5T1JA

Crystal structure of the tbox dna binding domain of the transcription factor t-bet
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
192
structure length
192
Chain Sequence
KLRVALSNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGSMPGNRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEPEAACSASNTHVFTFQETQFIAVTAYQNAEITQLKIDNNPFAKGFREN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the DNA binding domain of the transcription factor T-bet suggests simultaneous recognition of distant genome sites.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords T-box transcription factor TBX21
total genus 29
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00907 T-box T-box
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.820 Mainly Beta Sandwich Immunoglobulin-like Transcription factor, T-box 5t1jA00
2X6VA 1XBRA 5T1JA 4A04A 4S0HA 1H6FA 2X6UA 5BQDA 5FLVA
chains in the Genus database with same CATH superfamily
3B5HA 3RWIB 1RP9A 2XKNA 5IFJB 4NFCA 2BSCA 1XXFC 4OLZL 2APFA 4HFWA 4RGOL 5CBAB 1A1MA 2RIKA 1YZZA 3MREB 3IKCA 4ETYA 2UX6A 3O4LE 4ZW3A 1EHLL 2XT1B 1UJ3B 3OKNB 5EH1A 5IB4A 4PJ7F 4XNMB 5AG9A 5E5UB 2VMFA 2R59A 4P48A 4PW9A 2GJ6E 1R19A 3CHOA 3OHXA 4R7NB 3W11C 4N28A 4OFPA 1I9JH 3MNZA 5I1JL 3VNZA 2AEOA 5JR1H 1IARB 1TMCB 1XXDC 3NIGF 4C58B 1JVOA 2X70B 1CL7L 1OB0A 4KK9D 1D5RA 1K85A 2Z8VC 5AAWC 4JRYE 3SD2A 3V4PA 1QRNB 4Z77A 5DYOA 2BSDA 5EORL 3K71A 1F1GA 1MFVA 5BOJA 4M5YL 2X89D 3G6JA 1ZHBB 1ASOA 3FRUB 5TH2B 2OK0H 4AEHL 3V6FB 4XBMA 3KJ4B 3QDJB 5FFGA 1GY2A 2Z4TA 4GRLB 5C0NC 1WC7A 3I02A 1B2WH 1S78C 3H9SD 1WAAF 2EO7A 3L6FB 1S7SA 5FDWA 2JJWA 3MRPA 1TJIL 1CTOA 1HSBB 3D33A 5SWZA 4AYMC 5IW6B 5E08H 4M7KH 3HUJB 1QYGH 2FIKB 2YAHA 4NO0D 1PD0A 1LO5B 1PZ5A 5E00B 2X7LA 1OD9A 1JDCA 4U3SA 1Z2KA 3TBSA 3VFTB 4RMBA 1HINH 4K3DH 1LO2H 3EYUH 3VDAA 3GBEA 1REIA 4L3FA 5MEOB 4JJ5B 3WBDA 3N85L 2GB2A 3KE0A 5DZLA 5E99L 2ZUQC 7CGTA 2XWRA 3ES6A 1JYXA 4KX8A 2PW2A 1S7VA 2C9PA 1MH5B 3EUUA 3EJCA 4J8RB 4MXVE 3B9AA 3NFPB 3C6LC 3FN9A 5AW4B 1S5HB 3BP7B 1BCIA 4ODHH 2BOCA 3MLYL 4PJEE 1XTLA 5BV7B 3V7AG 3VYPA 2DIJA 1DDHA 4RX4D 1XGYL 5I74B 3VFUA 4OV6F 1JRHL 2WSKA 2YARA 4FFWD 4U0QB 3ZZLA 4X6BB 1SN5A 1WQVT 3BN3B 3E6FB 4JRXA 4OZFB 4UQIM 4HGWA 2X4NA 2FH8A 4KI5D 4Y89A 4YHNB 4EXPX 3N55A 1OLZA 2HFTA 3P9MB 4IGBA 4B97A 1F4AA 5EC1B 1XGRA 1KACB 4AQAA 1XCXA 2DY2A 3PWNB 5FUOH 4WHDA 4X7DC 4PI0A 4BSVA 3C5JA 1HZHH 4OJCA 3STZA 1OAXL 1N8ZA 3N9GL 5DVMA 2DWDB 2IADA 4JB9H 1AXTH 3PGDB 2P43B 4ISVA 4M7JH 5DEZA 4FFZA 1VSCA 1GGCL 4IKNA 4XCNB 1FFNB 4H26B 3BOVA 2ENQA 1FDLL 2NNAA 1X7QA 4G1MA 3D0LB 1VCBC 2WQAA 5GGRB 5D96C 4IKJA 2J5LB 3BGAA 5DRXB 2VR4A 4I77L 4ANVA 2HZHA 2NRDA 2BS8A 5C7XL 3QR1A 1JZ7A 2WVUA 3NIFF 3FYEB 5IQNA 3REWA 2OJZH 1TQCC 5J6GB 4L4TA 3H4HA 5JIMA 5KSAC 4M56A 1A6VH 5AAMC 1JPEA 1CTMA 5D1QB 3U0PB 2DQJH 3T77B 1II4E 4KROB 3CC5B 5EWIH 1RJLB 3N5AA 3IVKB 1G7MA 3HC2A 3QZWG 3L7EB 1RK7A 1B90A 2WWNA 1UGNA 3PNWB 3QZWB 4WNSA 4X5WB 4MWFA 4OCRH 4PS7A 4WFEE 4NQDB 4XP6H 3B9KA 3EAKA 3WFDL 1CD9B 4YBHA 1CGSL 1Z3RA 4WI0B 2VDQL 3ZKSD 1KTBA 2P8LB 1KLGA 1UA3A 2X9ZA 1A7OL 2OI9B 1BBDH 1U8JA 4Y4KA 4CADB 3OKLA 3NIFE 2PTTB 2W0PA 5CN3A 2NT1A 4FQ2L 3RPBA 4GAYA 1OP3H 4G82A 1G0YR 4OCYH 3IGUA 3MUUA 3JWNE 4U1HA 3B5GA 3IDJB 4F7TA 1CFTB 3A4EA 3X12A 1CLYH 3FU9A 1OP9A 2FHBA 2JIXD 4ABQA 1WWAX 4S0HA 1AQDB 1BFTA 3BP6A 2DLTA 2VLKA 4CUCA 1MHCA 4HFUL 4GG8A 3FONB 2GSIB 4LKXB 4GP8B 5ABDE 2ZOKA 1J9QA 3GGWB 3REVA 5HYJD 3K2KA 4XPHH 2GBTA 2IOIA 3O2WH 1F2XK 1HH6A 3OF6A 4CN4A 1MQ8A 1WBZA 5H2BB 3VG0L 4B9YA 4TSBL 5L2KA 2DQFA 2V6HA 1L9MA 1N59A 4D3CL 1H15A 5DFVD 1MCBA 1MHEB 2GBAA 3MRHA 5IIEB 3LS4H 2HWZH 3RBSA 5GGUA 3FW6A 2VNCA 1ZHLB 4NZRL 3O0RH 5F9DC 1WFUA 1AE6H 1AR2A 2AQRA 1LP9A 4F8TA 3WMPA 4LSPH 3LDBB 5C08D 2AMUA 4AEHH 5CFHA 1AGBB 4EOWL 3P4NA 4AV5A 1B2WL 5M7QA 3ZT5A 3MLTA 3L4CA 4BE6A 3VGHA 1X9QA 4Y2OB 1WTGT 5IT2H 2OJ1A 1Z7JA 2VDKB 3GTNA 3IRCA 5E08L 4MDJA 3WMQA 5L6YH 5EUOF 5FOBA 2X4TA 3TYGH 2LVCA 4NNXB 1OCOB 4B6ZA 4IM8A 4ERSL 5EPMB 3BT0A 3MROB 3ARQA 3N85H 4S0SD 2DJ4A 3BVUA 3OXSB 4OCSH 4R2GC 3GSWA 4PRIB 2EIMB 4KUCD 2X4PA 3U30C 2J1ZA 3BLBA 3UOAB 5FDYA 4UT9H 1D7CA 1NBVH 5E1IA 4FHKA 2J4WL 3G5YA 2EXTA 4ODHL 1GGBH 5I5JA 5HDBE 5LWYH 4XP5L 3VXSA 4EUPG 1XGYH 4PBVC 1ADWA 4YSOA 5D72H 2LGNA 1JRHH 1P7HL 4XCFL 1N0LB 1NOFA 1UGKA 3C09B 3SDXB 5E9DB 1NPJA 2E7BA 3RWHA 5C92A 3HNVL 2GAZB 4G9FD 3FMGH 5KVDL 5IQ9B 3W39B 1I75A 3PJSB 5JW4Q 4ZDHA 3X11B 3VVWA 1D9KB 5DD6A 3DHMA 1KGCE 3B37A 4TLKA 3UJIH 4LLQB 5KBPA 2PCFB 3QEGH 2YJQA 2EACA 3MCKA 4KXCA 4X4XA 4DPBX 1AC6A 2Q9OA 5TE4H 1DEDA 3EJYC 3Q44A 3ZYZA 4PGBA 1SDYA 2B59A 4AQ8A 3U0TB 2A38A 1N8ZB 4DT2A 5JW3L 4KPHL 1ZT7A 3D2UA 3ZHDA 4WSJA 3T3MF 2XTJC 4NPYB 5SWSD 5D4IA 2X4OB 4M4RB 1FO0A 1AO7E 2DMCA 4Z7VF 1E9PB 3ZKXC 1P5VA 3PHQA 2IFFH 4F9LA 2Y07L 1QTSA 5HGBA 3ZL1A 1SRDA 4ZOBA 1LO5A 3QORD 3OKMA 5ENWB 3HVNA 3F7RA 5AW0B 4R4NC 4Z7UE 4FG4A 4F7CA 2UWEE 3NMEA 3QDMD 4P2RA 2OMVA 2WLLB 3WXVH 4EF3A 3JV6A 4MMYB 4F24A 1I3UA 3ILPA 1TJGH 4ODVL 1BX2B 4QHMA 1S7TA 4KY2A 2GJRA 1JN6B 4WJG3 1E9OB 5T3ZD 4HXAH 5AYUH 1AQKH 3SYCA 3NK4A 4Y2DD 1FAIL 2UZPA 5ETUB 2VDPB 4OCRL 3QHTC 5T33H 4HK0B 5CM1A 4PJIF 4OZ4B 1PZSA 4WEMB 4AJ0A 1E6OH 1JUFA 4C56A 1PSKL 1IAKA 4NPKA 3V0DA 2VW6A 4WI0A 3UO1L 2P8MB 1QEWB 1WF5A 1ED3B 3ORJA 1A7PL 1WCBA 2TSBA 4L2YA 4A2GA 5LGJA 2Q10A 3COOA 4RSYA 3PCYA 3VFRA 1HSBA 3TTYA 5GS1C 5LBGA 2N7BA 4UIMA 2XWJA 4LDLB 3WL9A 1KCWA 4NZTH 1N68A 4ZG1A 4I3RH 1E90A 2N3JA 1OL0A 1RLBA 2P5EA 5CEZH 1F13A 5JOFB 1NFDE 4BELD 3C5SB 2W0LA 2F54E 2J25A 1CD0A 4YSRA 2NY3C 3DDFA 3F00A 5KANI 1JPSH 3GZPA 3RWJB 1LEIA 1W8OA 2GSIA 1U93A 4WWPA 3DKHA 3EZ8A 4YQXL 4PBWD 4PJEB 2VMEA 3KYOB 2CDFB 1ZGLB 5J6GA 2FO4A 3NPZB 3VG0H 3QFGA 5C0CB 4ECNA 4GW1A 4CL7A 3U7WH 4JM2D 3B6SA 3EYOA 4XPGL 2VZTA 3Q01A 3OM3B 1U4EA 3T0EA 5HVWA 4GSUA 1XVSA 3KPRE 4Q56A 3CJJA 4PS3A 2EKSA 1XF4B 2YPLA 4MJIB 4NP9A 4YR6A 4P46B 3MU3A 3O3DB 1MHPH 2QLVB 2CPUA 4L5FH 5B1AB 3VRJB 5DLLA 3VTMA 3BGMA 3BDYL 4OJYA 2WJ7A 2MSPA 5LGKA 2QQNL 3D2TA 2OMTB 2F7PA 2H6PA 4LBEA 4LLWA 4JRYD 3M17A 2AAVA 4MAYD 5BJTA 2BZCA 4WK2B 1NIBA 5I75C 4N2MA 2ADFL 1F58L 2X2UA 4NX0A 5JHLA 1SJMA 5C07B 3T0WA 5KOMC 3RILA 1KTCA 3WE6B 1YQVL 4FFVD 5IJKA 2YLHA 3QJQB 4LXFA 1MRFH 2F18A 5CGMA 3SE6A 4NKMB 3NRFA 4KK6D 3DUUA 4FI6A 1H3PL 1E28B 4BK4A 1RERA 2DWEA 3FONA 1DEEB 3OZKA 5FM5O 4BK5A 3D39E 4JG1H 4M93C 3MQIA 1TTBA 5KSAD 3GTTA 3V5DB 1GC1L 1MJUH 3QS3A 3LXAA 4G80B 3AQYA 4LU5L 1BQHA 1IV8A 2W91A 2VR7A 3M6DA 1KB5B 2J56A 3CXFA 5A6MA 2Z93B 3BUTA 5E1AA 1NDMB 4QD2E 5TE4L 4Q74A 3T8XA 1GZPB 4PWHA 4EUPA 1I82A 3S4SA 1UOKA 3APDA 3QG7H 3W1ZA 5E4EC 4AC2A 4YHLL 2W88A 2AEPL 1URZA 1DJWA 1BBJA 2EH8H 4I1PA 2PTTA 3OR6B 3AUWB 2NT0A 3IFOA 2WXIA 5FKAA 1MJ7L 3VQMA 1YCSA 2Y07H 7PCYA 4GBXA 3UZEC 5FUCE 1OO2A 3PPEA 4OZHB 3RL1A 4MNQA 1FNSL 2ZCHH 3MRNB 1H9DA 4DGVH 3P73B 1KXTB 5A16B 4WUUB 1UXMA 3H3BC 3WXVL 3US9A 5TK2A 5K59E 3GS7A 1WH0A 5AOJA 3MRBB 4K94C 5CZRA 3QXUA 4CRPA 2NR6A 2AC0A 1R3LA 4ZPTB 3BESR 1CGWA 2NSMA 4RDQF 1HI6A 2AQQA 1KB5L 4PAZA 3HBPA 1JDAA 3OQ3B 1RUPH 1RZFH 3CUPA 1RULH 4B95C 4N8VG 3BD4A 4DTGH 3SDAC 1JTPA 1AD9A 2CA4A 1U41A 4XC1L 2DL9A 4JZOA 1NIFA 4YDKH 1G7LB 3G5XA 4F7PB 3GMRA 2AJZA 1FV1B 2E76C 3KPSD 1XZ0A 2M1KA 3ARBD 2B5IB 4MAUL 2OSLA 1HXYA 3A4FA 3G5WA 1I9EA 1XF2B 4Z3TA 3U1SL 1H6UA 1IAOB 4BRVA 1WA0X 3FOLB 3TJHD 2B0SL 4IJTA 2OW7A 4MDIB 3TASA 3GSNL 2ZCKH 1IBZA 2GSGA 4JFQA 2FEDC 4ERSH 4QRFA 4OGXH 5CEZL 1DQVA 3UAEA 5HHPB 4K3HA 4U4BA 5CXPA 4NQXB 3IE4A 3HFMH 4PRIE 4M43L 2P52A 4PJGA 1FNAA 1HL5A 1GGIL 2Y2TA 1GKOA 4PS8A 4NAQA 2FZ3B 1Y07A 3SBRA 3H9HB 1ROWA 2FWUA 4LCYA 2OCCB 1G5GA 5FEBA 2VDQB 2YFOA 3JQOB 4TTDD 1FNLA 5D2LB 3OSKA 4GO8A 4N9GA 4JDZB 3CZFA 4NLAA 3POCA 3UERA 4N2CA 2BIPA 1YSOA 2K6WA 2CR6A 3SDCD 1FGNH 1K8DB 3AGWA 3KCWA 5JORA 4U1JA 5BVJA 2CKNA 2F7RA 4RGNE 3V4VA 4GW4A 2CDEA 3GUTA 2I5YL 2ZG2A 3S35X 4AENB 5E5MB 2VTFA 2WQSA 3D3VE 1GOGA 2RBLA 4H5SA 1YRKA 4NO5A 5CS7A 1FCGA 4YFLF 2VQ1A 4N0YL 1WJ3A 4O5LH 2MCAA 4AGMA 4Q9QL 1UZ8A 1UWGL 3IDMB 4HU2A 4TTGA 3B7UX 1K3ZA 1X5JA 4AQOA 4X42A 1ILSA 2FLRT 1IKFH 4FQJH 3O3BB 5LGHH 5T1LD 3QWOB 3LIZA 5EU3A 3IM1A 5LBSL 3VGAC 1UA7A 1RU9H 4K5MA 2ADGA 1J8KA 1DUYB 2AKRA 4K3JH 4HPHA 1N8OE 3BPLC 5DYFA 2VW7A 1NDTA 1RFDL 5DK2A 4LMQI 5FC9A 3TXAA 3VE0A 3OHXC 5GRJL 3TZVB 3DX7B 5HI5D 5I24A 3H53A 5B7MA 1OPGL 4GW5A 1U8HA 1CR9H 1RUML 4FTVB 3QYCA 3GM8A 4MZRA 5JZ7D 5E2WL 2EUXA 2OL3L 5LG1A 4BFRA 4ZUVB 3L4WA 4LT7A 3D51A 4LU5H 1QPKA 2XZCL 1MEXH 4U6XA 4KWUA 1M6OA 2I27N 5A7BA 1IILE 2Y0SA 3MLXL 3BAEL 3O3UN 4AC4A 4RNRB 2QHRH 3R4DA 1OB1A 3E8UL 2NXYC 2BNUA 3F05A 1JHKL 2XQ0A 3WY1A 5EUOA 2ILLA 2YD2A 5IBTH 4WU7B 1XF4A 3FB7B 4MJIA 2EH8L 2IQAA 5A2JH 5KBLA 3QYNA 3AWGA 3U79A 3LEVH 1CFQA 4NP4L 5J11C 5MEND 4Q2ZA 2VXTL 3D30A 1EA9C 4KDVA 4TPRL 5HSFA 2B4CC 5T1DL 3EJSA 1CVSC 2TRHA 4F80A 1XH0A 5EG6C 2GTWB 3TT3H 4K7PL 1FNSH 4IDLA 2E46A 2V17H 4LBEB 4LLWB 3QDHA 1T1ZA 1KY7A 4F7KA 2QQKH 3V10A 3FUMA 3C60C 2BERA 5KSUA 2Z8RA 1TZOA 4C4KO 2XHNA 3HNTL 2NQCA 3W9EA 1KBBA 1KJMB 4X99B 2CH8A 3MBED 2QJDA 4XWOD 2Y6TE 5ICYA 3QEHA 4Y5VA 4BCXA 1RHHB 1CDYA 3HG2A 1P4UA 2HRLA 2LU7A 3OBAA 5IVOA 1J1XL 3P3UA 2R69H 5E8PA 4OM0H 3TBBA 3SCMB 43C9A 2W80C 2DWEB 1RAMA 3DO7B 2BDNH 5JIQA 2ITDA 1BM3L 4ZZFA 1YC7A 1RULL 5HYJB 1MY5A 2FBJL 1TJHH 2BWQA 3EGDA 2E7HA 2EDEA 3MV7B 2KS0A 4TQPA 3HCVA 1E4JA 2Z64C 1PZDA 1CGUA 4QXTB 3P0YH 4L3EB 4UCFA 4WUUD 2IWFA 4PLNC 5F7EH 4YDKL 1FFOA 3O8XB 4H0IA 3M7FB 4DKAA 3JUYA 2FQGA 5AB0A 1JI1A 4HHAB 3PHSA 1B9ZA 1BG1A 3UBGA 3VACA 3WKPA 4DOHE 4MD0A 3DJZA 5DMKB 1NMCC 4YX2L 1AH1A 3B7SA 3BH9B 1S7SB 3Q5TA 2ED6A 4XN4A 2A4ZA 1E5BA 3MRCA 5F0JB 5FDWB 5HGAB 2WVVB 3DMMD 1UD8A 5HVHB 3T08A 4HUNB 4L4VD 2DMGA 3UJTH 3ZKND 4MJ5B 3QFJA 1AJ7H 3NFNB 4JFEB 2DEXX 3MRIA 1PZAA 5A6LA 3GB7A 4J6IA 1YYML 1VHPA 3ERXA 3CSYB 5MI0C 2WV3A 1O9ZA 2AK4A 3LKPB 1T04A 5BRZD 4JRXE 1N7ML 4WRLA 5F0LB 3C87A 1A9BA 5HHXL 5L9DL 3BEWA 3AY2A 5KAQF 1NEZA 1VEPA 2X1WL 3JV4A 2C9XA 1AGDA 4B9PA 4J4PA 2UUDK 3ARBC 3IMBA 1PCSA 1CFVL 3GDCA 3HG1D 5E8DH 2QVIA 2GITA 4G9FE 2ZWNA 4M1GH 3L3OB 1CLZH 1U8LB 4KGLA 5DD3H 4AE0A 1DVFB 4R8WH 4LPUA 5GZOA 4N2NA 3N1FC 4PWKA 1BQHB 4PCSA 2UYLA 2VXSL 3KPMA 1QUPA 1QR1B 3EO1B 4MJIE 4OIFA 5BZXA 1X7TA 4JZOB 3KVPA 4HS6B 2B1AL 3JWNH 5CJQL 4RQQB 4GMTH 5EN2B 5I1IL 3MRMB 2X1OA 4A2MA 5D1QC 4P3CL 5DS2A 5D1XE 5K9QG 1UWGH 1KYAA 4JY4B 4NC1E 1UATA 4NHUB 5LGHL 4MDIA 1YEHH 3HNSL 4WO4A 1Q9WB 1N64H 4R5VA 5F2FA 4U6VH 3RFRA 1RU9L 1R47A 2KMWA 2P8PB 2VMDA 3DJSA 4G8GE 5SWSB 3Q1SL 1QQDB 4HKZA 5D2LE 1BZQK 5D9SB 3O6LL 5HVGB 3TV3H 1BP3B 5F3BA 5HYSA 5IM7B 1LE9B 2HT3D 3AMKA 5I0WA 4RWYL 1TUPA 4B9FA 2WN2A 2Q2LA 3ESUF 1U2YA 1BF8A 5GGSA 2AV1A 3DK0A 2FYYA 3KWVA 4LVEA 1XH3B 5KBDA 2HFGH 5IOKA 1RUMH 3RY6C 1E4XI 2HG5A 3RYMA 4YDNA 5E2WH 1N2RA 1F41A 2I26N 3B1UA 3IDXL 4HAKA 2VUKA 1G7IB 2H8PA 1A6AB 3RWIA 4PD4J 2EIJB 1DZ0A 1FL3A 2BVPB 1L5GA 1MJJB 5L2JB 3MOQA 4KJYB 4OY9A 2QHRL 5I8KL 2E4TA 2BNRA 1C1EH 3DTUB 3GK8L 4KK8C 4BSWB 3MUY1 5F9OH 3K3QA 2JKLA 3P11L 5LAXA 5FYJE 4DESA 3F7KA 1ZVNA 4I5BA 5EC1A 4PLJC 1WAPA 2Z31A 4QEGA 1B0RA 1YY8A 1WT5A 1CFQB 2VXTH 4TPRH 3T1WA 2ITEA 1AHWC 1O9WA 1HEZB 1OTTD 4LDEB 3QULA 4PU2A 2FLMA 3PWUB 4X2UA 5EU4A 5JHMA 4K7PH 5HHPA 3LSOA 1W72B 3X12B 3UBHA 3GEWB 3QWRA 2QVKA 43CAA 3ZE0B 5DUJA 2CRZA 3N1GC 2NR6C 1BZOA 5FFLA 4L4VE 1B9KA 1ODAA 3S7GA 4J3WA 2V7NA 5AZEH 4ENEC 3HS0A 4H2AA 4QXUH 1QSFE 2AJ3B 1FIEA 2YEVB 3SDAD 4GMSL 1KDIA 1KJ3H 4XZUB 4G9FA 4EKXA 2CO6B 1MREL 3RA7L 4QNPE 4R96B 1Y0LA 5FCUH 2AK1H 4KITB 1ZHNB 1ID5I 1NAKH 1XH2A 4PIRF 5I18L 1U3JA 2QHLA 3BQUC 2W8CA 3AY4A 4HBCH 5I76B 1GL4B 4PJAA 1XTMA 2VDMB 4OIIH 2M8XA 1LGVA 3QCUH 3P73A 5IESL 1F00I 4IKIA 4JVUA 5E9DE 5J12B 2JSFA 4KO6A 2P9RA 5C0ND 1ND0A 3MV9A 2WHVA 4KROC 4YSEA 3GO1H 3H9SB 1J5CA 2L7JA 3P9WB 1IEHA 1T0NB 4R4FL 5KOVC 3QUMA 1Q9KA 2WNGA 3P4MA 4FKHA 4IBYA 1EH9A 1NBCA 4KROD 1KCLA 4QI3A 2ZNWA 2GJ6D 2IWKA 1TCMA 2ZWZA 3OR7A 3UZQB 1LEGB 3BAYA 3T65B 1W72L 4NO5B 4FFTA 3PP3H 2BM3A 3O8XC 5HJGA 3NBNA 5DYOB 5AWNH 5T3XD 4QRTA 4D0DA 1XGTA 4U2YA 2H26B 3GRWH 1OAKH 4MWFB 1XGPA 4G6AC 4D8PA 2CRYA 4CVUA 4JNXA 2E6QA 4A7VA 5G2NA 5FV1L 3ZYIA 3IDJA 2W92A 3V0WH 1QR4A 5ISZB 3V0GA 4FI8A 5L9DH 4YO0B 1CDIA 2AQ1A 3QCTL 1F56A 1MFDL 4MXVF 4PJCE 1O75A 2J55A 2YWZA 4X9YA 2YQGA 1TKWB 2VXVL 2FHFA 4LOFA 1JZDC 1INQA 2F19H 1YVLA 3C5JB 4RDQG 1U92A 4Z0BL 5GZNC 1CFVH 3B34A 1KCSH 3QHFL 4FQHA 1JNNH 1N26A 4LIQE 3HI1A 4BWTA 4EQ2A 4UOW0 3REVB 3STBA 4AE1A 2NY5H 1NLDL 3BZFB 4TXVB 1P1ZA 2EDLA 3ZKNC 1KPUB 3I84A 3MR9B 3PJSA 1ICTA 5B22A 2VLKB 3Q2VA 4JY6A 5DRNA 4M1DH 1TVDA 1MUJB 3T8VA 4D8OA 1S78D 1A47A 2DQEH 2ZUYA 3DRTB 4A37A 4F57L 4DP4X 4PJ7B 4FFVC 1A3QA 1KBKA 2MNUA 1LEKB 3H55A 4O51B 3V0AC 2A6DB 4CA4A 4FTDA 2UZIH 4LGSB 3TWCH 2HYMA 3N41B 4OLWL 4QRQA 4A39A 5J13B 1WDAA 4P3DB 3KPSE 1VEOA 4J1UA 5IVXF 2F61A 1ZV5A 3BP4A 1CURA 1CJYA 3L3JB 5DHVB 1PD6A 1OE3A 3TEUA 4I0PD 3UEZA 1RZKC 2QMKA 2CXKA 2Z1KA 4CDGC 1K9TA 2BNQE 1JPFB 4X4MA 1EFXB 2WW8A 3UGXA 4KXAA 4MCNA 1S7XA 4G9DB 2E9JA 4K2UH 5K33A 3X1EA 1V3LA 4KUZL 2VJ0A 3B9KD 4FF9A 5D7JC 1TPXC 4EQ3A 2E3VA 1KJMA 3EYQD 5I26A 2IADB 3KVQA 4AGLA 5GGSB 4L4JA 3O41A 3VXUB 5IG7B 2YMTA 2GHZA 4S1RL 3QJUB 1MVUB 4ZSOB 4ICXA 1TG8A 4Y4KD 2K78A 5IHZA 5ADOL 2QKIC 1VEMA 3BVXA 1FORL 2GEEA 3PHAA 4CILA 3RWHB 4JFDB 4JEGB 1KIQB 3GC3A 4EI5C 2QQLH 3H3PH 2YSTA 4JFSA 2F68X 4RA0C 5CZXC 4AI7A 4AIEA 1N5YL 5CD5C 1DBML 2ATKB 1Y18B 3D3VA 1C1EL 3PREA 2EEBA 4P2OC 5FXCH 4JDTH 3P11H 4FRWA 2BSTB 2IPKA 1H19A 4AKPA 2WXJA 3OL2A 1OK0A 3A5VA 1TYRA 3HMXH 5E2UH 4ZSOE 3EGXA 2HX9A 5F0MB 5IWLC 4RGMB 3FRPB 2A4CA 4YHML 3GXUB 4K7FB 3U4EB 3D0VA 3MXVL 3VFMA 1MH5A 3L4UA 5DJDB 2A83A 1K5WA 2XA8H 3W81A 1ZRUA 1FG2A 2XX1A 1GIGH 1S5IL 1T2QL 2QR0A 1J87A 1NPUA 2MMXA 3CG8A 2GY5A 3D08A 4BJLA 3WS3A 1FF5A 4Z7OE 2CG9X 3WHE0 5JPNC 2ICCA 4XVJL 4GRWH 3CQPA 3RA7H 2H2SD 5C9JB 3ZSTA 2DYPA 2R0ZH 3UEQA 4IW4C 4MTMA 1A2YA 2AK1L 2UY6B 3ZOAA 2J3SA 2F1BA 1YYCA 2P24A 1AHKA 3L5IA 4OIIL 4WHCA 1NBQA 4ATWA 3KLKA 1AG6A 4FCAA 3RPKA 4WAFA 4LEOA 2LU3A 2VGLM 2OMZB 1ND0B 3RX7A 3D07A 4XP4L 1MFBH 5CLWA 3W9EB 1CQYA 2BSSB 1KFAH 1MHCB 2X3AA 5DRWB 4NAJA 3LV3B 1Z3GH 2HT2C 1UOVA 1SEQH 4E9QA 4LKXA 5CR8A 3V52H 5FECB 3TJHC 1F45A 1WZ1L 2YAMA 3DXAE 4HJIA 4WHTB 5ITFA 3BZ4B 3PNRB 3W2DH 3NZHH 2AJSL 4A2EA 1XX9C 1DJYA 4P9HH 2IALB 3QWQB 4Q6IA 4LNRB 3MJ9A 2CBMA 1N5AA 2KLSA 2DQFB 2DYPD 4KI1A 1OAKL 1S3KL 3D39A 2DQTH 4PJXE 3VX0A 5DJ2A 1AYOA 1A14L 4KQ4H 1MCOL 2AVGA 3FSZA 2IQ9H 4NXKA 1I7UA 3CFQA 4GXVL 4J27A 5FOJA 1G6RH 4NCDA 1B4TA 1L7TL 1JP5A 2QADD 3GBLA 4XXDA 4HOWA 1Y6MR 2CHNA 2FO8A 2YUVA 2HT2D 3QHFH 1E50A 3B9KB 4QCIB 1KXHA 1R3JB 2FD6L 2AGJH 1HHHA 4HIHA 3ULVE 1IT9H 2EDQA 3MBWA 2F53A 1SOQA 1UACH 2RH0A 5L2KD 4ZFFB 3UL4A 1IC5H 3GSWB 4JCWA 3FFDA 3CC1A 3VGFA 3BAIA 2DQHL 3R06B 2P8LA 1EJOH 3PV7A 1L5GB 1C12B 5L2JA 2X4PB 5DUPH 4Y2DB 3DPDA 1E8XA 2XFGB 3PHOB 4AEEA 4AMWA 3UG5A 2XN9B 5C0BA 2Y72A 1F6AA 2NW2A 2FGWH 3UCRA 4PG2C 2OBGA 1T1WB 5C0GB 1EUUA 4OBRA 4I4WA 4OLVL 2CK2A 4XX1E 3QUXB 4ZW7A 3S5LB 5E5LA 2PP7A 2WZ5A 3CMOH 2OP4H 4NKOA 3IFPB 3RFZB 1A4KA 2VDMH 5HDBB 5SX4I 1KJVB 5BZWB 3MJ9L 1HT6A 4JFXA 2YJLA 1IQDA 3T71A 1JVLA 1E2ZA 1MIEL 3FQYA 4RFNC 3V6BR 3ZXAC 1XCQA 5AAWA 2EE9A 3WLBA 1FH2A 4Y1AD 4OFQA 1BZDA 1IAKB 1G9NL 4XHJC 3VI3F 1U3NA 1KCBA 4GKNA 4PG9B 4FHJA 2FECI 3GXTA 3QO0A 5EOCH 5L2KE 1MHEA 1CE6B 2VRAA 3CDFA 4FG0A 3TVMC 3IJHA 4JY4A 3P02A 2BVQA 1QATA 3EHBB 3QUZA 5EOQL 4LP4A 3SBWC 2VMJA 3HBZA 5K9JL 2Z8SA 3BISA 1NGPL 4BSJA 2BC4B 1SXNA 4DP6X 4EJ1C 3IDIA 3VGGA 5JHLL 3LN9A 2PCPA 3CN0A 3JV6B 4MMYA 3HG3A 4L4TD 3K74B 1N5YH 1B0IA 2PCXA 4FQLL 3VM5A 2Y7QB 5FK9A 4F5CE 2ZCLH 4TNEA 2F53D 3ARBB 3MDJA 3ZDZE 1LYQA 3NABH 4ZFQA 2CNYA 5GRVK 3WNIA 3BZEB 5EU6A 4E68A 3KYMA 3QC6X 5C0AB 2DYSB 3EBAA 1A8JH 5EU7C 3BPCB 3TL5A 1MHHB 3MBXL 2W0FA 3QO1A 4PVMA 5BRZE 1AZUA 2QFRA 3NG5A 4UDUB 4QRRD 2PYED 1MWAB 1YEGH 1T7ZA 1G7PA 3BP4B 3MYJA 4R9HA 4U1LB 1RZJC 3N0PB 3SGKC 2WWKO 4M8RA 2JKJA 1I9RL 5E24E 5I8CA 3F58H 2R7EB 4E2OA 1QRKA 1HK6A 3ROOB 3TGXA 2X1QA 5I17A 2R0ZL 3AROA 3HG0A 1PIFA 2WXRA 3GSRA 4J2QA 3DX4A 3CX5K 2QTVA 3PWUA 1KJ2B 4GBXB 4KH2A 4BHUA 1OTSD 2VQTA 3F6JA 2FTAA 5DJYA 3LRHA 3L3DB 2EABA 4ZMNA 1X4ZA 4RZCA 1IBBA 2WKGA 1SLWA 1LEIB 3I6KB 3K1KC 2D0FA 1AFVH 3HKZA 3O9WD 4V1DE 1FL5A 1ADQL 3MV9D 3FF8A 3EOAB 4QXVA 1Q0YL 1ZY9A 1ZIAA 4U3CA 1QFWL 1UVQA 1M71B 4JN2B 3VD1A 1Z0NA 1OP3K 2AQTA 2AJSH 3Q6FB 4N22A 1OD7A 4WK0B 3S35H 1SFDA 3BXNA 3GEFA 4KAQL 1JHLH 3I75A 4F7PA 1XR9B 4DH2A 1CL7H 2XLLA 3A6BL 2XPGA 2IDUA 4GSXA 1EZLA 1S3KH 3VA6A 3VI3A 4PJ9B 3JWNC 1X7SA 3CXHJ 1JVKA 3BVVA 2C9UA 3R4RA 4KVPA 1WIUA 3HBQA 1AKPA 2J12B 1WFTA 4BFGA 2YD3A 4CNIA 1M2VB 5ICUA 3Q5OA 3PAVA 3FQRA 5F1IA 1ZTXL 1GS7A 1VFMA 3WFZA 4IYKA 4HEPG 5DVOA 3JTTA 3OR7B 3UZQA 5GS2H 1DLHA 3OKDB 1TJIH 2K4WA 2DMKA 4JFTA 4NQUA 4PY7B 5EEZA 3QNZB 1MLBB 4FXGA 3FT2A 3BEVB 5IR1B 1NGXB 3ARGA 4JFYA 4G43A 4OVUA 5L8LB 4UM9A 5KAQG 4MS8D 4ZTEA 2NX5D 1BZ9A 1IT9L 3ARGC 5BJTB 4AGQA 5IF0A 1LO2L 3EYUL 4HUWB 4QDGA 2Z31D 1A2YB 3DV6B 5D71L 1LMIA 2NX5A 4CGUB 5G4NA 3QGVA 3F01A 5HYIA 3A6CH 1VB9A 2DQHH 4HV8A 1AD0A 1XMEB 2WJ5A 4JHWH 1NBYA 3CDCA 4U6XB 3RU8H 2VZ3A 2ZF9A 1B4LA 1RIUH 3NAAH 4CAGA 1NFKA 1KGJA 3OAWA 3L5WB 4GFTB 4U1JB 1XIWC 4A7UA 1JGVL 1OOWA 4KI5E 4XOCA 4N8CH 4OIBA 1T89C 5I19H 2FR4B 4RFEA 1NFDA 3B2DC 4JDZA 3G5ZB 3WNLA 3N06B 1EAJA 3FFCB 3EG9A 3BPOB 4U7KA 1JGUL 2CMRH 4JY5H 3WN6A 5ALBH 2OLDA 3D06A 5E1AB 3OJVC 1XGZA 3CSBA 3KYOA 1RSFA 3HPLA 5DD1H 5F72S 4ZNEA 1NCGA 1R5WB 4GUPA 1SYVB 5FFOA 5T5FL 1RKRA 2GFBA 1GGCH 3QXTA 5IGXL 3EYOB 4ONGH 4ODTH 4ZUWB 4Z7VB 3GSUB 3EZJB 3RAJL 5EOQH 1QOKA 3SQOH 1HAWA 3NSCA 3TNNA 2NQ3A 3UXFA 1EDYA 4LRIA 4A38A 1TU2A 4X6EA 2X3BA 5EO1A 1R3JA 4HIHB 3U4KA 5C3LD 4PHXA 3T6QC 2VZSA 2C1OB 5IMLA 4HWZB 1AO7B 3KH3A 1KIPB 1JZGA 4FQLH 4K94H 2CA3A 3RVUD 4F3FA 3PXJA 5HDQH 1R3IH 4IOIA 4XBPA 3RWGA 3HKFA 4OB5L 1OCCB 2MFNA 3HEIB 1IEAA 4WI5A 5I1CL 3CVCA 3Q8BA 1YYLL 3T3ME 4FNTA 3QNFA 4NRZA 4HJ1A 1VFUA 3WFBH 1OSYA 4FZ8H 5GJTH 4Y9BA 1V3JA 2X28A 4Y16B 3WFDH 3EO0A 2Y5TA 4QOKA 3ELAT 4KVNL 5KYWA 3H9YA 3HG4A 4XO5A 2XV2A 5HBBA 3ZE2B 2A9BA 5FYKD 3UTPD 3B83A 2R4SH 3AABA 2OCJA 3RPIB 3WIIH 3DV4B 4MCYA 1T66C 2MKLC 4WW2A 1PG7L 5D6CA 2ZX5A 1IAOA 5J6HA 3F7PC 3IF1B 5ELIA 4AGNA 5IFHH 4NC0B 2BIHA 3G9AB 2CKBL 3BUYB 3DRQB 5FLVA 1PY4A 2QVTA 2XTJB 2X87A 4WFED 1SJEB 3FTGB 1J10A 4EUPH 4PWJA 4HJJL 4ZMTA 2WQUA 3O3BA 4Z6AT 3VMOA 1SN0A 2PWGA 2ZOLB 4ETQB 1DCLA 1ADQH 3NQIA 1Q0YH 2Z0BA 3GMQA 2VSDA 1RZ8A 2HT3C 4LHQB 2Y36L 4HWNA 4WWKB 2N7AA 3N3EA 5GS0C 1OT1A 3C5ZB 2IDFA 4PD4K 1XGUB 3I6LD 4OLYL 4I4WB 3A6BH 4X0NA 2IAMA 3S48A 3BWAA 5JOPD 2O1AA 4JVPA 2IH8A 1EZSA 3ILEA 3LKQB 1TETH 4OI8A 1KIRB 1NAMA 2ICWJ 3L4VA 4NZRH 1U8KB 4FYTA 1BDYA 3O6FA 2X4SB 4HUVB 2YPVA 3FSWA 2WPGA 5K9QI 3BWZA 1HJCA 4BH7A 5E0FA 5AUMA 4MYWB 1PLGL 2ZQKA 5EN3A 4KKRA 5JHDA 25C8L 3PF2A 2V5YA 1G1KA 2FUQA 2M26A 2VQ1B 3GMNA 3MGAA 4FNUA 3ULUF 2WXFA 3QORC 4C4KT 1WD8A 2WVVA 5EUOB 4YDZA 3F7LA 3KBPA 3M1BA 1JE6A 5HI3C 2X9WA 3QUZB 5J9PB 5D6DA 3BO8B 2G4EA 3NSFA 4MB4A 4BWWA 3V6OA 1TVHA 2BFVH 1I1AC 1TXKA 1ZOXA 5HTSA 5GGRY 3H8NA 3ZDZF 3RU8L 2EEXA 3QXDB 4K9EH 3MODH 3OAYH 4NZDA 4JDVA 2J4WH 3I6LE 1BYNA 1I1YB 1UA6L 1GGBL 2F7QA 3HAEH 4M3KB 4S1QH 1JGVH 3HTLX 4X99A 3HPJB 3SO5A 2UZXA 4PBDA 4PRHE 2JVUA 3ME0A 4ZOCA 1UD4A 2YGNA 4FQ1L 3BXNB 4MD4B 3RUGE 2XQBL 4UAOC 2L7UA 5JTWA 1TZAA 4JRXD 2R2HA 3TTSA 3LKNA 2WXLA 4B5EA 5C0BB 1NEUA 1T2XA 1LP9F 2IAMD 3C5XA 1CGTA 5CD5D 2L8AA 5LVEA 4WU7A 5DRZB 4LCWB 2GFBB 5FKPB 5F1IB 3WHE1 4GT7A 2Q6WA 1FBIH 1U3HB 3LB6C 3MKKA 3MRDB 4YVUA 3QDAA 3MLRL 4ZQKA 3FTZA 1F0LA 4X8CA 5B4MC 5AALA 5C0BE 1ZDSA 1KSRA 4GSDH 1XMWA 3K81A 1IJNA 1AY1H 3TT1L 4AQ1A 2D73A 4PJAF 4I0CC 2FX7L 1JZFA 4LGPB 1JF1A 1IBHA 2V2WB 3FT4A 4TUOB 2JWYA 4PP2B 1QSEA 4ZMAT 2Y7OA 3FUDA 3HMXA 4NAMA 1Y6KR 2WLZA 1U8OB 3K5SA 1YYLH 1KTDB 2J7LA 3NCXA 2PO6A 4P5MB 1FZJB 5JA8B 1DUYA 2AKRB 2VLKD 1NCCH 2B77A 1RZKL 2I9LB 3IE9A 3UC0H 2A1WL 4PJ5A 4YPJA 1U8PA 1DN2A 3ETTA 5LG6A 3X1GA 2WTOA 3FXIC 4HPYH 3UBXA 3AJ7A 4AQEB 2YO3A 3KPTA 2YBGA 1BLNB 1A7PH 4MMXB 4X4KA 1KXVA 5AZUA 3RKDC 1W0VB 5DTFA 1YDPB 1ERNA 3SGJA 2DKMA 2VUOA 1GTFA 1HYSC 4DEPB 1PG7H 1JIBA 2MCPL 4BH8B 5D7IA 4IBQA 3MRMA 1P7QD 3PNWA 4X5WA 4CBPA 4XP9H 2OM5A 5IFHL 1SDDA 3D85A 2Y7LA 2A0LC 4I3RL 4LSVL 4UINL 3JV5A 2MRYA 5BS0B 1NDGB 5IB3A 4HJSA 5KVEE 4X8XA 3DX6A 1CXKA 1H9VA 4LCIL 4DN4H 3RL2A 1PYWB 1MI5A 1NEZB 3ESVF 1G7QA 4QGTA 3BEWB 4X5QA 1HHGB 5HY9B 1FFRA 2B5IC 2MPAL 3FDWA 3LN4A 3OKLB 1FG9C 4IRJB 2BHZA 2BNQA 2JE8A 5DJ0B 2CO6A 4DAGL 1H5BB 3DIFA 2VERN 3AM8A 3S3JA 1TFHA 4J3UA 3GSOA 3NFSL 4HSAC 4PV9A 2AZUA 3F7YA 3K6FA 2WBKA 5I0VA 2FT6A 2A6DA 5CBEB 1F8TH 3SD5A 1MW2A 2L0DA 1WTLA 4LARL 2ZWKA 4XPGH 1KOAA 5TQ0L 5F9JA 5CJOL 4OFYA 5B7EA 2ZUVA 3CFEA 5LNDA 1UXLA 3DLQR 2DWDA 3DVIA 5KSBA 3LJ3A 2JIXA 1UH2A 5KYUB 1YN6B 2FEDD 3R8QA 4ACPA 2BY0A 1UTDA 3AT0A 2ENYA 1Q9OA 3LEXB 3L9RA 3QW9A 4KRMB 5CWSB 4CJ1A 1MHPL 4DPAX 3FQWA 1NBZB 4E41A 1FYTE 3BMVA 2F7IA 2MPVA 2OMNA 3LIZL 5H2BA 2YA1A 3SDYH 4F33B 4BFIB 4KMTH 4OLUL 2VLRE 3HUJF 1S7RA 4OLEA 5HYJA 4KY1L 4YGVB 5DQ9B 3AADB 2DMBA 4ZSOA 5JDJA 3T9WA 4ZFZA 4F2FA 2YN3A 3QRBA 4N0FB 4IS6B 3REWB 4YS4A 5D7HA 3QFJE 4XMXA 1XIWA 3EBIA 3MA7A 2DPKA 4UNIA 4P5KA 1W80A 3G3LA 3L9EA 5GJSH 1JERA 1SY6L 1T4KA 3EYVB 2MKWA 3KEDA 3MODL 1YQVH 4JDVB 4A67A 1EEUA 4TUJB 5IV2A 2WLNA 4OGAC 5K39A 2WNXA 3II2A 1R4XA 2FYYB 4WEBH 1QHPA 4Z7OB 1PX4A 3UTTB 1E4XL 1LMKA 2ROXA 4FEIA 1WWBX 2GTZA 4JKMA 3D09A 4MA8L 1X9UA 2BSEA 3VFPA 3F2LA 3MLZH 5I1GL 4ZUSA 1B6UA 2GJ6B 2Z35B 4AM0B 1AQHA 3U4AA 1RZPA 5JIKA 4DETA 3WN5B 2AJYH 4YHKH 3N43F 4X7CC 3KCPB 4F27A 5ACMA 3H0TA 1YUHB 4X6DA 3GJFB 2XCMC 3PV6B 4JG0L 4OAWA 2VDNB 2O5ZL 1NFDB 5IBLC 2YD0A 3A22A 4I89A 4P5TA 1KENL 5TFSH 1ETZA 1L0PA 4AZ8A 1E27A 5EOCJ 3C2AL 3DIDA 4PWFA 4OFKA 4D9RD 4UTAL 4G8IB 1XB6A 2ZKHH 2X10A 3KM2A 4NJAH 1TTFA 3WUWA 1UT2A 5LUMA 1Y1UA 3E6HA 4YHIB 1J5DA 2BPBA 3DTDA 4ZXBB 1XDTT 3QP3A 1KG0A 1N70A 1RL1A 3BPNC 1I7ZA 1T83C 5SX5H 1AVAA 2EDKA 2JNZA 3HMWH 1ZMYA 5HGGS 5EEYA 1JNJA 3ARXA 4GEIA 5DK0B 1A7NL 1J9CT 1L0YA 1SF3A 5I73B 4WQOA 2C3WA 1Y18A 3D3VB 1T4WA 3ECBA 1XT5A 1KB5H 2O4EA 4S2SA 3APFA 3VXSE 5ENWA 5GSRB 3AXIA 4FQQB 4DTGL 5FYKE 1RZKH 4JJOA 3UC0L 1V7MH 2O6PA 2APTA 4XC1H 1NGQH 4XMLH 1KWGA 1DBKH 4EEEA 1BQSA 1F90H 4NENA 4PS4L 3HR5A 4FXKC 3NPSC 4CN1A 5CSBA 1UH4A 1INDL 5DVPA 3CZEA 1KC5H 5D55A 3VXQB 4UYPA 2QR0B 3ISYA 4JR9L 4LPTA 1A6AA 2HUHA 4H8HA 3GSNH 2CLZA 2WWMD 2BP3A 3IBOA 4LSVH 4OGXL 2Z65C 3MBEC 3VFMB 5GS0D 1JUFB 3HR6A 3MRDA 3M7OA 1OHZA 1PLAA 5ESAB 2NY5C 4Q9BA 2E8YA 1KB3A 3ZGHA 1QFUL 1HIML 2WO2B 3NYKA 5DHVH 2MPAH 2RAMA 1TTUA 1D5MB 1F6FB 4UT9A 5EF3A 5E6UB 4AUYA 4DAGH 1U6AL 3HE7C 2H0JA 3AMLA 2JKXA 3EHBD 3U4BL 1EBAA 5KW9H 2OQJA 3D8MA 5I15H 1QABA 3MRBA 4IOSA 1DJIA 3HE7D 4IK6A 2A74A 1MCSA 2G3ZA 1FJ1A 1DQJA 3TA3A 3C5SA 1FGNL 4P5MA 4XVTH 1I85A 1IGMH 4LEOB 3VB8A 3DMMC 3AG2B 1WP6A 1EBPA 3LNFA 1MUJA 1U2HA 1FC1A 3RZWA 4G9FB 3FTSA 1MXDA 2C3VB 2WNKA 3AXLB 2XVGA 1F5WA 3KBHE 2OL3A 2EDWA 1FO0B 3BKJL 4CU7A 2YBRA 4OD1L 4UOJA 5HHQB 1AMYA 3ARYA 3RTQB 1PAMA 2P5WB 5B39B 6FABL 3ZE1B 4LAQL 2PF6A 1N5AB 5D4HA 3TIEB 3D52A 4ALAH 1KUMA 2HX8A 5BMFL 2BIIA 5BQ7A 5C08B 1BZ7B 3OKKA 5GRYA 1IKFL 4FQJL 1KBVA 5LCVA 5EU6E 5SWZB 5IW6A 4QTIL 4UB0H 1QFHA 3K2MC 4U1GC 3HS8A 2Q2EB 3IETB 4NKQB 4KK5C 3T2OA 5JHAA 3MGTA 1YEEH 1MQKH 5HHME 3SBQA 2QZQA 2YK1L 3NSXA 2PCPB 2WQWA 2K8MA 5DR5H 1VFAA 1HL8A 1T5XA 2DM3A 3BWUF 2WKLA 3ARFD 4LOVA 4D0DB 3O9WC 4WEBL 4YNYB 4YHOH 5FK9B 4PVBA 1RIVL 5CMAB 2CBOA 3FB6A 2V8MA 2W9LA 4UU9A 4ONHA 1QVOA 1JXFA 1ZVYA 4MA8H 1FZMB 4TOYL 4PWIA 2GC4C 3DOSA 5C8JB 4WJ5B 1PEZA 2XZCH 1P9MC 5C07A 1DVFC 2VDLH 2JB6A 2HLAB 4YC2B 3ATEA 4BWUA 1J5IA 3Q8AA 3L1FA 1U3ZA 3GBML 3IDUA 2A6IB 2LQRA 7FABH 2EICA 4GSQA 4HH9A 3LMJH 3DK2A 1LK2B 4RH4A 2DOCA 3BT2L 4Q89A 2NY2B 2A73A 2XN9E 3TPUA 4AENA 2W07B 3CLFH 4NOFA 4LSQH 1EFQA 3M8OL 5C6TL 4QRBA 2FIRT 4WCYH 4Z8FL 2ZT9C 3QVAA 1ZK9A 2JB5L 4O4YH 3BFWA 4OLXH 1DCEA 2G60L 4JPVL 3V0VA 4E9SA 1ZJBA 2E9GA 4EDXA 1MVFA 3WNJA 3KPSA 4JKPL 4XTRD 2QQKL 3PFQA 4XGZA 4GNKB 4JFFA 4LPXA 4LQ1A 5I71B 1YY9D 5TE7L 1WUZA 2VDRH 1DVFD 5C0CA 3VI4B 3DGGA 2YIHA 3QA3A 3HRZA 2EXWC 5JPNA 4NQQA 5EO0A 2EIZB 4DEPC 3THML 5GSVB 3EGSA 3LYRA 5DDHB 4TVPD 5J56B 1J7VR 4L4TB 4PJIE 1JNLL 3HRPA 1GY1A 4EBQL 2XPGB 5DJAA 2EDRA 2YRLA 1PFCA 3MA9L 3CCHB 3CC5A 1UJ3A 3NDYE 2F53B 3OKNA 3O4OC 5IB4B 3QPQD 2WINB 1DBKL 5D7LE 3NP4A 3P0YL 2QV2A 3TJPA 2Z0UA 1DDTA 4Y4FC 1JWMB 3C9NA 3OLDA 3KJ6L 4IEFA 4WZ9A 1XD1A 1O7VA 4TUOA 4UDUA 2MHAB 1NFAA 1R0AL 1P2CB 4J8RA 4G71B 4HP5A 4NKDA 2ODIA 2MJWA 2XWBA 4YIQB 1RUAH 3V5KB 4TNVF 4Z3EA 1A6ZB 1QHOA 3UJTL 5F89A 4D0CA 5DQ9A 5F21B 1EUTA 4ADJA 3BKML 4OFDA 3TURA 4LDOB 4V11A 1YYMH 3NIDB 4HQQH 2QPFA 4RMSA 1VADB 1A6UH 1U8QB 3V4UL 1RMFH 3INUL 5KG9B 3TO4D 4GRMA 3EJZD 3T0DA 1VPOH 1F3JA 5DUBB 3RGVA 4L8BB 4YN3A 2X4NB 3QEQA 4MD5B 4NCC1 1RIHL 2YKKA 5I8CB 2XI9A 2H0PA 4AVIA 1MZZA 1D9KD 2CHXA 3Q6GH 1G1CA 4AQAB 2MQGA 3ARZA 2J88H 3GJFH 2XN0A 1WFJA 2J20A 3JVGA 1GMIA 1OW0C 1KGUA 3QBTB 5D7SH 4GG8B 2ITCA 1JZEA 4RDBA 4ANWA 1I8LA 3GGWA 5AYQA 1PZUB 4PJ8A 3V0JA 4K3EL 3NH7L 3G9VA 3M07A 4HWUA 1TTRA 1IGML 4HETA 5IREA 5MEPA 1RV6X 1PYWA 4LQFL 2XN1A 1PKQB 1TITA 1HCVA 4WTZA 3RJQB 1QACA 3K8LA 3N40P 1HSAA 4KDWA 3CBJB 1SOKA 3U0WL 1KGYE 1XB8A 1R5VB 4ODSL 5T3XL 5LKNA 4YSCA 4BDVB 2VDLB 4MA3B 5I1IH 3GMMA 3OHXB 1J0YA 1U8IB 3TZVC 3KPRD 1KV3A 2X38A 4XO4A 2CDGB 4BA8A 5BMFH 4L1HA 4ZUWA 4RAVB 4MBRA 5KZCB 2BCKA 2PPAA 2O26U 3HAEG 1YEHL 3HNSH 4E9YA 3QE5A 6TAAA 2JI3A 4P2QE 4IGBB 4BM7A 3QAZC 5BVJB 3SQBA 4YZFF 1DBBH 4MQTB 4R4BB 4NBXB 3S88H 3LH9A 2EVJA 1T6VN 2X4UA 2Z7ZA 1X5YA 3WHXA 3I9AA 4RWYH 3JTTB 4H5SB 4RBPK 3ULUE 3MLPA 4LF3B 2VR8A 4PRDB 4YNYA 1MLBA 3IJHB 4X0KB 1X44A 1L0QA 1RJZA 1F2QA 1CLCA 5D70H 2IH9A 1BJ1H 4RX4A 1T7VA 5T1KB 1JNHA 2HKHL 3CQFA 3IGAA 3L4XA 3CIQA 5IF0B 1P84K 2JJVA 4EI5D 1UADC 2OQJB 1MCIA 5DUML 4BD4A 1ZS8A 4U1HB 3SOBL 2AJZB 2K70A 2VDLL 3L3OA 5IQ7H 3NJHA 3ZQ9A 2ED9A 2C9SA 1S9WB 5A2AA 2Y5TB 2WQVA 2DTML 4QOKB 3EDDA 4KUCF 5AW6B 3PY9A 3CTTA 3RDTD 5E4OA 4U7MA 5TF1L 1EFXD 1O0VA 4LSUL 5C2UB 3HUJA 5F3HB 5DEJA 4PYHA 4F7MB 7FABL 1W16A 4UTAA 3LMJL 1B3JA 4I48A 1K3IA 5F7BA 3UTTE 4C8XA 4CVZB 3L3HB 3BZEA 1D5BA 2A73B 3TPUB 1DVSA 3ZR5A 1UVQB 3S5LG 2F53E 4LSQL 3L4TA 3ARFA 1A5FL 3M8OH 5C6TH 3U0TA 2W0KA 3V6OC 3LRKA 4E41E 1BAFL 4ZMZA 1L9NA 2JB5H 4UMSA 4P23A 4B9CA 2EEDA 1F1AA 1L4IA 1PG7W 4HDIA 2MWCA 3P30L 4PR5B 2W0FB 5D1QE 1K4DB 4I9XA 4KVCL 4ZMLA 4C83B 1Q1JH 3LNEA 2DL2A 4I1RA 3P9MA 5E51A 2Q8AL 5CEYB 2ZZUT 3GMPB 3VFUB 5D9SA 3U7AA 4M5TA 4ZS6C 4XNDA 3ROOA 1JFHA 4PTTB 1MCJA 4HS8L 2IO5A 4LHJB 3UAAA 1UJTA 1UWFA 3T8MA 1K8DA 2OYMA 4F9PC 4I1NB 2YGQA 2AK4D 1KJ2A 3FAWA 2Y4SA 4XOEA 4IRJD 5FOBB 3NJFA 3QCUL 4P46C 1N2RB 2EYSB 2WXHA 4NEHB 3ETBF 2WZPA 5DEFA 3IYLW 3EOAA 2A9NH 2NNRA 3D12B 3F65A 4FFYH 1JWMA 3T0XA 3MTRA 5KJ7E 1M71A 1CE6A 3P2DA 3V6ZB 5FYLL 5FYKH 5J5EA 2AJXL 2X0WA 3CZGA 4EI5A 3S37L 3T0EC 2PXYD 2OXHB 4JREC 1QBML 4FXTA 1WCBB 4J3OC 4JFHD 5DFVC 4PRPE 5LO7A 4N6RB 3VXPA 4LCWE 3T3PB 3GRWL 4BGLA 4LL1A 2ARJA 4LOUC 2KZKA 2LE9A 4W4OC 1MRDH 5IHUH 4GG6E 3EDJA 4GQRA 1KDJA 3VXUD 1QO3A 2F9BT 3QIBC 2X4RA 2FJSA 4OZGF 5CKGA 2BSRA 4C59B 2R56H 2WUBH 3QQ3B 1XF3B 2A9DA 1TCRA 2X40A 2WXPA 3BAWA 4L4TE 4R7LA 4XC3L 5AKTA 2J6EH 4GAJL 2WZ6A 1TQVA 4PY8J 1M1XB 5J57B 2VMCA 2VM4A 4XE0A 3FT2B 1EQWA 4PPTA 4UIKL 2R9HC 3EF4A 4G5ZH 4PCYA 1KYOK 5D7SL 2W5PA 5IB1B 4QJ5B 4JFYB 1JYWA 5CEXB 3US0A 2AV7A 3ZHNA 4RRPM 3OF6D 1ACYL 2CO7A 2F1AA 3M1OA 4KQ3L 4D9QD 4K3EH 3GDBA 4XP1L 2KKQA 1L6PA 3KLAA 3AG3B 4YSSA 1KNOA 2AXHA 3D6GA 5DZ9A 5I76A 4JO3H 2DI7A 5DLML 1U4FA 3BPOC 1FHNA 5K5YA 3QRGH 2BP8A 4M1DL 1TOXA 4P4RA 1IJ9A 5T3XH 1YPZE 1BM7A 2Z34A 3VGDA 4ADGA 5IJCC 3LQZB 2I60H 4FQXD 4F57H 1BIIB 3RVWC 5AD0B 3ZL2A 1C5BH 4IU3B 3UJJH 4HK3J 2ROYA 2BS9A 3I9GH 4WNQA 5KN5B 3GIZL 1IAIL 3L3DA 5J0BA 3FO0L 1FJ1B 3W39A 1W0YT 1IEAB 4Y4HA 4Z7QB 5PCYA 4J6RH 4DGIL 2G5RA 2DD8H 1DBBL 1NEPA 2JELL 1A22B 4HPOH 2AI0H 2D7PA 4J8QA 1GZHC 1KN2L 2VZUA 4P57A 5FA3A 5DUBA 2QSVA 3PGFH 3GXNA 3KPOB 1DUZB 1UKQA 3RVVD 3ZKXB 4XH2B 4NRYB 4ZT1A 5JPNB 4S1RH 2ZYIA 4XT1C 5D70L 5HDRA 4GS7C 2XQYK 5E2VL 4EXKA 2VR9A 1YPZF 4OQTA 4PB0H 4PVLA 4ADIA 5C3IA 4OV5A 4L1TA 4FMVA 1B88A 4NJ9L 4MXQC 1KPRA 3QAZB 5C08A 1IM3A 2K6YA 4PRNA 5I6MA 4TV3A 3UMTA 3PQYB 4ZQTA 2ZPKL 5AOKA 5HYSG 3LHPH 1DQQA 3GIVA 1P84J 2VWEC 2YR3A 1P1VA 1HTYA 2ETWA 3GLDA 2VDOB 3ULVF 4UQ2A 2C9RA 2XZAL 4YEEA 1KIPA 4LO9A 1WD9A 2ZOTA 2BFGA 4LSUH 5GGVH 1RPUA 4CDHA 4DKFH 4CMHC 4KZEL 4MFHA 3U46B 1LD9B 1JHTB 3PWJB 5IJVA 2LLLA 4HAGA 4QHNB 1ET8A 1RK0B 4M8UA 1V05A 2UWEB 1KELH 1SJHA 4PJ7A 2NX5E 3BRDA 1C7SA 4N1EA 4LIQH 2UXFA 3RZCB 5D1XA 1KLFB 3RTLA 3VXOA 2QSTA 3RUGB 3LS5H 3LN5A 5AL0A 4QRPB 3ZK0A 1EMTL 1GIGL 5TPWL 1CD1B 4JQIA 1NICA 4HKJA 4XCCL 2DMHA 2VB5A 4AL8L 5GS1B 2CO2A 1RUKH 3NIDF 3IAGC 4HH9B 3VRIA 2Q5BA 3CHQA 4K3GA 3VFRB 4W9LC 4XVJH 4N8VA 4OCLC 4Q4EA 4OZFG 1HCZA 4ZBJA 4P8QA 1ZLVK 3J7HA 1L3WA 2DF3A 4MAZA 1FYTA 1WRFA 2NUPA 2VM9A 3DUSA 1DQML 3OJDB 1M3IA 1BPLB 2VDKL 3VXNB 4AEIL 2DKSA 3DXAD 2H6PB 4HCFA 2NDFA 4ZNEE 2EEAA 2ISDA 1MZYA 3P4OA 3B3IB 4ZXBD 3CVIL 4S1SH 2ZSVA 4AQ1B 2I7SA 1Z3GL 4ZK8A 3I9IA 2OMYB 3AS3A 2VE6B 5FYKL 1Q9LB 1ASQA 2J8OA 3ZVVA 2GUOB 4P9HL 1LNUB 1M3JA 3CZJA 2BSTA 2IDSA 2JH2A 4HF5H 4PJAB 4MA1B 1KGIA 4UMGA 4K8RH 2HKAA 4JO2L 2BCKB 1CWVA 2DQTL 1JPTH 3ABKB 4XMTA 1IVLA 3CVDA 3FRPA 5F6HJ 3H9SA 2WXKA 2CD0A 5JXED 1YN7A 4GSRA 2VDOH 3T4YB 3BC9A 3O6FC 1I1AA 1S7TB 2YXWA 4XC3H 5TK4A 3O3DA 3IJYB 1SVZA 1DP0A 3DXAB 2FEEL 2X4UB 2P46B 2D0HA 1KBGL 1OZUA 3BGMB 3KYAA 4BK5C 5FA4A 1AYRA 4UIKH 2H3KA 4OQTH 4L8CA 3TCLB 4G5ZL 5LXVA 5FUCC 4OZHE 3VD2A 1A6ZA 3FQTB 1XO8A 3HFFA 2MEJB 4OT1H 2VYRE 4N86A 3WLWD 1N4XL 4IGBC 3QCVL 4IRJA 1T03L 1NC2D 3UDWA 2OI9C 4JPIB 4N25A 1E3FA 4JM0A 5D7LA 5CO1A 3HE6A 3ECVA 5EC2A 2HX7A 3HZMB 1VGEH 2QLYA 5DT1H 3HC3H 2F7OA 4QT5A 2WIIB 1NTDA 4DP9X 4I5BB 3GJEA 1UHVA 4KRNA 3BUIA 3O11A 5DUPL 5FO8A 4MYPA 4PGBB 2Y2WA 3A6OA 4EZJA 2IWGA 4OZGA 1E28A 4AM0Q 2E7MA 4HGMA 4OQ1A 4BZ2L 1FNGB 5JXEC 2BSSA 1RHFA 2AJUL 1P4LA 1CICC 1BFSA 3EDKA 4PJBA 5G5DA 5IK3A 3HI6L 5TDPB 3RWEB 3X13A 5JUEL 2PPFA 5ANMB 5K1JA 3NJLA 2VXQA 1DQLH 4QIRA 5HGBB 1UZ6E 4G7SB 5JDSB 4FA8A 1YEFL 4A6YH 4GUCA 1ZLUH 4LHUA 5J12C 3TIDB 4M7LH 1SLVA 3NCJH 2OSWA 2GCYB 4KZ0A 5T5NG 2AI0L 4UZUA 4DPRA 4KKBC 5CCHE 3G6JF 5C09B 3KL0A 4P2RB 4OKVB 3DRTA 1OARH 1G9NH 4O9HH 3PGFL 3EUDA 3KPLB 3CVHH 1XIWB 3MA7B 3R1GH 2ICEA 4H25A 5E56A 3OV6A 1S7RB 2VWEE 1U8KA 4PJCA 1UM5H 4NJ9H 4WW1B 1BEYL 1R5IA 3MV9B 5KJRL 1H8NA 3CSTA 1NLBL 3CLWA 1EAOA 1OQOA 1YJDC 3LHPL 4FQQA 3QQ9D 1IL1A 2VLJE 3S9DB 3B56A 2OMXB 5KVGE 3G08B 1J5OH 2EILB 3UTTD 2L7EA 1MAJA 4XAWH 2QBWA 4L9DA 1LEGA 1QG3A 3K4DA 4AYDC 3ARGD 3AQZA 4U05A 2BW4A 1RD6A 3U7YL 5B1JA 4DKTA 5C0IA 5D2NB 1DQDH 3HN8A 3VU1A 5K9OA 5DC4B 1XR8A 2H26A 3INOA 4TVPH 2DQUL 1ZA3A 2E6PA 2XWJB 3L3IA 4NKIH 2B9AA 1EV2E 1Q1PA 3OJMB 1ZE3C 4I13B 4NYLA 2NSXA 1RJYB 3KR3L 4PJ5D 4R84A 4DK6A 1SXAA 2FQEA 2WZAA 5FW7A 2ZUWA 2BCMA 1QI3A 2X1PA 1DTUA 3LS5L 3RUGA 1E27B 1EMTH 4TYUA 2W81C 3GI8L 2RFXA 4XCCH 1JV5B 3T3PF 4Z76A 1WUNT 1GHFH 4R97B 5F96L 2PW1A 5EORH 4YHZH 4KXBA 5E9AA 1PVHA 5ITBL 3ME0B 5E6IA 1IX2A 1KG0B 4ELME 3LQMA 1P1ZB 2ZXCA 1A25A 5LDUA 3QUZD 1B3IA 1ETZB 3D0VB 3MAWA 4X5XB 4XMVA 5GGSY 1SDDB 3D85B 1DYZA 4PCTA 4RETB 1RZIB 3QISA 4B5ZA 1DQMH 4NQEA 4RGMC 4TM9A 1OKEA 5E6YA 2X2IA 4BA0A 5DHYB 2V2XA 3KM1A 1I31A 1QLFB 2X6CA 3FULA 5HPMA 2NY1B 2J1KA 4LSRH 3DX0A 2AQSA 4IBTA 1HINL 4QO1A 4B9JA 4YWGH 3B9EA 2JTYA 3LNHA 5KSAB 4GBXD 2R1YB 3S3PA 4FL4B 5DJ6B 5E99H 5JIPA 5E8OA 1HHJA 5EHFA 1UEYA 4HF5L 4YSDA 2VIRB 1UKSA 1KGXA 3UTTA 5F9JB 5DEGA 4PH8A 4DEWA 3MV8A 4APXA 1SJHB 1CTNA 1G9NC 4ZMOA 4Y19A 2HVJB 4N26A 5CCKH 1ETA1 5C0BD 3KPRB 2XTSA 3LV3A 2NYYC 1MHHA 3D50A 1TF4A 1YEIH 3L9YA 3MNWA 5D1ZI 5BRZA 5B3JF 1KCUL 1T5WB 2HLFC 1U95A 5IOPA 3ZYJA 1NBZA 2COQA 3T1FA 4FABH 2NY6B 1BQKA 5L0QB 1JWSA 2VC2H 3VI4F 4GXUN 4JFOA 2D0GA 1PEWA 5D7EA 8FABA 1R3HB 3DVGB 4EDWH 1QW8A 3D1MC 4FOMA 4K73A 3CLEL 3OB0K 5FUOL 1YAIA 4TMPA 5L88L 4YSQA 3HC3L 4UDTA 2EIDA 5EU6D 2JTDA 1INEL 5JW4M 3H6AA 3A6CL 4YDIH 4Y4FB 4NQDE 4GRLA 3EYFB 3QPQC 3WTUA 1I3RA 1BD2B 3RTQC 1J48A 2QKSA 5DJYB 3RNQB 3PGCB 3APCA 3DDGA 5EZIL 2EO1A 1RIUL 3RWCB 4Q58C 2JI2A 1EHXA 3ESNA 4BZ2H 1W9XA 3WY4A 1XSIA 2VR6A 2J8UB 4NO3A 4ZAKD 3EBGA 2ZXDA 2ENSA 1XHHA 3EO1A 3IFOB 5I19L 4BQ9A 1Q9LA 1MAMH 4HIQA 3RWDB 1XFPA 3KHOA 1CDGA 1C7TA 5HGHA 3L16A 4AITA 5GGRA 4Y9GA 4A6YL 2F15A 3RZCA 1JGUH 1S7UB 5DJXB 1NCBL 2DQJL 2PW2B 3ARTA 3SKMA 3TVMD 1R34A 2K8QA 1TZIB 1NC4D 4EDXB 5M95B 2X6AA 4WIQA 1OARL 4E9XA 1THCA 5T5FH 4OF7A 3TZVD 4ES8A 3GUTB 4IRZH 1EAPB 3X3GH 2EDDA 4QHKI 4WFHE 2W9DH 3D4GA 1E4HA 3I3BA 1ROCA 2H32B 4ONGL 3SPHA 2ALAA 5EULV 3TIEA 1AGFB 1NAMH 4A55A 1FP5A 1DANT 3SQOL 3TO4B 2HJFA 1RY7B 1O7SA 1JG9A 1YN6A 1A7OH 1T1YB 1PF3A 3B9VA 1HC1A 2P47B 3PAZA 1MAKA 5FGCB 5DMYA 4FQ2H 3VD5A 4HUWA 1FZMA 4YC2C 1SYSB 2D3VA 3GSNB 2N01B 1I9IH 3LRSA 3CFJB 4K94L 3DOSB 3DYPA 5C8JA 2AK4B 3LKPA 4RISH 4BQCA 1CXEA 4ISVB 2HJLB 2GSMB 3QEHB 3S3SA 1A9BB 3MNVB 3VWJD 5AB9A 3EBHA 2V8LA 4UQ9A 1VF5C 3FN0L 1OCWH 3HC4H 2PO6D 1YPZA 3R7QA 4ZX4A 3MV8E 3B2PA 4GAYB 2IPTH 2OYKA 4NUPA 4LPYA 4N68A 1GYWA 4P5KB 1U21A 2BMKA 3SZKC 4DVBA 5GJTL 4AH2B 4F2ME 3OMAB 1MKFA 2D2CC 1SUJA 1HQ4B 1AQDA 3U1QA 3O8XA 4YPGB 3VW3L 3PAYA 3FO9B 3RDTC 3ALWA 3ILDA 3ARDD 3E0GA 1DVTA 1G4MA 2HWZL 3RWFB 3UPRA 1E9QA 1VKXB 1S5HA 4J4PC 1HDMB 1QTPA 5PAZA 1AE6L 3L3KA 4KBPA 3ARDC 4CGTA 5GGTA 5MEOA 4XN8A 2V7NB 5HVFB 5JIIA 4U0RC 3QFJB 4HZAA 4IJ3C 4TQHA 2KZ1B 1HILA 3KNBB 4PLKD 5EZOH 4NQDA 4DOHB 2H3NB 3FHQA 4UTBA 3MNMA 4Z7VA 3OXRB 3Q0HA 5EBMA 4XPTL 5EV7A 2Y7SA 4HJJH 3VFOB 5JW4N 4NHUA 1S9VA 4YFEA 3BH4A 7TAAA 1F02I 3TU6A 3LY6A 4PV1C 2DTSA 4IU2A 2D7TH 2BIOA 4LSRL 5DD5L 4YDVB 2EVGA 2BY3A 2F8OA 3GFUA 1ASPA 5FV2A 2J1YA 4BCYA 2HFFB 1K4CB 2OJEB 3D4ZA 5E9DD 3GHBL 2G3NA 1ZS2A 3GSRB 4JRXB 4OZFA 4FL4C 1H3XA 1HH9B 3GSQA 4PJDA 4Z0XB 1KB9K 4HEPA 3CFCH 2SEBA 2X4TB 3ZZQA 3WFCL 1UYWL 2R29L 4KKAD 4BQ8A 3QT2A 5KS9F 3D34A 3MROA 3NEOA 2YOCA 3LQAL 4PJXB 1TQCB 1OY3B 3ROLB 3ZR6A 1CT8A 3ISWA 1L0XA 1H3TA 1FVDB 4PG9A 1IM3D 2Q3XA 3IDGA 3WEXA 2X12A 4XCNA 1M56B 2X6BA 4LPVA 4QPEA 2GW5A 1FFOB 4DZBA 1T21A 5ESVA 4WVRA 4PB9H 1JV5A 4YZFE 4XNXL 3QZPA 4FLRA 1A1MB 5KYXB 1OAJA 3TN0C 5FF6A 4HC1H 4PJAE 2O5YH 1H15B 1PZ5B 5E00A 1RJZB 2IBBA 2N1KA 4P2OD 4TS6A 2NYKA 1B4RA 3D9AL 4N2DA 3S98A 4MJ5A 5LBVA 3MACH 3SBPA 4Z3HA 1BG9A 1JK8B 2P45B 3I2CL 3JTBA 4YDIL 1HHKA 2DWXA 1ZKAA 3AXHA 5DC2A 1SM3H 3WFEL 2D7NA 4ZI8A 4E5XG 1NSNL 4BZ1L 1USZA 4MCMA 3ECUA 1BHGA 3S37X 5HGAA 1RJLA 2XXMB 3NJGA 1S9YB 4AOFA 5IUCA 3FT3A 5AKSA 4RGNC 2H9GA 3NA9H 3SDCB 1GPOH 1OAUH 2E74C 1JZ5A 4V1DA 2Q3ZA 2MOGA 4UTBL 3LZLA 1M9WA 4ODWB 1HCFX 4HCIA 1PQZA 1IGCL 2ZP8A 3FSVA 3H9SE 4KHXL 2KERA 5IHWA 1X5HA 1MCNA 3RGHA 5IBUB 1JPGA 1CFTA 2AXGA 2E7CA 4HWEL 1DFBH 3TFKD 3LZFL 4DSYA 1ZWIB 1Z66A 1HEHC 2BNRB 3OWEA 4DGYH 4AQ1C 3LHAA 5TDNB 3O2DH 2LW3A 2Z7UA 3KLLA 5IB5A 4ACTA 3ESOA 5ICYB 1T5WA 1TZ8A 3BSHA 1E6OL 3FQ2A 1BF2A 2C7UB 4JFZH 3UO1H 5T3XE 2NZIA 5EZJA 2AMGA 1FBIL 3VFVA 3IFNH 3AS1A 1TLMA 2C8NA 3NSJA 5E94A 3MRJA 5C86A 1FL5B 5TQ2H 1UB6B 3FCTA 4PRPB 4GYBA 4TVSa 3P0VH 3FB8B 1JNHB 3ZRCC 3KWWA 3W57A 4W9ZA 1KYUA 1BGXL 1XF5B 3TT1H 3HLKA 3O2VL 4HHAA 1OM3H 3DX1A 3FZUC 4W9GC 3VRLF 5CKAA 4O58H 5DMKA 2G2RB 1EEQA 3QEQD 4L23A 1FRGH 4B41A 4HKBB 2AEWA 4BUQA 3O3EB 1JPST 4KK8D 3U1PA 2UUDH 1HCYA 4V2BA 2EUWA 3DURA 4FCHA 3WL9B 4OZHF 2ZOWA 1EO8L 3RVUC 2WMPA 4YQXH 4FQHB 3QJVB 1M7DB 5IM7A 4J3OF 1GS8A 4TNFA 4FNLH 3C6SA 5BRQA 1FFNA 1S7UA 4H26A 3FO9A 1PDKA 5ALCH 3RGVC 1HOEA 1NCNA 2D7OA 3RWJA 3GSVA 2D7QA 5K69A 1F11A 1MLCB 2A9AA 3O4LB 4QLRA 5DURB 4EN3A 1J1PH 3S96A 2VO5A 5F8RC 3L1EA 4AV0A 1GGTA 1E67A 4LCVA 4N2GA 4XP9L 4L2LA 3JVGC 5IB1A 3UYRH 5HHMB 2ODHA 3BH8B 3LVEA 1OSZA 4J3OH 4L5FL 4UINH 2JJSC 5AB1A 3W56A 4PR5A 3PIQA 3SE9L 3BDYH 4R5TA 3Q5YA 4KZDL 2OX5B 4AVJA 3BVNB 3SDDB 1EGJA 5T1KD 3DJ9A 1HN1A 2EYTB 4TNWK 5DD5H 3S0PA 3MMEB 3X1BA 5LGJB 5I28A 3VGAB 5DMJB 3ZBMA 3KLSA 3MLUL 4UM8A 2ITFA 1F58H 5D6DC 3FH8A 2J72A 5F7KC 5JYMA 1MCQA 4XNUL 1U2CA 5F7DA 1FL6B 1YHPA 1A4CA 4PJ8B 1UYWH 1CUOA 5FO7A 1QSEE 3FU7B 5DURD 5HHOD 4ENED 4ZNCD 2WY3B 4U31A 3S3DB 5E6ZA 3LTVA 4JCLA 3N44F 3ROLA 3UP6A 2RQEA 5ECGA 4S10A 1S7QB 1H6TA 5DFWH 1R5VA 4XZUA 1MW1A 4HIXL 3TPKA 2BXYA 1GC1H 3CXDL 4OF8A 4EI6B 4DGUA 5I9QB 4QOKE 4K0OA 1QO3B 1QNZH 4NQVA 3SDYL 4ODXB 3TM6A 2ZONA 4MMXA 4OLUH 2O5YL 5DJAB 3IMVA 4K23H 2PYFA 1KZQA 1Z32X 1Z0MA 4J1UB 2CK0L 3VXPB 5FPIA 1AGFA 3D9AH 1ZVSB 3GBNL 1CF8H 5I8EB 2AEIT 3V5DA 1Q72H 5C6WH 3S36H 3CFNA 1XV8A 3TN0B 1KIUA 2V0AA 3PUUA 5GRZA 4E9TA 1XAUA 2WK2A 4R4BA 3PS6A 4MJID 5GJSL 3KGRA 2L4OA 1NSNH 1OQXA 1N6VA 1NCUA 1NOAA 4F8LA 4YJZL 3BJLA 1PBYA 2E4FA 5C0RH 3S4SB 5BNXD 4GQPH 4DNLA 3L13A 1OAUL 2D8KA 3QPXH 4Z9KB 1JYNA 4UTBH 4WTWA 4UWQB 3VJ6A 5IJBC 1E4XH 2XOTA 2XY1A 1A8ZA 1USQA 4U6TA 4UIMB 1AACA 2XXCB 3KXFD 3EF7A 3FUKA 5A6IA 2JV6A 1J8HB 3BE1L 5KVGL 5E6ID 3QEQB 4MD5A 1TTGA 1WITA 3QNXB 1V5JA 2P80A 5I1GH 1DFBL 1EERB 4AH2A 5JQ6H 3QFJD 3QUYC 3FU6A 5BZDB 1ZWIA 1O5DT 2DBLH 2V37A 3SIKA 4YPGA 1S9WA 1AZCA 1T20A 3U25A 3O2DL 2NY1D 3N43B 1RUPL 1RZFL 3BI9X 5F3HA 4J5VA 5A3IC 4QRUA 5GIRB 1B4JH 2CJUL 5AW8B 4ELMB 4LKCA 4Q97A 5B8CC 1KENH 5TFSL 2LFEA 3UDWC 1YECH 4M7ZC 1Z9SA 1K8IA 1IGYB 3HE6C 5B8CA 2IALA 1PKQA 4MAUH 4MB3A 4PP1D 4P23B 5F7AA 5DZNA 3FUJA 3OXRA 3LKNB 3ZDYF 3D0AA 1UWXK 2QL1A 1SJVA 3IJEB 4PLKC 1PJWA 1BGXH 2P1YA 2RJMA 4FKEA 2ZCKL 4L3EE 4PJEA 3WEOA 4D94A 1OM3L 2XKUA 1FGVH 5FHBH 3B3IA 1A9EB 3NCFB 1LLAA 1SBSL 1SOXA 4O58L 3IRZA 4JUSA 3L95B 5L0QC 3IMUA 3SDAB 4LESA 1LE5A 3IGFA 4NQDD 4XPBH 2VZ1A 3V0IA 4AIZB 5IG7A 1DBAL 2F0CA 4LK4A 3MNDA 3VH8G 4V1DB 1KJ2H 1SPDA 3QK0A 5AVVB 5AAMA 2WBXA 2DBJA 4ODWA 3ZTJH 1S7XB 1DHKA 1E5YA 3LPOA 5EU6B 1ACXA 1V7ML 3EYSH 4G7RB 4LVHC 1HXMA 1NGQL 5IW3A 5ISZA 4BFNA 3VRJA 1GJIA 2HPOA 3B8YA 4OJEH 4WW2F 3SE8H 5CZVH 5ALCL 4X0KA 2X4OA 4WWOA 1WAEA 2NCMA 4U1SB 4PS4H 1XBRA 4HIJB 4ANKA 3KPQB 4XXWA 3DUUB 4O2CA 4HKJB 5BZZA 3LPFA 5IVXE 3WKML 5IVZA 4TSAL 1UWEH 1NQBA 3OG4B 1YY9C 3IWUA 5I6LA 2MTAA 3TO4C 5C0JA 2JMRA 3F7VB 2C7UA 4G42A 4AUJA 5ANME 1OT2A 1Z5HA 2F74B 5HHNA 4XB3A 4PJ6A 4BZ2A 4NKOB 8CGTA 4Q9QH 5AVUB 4M6OH 4Y4HD 4XNZC 5AVYB 1DSFH 1T1XA 2H1PL 3D18A 4XWGH 4MNGE 5FO9A 2HB0A 1AR1C 4EZKA 1SN2A 3HVDA 2IAAC 1HKLL 1QWNA 2WQXA 1U6AH 3ZDWA 1WZLA 3CFBA 2EO9A 2EH7L 2R27A 4K3JL 4OM1L 1HILB 2IDTA 3KNBA 3O6MH 5GZOD 2EZ0C 4F2MA 5C0FB 4MJ6A 1LHZA 1PQZB 2Q3AA 3B6SB 4P3DA 5I30H 5F44A 4OV5B 4FP8H 1CIDA 1QEXA 2RHEA 3CDZA 4KNSA 3SZ6A 3JV0A 2XJLA 4XVTL 3ATBA 3I75B 1GKEA 4QAMB 2LAGB 3EFOB 5EIQA 5FKPA 2CKBA 1F6LL 1F6AB 5DHMC 2A7BA 4TNVK 3WJJC 3UPAA 1VFBB 1IC0A 3AS2A 1R33A 1T0MA 1MFUA 1X3DA 4MVBC 2Y06H 3QJFA 4JO1L 4PI2A 2OYPA 4OD1H 1MEXL 2J57A 1LM8V 4RAUA 2GUOA 1CMOA 5CBEA 1PKQE 3MLXH 5IQOA 3G6DL 3BVWA 2PPDA 3OKEA 4Y1TA 1H5BC 3O4LA 4BFBD 4DVRL 2C9AA 4XTRC 1WPCA 5EZJB 1CF8L 1ZVSA 4RLDA 5C6PB 3FRPG 4KK9C 5IBTL 1U93B 1NGXA 1O9VA 1AQ8A 5F1NA 1YUKB 2UXTA 4HSCX 3BPCA 1YMHB 3L7FA 3WTVA 3S97C 5D7LB 4H8VA 4JZJC 3LD8B 4UV4L 1UCTA 3OQRA 4GW1B 5ESAA 4QKTA 4R0LA 3PFUA 1M53A 1UB5B 2V17L 1J0JA 1WISA 5IEKB 4TNGA 3SPGA 3QHZL 3QWNA 4Y19D 2EDHA 1D5MA 4POZC 4WEUD 3FUHA 2L3BA 4ZFZB 1MDAA 2FIKA 3BE1H 3IJSA 4OGYL 4EPSA 5KVGH 1TO4A 3ZMEA 4PJHE 3OLIA 3WIHL 1EZVX 2F2HA 3QUXC 2XZQL 4WO4C 1EHAA 3BP5B 3V4PL 3AU1A 5HHMD 4WENB 3TV8A 4Q6YA 2WYIA 4M4PA 2EXYC 3SJVA 1OGSA 3N1MC 4GKZA 4L8SB 3AQDA 3PL6C 4Z7WA 3BT2H 1MWAH 5IJVB 1ECZA 2WCGA 2Z7YA 2YOAA 4OI9A 3CLFL 5F7EL 1D5IL 3PL6B 1WS7A 3NJJA 4HUXA 4MAYA 4HLZG 4V2CB 4Q9RH 4ELKB 1JF5A 4LOEA 1YEDB 3UAJD 4YX2H 3SQRA 1WA2X 4HX1A 3GBDA 4WWKC 1ONQA 1XSJA 2K0RA 5F8QC 4IRSA 4OBSA 4F9LC 2HH0H 3WEBA 3KWUA 2LU4A 3UADA 1I1AB 2B08A 5L4JA 1MPAL 3D7PA 3WG7B 1YG9A 1IE5A 4O2EA 5KVMC 2YLKA 3SGEH 2ALWA 2CO3A 2LTQC 4AG4L 3NGBB 4XPBL 2G0LA 2QSCH 1FYTB 2NUPB 2CCLA 3HHSA 3V4PB 4BZ1A 4QMEA 3FU7A 4N5EC 1HX0A 2ZKWA 2W65B 3GI9L 1HESA 1I3VA 4OTXL 2N7SA 3MA9H 4FMKA 4DQAA 4ZXBA 4UM9D 3L3IB 3EYSL 5H37G 5A43C 5EU3B 5H8DA 1EDQA 5JLZA 3WFHA 1T04B 5AFAA 5D7KE 5D2NC 5F7LB 5SWSE 1WAAA 4BFIA 2ZSVB 4FI7A 4PRHB 4UNVA 3QEUB 2IXQA 2FX9H 4LVOC 5FLUA 2QGCA 3A3YB 4UT6A 2N0MA 1IKOP 2JJSA 2V9TA 4XXDB 3U36A 4KV5E 1KCVH 4WSKA 4XOAA 3EOYG 5H35B 3BMWA 5IBUG 3B4NA 4XCEB 4Y16C 1A6TA 5C08E 1ZSDB 1ZCRA 1RUAL 4N0FA 2OZ4A 4JRFA 2BS71 3N04A 3VQ2C 5E1GA 1UXSA 3MBWB 2HVBA 3W9DA 4Z7UA 5IHBA 2E9BA 4H8WC 3EHBC 5KSVB 3BQUA 1LXMA 2M83A 1A64A 3F64A 4GI8A 3UTQB 2ZF8A 2UYLB 3DSNA 1RK1A 3VSVA 1DSFL 2H1PH 1S7VB 3CFKB 4FTVD 4G3YL 1RIHH 2LVEA 3GSVB 3Q2NA 3WDJA 3NEXA 1HZKA 3DX2A 2C4XA 4J4PD 5T1MB 2RQ8A 4WJKB 3Q6GL 3UAJC 4Y5XC 4JM2C 3DI3B 3OX8B 1NGYA 3PWPA 1QSFB 1EAQA 3PYCA 2O61A 1AD9B 4LHUD 2WGXA 4HIIB 1FVEB 4IMKA 4X5XA 5ID0A 3L4YA 1XWVA 1AR1B 1AKJD 1ET7A 5BV7L 4HGWB 3VH8B 3HE6B 5EC2B 2C4FT 5DDHA 1HHJB 1DANU 2GJPA 1YAZA 1OF2A 2KQNA 2ICWA 4LQFH 3TYFA 3U9UA 5HI5C 1QLFA 4LHUG 1NKRA 4LSTL 4APXB 2XACC 3LZOA 3MRLB 5F3BB 3IDXH 3RURA 5I17B 4BSVB 3KVDD 4IHOB 1VFBA 3EJJX 2MQ0A 3NJIA 4JFPB 4QHUB 5HHOB 5G5DB 5IK3B 4KK5D 1E4KA 4JO8A 3EJTA 2LFGA 4KRPB 3QDGE 1IFRA 2CE6A 2XX0A 3DARA 4FA6A 5I8KH 1DVFA 3C75A 4TUUA 4Z7QF 5C0CD 4GUOA 5F9OL 4M02A 4PW4A 2ID5A 1FSKC 3TO4A 5GZOC 5F71A 2DKUA 2WYTA 1CDBA 3HCVB 3NK3A 5DJCB 4HT1L 5DJZB 4BFEA 4IMLA 5J9PA 3HI5H 4UV4H 5CR1A 3VUAA 2CJSA 1ILUA 2IJ0C 2R2EB 2YAEA 3OPZL 4M93B 3JWDC 2XQYG 3OWRA 1MFEL 3AG4B 2OR9L 4M62L 3FUFA 4ZPVB 4Y2OA 2W60A 4MNHA 3J07A 1TEYA 1OT4A 3CU7A 5FS5A 4MJ2A