA 4KY1H 2P24B 4P99A 3MBWA 2VGLM 2WVTA 3FOMA 2IPKA 1FNHA 4HSAC 4GPVA 5FUOL 4XE5B 5DXWA 4HH8A 3IFPA 3QCVL 4JQIL 4FQQB 4MX7A 4GS7C 5DRNB 5TE4L 3T65A 1M7IB 1P7KB 4P2RE 2W0LA 1RUMH 2YMXH 3DMMA 4HUNB 1QSED 2GSGA 3CPLB 3BDYH 1E27A 1NCGA 2B5IB 3SKJL 2NTFA 2UUDH 3AM8A 3ZO0A 2CIKA 1R0AH 4HG4J 2FSDA 3K74B 2HT3D 3Q3GB 4KX9A 1NGQH 2CXGA 2ATAA 4PJGE 1EZVY 3MGTA 1E7VA 3GS0A 1MAKA 2C9SA 1GS6X 4HCRH 3D39B 1PZBA 3F58L 3QUGA 4KAQH 4RRPM 3ARBD 3X2QB 5IY5B 1N10A 1N4XH 1J8HE 3O6KH 4PR5A 2VDOL 4AYDC 2JV6A 3MODH 4W68A 1P7QA 2K70A 5IB1B 4YHZH 2Q7YB 5EBLA 1DL7L 5F9WB 1U8HA 3KS0J 3CBJB 2FX8H 3SGDI 1DVQA 3KWVA 4U0RB 5CP3H 1BLNA 4Z5RA 4KI5E 4X8JA 1U21A 5AW9B 5BS0D 4JGNA 2NQCA 1PSKL 1MCQA 3L3DB 2GB2A 3L6FB 3H2QA 4OUOA 4AQEB 1FORH 4K8RH 1IAMA 3CFKA 4BYHA 5DMIL 3A3YB 1KBPA 2EZ0C 1OARL 1WD9A 4YHYB 1TZGL 4QLRA 2BP0A 5BRZD 3RJDA 3ESPA 2N0MA 4BCZA 3DXAE 1F2XK 3H1ZA 3HKZA 5KVDE 1NICA 5I6PA 5FYJH 2BX5A 3VFNB 1OWRM 3SYCA 3VWJA 1ZDQA 1A3RH 2YAOA 4XVSL 1X5JA 1QFUH 3MRHB 4D7PA 3AGVA 3DX0A 4XX1G 2VDPH 2P5ED 1RURL 4AQOA 5EN2B 4BXSV 2JXMB 4MCMA 1DJXA 4ZO6A 3TBTA 4JQIA 4NHUB 4EUPB 4O02L 3GNMH 3ZQ9A 3BN9C 1NGPH 3LOWA 1FNAA 4G6KL 1LO0L 2EUVA 2K3TA 2OTPA 2BNQB 2IFFH 1HI6B 3BQVA 1R9FA 1PZUB 3LEXA 4HIJA 1TQBC 4MYPA 1T0NB 4UINH 3UBXA 4AMXA 3HE7A 4Y8AA 4L1LA 4PLOB 4R8WL 3U6RA 4HWEH 1JF1A 3IM1A 4FMKA 4S1RH 1ZIBA 4KK8C 1DEDA 1VCBC 4DCQB 2FWOA 4F8OA 4EUPA 3LEYH 2DBJA 3QUYC 2X4PB 4NKIL 4XZUB 1BZQK 1V7NL 3I6GB 3NJLA 4JPQA 3I9IA 3MJ8B 3IJEB 3LKQA 4Y5XB 1AKJB 1HXMA 1T6WA 4FXLA 4ZOCA 3SDDD 3VAEA 5GRVL 1JJUA 4JLRA 3TNMB 2AERT 4U7KA 2YMTA 5LGKA 3IRZA 1A6TA 3WJMB 3EO9L 3KGUA 1GHFH 1WGOA 3GSUB 4AEHL 1OAUL 4UV7L 3TEZA 2H5UA 2LAAA 3VM5A 1CG9A 2I9LB 3HS9A 3ORJA 3QWNA 3ARDD 3JV0A 4BFRA 5H35B 2D3LA 2VUOA 2ZXEB 3JVFC 4P23D 4DW2H 4Y5XA 1BVNT 3TVMC 1WK0A 5E08L 1TMQA 5AUMA 1V05A 4DN3H 3SJVD 1OGSA 1UH3A 2CR6A 3HG0A 2XDHA 4R9HA 3EF4A 3HB3B 3QRBA 5D7KE 2X4RB 3ILPA 4PLKD 2MTPA 1MQKL 5BS0B 4LCCB 4CU8A 3QS3A 1QBLL 5EZJB 1YEGL 4YDJB 3DC0A 4JANA 4Y1AB 4YXKH 1MY5A 4O58H 2AAAA 3BDXA 3IDUA 3MLSL 3D2UB 2XV2A 1W72H 4D0BB 2HG0A 3V52L 5I28A 1ZHNA 4LU5H 1X5IA 5E1IA 1G9HA 5F8QC 3DUUB 3L5WB 3HMWL 3K6FA 2X0WA 3V6BR 3T08A 4YQXL 5BW7C 1YECL 5JHAA 4RVBA 1MREL 1U92A 1YPZB 4Y9GA 3BPNB 4IGBD 5HI4D 3SE4A 4AQ8C 4KTYA 4NRZB 2H45A 4H8VA 3ZT5A 3FUDA 3MLWL 1EHLH 4PJDA 4PD4J 1S9WB 3X1GA 3E6FA 2FSEB 2AXJA 4WDIA 5IEHA 5D2LB 1KYDA 2CUHA 3L6FA 3APDA 2FE0A 3CZJA 2AEPH 2PETA 2VO5A 4PV9B 3DJZA 2BSRB 3SQBA 1NCNA 2VDKL 3WMPA 2A6KB 3ZKSD 2BC4B 5IW6B 2QQNL 2J1KA 4YHIB 5DJXB 1XQ4A 2B3RA 5FYKE 4D9LH 2W0KA 3T0AA 3GO1H 1IFRA 2EDOA 2XOTA 4X7FC 1BGXH 3RVTD 3UMTA 4WO4C 1AKJD 3NIGF 1G7HB 3EUDA 5CJ8A 2CXKA 4H44C 2Y7NA 3O2WH 3QZNA 3IFNL 1XD0A 2IF7A 3EYQC 3NCYS 5TF0A 2QLYA 4NRZA 1JPGB 4RQQA 2E6PA 4NNPL 1ADQA 2B1AH 4XMLH 5FYKH 4GUOA 3CMOH 3SD5A 2I60H 2BVOB 3KAAA 1IV8A 2YBRB 4HJGA 3QUMH 4NYLA 4QI3A 2YN5A 4P4KC 2P8PA 5D4JA 1E3ZA 4ZOAA 4M4PA 3LIUA 5DJ0A 2QADD 4NN5C 4HLZH 3KE0A 1HL4A 2RIKA 5IV2B 2VZOA 1JWSA 3OZ9L 4BA8A 1BFOA 4W9HC 1DQML 3VXPA 3W0WA 2PWHA 4C54A 2Y1YA 2YGNA 5C07A 4S0HA 1KFAH 5TH2B 4YFLI 1R3JA 4F8PA 4A2LA 1OP4A 1UJTA 3DARA 3O3DB 5IEKB 5EO0B 2B4CL 2YD7A 4AV4A 4AIOA 4TQEH 3P9MB 5F89B 5KYXA 3MRGB 5FLVA 1JAEA 3T3PE 3D85B 4E41A 1OAZL 3CSFA 4EPSA 5K69A 2FO4A 1RUPH 4Z7AA 3GI8L 3STLB 3Q05A 4RFNB 3FCUB 4E41D 5AZUA 1NFDE 5HI4C 3QDMB 2DQTL 1N67A 5DUPL 1OAXH 3ZDXE 4LSUL 5LGJA 5ENWB 4XBPB 5EZIH 1IGFL 2C7FA 1JWUA 5D1QA 3WKML 4HJ1A 3UTPD 5JORB 1E4KA 3KYNA 4KKBD 2PWGA 5CUSH 3IDNB 3HS0C 4LCIL 3UIZA 3L5HA 4PVMA 2FJFB 2X4TA 2YQBA 1SXBA 3OAYH 5I1EL 1KY6A 3V55A 1S7TA 3L9RB 3UYRH 2EKJA 1XGPB 3WHE1 2OJ1A 7FABH 5J1AB 2CSPA 3MJGX 2YR3A 2GHZA 2NYYD 3FONA 1IAKA 2WVVB 3JVGC 3FO9B 4JN2B 4XC3L 5CINL 4OI9A 4J3SA 4LOVA 2ZE0A 1U30A 2DYPA 1JMZA 4RRPG 3HNSH 2BP5M 2C1PA 3RVUD 1R0AL 4Y88A 3JWOL 1WISA 3NIDB 5A2FA 3CZEA 4DFIA 1E6OL 5F7BA 5AB0A 1N5YH 1ETA1 5KW9H 2YEQA 4JFHD 4NEHB 2XV6B 3Q8CA 4GSXA 2YKLL 2WTRA 4K3DH 5F3HB 3P40A 3SBQA 1HU8A 1XT5A 4PJBF 4IOSA 2XTJC 1CICD 1BZ9A 3PGFL 4EE2A 2F19L 2GABA 5ES4B 3BZFB 1I8IB 4JO3H 5D7LA 3PWPE 3MOQA 5AZ2L 3T4AC 1PZ3A 3ZY7A 5MEQA 3P73B 4Q0XH 4WWPA 2AV1A 4X4XB 4H0HB 2BIMA 2BNRA 4MMXA 5I8KH 4PB9L 3IU3A 2V3FA 4CA4A 3IE9A 2VSMB 2XBDA 4H20L 5I1JL 5JTWA 1BD2A 4ZODA 4UQBA 4XCYB 2ZPKL 4KKBC 3O3UN 4GBXB 1NLDH 5T1KA 1E67A 2X6MA 4YHNA 4ABVA 2X6AA 2NXYC 2EC8A 4ES8A 2CALA 3ZYZA 3VU2A 4FG4A 2AGJH 5KZCD 1IAIL 3FUFA 5CD5C 5KAQG 3BIAX 2ZCHH 3DSFH 3PABB 4IBWA 1C12B 4Y16B 4N26A 3VD0A 1Y0LA 3DJTA 1FN4A 4FTDA 5E03A 1R3KA 5E6IA 3V4VH 3VCLA 5PCYA 4G8GA 1PU0A 4Y7OC 3D4ZA 1VGEH 5B7MA 5IROD 4RSYA 2MIZA 1SPDA 1YYLH 4MWFB 4A66A 1SN2A 1U8IB 2V2WA 4GXVH 3HMWH 2L3BA 2J8UF 2Y1VA 3OKEB 3GRWA 1P53A 3QNZA 1CURA 1TKWB 1BLIA 3RWEB 1XZWA 5CLXA 3IJSB 3UG5A 5KUMA 4HUUA 1CB4A 3CU1A 4JFXA 4E5XB 5AAWA 3NSXA 3ZDYB 3D18A 3MLSH 5EDXA 5IOKA 1WAAF 2CK2A 1FRGH 4O58L 2VR9A 5GGSY 5LAXB 3LRSA 4LKCA 4Z3EA 2CGZA 1GMIA 4WJG3 4U6XB 2IWGA 3SJVB 4QRRE 1I9IH 2DQIH 3NAAL 1UCBL 4L8SA 3VXSD 4MWFA 3OX8B 5AVSB 4W9CC 3NCYP 4APXB 2L0DA 2R59A 5FOBB 3OKEA 4OT1H 4UM8B 3DGGB 1R3KB 2VISA 3V0HA 2QVIA 2EUWA 2VDQB 4RAVA 4GAAA 2R1WA 5F97E 4BFIA 4JREB 2HVKA 3D2UD 2HKHH 4NQSA 3MR9A 5L4IA 2C1OA 1KC5H 1DQJB 3QXAA 3H3KA 2ED9A 1QFWM 3HUJA 3RVTC 4BBWA 5IVXF 5CEZD 5AB1A 1M2VB 1RUKL 1BXUA 4JZOB 3P1VA 2ZCKH 5MP6L 1YNLL 4P2RA 1MCEA 3DGGA 4I8DA 1G9NL 2ITDA 2E86A 4IGBB 1R3IH 5JHLH 1YY8B 1SF5A 3D6GA 3FSWA 1ZLUH 2EP6A 3AT9A 2HVKB 1Z1WA 4PJ7E 4U1HB 4AXWB 4JKMA 1KCUH 2ZSWB 4OTXH 1OZUA 2ZXCA 2YJQA 3MACL 3DBXA 5ACZA 2NYZA 3N1FC 1ECYA 1BMWA 3DURA 1PNCA 4EAEA 3MNZB 1T2JA 2PXYA 4MVBD 5ESQA 2DLFL 1T1XA 1MHPH 1I8UA 3FQUB 5TK2A 4OCXH 3SBWC 3B43A 1UD3A 2X4NA 2BIPA