5T1JA

Crystal structure of the tbox dna binding domain of the transcription factor t-bet
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
192
structure length
192
Chain Sequence
b'KLRVALSNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGSMPGNRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEPEAACSASNTHVFTFQETQFIAVTAYQNAEITQLKIDNNPFAKGFREN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-box transcription factor TBX21
publication title Crystal structure of the DNA binding domain of the transcription factor T-bet suggests simultaneous recognition of distant genome sites.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 29
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00907 T-box T-box
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.820 Mainly Beta Sandwich Immunoglobulin-like Transcription factor, T-box 5t1jA00
4A04A 5BQDA 1H6FA 5T1JA 4S0HA 1XBRA 2X6VA 2X6UA 5FLVA
chains in the Genus database with same CATH superfamily
3BD4A 5AZ2L 1O7VA 3ZSSA 4FXKB 4Z3JA 3KCPA 3D5OF 4KRLB 4BFRA 1TTAA 4MMXC 2WWOA 1W72L 4X7TB 3CX2A 2ZAHA 4D9QE 5HGAA 2HFGH 5ETUB 4IKNA 3MLRH 4OLYH 4AQZA 3FUIA 4I0PC 2X6VA 5J11B 2OSYA 1NLBL 3MNWB 3MREB 1H8LA 2CKBA 1I8IA 4J12A 3CC1A 4JZOB 1LMKA 4OV5B 3F64A 3F6JA 5B38B 2YGOA 5KN5A 1ICTA 1WISA 1P7QA 3WIFB 4DGUA 4BQ6A 3M1BB 3HPJB 3RVWD 4LLMB 3L1OL 3W0WA 1NBQA 1YY8B 5CSZA 3GBML 4DGIL 1AI1H 3U82B 5FUCE 1HU8A 3WDJA 2DBLL 2DMKA 3NH7H 4PG2A 3FQUA 5HHPB 3VWJB 4F5CE 5I1IL 5IGXL 2EDMA 4K8RL 5A2AA 1SMAA 4G42B 3LQAC 4RAUA 5CJQL 3QCVL 3ZK0A 4J3OF 3INUL 1VFMA 2BX5A 3L3KB 5IF0B 3AQZA 4YUEL 3SBPA 5D4QA 4PY8I 2YD2A 1LP9B 1IEAA 4HGWB 3QEQE 3O6LH 2AHIA 3MU3A 1TEGA 4N8CL 3ALXA 2ADFL 4X6BB 1A4JA 4X8CA 1SQMA 5D6DC 5ITFB 4YJZL 5EF1A 1TETH 2C9QA 4BQ8A 3P3RA 1JZHA 3B37A 4XN5A 1GOFA 4UV4H 3RZWA 4G71B 4JKPH 5TGBB 1ZT1B 3GSXB 1BFOA 2LU5A 1NBYB 2VIRB 3GB7B 4L1HA 3L16A 4XVOA 4Z7NB 2OMUB 1X9RA 5LNEA 5H2BB 3UTPE 4HZAA 1WA0X 3VGAB 3OKYA 1QHQA 2JKTM 5L2JB 1HSBA 5AVUB 5BW7C 2ZZUT 2XZCL 1V10A 4R26H 1EPFA 4UDUA 5DTFB 3OBAA 3BT0A 3GPSA 4U0RB 5L6YL 1GCYA 4LRIC 4PG9A 4TQ8A 4S0HA 2AZAA 1VZHA 1QZNA 2RQ8A 2X4SA 4NHUA 1H8NA 2XTJE 5JLZB 3V52H 3ESVF 4KZCA 3K8LA 3UCQA 5JQIB 1UT9A 2EDNA 3IAGC 2PYEE 3V0AC 5T3XE 3BAEH 5IB4A 2C8NA 3QQ3A 4BFKA 2DLEA 3HC3H 1HILB 4HWBL 3TH3T 4Q9RL 3L54A 4M6NL 1KTDB 1V54B 4X5WB 1UWYA 3BUIA 1KT2A 4FFZH 3RWHB 2EVGA 1F00I 1MCRA 3HNSL 1J18A 3BPLC 1KXQE 2D0HA 2AJVL 4GW4A 1ZCRA 2FLBT 4G6KL 2Y69B 5A2LH 2GB2A 5CILL 5TPWL 5MP6H 3B6SB 2DLIA 4N20A 3G5VA 3RB7A 3L7FB 3TIDA 4PU2A 5FB8B 3MBWB 4DUVA 4DH2A 3NJGA 2XG5A 1CE1L 3UH8A 3OZ9L 4DO5A 3NJNA 1DVXA 2N56A 2I07A 4XODA 3Q7JA 4GRLB 1J9SA 1N8OE 1N8ZB 1ZXKA 3CXDH 4KVNH 2H0FA 3L3IB 4JN1H 4JY4B 5FFGA 5KYXA 5EF2A 3FFCA 4GEIA 2FO8A 5EDSA 3VXRB 4LLWB 5IJKC 3K46A 4B97A 5D71H 2WZAA 4NQDA 4WWKB 3SQOH 2YRPA 4UU9B 3M17B 3HEIB 2P5WE 4PRPA 4PJGE 2LHAA 2E4FA 1HHKA 2WWMD 3GSNL 4F7TB 1FO0H 2ZPKH 3BVWA 4UQ2B 4C4BA 2RTTA 2R0LL 4KROB 1IAOB 2PCPA 3EGSA 5JIQA 1XGPA 4B5ZA 1JPEA 1ES0A 2XX0A 2F53A 5IVNA 3LEVL 2GK0B 4LF3A 1K4CB 2YAPA 1M1XB 5I1GH 2Y24A 3MRGB 5CUSH 3S3PA 4N0CD 1LD9A 5LCVH 1CDCA 4DQOL 4MNQB 4JRXE 3C8DA 5JW4N 4CMMB 5J12C 4JFXB 4KUZH 1Y18A 3C6LD 3WY4A 3SGKC 1CGWA 4EF3A 1MH5B 3CUPA 5KSAA 3TURA 3OKEB 1PZ5A 2ZF8A 1T2JA 1TF4A 3MCLH 3H9SA 1YC7A 4Y5VB 4YNYB 1MAKA 2BH0A 2W94A 3PWLA 1JPFB 1ZWIB 3RY4A 5AVSB 3BLKA 2YBRA 3MGOA 2DWEB 1QA9A 4P2QA 1G1KA 1O7DE 1BQSA 3BKMH 3U46A 1F90L 3EHBD 5EOQL 5C09D 4LQ1A 5IB1B 4WV1C 3WXVL 5A7EA 3MLZL 5CIPH 4FEIA 3T6ZA 5HHME 3VXUB 2F19H 2Z7ZA 2CLRA 5T3ZH 3E1F1 2BNQE 1CTNA 1YN7A 3ME0A 2LW3A 4L3EA 5CN2A 3B7TA 3OPZL 4L9LB 1I7TB 4NRYB 4N0RA 1AG0A 1X6LA 2ZSWA 4R7DA 1CDYA 3C5ZB 3EO1A 5D2LB 3VM7A 4NZUH 2ZUYA 2VXVL 1IIKA 4IS6A 2OPCA 1A7QL 1B0GB 1QBLL 5C86A 3P9MA 3Q1EA 3MRFA 1CF1A 1GR7A 3P0YL 3GI9H 4ZZFA 2X2YA 1F6LL 1K6QL 4C59B 3CVCA 1TQCB 12E8L 3L8QA 4KJQD 4BK5C 4N2KA 1FYTB 3R06A 1XGQB 2Y06H 3NK4A 2AJZA 3ZE1E 1XCTB 4WDIB 3N2JA 3HS0A 3KXFE 3VWJD 5KS9B 2C1OB 1XGRB 3FU5A 4PI0A 1TVHB 4NAJA 5C0AD 4L8BB 2HLAB 3O6FC 1N0XH 1HCZA 2UZYA 3WIHL 4MKMA 4K9EL 4LSDA 2Y7NA 4ESKA 1I8UA 2CAKA 3HC4H 4ZYKA 3SDCD 1W0YT 1A6UL 5HDBB 2OMBA 3V6FB 2IF7A 1M2VA 4JRWA 2NYYC 4AYEC 5TJWK 3V4PB 1G9NL 1EEQA 1T89A 5GRJH 1I85C 1HOCA 4A2GA 2PCFB 2MHAA 3NIDF 5E0QA 4DPCX 3AXLB 2YOCA 5HYJA 1TOXA 1JK9B 4PJ8C 1ECYA 35C8H 1XSOA 3VSQA 5GHWH 4K5MA 4GI8A 3MV9E 4AY0A 4FQCH 4XP6H 4GIOA 3OB0H 5CZXC 1R0AL 1KXVA 2KS0A 2UVFA 4MA7L 2O5YL 4OB5L 3EJZD 2DTSA 5CD5D 4U49A 2Z91A 3LQAH 1AGDA 3D85A 3U30B 2YGPA 4UANA 1J8RA 1UZ6F 2HJFA 5GGUB 4NNYB 5DRZA 3GO1L 5D4JA 4GQZA 2EDWA 3V4VH 2WBKA 4DPBX 2PUQT 2Z7WA 3DPDA 2O4EA 5E4AA 3VD2A 2X41A 5FDWB 3T0WA 2AEIT 2B3RA 2P49B 4FFVD 3GHEL 1OGTA 3IB4A 1CQKA 3WIIL 2EYSB 2QBWA 4GMSH 3OR6A 3P4MA 1IGML 3CMGA 3QC6X 1VGKA 3V9CA 3VG9C 2V2TA 1E4KA 2Q3ZA 4F8OA 5EU3B 3UO1H 1N6QL 3NVQA 4OD1H 2OFQA 1B9KA 2B2XH 3FUMA 2GJ6E 2WHVA 1OM9A 1KB9J 4M43H 4EN3B 2EIZA 1GL4B 4JQXC 1HDMA 3K6SA 3PWUB 3SDDA 2Q2EB 5JHDE 1FV1B 5SV3A 1RP8A 4GRLD 3O3AB 1EAOA 1I9RH 1WF5A 3OX8B 3MLYL 3T04D 1A22B 1HNFA 4TMPA 5CJ8A 1TJGL 2CBTA 1FLRL 3RNQA 4ZXBC 3VXRD 3VO0A 4RISL 4UT6A 4AZ8B 1RZJC 5HHOA 1MI5B 3H9HA 2B7DT 2Y5TB 2HMID 4TOYL 3WHE0 3SBWC 2BIMA 3K6OA 4XPTH 3VB8A 1Z66A 4DO4A 4R4FL 3G5ZB 4XNXH 2DIJA 2XIIA 4JG0H 4HJGB 5I1CH 2QADC 3KPRB 3OL2A 1OO2A 2IGLA 4KROD 4NUJB 4PRIB 3HLAA 2YPVH 3TEUA 4HV8A 4OTXL 4O51B 2P9RA 1BECA 3IYLW 4HULB 3UAAA 3FB6B 4MAYC 4LVNC 2ADJB 4LL1A 4MNQD 1NKGA 5IEKA 4KO7A 4A1RA 4LHUG 4PJXB 5E1IA 1YMHB 4KKZA 5IW1B 1ZK5A 3QQDB 5DCCA 3X11A 4HLZG 4X50A 2J1KA 3LN4B 5ESQA 5HJBA 1QSFB 4U1JA 4X6EB 2E86A 3VFMB 3V55A 4QJ3B 3ZTEA 1A7NH 1FFPA 2YRBA 4JFQB 2A9DA 2JKXA 1J0IA 3EFOA 3O41A 1DBMH 3IE9A 4JFEB 2VB5A 2Z31B 2OTUB 4KKAD 5D96B 5I6XC 3QDJA 3N41F 4NN6C 3D2UA 2FSEB 2QR0A 1CFQA 2CHWA 1RK0B 2QDWA 2LLNA 4FFYA 4YEFA 2HWZL 1YEDB 5CLWA 2ZOWA 1MNNA 1ED3B 3TJPA 1G1YA 4N2IA 2FT8A 4I87A 3BO8A 4E9LA 3H2QA 3VXUD 2R0KL 3JWDC 4JFOA 4PBWD 5JUEH 1FL5A 1HOEA 1XGTB 2EE6A 4DWHA 3HBQA 1B6DA 4XZ4A 4U7KA 1OT2A 3QDHA 1NCCL 2FX7H 3L9EA 3C5ZD 3TBTA 1WAAA 4LHUB 1CR9L 3KBPA 4MDRA 2VCOA 1T7VA 1OAXH 3PGCA 4WTZA 1A0QL 4G1MA 3TT3H 4A04A 3TWCH 1AR1D 4FQQA 2FATL 3OHXB 3T08A 2EO9A 1FC2D 1KCVL 2RMNA 5LN4A 4AGOA 1QPXA 4NB7A 2W0LA 2MCPL 3ARFC 4JHAL 1ERNA 4IMLA 3DMMB 4PD4J 5EBWB 5KVGE 4GG8B 3TJEH 1E9QB 4EDWH 4JY5L 1FYTD 3WN5B 2WVTA 3MXVH 4X99A 1PLGH 1E2WA 2TSAA 4WU7A 1CXFA 1J5CA 3T65A 3ZZLA 3JSSA 1FH5H 5DZLA 2YPLE 4HCGA 1OV8A 5IY5B 3KL5A 1DANT 2OP4H 1EO8L 2Z1KA 3LKSB 4ZAKA 1U6AH 5EUKA 3R1GL 5EZJB 1AOZA 4NGHL 3AGWA 1LTXA 3VMPA 1J1XH 1FCGA 2HP4A 4HK0B 4MD0B 4F1SA 2R27A 3EXLA 3CGTA 3V4PL 1OWRM 1AS8A 2GK2A 4FNLH 2BVPA 3QJVB 5FYJU 3T3MF 4YK4B 2VLKA 3MBEC 2OI9B 2WKLA 1NZRA 3B56A 1VZGA 5J6GB 2GHWB 3VXTB 1EHKB 3VI4B 2VERA 5KSBA 1EUUA 1SJHB 4Y1TA 1GZPA 1Z7JA 2JJUA 1ZA6A 3KPMA 4NP4H 4OUUB 5FO7B 1SYVB 5K9JH 1DE4A 2DMBA 1FE8H 3LN5A 1A5FL 5SWZE 1SEQH 1UB5B 4FYTA 1IBDA 3FCTB 4MJ6A 4R0LB 3QQ9C 3TZVA 3JWNG 2NY6B 3G6JE 1FDLH 5DHVA 2VLME 4B95C 2OTPA 4TSBL 1HZHL 5D1QE 1JGIA 3F7VA 4P5MA 5ALCH 1CJYA 4R84A 4OQTA 3BWSA 5C07B 3RUGA 4PY7A 2O93L 2EP6A 3PWPE 1HTYA 2E9GA 3AWFA 3D3VE 3NK3A 5F96L 1XH0A 2XIDA 5DJ2A 3BMWA 4WFHE 2AQSA 2G2RB 4UAHA 5E4OA 1HIML 1U8KB 3QJTB 5T5FA 4EIZC 4WW2B 4I18B 3FH7A 3U7WH 4MCZA 5BVPH 1JHKL 2J1WA 3CX5J 3GMLB 3GZPA 4RRPA 2C7FA 4DVBA 5B1JA 1PCSA 2XPZA 3VXOA 1FNGA 4MB1A 2O5XH 1KTKE 4GXVH 4Y7OC 5FUZL 3QZOA 4Z7QE 1EGJA 1RZIA 3FCUB 4KXBA 2CM6A 4UILL 3DJSA 1NPJA 3LKOA 2Y6SC 1M6OA 2X05A 1OQXA 3EAKA 3ZY7A 2B4CC 1C12A 4JO5A 4XXDB 4UNVA 4KHTL 4LOUC 4LSUL 4N5ED 2H41A 1MCBA 4HHWA 4AL8L 4L4VB 3CHQA 3D12B 1QWNA 2YD3A 5JDJA 4GSQA 1NFKA 3IPEA 2QKIB 2W65A 2ZAIA 3HNTH 3I9GL 2IXQA 4TQHA 2WLLB 4EN3D 5K5YA 5KSUB 2DWTA 3C5JB 3V0JA 4MSWB 4XMXA 1UKQA 3LS5H 5CEZH 1ETZB 4PR5A 3LZRA 3CZFB 3RWJA 1BBDH 3DJZA 5C0CB 3TYFB 1U8CA 3WNOA 2DLFH 5KBMA 2X4OA 2XV6B 2WQWA 5I16A 2O5NA 4ENZA 5I66A 1UASA 3TOPA 2NUTA 3R4RA 1KPVB 1XH3A 5J5EA 2D7OA 1XIWA 4AEHH 5I8EB 2Y5EA 3GXUB 1LXMA 2MFNA 3NSCA 1MI5D 4OKVA 1BVNT 4R4BA 4YXHL 4NAQA 4GYBA 4AIZA 5EU7E 1S9XA 1ZGLA 3KPRD 1ACYH 1ZMYA 3ULSB 1RL1A 4U1MA 1J5HA 3RL1B 1CDIA 1NDMB 4PJXF 4AUUA 1QABA 2JQAA 4ODWA 1J12A 3MNVA 4P99A 4A39A 2EIJB 1PF3A 3NFPA 2C4FU 3LH2L 5DA4A 2VTFA 1BGXL 3ETSA 3PHAA 3QWNA 3BYTA 3QUYA 5LUMA 4DVRL 1E65A 1QSFD 3CSTA 1WYJA 2NNCA 4RX4D 1BVLA 5AB0A 1N12A 4OIBA 3QULA 1FCCA 2EXSA 1DBAH 1D7CA 5I82A 1WQVT 4NT6A 1RZFL 4M4RA 3WJLA 3F85A 4Y19E 1RZJH 4WFEE 5GRUH 1EZUA 4F9LC 4EUPG 4K5LA 3KWWB 1WAAF 1R34A 4OU3A 4WUUA 2BO0A 1QRNA 3WS6A 4QAWA 2H3NB 4N2AA 1S7SA 3CN0A 2MOVA 1P4BH 3L5XL 5FYLH 2J2ZB 3EYFB 3QRGH 1XSIA 4OVVA 1OM3L 4ABVA 1G7QA 4PJIB 3T4AB 2W81C 4LHUD 1EJFA 1SLVA 1YEKH 3FUNA 3IDYC 4G6FD 3WO4B 1KELL 1YEHH 3NZ8A 5B7MA 4L8SB 3FU3A 1JTTA 3IETB 5DO8A 5D1XD 3UJIL 3BGMA 4QRRE 5T33H 2IH1A 4K23L 3GFUA 4L29A 3QISA 4DAGL 2ZX7A 1CLZL 1E5BA 4CNIB 1JGUL 2WXIA 2XYBA 3DMMD 5F7UA 2P5EE 5DD6A 2J4WL 2BCKA 4L4TE 1MELA 4L8DA 5TD4A 3OKLB 3C60B 5I76A 2K6WA 5J4MA 3WAKA 4EUPB 4H8UA 1YJDC 5GJSH 3F7KA 1PJ9A 2LABA 3HZYA 3QG7H 2SODB 15C8L 1OY3B 3ABMB 3R8QA 4YZFE 5FA4B 4D9RD 1KCWA 1E4WL 1HZKA 4JPVL 3GSWB 1NGQL 4HUCA 4Z78B 4Y1AE 5E2TH 4RDBA 2A9AA 4PJBA 1DBJL 2EDRA 5HHNB 4LLDA 4KJWC 5E9DA 5IMOA 1QOKA 3JWDH 5KSBF 1JG9A 1OTUC 2LFEA 4JW3A 1BMWA 1WFJA 1PEZA 1EJOH 2UX7A 4YHLH 4G82A 4FZ8L 4OVUA 3X14A 1RPUA 3F05A 3KM1A 5KJRH 3S88L 1Y6KR 3QZLA 1TQBC 3D0LB 3LXCA 1TCRB 4EDXA 4OY9A 4ZX5A 5ADOL 1YYCA 4PRHE 4OZGA 3RDJA 4GT7A 2NY6D 3FONB 2QTEA 2X28A 4OFYA 2C3WA 3SYAA 5D70L 1MFDH 3AREA 2P48B 3CVHB 1TJHH 1U8JB 3K8MA 5C2UB 4LDLB 5D7EA 2DQHH 2K3HA 1FYHB 2XVKA 3QI9B 4PJEA 5FA3A 2NQCA 4J3WA 4YHMH 1G7HA 4YC2C 3TV3H 3BW9A 1MFMA 4MCYA 4JHWH 1YQ2A 1BCIA 2FEJA 3GK8H 5CZRA 3NCYP 1G7JB 4JPKL 2WCGA 1CIUA 5C0RH 1ET5A 3MX0A 1D5IH 4I5BB 4NOFA 4YHKH 3ZUNC 3CFQA 1MEXH 4Q6YA 3RE0A 4N6QA 3P4LA 1VFBB 1UM5H 2H26A 2EXYD 2JELL 3ESUF 3PGFL 4WY7L 5LGJA 1UCBH 1PBYA 4ES9A 4BHUA 2ICEB 2J25A 4N90E 3P40A 3CCHA 1NGZA 4PWJA 4P5KA 3RKPA 3FDWA 4K71B 1THCA 3DSFL 3EFDL 1F11A 3HAEA 5DS2A 2J57A 1T0MA 2BERA 3CZUB 5EC2A 3Q6FB 1H5BA 3QORA 3BLPX 1L9RA 1NIFA 1R1CA 1T20B 3I50H 3GXPA 3QIWB 4QNPF 2NY1C 3SHSA 3TBSA 4QRTA 5ICXB 1P5UA 3P9WB 3UO8B 4X8JB 1TTCA 2KLSA 5C0EB 5I18H 1QG3A 4A2EA 5ANMA 5C0CD 3W38A 4FG6D 1KB5H 3UIZA 3PP4L 3CQQA 3DV6A 4MQXD 1HXYA 3D25A 1ODAA 1JGDA 2R1YB 1JVOA 4U1NA 3W81A 4ZPVB 2V7NA 1MCPH 4FJYA 5EZLA 4LPWA 4IJTA 5EB9A 1DCEA 3QAQA 5ITBL 5AOKA 1XD0A 4TUKH 3T77B 2ZXGA 4S1QL 4APQC 2CIIB 3NZHL 3DDFA 3ZXAC 4HIXH 4Q9QH 2B4CH 2Q2LA 3NSFA 4PVLA 4UZSA 4XZUA 2RBLA 1VFAB 3TN0B 3CMOH 3R18A 4U1KB 4N2HA 1WA1X 1TQWA 3D39A 4CSZA 1IC4H 3OSKA 4ONOA 3H8NA 3ZDZE 2VR6A 3DJRA 2E9IA 5JXED 3BZFA 1FVDB 3MV8A 2VM3A 4FI6A 5HDLA 3SY0A 3VFNA 4MQSB 3RIKA 4FTVE 4Q2ZB 1DFBH 2QQKL 1WO2A 2XVBA 3MLPA 3ZMNA 4LKXA 3F5WB 4LFHG 3L3GB 3WE1A 5GS1B 3HZ3A 3N0PB 3LRLA 2FEEL 4IIQC 2FBOJ 2ITCB 2AJSH 1KULA 2HKAA 5AW9B 3GXDA 2P4AB 4K07A 2IPKA 1H19A 3HI6L 3QO1B 3FU7A 4AYSA 1P84J 1ROCA 4Z18A 3BSZA 2GIMA 3IDGA 1R5VB 2I9TA 4PJIF 3SOBL 3AAZB 5IZ7A 1IVLA 1JF5A 2QMKA 1IQWH 1I9EA 1AGCB 3CLEH 3WMSA 4IOSA 3ECQA 1KYFA 2D03H 3H53A 3SD5A 4B50A 2OMXA 2XFXB 5C0BA 3B3IB 1NGYA 2KYIA 3TIEA 4F7MB 5IG7A 3HG1A 5E8NA 4BH8A 5LGKA 5EU6A 2A7BA 3BRGC 1YUKB 2NW3B 3K91A 2H1LM 5FUOH 4AT6B 5JHAA 1JXDA 5E5MA 2Q7NA 1HKFA 3DARA 3FQWB 4P04A 1L6PA 4P57A 4HX1A 2ZYRA 3RTLA 2NXZB 2A73A 1OGAA 4N8VA 1DQQB 5BNXD 3G6AA 3I2CL 4H13C 4PJBF 1DCLA 3ZR5A 1T21A 3ZSTA 2JKRM 4XVSH 3MODH 3ROLB 3SCMA 2X3AA 3TEWA 2V0AA 3VYNA 3UGEA 2HT3D 4FNRA 5JOPE 2PPEA 4EQ2A 1LO2H 3CDZA 1CFTA 1IM3A 2VDLL 3MLXL 4R5TA 4ZUVA 5IB2B 1T1ZB 2K6ZA 2RAMA 5DU7A 1AGEB 4L0PB 4KVPA 2YMTA 3FZUD 2FHBA 4G7YL 3TO4B 3WKNA 3MHZA 5DUPL 3T2QA 4W9LC 4JCMA 4BZ1H 1UADC 3U2SB 1R3HB 2IANB 4OZGF 6TAAA 2AJXH 1XF5B 3N85L 4CSTA 2X1XR 3PHSA 3DIFB 3IWUA 3MOAH 5F6HJ 5JW4Q 3GWJA 3CVHL 1IGYB 2J56A 4MB4A 4MMZA 5F7AA 5AVZB 4AQ8C 4PJEF 4ZX6A 3RWFB 1JL8A 4BM7A 2KZBA 4GSRA 3KYNB 2AJ3A 1JPSH 3VRLE 2BS9A 3HCVA 2GW5A 3LPGA 1U3YA 3P4NB 2GITA 4LCCC 3RAJL 3VMOA 3W9DB 3QI9D 5BV7L 2AK1H 1Q9WB 1VFUA 1VAHA 2MTPA 1I1AA 1MCHA 2FNBA 2O26U 1WCQA 1WT5A 4NUMA 3BEWA 4TV3A 5E5RB 1DUYB 4Z7OE 2HFFB 3EUDA 3VUAA 4AZUA 5LDSA 4IGBA 3L45A 4J3OC 5MEOA 1UG9A 2BNRB 1IEBB 3VXQA 3FOMA 3IJEB 4FXLA 5JYLA 2XCMC 1G7MA 3FO9B 2YUXA 4DP5X 2WXQA 1EDQA 4GBXA 4R83A 4JY6A 4R6UA 3C75A 4QRQB 1SDDA 5JNYB 3ML8A 1SZNA 4X7SH 5GRXG 1ADQA 2MOQA 3LNGA 2JCWA 1QI5A 2DQDH 2C3VB 1FG9C 1ZSHA 1WAPA 4PJ5B 4TRPL 4HIQA 1RJLB 4MS6A 4NQEB 1JRHI 4CMHB 3FB8B 2ADIB 2FYYA 5L4JA 1X44A 5FDYA 1K2DA 3QJFB 2XDHA 3NDYE 1F18A 1YEIL 1XF2B 2VLJE 3D1MC 4H1LA 3QUXA 4PGDB 2AQRA 5CCKH 5I8CA 3IJYB 4HS8H 4J4PA 2C9AA 3GLDA 2QQNH 4DP0X 4QTIL 1HH9A 4KO6A 2ED8A 3DUSA 5EO1B 3GIVA 1RJCA 1UD5A 4PGCA 1C16B 5SV4A 4RFEA 3FO2A 5G5DA 3NOIA 3AUVA 2BSTB 5CD3B 1QUNA 2EXTA 3Q13A 4UQ9A 1NJ9B 3SGJA 1U36A 1YNKH 1B0IA 4CADB 2ZONA 4MA1C 4DFHA 2IAMB 3H4FA 3I02B 4UTBH 1B3JA 1MJJB 1JV2B 1MCOH 3TN0D 3WFBL 4JCLA 1YMMD 4F93B 2ZWLT 2Z34A 3K2UL 3BPCA 4IBTA 3S3DB 4Q58C 2NR6C 1U58B 1MAJA 3IU3B 4XX1G 1OCWH 2QHLA 1EEZB 3BE1H 1AGFB 4WQOA 1K4DB 5IFHL 1CK0L 2PW1B 5JDSB 4FEMA 2OBGA 5BZZA 2B39A 2G60L 4EIBA 4N0UB 3QFJB 3S8WA 4N0FB 4PJCB 1M57B 1RUKL 4QOKE 1O6TA 3IRCA 2NZ9D 1KWGA 1WEJL 4TVSa 1T66D 5JMOC 3GBEA 4H40A 5KWYC 4K7FA 1F42A 5AAWC 3KG5A 1Q0EA 3IKCB 5CN1A 5DD1H 3V7MA 2FZ3A 3RL2B 1JDCA 4UQCA 5AW3B 2X6UA 3LIZL 2X4RB 3KPQA 2LTQB 4ONHA 4XBGA 1K5NA 3ZHKA 1OT1A 2OXGB 2CDEA 3EG9A 4PVMA 4RH4A 3WHE1 4QXWA 2L0DA 1B4RA 3TS8A 2QVFB 1NMBL 1X5LA 2D3VA 2YEZB 2B0SH 2HTKC 3T4YA 1LO4L 2CH8A 3EYUL 4K7PY 2XA3A 5JOFA 3K2MC 1GPOH 5DC4B 1P1ZA 5HYSG 3QDMD 3ENEA 2QL1A 1DDTA 2W9DL 4LNVA 5K59E 4LFHD 1EZSA 2CO6A 5AQ0A 5DMGC 4IRSA 1XQ4A 3UIYA 4H8WC 2NXZD 1U3HC 4HA1A 5KYNA 3LQZB 5INCB 2BXYA 2KI6A 4M02A 3KLHC 4XWOC 2C9SA 1OAUL 1OAQH 2EDDA 3LRKA 4JREC 4U3SA 2FEDD 3PABB 1AG6A 1OF2B 1W0WB 1U8HA 3HZMA 5C7ZA 4XTRC 1G9EA 2OYMA 5DRNA 1RVFL 2F1BA 1NCWH 4DGYL 4DP2X 4AI7A 4WK0B 2YC1B 3BDXA 2CO7B 1HXMA 4JO1H 2NY4B 3UTTE 1WIPA 2C4FT 4XE0A 3SE9L 1KXTB 5DDHA 1UT1A 4PJFA 1KBBA 3I6LE 3QZBA 4F2MB 2WJ5A 1YA5A 1OK0A 3ZYJA 2VLRB 5GS0L 5HYSB 2OMWB 3UL4A 2HVKA 1KPRB 1SDYA 4G8FA 4U1LB 1RXLA 3D9AH 1RY7B 2X70A 3FL7A 2G5RA 2XT1B 3RZCB 4AUYA 3IFOA 3WNMA 5EEZA 4DP7X 4PFEA 5FYJE 1KEMH 4FMVA 5LJYH 2X0UA 1E5CA 1JWUA 4PG2C 2FX9L 3DDGA 3EBHA 3FUJA 3VAEA 3NJHA 4AW7A 5AW2B 1G84A 5PCYA 1ITBB 4NWUL 5DVNA 2YAOA 3FS9A 1JWMB 5T1LB 1GW6A 4BE5A 1QFUH 4PGEA 3SJVB 1U8LB 3VJ6A 2YD4A 4ZX4A 4KI1A 1HJCA 5HYQA 1LWRA 3BP7A 1T0NB 1AC0A 1H3TA 2K7QA 4XBMA 4EXKA 1T5WB 3O9WC 1YHPA 3UG5A 2I69A 2ZOOA 4PGBA 3QWQB 1IL1B 5EUOB 5JXAL 3D09A 1T6BX 1TZIB 2V8LA 5AUMA 5G4OA 2IDCA 4LCUB 1RERA 4XCEA 1K8DB 2D2CC 2NCMA 1HHHA 2DQ6A 3STLB 1JPGA 3ARXA 1EZLA 4PJ5D 4K3JL 4L3FA 4WSGA 2Z4QA 1G1OA 3B5GA 2YMXL 4WHDA 3BQUB 1PS3A 3IXTB 3V0VA 3SD2A 1W0VA 4NPYA 1XT5A 1SY6H 1S7XB 2ZKHL 5CU9A 2CGRH 4U0RC 5F7EL 1MW1A 4MJIE 4TLTA 2F7PA 1LNUB 4N2FA 2MOGA 1QYGL 5BMFH 3V5HA 4PS3A 2Q7YB 4AGLA 2PXYA 1A1MB 2D31A 3LZLA 1IGIH 1QRNE 2UY6A 3KPOB 4UM9B 2AJUH 4BYHA 4PRAA 4ZFZA 3QCVH 4QRSB 3INUH 2WB7A 1GRWA 4Y9EA 5MHSE 4LCIL 4WJKB 4PV1C 1TU2A 3RX5A 5D4HA 2G5BB 3Q06A 1GTFA 2PYFA 3A21A 1DEEB 4OJFL 1Q72H 2VDRB 1M7XA 3ZX1A 5L88L 4JRYB 3P3TA 4FQPA 3D08A 3ILQD 2AK4B 4KDWA 3X12A 4EI0A 5LQBH 4KZEL 1P7HL 1MNUH 1ZOXA 3K6IA 3STZB 4F7PB 2IAMD 4W81A 2DQTL 5HXMA 1D5RA 3B2VH 3WSQH 4Q6IA 1I1FB 1JS4A 3PV7A 4HP5A 2ODIA 1CLCA 3MJ7B 2WMPA 4PJ9A 3P3UA 1MCWW 3VU1A 3QJRB 1NAMA 1F4HA 2APVA 2XQBH 1CDJA 3QFJD 4OKDA 4GO8A 3C6LA 3QXUA 2PWEA 3T2NL 1LGVA 4OGXL 5L6YH 4KK5D 1KCUH 3DPBA 4L4JA 5I1JH 4WWKC 1WDAA 4IRJB 1BLNB 2WNWA 4ISVB 4LNRA 5I1LB 4P2YA 5CWSB 5BO0D 1SXAA 1IKFH 3L81A 3V5KB 3DHPA 1G43A 3NAAL 3SO5A 5E00B 1I1RA 3IRPX 1HN1A 5E1GA 4L8CA 4PJHA 5JPNA 2X2HA 1J8HB 3OC5A 4HWBH 5DZNA 4FI7A 2VXQA 2IH3B 1R24A 2XWJB 1UHVA 4WKZA 4AX3A 4UQAA 1PG7W 4P4KB 2DV6A 2A6KA 1L9SA 3H42L 2X4TB 3QE5A 4HSQA 2BHZA 2MCAA 5D8JL 3KGUA 5C08B 2V2XA 5DEFB 1MF2H 3DGGA 1EHAA 4CC0A 1BM7A 5B39A 3F84A 4ZNEE 4Y7MA 5FXCH 2ZUQB 3OKOB 3QFGA 3HE6B 1JDDA 1YPZB 5I71B 3REWB 5L7XH 2CGZA 5CKGA 3CH1B 4ZMAT 4N9GA 2VN3A 4GSUA 1ZT7B 2ED7A 1DLFH 1S2EA 2NPLX 1A3LH 4K2UL 4EKXA 4N2CA 4YO0B 2NY4D 5C0AA 1YNLL 2CQVA 4R4ND 1GGCH 3K1DA 1FJ1A 3LHPH 5M94B 1CFBA 1JZ3A 2VLRD 1OB0A 5ID1B 1PQZB 2W88A 1OF0A 2WSKA 2NX5E 1NUFA 4FJ6A 4HGWA 4M1CD 4QRUB 3SDCA 3VVWA 4GUOA 4DGVH 1X5HA 2I60L 3RZCD 2WNGA 2FGWH 4L37B 1P7KA 4Y2DD 1F3JA 1JYVA 3F8UB 3V0HA 4DJMA 2WLJA 4GFXA 1BFTA 1H3GA 4H8WH 5F1IA 1M4KA 3AQXA 4PGZA 3HS0C 5D7LD 2RD0A 4DP8X 1E28A 3GB7A 1AHWA 2BRRH 1VHPA 4UAOB 2DEXX 2ITDB 5H2BA 1ESOA 2VC2H 1UZGA 2DJMA 3QIUB 5JMRA 3VVVA 5JTWA 3WTWA 4QJ5B 4AYID 2JK5A 3QYNA 3SJVD 1VACA 3LMJL 1WIOA 1GKEA 1TZHB 1E9OB 5GJTL 4A7TA 3PQYE 3D0VA 4OCRL 4QO1B 4NO2A 3VYPA 4G80B 2AERT 4M93B 4NFBA 3WXVH 1X7SA 2CKBH 1T89C 4KMQA 2BVQA 1OAYL 2G30A 1S78C 2ROXA 9PCYA 2D7QA 2YSSB 3OB8A 4ECNA 4HBCL 5B1BB 5BZDB 3GXFA 2YPKA 1ROWA 4GG6A 2JXMB 1HILA 1JTPA 1SHXA 1UUNA 2IBZY 2WVVB 2MWCA 1XMEB 3NQKA 1U8OA 2EZ0D 4OF5A 2ZP0T 3RU8L 4N8UA 2VXVH 2QSCH 4WI9A 2JQZA 1HT6A 1PY0A 2YXVA 1PZUB 1Y6MR 3MA7A 5I0XA 3HPLB 3BQUD 3T3PE 1QSVA 2WLHA 2DI8A 2R69A 4KK9C 3B2DC 1HVXA 2AW2A 4JM2A 4URTB 3U1PA 3B6SA 4CSPA 4LSPH 1GJUA 1CXKA 4HAFA 3U30C 2DD8H 5L9DH 4B9CA 2ODHA 3KDPB 1FL6A 3KVDD 1IVTA 2J6WA 1TLKA 4ODTH 4GQ9H 2MPAL 2VDRL 1G7LA 1BFVL 1FZOB 1NLDH 4MA3B 1OW0C 3ZDYB 1N8ZA 2NY0B 4MQ7A 4P23B 3KH3A 1ZDQA 4GS7B 1AKJB 1ID5I 5C0BE 4XCCL 5DEGB 5C97A 1AANA 1H6EA 4KUCF 2F54B 2G9KA 5IIEB 5DJDA 1A6UH 1A9EB 4NRZA 4R97B 3NFSL 3ZKMC 3SE8L 1E4KC 1BWMA 1AAJA 4XWGL 1IB5A 4F7TA 2VOTA 5H94B 5IFJA 3IDMA 3A6CL 3MA9L 4UUJB 2HT2D 4IOIA 4BINA 5K1NA 3MGTB 4R5XA 2H32A 2YWYA 3LDBB 1QWHA 1JFHA 3MR9A 2CA3A 3SDDC 5IB5A 2R2BB 3ELQA 3GRGA 1SYSA 4OM0L 1MCQA 1KEGH 3ELAT 5EU5B 2IQAB 4KRNA 1FFOA 5FGBC 1P4LA 1S7UA 4CMMA 5SX4H 2VMCA 2C3XA 3LYRA 1CL7H 1LQSR 3UAJD 3IFPA 1KIQB 5IV2B 3EJJX 3KCWA 3MZTA 4G8GB 1WTGT 3SEPA 1ZTXH 1MLCA 2YN3A 3CFCH 4XOBA 4NQCB 4X42A 4M7JL 3CIQA 2Y22A 4IRJD 3TL5A 3TF7C 1IU1A 2ZIDA 4PHXA 3IFNH 3GO1H 4R7NA 1A8ZA 3FN0H 4Y9CA 4NM4L 3AY2A 1J8HD 3FT0A 3V4LA 2DL2A 2C9XA 1TXKA 4JEGB 1O9ZA 2KKQA 4TVUA 4G2AA 5EZOH 4DCQB 1PX4A 3VFWA 3VXUA 5MENE 1Q94A 3UGUA 1MJ8H 4O2CA 4P4KD 4PJDE 43CAA 3TNMA 4PTUB 1U8IA 1Y0LA 2IC2A 1IX2A 5E9AA 4CILA 1HE7A 3AW5A 2P52A 1HHJA 3BKCH 3IMUA 1AVAA 1PX3A 3PY9A 4WFGE 4NJAH 5C08D 1AP2A 3F04A 1VCBC 4BFBD 3EO9H 3T2OA 1PG7L 1KJMB 3CK0H 4TSAL 4O02B 5BRZB 1PAMA 4FX5A 4ZPTB 3B3BA 4GXUN 1HH6A 3QO0B 5DFVC 3FYIB 2P8PB 2NSQA 5C0NC 5T5NF 1V3JA 4XP9H 4K73A 4H20H 2X4PB 1G6VK 2HFEA 1ZIAA 1A7OL 1WUZA 5KYWA 4X7EC 3KJ6H 3HE7A 4HKXB 4JHZA 5GIRB 3HBGA 3O8XD 3JBG7 4AQ1A 2GSIB 4MNHB 1PX8A 1XSJA 2RGSA 4W6XB 4HKJA 4I9WD 1TYEB 1FLRH 2EE0A 4X6DA 5AB1A 3RWIA 4FMFA 1WV7T 2DTML 3EZ8A 3N50A 4YDLB 3GUTB 3QUMB 4DPAX 3IBEA 2MNJB 1Q4NX 4LSSL 4NJ9H 3DO7A 1F4XH 1S7RA 1P1VA 2E7DA 2XN9D 5CP7B 5JIPA 1GS7A 4OLXH 1S9WB 2GAZA 1DQTA 1RZKC 4U4BA 3GMOB 2NOYA 4IYKA 4Z95H 3OHXC 3ZOAA 4D3CH 3N5AA 5TH2A 4XO4A 3V5DB 2G3MA 4P2OB 1JSYA 3DURB 1PKQA 5IVZA 1LILA 1JWSB 4G6AD 2QPEB 4AK2A 3WN5C 4ZNCD 4JFVA 1T03L 4KKLC 4L3CA 4GKZA 2VSCA 2L7EA 3E2HB 4ZAKC 2JJTA 4GSDL 3F58H 2E3VA 4AOFA 5JIDA 2K1MA 2APWA 3SYOA 4TQPA 2A9ML 4HJ0C 1N0LA 3P73B 3QJOA 1WZAA 1CLOL 4ZD3L 4YDKH 3GSUA 3T8VA 4DZ8A 1NC2A 5EZIL 1CO1A 4ODUA 2YEQA 1R3IH 4XN1A 4X6CA 5DZVA 2WSPA 2B5IC 3ALWA 2R8SH 1MY5A 4AJWA 3V0WL 1L0PA 4UB0H 5F7HA 1X4ZA 2A4ZA 4AEIH 4S2SB 4ZFQA 2HSIA 1DFXA 2VLLB 1JZ2A 4ICWA 4YSDA 3VFVB 4JQVA 4BFJA 2EIDA 4ZMNA 4JFZH 1NAKH 3HNVL 1TKWA 3CXHK 3QJQB 4TNEA 4JG1L 1D6EB 2YD0A 4JM2F 4PJ7E 1PMYA 3IFLL 4WJG3 2VDOH 1NINA 2DQJH 1AGBA 3AB0C 4EQ3A 1CPUA 2YMOA 4NQXB 3IVKA 4D9QD 3ZL4L 4DK5A 5DHYA 2H0PA 4LSQH 3TU6A 4DEWA 4AWJC 2HJLB 1CURA 1OVZA 2FYVA 2DB8A 2CDGA 2EDTA 4OF7A 4PS8A 4WFFE 3HZKB 5EU3A 3T0EE 4NENB 4KKCD 4XMPH 3BD3A 3DX8B 4XAKD 3U4BL 3ZDYF 3CFBA 4UT7H 4MMYB 4PP1D 5CJOL 1ZT4A 3GEWB 2D8KA 2BVOB 1ECZA 3C8HA 1T5KA 1JI2A 3IPFA 1FPTH 4KQ4L 5B1JC 4B9ZA 1GYUA 3CSGA 5A2IH 1QPKA 1ND0B 1MIEH 3JTSB 2VDQB 4UQEA 2NY0D 4XC3H 1RZPA 1EUTA 4P5TB 1AKJD 3MN8A 2MH4A 3NGBB 2BOCB 4R9HA 3O3EA 2Y7QB 4H88H 4YGVA 3T6VA 4DK3A 3MCKB 2B08A 2BW5A 4AQAB 4YXLL 1K85A 1G94A 5CCJA 1RJYB 2QEJA 1LL1A 4K15A 3E0GA 4Y4KD 2BOLA 5DURB 3UDWA 4EBQH 4PUBH 1LK2B 3O4LA 2QKIC 2B9AA 1WFNA 1J1PH 4LP4A 1Z2KA 2XYCA 3FTXA 4HFWA 2NYZA 1I9IL 4JDTH 5LHDA 4NBZB 2CUIA 5I1AB 2Q76B 1YEFH 4OZFA 3TPUA 2IG2H 2AAVA 2ZUSA 3CZJA 5KYYA 1A14H 1XIWC 4KPHH 1RK7A 5DZPA 4G8GD 2BHYA 4YSEA 4LIQH 3NCJL 4OGYL 3UTPD 3C09C 1HIMH 2JCCB 3WENA 1T4KA 3GKWH 5EA0H 3KEDA 4PJFE 3UBHA 1MAML 1NDGB 4UIKH 3BVNA 3TT1L 3KWVA 5ID0A 1O5DT 4AYFA 4XPFL 2J20A 1WFOA 3ZE0B 5E2WL 1S5IL 2XTJD 4X4KA 1B3IA 3LRGA 3HTLX 3VFTB 3TA3A 5M7QA 4RZCA 1BF8A 3US0A 4YE0A 3G7TA 2VUYA 4O02L 3PWNB 3K4ZA 1LWJA 4L1DA 2GUOA 4Q0XH 3BP5B 5ILTL 5AW1B 1KF9B 3K72B 3K80A 4ONGL 3MMEA 1BAFH 3RFZA 3DX7B 4GRWB 2YK1H 3M1OA 1XD1A 4DFIA 1TR7A 2VISB 2B77A 1YECL 3P0VH 2VMFA 2XZAL 1S8DA 5D1XA 5FECA 5ICYA 1SOSA 5JHLA 1XTLA 4UT6H 3VXSE 3WJLC 1NFIA 2FJGA 2FHCA 3ECVA 1KDJA 4WU5A 3DMMA 1LK3H 3HBZA 3O6KL 1E9QA 2CXKA 5J6HA 4R90L 3QUML 3QNXA 2D0FA 3VWKD 4RIRB 3OSVA 3PHOB 1PL3A 1A4BA 1HQ4B 1SXNA 1E27A 2CM5A 1ORSB 1NCJA 3NFNA 4FYSA 4Y4HB 4V1DB 3CAFA 2OZ4L 1BZQK 3LKSA 2DDQH 4C56A 3QPXH 5DMKB 3DX9B 4B9PA 4LASL 4R5VA 2HCZX 1I3RA 2EVHA 5ECGA 1U2YA 5CSBA 2P47B 2DWXA 5AVYB 4CDGC 3WFCH 2AGJH 1MPAL 2W07A 4OIIL 3EZJB 2FL5A 3JZYA 1ZANL 1QO3A 3K3QA 5DQJB 1MUJA 5FGRA 3WJJA 5DMJB 5I2IB 3KLAB 5C0JA 3R7QA 4BWUA 2QHRH 4EIUA 1BEXA 2CUHA 2IWFA 4BV1A 4P4RA 4Y5XB 2WLIA 1FNEB 3LKQA 4Y16B 5E99H 2GJRA 5F1NA 3HUJA 2KLTA 1AR2A 2BIPA 2F58H 4FFYH 4H26B 4X6CF 5FEBA 5SWQB 3QXWA 1UB5A 3FCTA 3GTVA 1R3KB 3Q9PA 4I77H 2X12A 1J86A 1CS6A 1FH2A 3ATBA 3PHQA 5JZ7C 2WTRA 1QFHA 2C7UB 4MTMA 2ARJB 2MCMA 1MFBL 2VITA 2Z8WC 5DRWB 1RFDH 5HI3C 1T1YA 4LQFL 4PJAA 4XN7A 1Z9SB 2IOIA 1S7WB 5DSCA 3LEXB 5HJGA 1KLGB 2M83A 1B6UA 1MREL 5DQDL 2CRMA 1CXHA 1MJUH 2YJLA 4ZUWA 1S7VB 4HLZH 1RZKH 3GSQB 4BFIA 2HT4D 3AXIA 1RMFL 3EFFB 4Y2OA 4EIGB 2V7HA 3MV7B 1J05B 5KYUA 4P9HL 4Z7WB 1UA6H 4O9HH 2W9LA 1ODUA 1XB3A 1U21A 1G5GA 4H44C 2FJSA 4M6AA 4WNJA 3OKNA 4MHHI 5JA8B 3I85A 5F6HI 4F3FB 3EDEA 4Z1PA 3ZLQC 4BJLA 1GZHA 3VFSB 4LGSB 3KYOB 4PREA 4F92B 4M4PA 3D4CA 4JFDA 1PY9A 5I1DB 3QXTA 4N1CA 2AVFA 5BQDA 2VDQL 1UOWA 1RI8A 1EK3A 4X6FA 4ANKA 4YQXL 1OP3K 2YKLL 3TM6A 2A0LC 4HWNA 3VQ1C 3C5SB 3ARYA 5FX3A 1B4JL 1K3ZA 4RWYL 5IQOA 1MXDA 5I5JA 4PJHE 1MVUA 3IT8D 5C09E 1BQLL 2ENYA 4P5TD 1UWXK 3HG4A 4IRZA 5JO5B 1MFEL 1WBYB 2AQPA 2WUCL 4BDVA 4DIXA 3U79A 3QNYA 1T7XA 4ERSH 1DO6A 3BHBA 2OW7A 5DHVH 1H5BC 3QORC 5GGRA 1CF8H 4LP8A 4E9WA 3QR0A 4PCYA 1H0DB 4NZJA 3QIWC 2OSLA 4OQTH 1XEUA 1UJ3A 4OCWH 3U6RA 1SN2A 1P5UC 1OD9A 2JI3A 2PCYA 3BFWA 4NNXA 3VA2C 4DTGL 3QUZB 2GJZB 1BYNA 1HXKA 3UJTL 4DOHB 2V5YA 5T5FH 2FRGP 4DEPB 3VE0A 4DKFH 1IBGL 1A3RL 1EO5A 1M7DA 4BZ2A 3SKNB 3N91A 1X5XA 1SGKA 5E6IB 1N6UA 5I26A 3DJ9A 4PLKD 1UWEH 3KPLB 1ACCA 1DBBL 3MRCA 4U33A 1GXEA 2VDKH 1A7BA 5C0AE 5HGBB 1EGJH 3D6GA 3DROB 1D9KD 1DVFA 4EVNB 1NC4B 1UXLA 1JGEA 4Z8FH 2D9QB 4G9FA 1RIVL 4N87A 5DWPA 3PYCA 3MJWA 1JUFA 2XKNB 1KNOA 1GW0A 1LP9E 1QQDB 2YXMA 3K4AA 2KZ1B 4OJYA 4WRLA 1QW8A 2QELA 4KXZH 2EYTB 4RGMB 2JELH 2XWDA 4Y4FA 2CBMA 4JB9H 5IBUG 1CD8A 2IGFL 3RGVD 5IQ7L 2N1KA 2JE8A 1G7PB 4LEXH 3GDCA 2X1QA 2I5YH 3MJ8B 3GMPB 5GSVA 4A67A 5JQ6H 5A2CA 2XSKA 3OF6D 5FAAA 1DR9A 1ETB1 3RX8A 4Z7NE 3FQYA 5I1KL 2AV7A 2Y2TA 3IMWA 3Q01A 4UM8A 4LRNL 1MDTA 5FO8B 2HJKA 3A67L 4NN5C 1GGIL 2WOYA 1RQ5A 1AYRA 3MKGA 3LZFL 4G5AA 4NWTH 1LO0L 4MZ3A 5GGVL 5C0DB 5I8OH 3KPSB 1F02I 3EOYG 4KY2A 1A1OA 5CGTA 2GTWB 4MNGA 3ARDB 3VXMB 2VE6A 2H6UA 5IQNA 2GJJA 4HC1H 2F9BT 1INQB 3KGSA 4JJ5A 4E9TA 3E6FB 1RZGA 3WKMH 3L3HB 4Y9FA 1L5GA 3P30H 4UNUA 2EDBA 3WEXB 3X3GH 4K94C 3ABGA 3FUDA 5GRVL 4HIHA 1BSIA 3MJGX 4B9GA 4QF1A 3QG6B 4G59C 4XNUH 3GSWA 5DGRA 1UXWB 4Y5YA 1JNHA 2X3CA 3B5HA 4AQOA 4GG6E 1E6OH 2IADB 4UDTB 5B1AB 3RWEA 3US1A 4GY4A 1KJ3H 4XX5A 2IDQA 5DJZB 1DQLL 2QJDA 2YWZA 5AZEL 4QWWD 3EOAB 4NM8L 4LAQL 5CBEB 3BP4B 3UYRL 3ZL1A 4F8QA 4EZKA 3IXAB 1UH3A 3L4VA 4M1DL 3TBYA 1ZV2A 5HDQL 1KJ2A 1WJ3A 1F41A 1NCOA 4UI2A 5EO0B 3HB3B 4Y16D 3RY6A 1JNLH 3SCMC 4IDJL 1A9VA 5IJVA 4HOXA 2ZOLB 4NXKA 2CIKA 4K3DL 4PJAF 3NJKA 3QH3B 2DQGH 1JPTL 1JE6A 5I23A 2N3JA 3CVHA 4OH2A 2PWDA 4ZMXA 4HIIB 2G3NA 1OB1B 3L4WA 3MRDA 4LSTL 4UWQB 1I8KB 4J8RB 1UEYA 4WI0B 3VXRE 2BZCA 2ICWB 2QV2A 5BZWA 3TTYA 4HBQA 2P5PA 4DETA 2ALWA 4WTWA 2Z3FA 1GOGA 1G7JA 1UFUA 3N42B 5FPIA 2BVUA 2X38A 3HN5A 4NQVA 4I5BA 1CD0A 2FO1A 3MV7D 2GYSA 1Q9KA 3CHSA 4KDVA 4M62H 4AEEA 4U1SA 5IVXB 3J2PA 4TUOB 2E7MA 1MXGA 2OR9L 3NIGF 1GGBH 2NNAB 3H56A 1YDPA 3S5ZA 4Y88A 3RVUC 3UTSA 1HL5A 1ZSDA 4RNRB 4POYA 5EN3A 4OCXL 4E41A 4MNQE 2EKSA 4X7CC 4YHPA 1MW3A 4ONFH 3FHEA 4BZYA 4EUPH 4KAQL 2DYPB 4L2LA 5ADPH 2XA8L 5F7BA 1I1AC 1WT5C 1TJIH 3BUQA 3LKPB 2NY5C 4MVBC 1RHFA 5D9SB 5TE7H 3U1SH 1FO0B 3NP4A 1CGXA 3MRPB 2ADGA 1OHZA 5TDNB 3GIZL 2C3GA 4X4YA 3MRLB 4QUOA 4IGBC 4HUXA 2PTTB 1JVKA 3ZL2A 4AM0A 4BEIA 1X9LA 3BAWA 1P9MA 4A38A 1WCBB 2HN7B 4G1EB 2DZEA 2C26A 2ENQA 2CLZA 3GS7A 1XB6A 4GBXC 3WMPA 1A2YB 1IC5H 2WXOA 3OR7A 4JMXA 3WHXB 4TL4A 1KIRB 3MBXH 3AABA 4YDNA 3VXUE 1RURH 1CC3A 4HUVA 3MRMB 4N0YL 5TF0A 5H37G 2Y1YA 4WI7A 3AU1A 1QR1B 2VH5H 2EVJA 1ASQA 4YDIL 4FZEL 3CLFL 4LCWB 3TYGL 1PDKB 1OTSD 3RWGA 4L5FH 2R15A 2AV1A 5D2LE 1LEIA 1F0LA 1OSZA 5I74C 1J9QA 3BESR 3EADA 3TVMB 1WITA 3MGAA 4CMHC 1CLYL 2WZPA 5EU4B 2HFGL 1LO3H 2Z65C 4LLQB 3L5IA 3GBDA 3MLRL 4OLYL 1YMMA 5ACZB 2WO2B 4Z76A 2UWEB 3MLTB 4OAWA 5GZNC 1T6WA 1MFCH 4JZJA 4XBEH 3GNMH 4J4PC 4M61B 1FYTE 1R46A 1U95B 4WHTB 5A6IA 1OOAA 2OYPA 4FKEA 2BOBA 4NYLA 5SWZD 3QQ4A 4DZBA 4HD9A 1JN6A 5FCSH 5KS9E 3GJEB 3QT2A 5E1HB 5CGYD 2FJFA 3MNZB 1DVQA 3MRJA 5L0QC 1FHGA 4C8XA 1AI1L 4XNZB 4NX0A 4W4OA 1EHLL 1NC4D 1GY2A 4G8EB 3SGJC 1KLUA 3NH7L 5EO9A 3CSFA 4HOZA 2EADA 2WANA 5HDBE 1HL9A 3HAEH 5IEHB 1ZVNA 2RALA 3WLWD 1BLIA 4AC4A 4M5ZH 2W5PA 2Y2YA 3OAUH 2G9HB 3MYJB 3RB5A 3U0TA 3K7UA 5K33A 4HZLA 4PAZA 1MCKA 1F1AA 3O6LL 3QVAA 3FNKA 4S1DD 1FNSH 5FKAB 1TETL 3A5VA 5C8JA 3SDXA 3C8KA 4MMXB 1KENH 3RVXD 4AT6A 3ETBF 3G6DL 4UV4L 1CTOA 4XPBH 3RY5A 4DF9A 4JKPL 1V7MH 4M3HA 3BSGA 1E8WA 3QDMA 3KPSD 3VH8G 4I0PB 4I48A 5LGHL 5GS2H 3VXMD 2KZWA 3D2TA 3L17A 1JCKA 1KC5H 3WELA 1YG9A 4HXAH 3QFDB 3KM2A 1NKOA 1CT8B 1JV5B 1ZV9A 2FO4B 3G08B 2G0KA 4FQ1H 4R26L 2BHFA 3ECBA 3O81A 2XQ0A 4MDIB 5CJ5A 1T22B 1HCFX 2EUZA 4ALAC 2DWSA 2OCJA 3VFUB 4E9QA 3FCSA 5DMYA 3V52L 1T1ZA 5IROD 5F3HA 3G9AB 3BAEL 2KDGA 2M26A 1MHEB 4YLBA 1FF5A 4PB9H 2BSED 2OCCB 2WB1A 3HC3L 3U4EA 4AYDC 4IRSC 3SE6A 4WK2B 3VH8B 5D72H 4FFZL 2EINB 4G8IA 4O4YH 1AO7B 4FP8H 5GSRA 3HB3D 1OXYA 4A7VA 1D5MA 3OWRA 3V4VB 2CMRH 2NDFA 5CFAA 5DUJA 4UINH 4YHIA 1UXMA 3FFDB 3QXDA 1CQYA 1A6TB 1NL0H 3BSZH 4RBPH 3RWDB 5MP6L 4H0HB 4WNQA 1J87A 2YAMA 3FTUA 4JN2B 1W15A 1CCZA 5KUMA 4K94H 3FAXA 1CN4A 2GSGA 2XETA 3UG4A 2XKUA 2VR9A 1NGWA 4LBAA 5IHZA 5J57B 1MI5E 4P3DA 3RWCA 3NSDA 3PJSA 4HISA 4NO3A 2IV9A 2HFFA 4QIRA 4KVNL 4BSJA 5HPOA 1T6VN 4JN1L 3ZU8A 4QDGA 2ZT9C 1VZIA 4PV8A 2XWTA 3B8YA 3PP3H 2F8IA 2W91A 3FTGB 3JV5A 4U6VH 4WFED 4Y19D 1ZHBA 3KPRE 2Q8AL 2N7SA 4HETA 4PRIE 5D71L 2EIEA 3SQOL 2FUTA 5F72S 4ZFFB 3GT6A 3V6OE 1JMXA 1X9QA 2B1AL 3TH2T 1FO0L 2ZPKL 4QRQA 1ZHNA 5D55A 4NC2B 3NIFF 1C7TA 1HWWA 4OZIA 4PJXE 4ORGA 2H2PC 1HWHB 4LEEA 1Z0NA 1O75A 1IAKB 1QSFE 1T1WA 2OSXA 1QI3A 2BRQA 4MZ2A 5CUSL 2QQLH 1I31A 2CRZA 2XPGA 5LCVL 2O6DA 3RVTD 3BPLB 4L1SA 1ZE3H 3NCXA 4KUZL 2VSMB 1NBVH 1F4YH 2JFCA 1GYCA 1OSPH 3FT2B 2PP9A 1NOLA 4XH2B 5LAXA 2PR4H 5AD0B 3TASA 5E6RB 3MCLL 4U1HB 1GA2A 4WVRA 2AXJA 4M3JA 5LBVA 5EEWA 3MRHA 2YA1A 4S10A 2WYTA 3K2KA 3CFUA 4QLWA 1UURA 5E8PA 3BKML 3HRZA 6FABH 4AJVA 1LO5A 4LCWD 2MRYA 5FFOA 4HKBA 3TC9A 4ELMA 3HHSA 3HG0A 2E59A 2F19L 3UTQA 5T3ZL 3B9AA 5SWSA 2CUMA 5EEUA 1CBVH 2IAMA 1GGTA 1VCAA 2ARJQ 4QXTA 3DRTA 2P44B 1FL3A 2NY5H 2ENSA 1YVLA 5C3IA 2JI2A 4NZUL 4LBEB 5T3ZD 3B7RL 5IMKA 2PXYC 4ZO7A 4N2BA 3IU3A 4X2UA 3FU0A 1M9WA 1ILSA 5I17A 4C57C 3BWUF 3GI9L 1YEJH 1ASOA 2DIBA 1TTBA 5DQ9B 2Q3AA 3LHAA 4XBPA 3U9PH 2R23A 1SHMA 3B2UC 1UFGA 4IHOB 4LOFA 4IEFB 1BX2B 4Z7UB 1ZPLA 4TXVB 1CG9B 5J12B 1ZJBA 2Y06L 3V9EA 4YHYC 3K8KA 4YAQB 3RBSA 5IHUH 5D7IF 3ZHDA 1SJVA 4AITA 1NEZG 5CO1A 5MERA 4KK6D 1UT2A 2WN3A 3DK0A 3QJUB 4TQIA 4ZUUA 2E46A 3CC5A 1U30A 4Q6IC 2GCYB 3MCYA 3AG3B 4ZOCA 1N0XL 1SBBA 2XKSA 3ARVA 5E95B 3S5YA 3SDXF 2DWDA 1FG2A 1EFQA 3VI4E 3HC4L 4PJ9C 4Q97A 1RLBA 1P69B 3FT4B 1UH2A 4N0CC 4WV1B 3BDBA 1XGUB 2ICCA 3D07A 4H1LH 2X4QB 3RILA 5G4MA 5GRJL 2Q86A 5FM4A 3WLBA 2EO1A 5D5MB 1WZLA 1UACH 5C07E 4I0PD 1FZJA 5EBLB 35C8L 5ERWB 1Z0MA 3UAEA 5GHWL 2Z93B 4A7UA 3L3DB 1NEZB 1NDTA 1ZA3B 1CDUA 4FQCL 5GS3A 2CA4A 4BKSC 4ODSH 5JPNC 2Q20A 1JZDC 1SJEB 5GPRA 3ATDA 4HT1H 4BRVA 5FYKU 1UZ8A 1WSST 5A16B 1ZLVK 4HCRA 5DWUH 2IWGA 4UTCA 5DFTA 3PABA 3IMVA 2HKHH 3LQAL 4KRMB 1NIEA 5IHBA 1IC0A 3S7GA 4E0RB 2BVYA 1B4LA 4XNYH 1F4WH 4UF7C 3ULVF 4IKIA 2IBZX 4IBZA 3DOSA 4APXB 1B0RB 1WC7A 4M48H 5K1JA 1J5OH 1DJGA 1Z1WA 3JWNE 5CBAB 3CSBA 4HEMA 3V4VL 3SPVB 5HGDB 5DJYB 1QUPA 2FWOA 2QDVA 4L4VE 1O6SB 4ELKA 4X0KB 1PPIA 4WWOA 4AJYV 3FUKA 1U8NA 5DS8A 1AO7D 3HE6C 3MRKA 3HVNA 4FDWA 4ZSOB 3MI6A 3U7YH 5IB3A 2DF3A 4GMSL 1FZKA 3B8SA 1AQDB 4Y2DA 4PRDA 3RI5K 2K4WA 4G43B 3UO1L 4Z6AT 4P59H 4FQHB 5D7LA 5GRZA 5C0CE 4OD1L 3DIVA 4FNPA 3ZTJG 2B2XL 1DVUA 4NO5B 5CJXA 3MJ6A 5EFIA 3MRIA 1P53A 4M43L 4PJ8B 3CD4A 1YZZA 4LLUA 1AQ8A 3EO0A 1J8SA 3D18B 1FN4B 3DX0A 3LZOA 4I2XB 1C1EH 3H1ZA 4NZTH 4QMEA 5E8OB 1I9RL 4ALAH 5KANI 1LE5B 1XR9A 3LZNA 2QVTA 2VRKA 3POCA 3SDCC 1FGVH 4FYQA 4V2BA 4GINA 2V5SA 3OTTA 4HH9A 4QHLA 2EUXA 4OZIF 4AYGA 1UTDA 4XPTL 1T5WA 3C6SA 4UQ3B 1M7IA 4XNXL 1BZ9B 1KV3A 1T3FA 1JI1A 3B2MA 5I1EH 4JG0L 2XZQH 1TZIA 2AS5M 6PCYA 5I1CL 1AHWC 3MACH 4NUGH 4W9GC 4FULA 3VGHA 1T7ZA 4D8PA 5L4IA 2QT6A 2YPVL 3BPNC 3S5LB 3BZEA 4E9SA 1C5BH 4FQXD 2D7PA 3APDA 4YN3A 3BQUA 4JAMB 3WJMA 4AQEA 3TP4A 5EOCH 5CD5C 3FRPG 1BBJB 1QLRA 2CE6A 3WNNA 1X5KA 2VWEE 1HL4A 2CHXA 3VG9B 3LZQA 3WO3B 4KITB 2QFRA 4M93C 1EWHA 2QQQA 2YAFA 4X5LA 4XNAA 1VGEH 2FLRT 3BWZA 1C5DA 3NEXA 4X5XB 3WEAA 2Q7YA 1DBML 1XDTT 4ELMF 5D2NA 1D5ZA 1HHIA 3CV5A 3P0GB 2EH7H 1YNLH 3BAXA 1P2CA 3GJFK 3DI2B 5GXBB 2AFNA 3WS6C 3WU1A 4OLUH 2V2WA 5F0MB 5EOTB 4OZ4A 4W9KC 3V8OA 1GMIA 5ESVA 3AGVA 1W8NA 3CDGA 2RQEA 3W39A 3OGCB 2BP0B 4UYPA 1B9ZA 3FH8A 5JUEL 4ZXBB 4JM2C 5AW8B 1VLXA 3EGXA 2I60H 1AIFA 2O61B 1JD7A 1IT9H 4U1IA 2FX7L 2BY0A 4MNGE 4OZHA 3FRPB 4OM1H 2FLMA 1J5IA 1OAXL 3TT3L 1TNNA 4WW1B 2UZIH 1Q9OB 4R8WH 5DFWH 5DK0B 3IS0X 2QADB 4K3GA 5CEXB 3L5WA 1U0QA 3MJ7A 4YSPA 5E94B 5BXFA 4M6OH 1DUZB 3Q5TA 5IT2H 1ZS2A 2L4OA 3PDOA 4M6MH 2A1WH 3BRDA 2VM9A 5IBLC 4YSTA 4B0MB 4P23C 3TJEL 2J8UB 3DETC 4G6JH 4MAYB 4EDWL 4GS7C 4LVNB 3EGDB 4OLWH 3MXVL 5AB9A 2WD0A 1PLGL 3IDNA 1Y1UA 3WBDA 2NY3C 1FH5L 2WIIA 2WLKA 2OJEB 2FWUA 2OP4L 1U6AL 4G83A 3SE4A 2RACA 5DZJA 1VADB 3ZDXF 3E80A 3V5KA 4N2OA 2J5LB 1J1XL 1XCWA 3L08A 3EYVA 4M1GH 5I6XB 4AKPA 4NN6B 4R96A 4KDTA 4IOFC 3SQBA 4FNLL 3TJHC 3GD1C 4P07A 1N3NB 4YSSA 1A6ZA 3VTMA 4MRCA 1RULH 1RK1B 3QNZA 3KYKH 2BMKB 4IBUA 3LH9A 1E8XA 5K9JL 3DVGB 3PXHA 3DTDA 1TSRA 1SEQL 3OLDA 3WTYA 1DVYA 4FXGA 4KKAC 3SO3C 5TE6H 3JV4B 3M88A 4HS6B 5ALCL 4GQRA 3PF2A 2P80A 4TKWA 5HSFA 4GW5B 1C5CH 1J10A 3ARFB 3DA0A 1NSNH 4XHJC 3O8XA 4AE1A 4JDEB 2VXTH 4NZRH 1DN0B 1QTSA 2EC8A 2DOCA 2HKFH 3LPPA 4NCC1 3U7WL 1AXSA 1IFHH 5BVPL 3PCYA 1QPPA 5T1KA 1JNNH 1NAMH 4UOW1 5E4EB 3GJFA 3O6FD 2XN9A 2ZUWA 3JTTB 2O5XL 4PV9B 2ATKB 4QCIA 1OSEA 3NBNA 5LBGA 5AG8A 3MNMA 5K39A 3KBHE 3ARRA 1N2RB 1F3RB 2DLGA 2VR8A 2GBUA 5J8OA 1R5WB 3HE7C 1WZMA 3FHAA 3G5YA 4AQ1C 1X5ZA 3TO2B 4HS3A 5JW5A 1JTOA 4F27A 1SXSA 1XBDA 1DDHA 5DJ6B 1I82A 3SB3A 2XG4A 1UB6B 5BQ7B 2HLEB 2XFGB 4BSVB 1GYVA 3BH8B 5C0IA 5KVDH 1BG1A 4PWKA 1FAKT 1R3LA 4QRPA 2VXQH 1N5AA 5CHNA 3LS5L 5CEZL 3MUHL 1MHHB 2EO7A 3D4ZA 3T1FB 4QOKD 1BBDL 2FTAA 4M7LT 2GEEA 4F7KA 5IHWA 2DLFL 2BY2A 4I3SH 1UVQA 1RZ7H 3CFDB 4F37F 5CZXD 2Z0UA 4WJ5A 2J73A 5HVWA 3HR6A 3STBA 1D2PA 1MG2C 4AEHL 5FGSA 3U36A 4KV5E 4KI5F 1KB5B 1YMME 3DSNB 1PEWA 4RGOH 2CJUH 1PZDA 4JPWH 5HJ3B 3AADB 2CLVB 2JJTC 1NFAA 2H8PA 3E2HC 1MLBA 1H6FA 1NFDB 1ACYL 5IK3B 3WUWG 1NCIA 4LZKA 4QHNB 3TCLB 3CHXA 1E6JH 5T1MB 3PE9A 2J44A 3NJVA 5H4YA 2FIKB 3UG3A 3T8XB 1FVEA 2BJMH 5KTEH 4ZW3A 3ULUF 5F70A 2WINA 5CLYA 2FIRT 3BUYA 4ETYA 3ZT7A 2F8OA 2WYZA 2NTFA 2X6AA 4HXBH 2HVJB 4ODBD 2EE2A 2RCSH 5EIQA 1QLFB 1QZ1A 1SEBA 4JQVC 1SM3H 4ZQKA 3UTZB 1QATA 3L9RB 1BIIA 2IPTH 2DTMH 3JTBA 4C83A 2XRAH 5I0YA 1JZ5A 4GRMA 2Q8BH 3QS2A 5FK9A 1U93A 4L0ZA 4LSSH 4DUXA 5FGCB 4PRBA 1RZJL 4H2AA 5GRUL 3I75B 1KY6A 4OZHF 3CSYA 4GT0A 3WUWB 2AMGA 1WP6A 2JQMA 5I1HH 3UTTD 4ZXBD 2YRLA 1P4BL 5FYLL 4JZNA 1GVIA 3QDME 3QRGL 2E76C 4X98B 2CNZA 2R2EA 3QEQB 4Y4KA 4UUJA 2PO6A 1YEKL 1EAJA 4IW4C 4PVNA 1KGWA 1OP4A 1YEHL 3RI5F 3CBRA 2VQ1A 1BPLB 1J9CT 2QADD 3B43A 4ATTA 3PL6A 1BD2B 5FYLD 3VX0A 5LXGH 3LPWA 3D48R 3UBXA 5INDB 2Z35A 2ZCLH 1DQJA 4RDQF 2IALA 1KBGH 2J8OA 3F7LA 3N40F 4U7SA 4MAYD 1LEKB 3MRQA 1IILE 4JS7A 1EHNA 3NGBC 5AW5B 4Y89A 3U9WA 5GJSL 4ZW6A 3KLQA 5DK2B 5DO2C 4BKLA 3QG7L 4X4XA 2TRYA 3QW9A 4RGNC 2Z4TA 4JLRA 3UDWC 4Z77B 1YQVH 5E2TL 3Q8EA 5DJ0A 4EAEA 1HYSD 5E1AB 4PS7A 3JWDL 3LVEA 3UROR 1XF3A 2R69H 4CAGA 3T1WA 3DBXB 2K7PA 2SEBB 1AHMA 5DVKA 1MCEA 4YSAA 1UATA 3SBRA 2PYEB 3CFKA 3QDGB 1EJOL 4W9EC 4Q9CA 4EO5A 4HMDA 4YHLL 1NCTA 1CFSA 1WK0A 2V17H 5F88A 2XWBB 1E8ZA 5KJRL 1SHSA 1YUHA 4IBSA 5IQ9A 5K93A 4UTAA 5E24E 4HMCA 3NCFB 3WS3B 2BWDA 1KJMA 3IDYB 3VQ2C 4FQLH 3UPRB 1KXQA 1NM9A 3QWRD 1L9NA 4KKRA 1MFDL 3P2TA 3BAYA 4RMBA 1TJHL 4NLHA 4ZMPA 3FO0H 1WWBX 2C9PA 1JHTA 2DQHL 2VZ1A 3AT0A 1M71B 3ARFD 1FP5A 4HQQH 4YHML 2BNRE 4KXZI 3TA3C 3VWKA 4YPGA 4IMKA 4F8LA 3VRJA 3H54A 4JHWL 5IR1A 2W0FA 5BVJA 3NJXA 2E7BA 3GK8L 2TRHA 1FQ9C 2AQQA 4YDJB 2H32H 2FQEA 3E7JA 5C0RL 2WYIA 2PPFA 3KPNB 3UADA 3RFZC 4YHKL 5MHSD 4KTEH 1FRGH 1E9PA 1MEXL 2AKRA 3ZTNH 4AH2B 1UM4H 4HUUB 4LOEA 5KAQG 1UM5L 2EC9T 3JUZA 4PJ5E 5L2KB 1UCBL 2ZCHH 4MXVF 1LE9B 5GRYA 2P5WB 3HS9A 3OG4B 3TA4D 4NQEE 1F6AB 3MBED 2F2HA 3BKJH 1SLXA 2EYRA 3WL9A 3GEFA 3FO1B 4GAYA 2PABA 2P7TA 1KSRA 1IQDA 2FJHA 2VO5A 2EECA 3NDZE 4A68A 2D7TH 1PZAA 1TQSA 1XR8B 3IGAA 2NZ1A 5SX5K 3W57A 2DI9A 2ZQKA 5L4MA 2O6EA 1XZ0B 1QACA 2JTYA 3U0PA 2QPUA 5BS0B 2HG5B 2HPOA 3QQ9D 4JRXA 5I6LA 5I18L 1NCBH 1NGXB 4WI5A 2BC4B 3TT1H 4B5EA 4OI9A 3VXPA 1KB5L 4M03A 5AB2A 2I24N 5ACMA 1LEGB 1F13A 3BAJA 1U92B 4A2HA 4P2RB 3GF8A 4JFYA 4YC2B 4CC4A 3ROOA 1MCPL 1E7VA 1XZWA 3B9EA 4CVWA 1U4EA 1R17A 4YHNA 2W59A 5FF6A 1N5YH 2P8MA 3S48A 2OTWB 4TUKL 4XPAH 2WLYA 5LVEA 3KAAA 1E67A 3QHFH 2ZP8A 2CZNA 3L1GA 5DZAA 1I4FB 3I6GB 4HIXL 1M2OA 1FBIH 2B4CL 4Q9QL 2V3FA 1N4XH 1NUNB 5FM8A 1I7ZA 1L6XA 3CMOL 3P11H 2BNQA 4N0UE 3QFJE 1KGIA 1IC4L 2Y6SD 3K2IA 4MD4A 5MEPB 2FEEI 3VI3B 4GUQA 4PJCE 4TVPH 1A6VH 4JM4H 3LKNB 1DHKA 3ZZQA 4WTXA 1QEWB 3VDAA 1DFBL 4X5QA 1HESA 1S3RA 2X7LA 3SE3A 4IQHA 2UY7A 3VSTA 2NY1B 4Z5RB 3MVSA 1ZHLA 4J3XA 2GTZA 1OT4A 4GP4B 1DSYA 4BCXA 2N4IA 1WZ1H 3AXHA 2AJSL 2BFVL 3EYOB 1KG0A 2ZG1A 4KK8C 1IGTA 3SKOB 3KR3H 2EABA 4KHXH 1I1YB 4OIIH 4QPEA 4U6YA 3BN9C 3GMNA 3TONA 1IQWL 4FXTA 4XVUC 4NPKA 3CLEL 4P3CH 3C5XA 1CXIA 2D03L 2VDNH 3QAZC 4H2CA 2NX5D 3RGHA 4XXWA 5ICZA 1MFAH 3QBTB 4J27A 1G9MC 4MJJA 3FC8A 3KWTA 5FUOL 1FIGH 1HINH 2AI0H 3D87B 2G75B 3OKMA 4LLVB 1GOHA 4W9DC 2Q6WB 5FIEA 3FPXA 3GSVA 1J7VR 4KGLA 3M86A 1CGVA 4U6XA 1HSAA 1PLBA 2JIXB 4UOJA 1CGSH 3KEHA 3W11C 1K8IA 2F74A 3CN2A 4F33B 3N55A 4XVSL 5CCHE 3MODL 1IGCH 1Q9LB 3LV3A 1KYUA 4LQFH 4K5NA 4OD3H 3THMH 5ISZD 3MV9A 1UM6H 1OOWA 4A6YA 1D9KA 2WTOA 4XPGH 1LO2L 1SJMA 4KJYA 3S4SA 5DUBB 4F2ME 4IIQB 4EI6B 1UJ3C 2VLRE 5I30H 1N19A 3PQYD 1W9XA 4XO3A 5C0GB 1OD7A 1EDHA 4HG4K 4MD5A 2PNDA 5DYFA 1EVUA 3BXNB 3G5XA 4Z0XA 1PYWB 4HIJB 3RGVA 5TDOB 2OMYA 2AJXL 4DEPC 2ZWZA 3LEYH 3H7BB 1IM9B 3MOAL 5T8IA 5EIVA 3RVVC 1QRKA 2FX8H 3ABZA 3RNKA 1DVFC 1WAEA 1X4YA 5F71A 2RFXA 7FABH 1AZUA 2YKLH 1JPSL 4BHUI 3SJVE 4ZS6C 1F2QA 2EDJA 2IGTA 4JQIA 3K6DA 4GAAA 2W0PA 2WV3A 2AK1L 2OX5A 4Y4FC 2GJ6A 4Q52A 1BVNP 1BIHA 3HW7A 3MFGB 1BOYA 3H0TB 4MB3A 4KO9A 3GZKA 1UOVA 4OFIA 1EAPB 3BJLA 1IJNA 3QEHB 4PMFA 5JHDA 5EUOE 2DS4A 3GS4A 1GCFA 4HKZA 1JXJA 1TMQA 1CYXA 4XGZB 2V9UA 5CR8A 3RJDA 4JJHA 4PJGF 1DJIA 4GI9A 1CD1B 1UA7A 4OZFH 5DJ8A 5HGHA 3S36H 4KH2A 4KJWD 3PWJA 1Z3RA 5B3JE 3GGWB 1OTUD 5L2KD 4ZMQA 3F12A 3H3PH 3MRRA 4F8NA 4X7SL 3ARDC 4N28A 4ATWA 1FSKC 5C9JA 2CK0H 2DQDL 2WXFA 2I9LB 1RUAH 5KVFH 4Y16A 2FT7A 4S1RH 3GRWA 2HT3C 1I3VA 2EIMB 2WP3T 3VCLB 32C2A 4Y5YC 1CFMA 1ACXA 3HKZA 5KAQF 3RRQA 5BS0D 3CXHJ 5IM7A 4ZUTB 2H47C 4F57H 4XCYA 5CCKL 4LKCB 4HS8L 3I9AA 4LCCB 1TZ8A 2QQNL 3WY3A 3GBNH 5BZXA 2JI1A 1HCYA 4JRYE 3E9TA 4OCLC 2AK4E 4YIQA 4P5SA 3CFJB 3QB7C 5FO9B 4KVCH 1W2KT 3UBFA 1A4AA 2A77H 2XNAA 4OD2A 4TNWK 1WD8A 3BDYH 3RY6C 3OKDB 5JHLH 3MV7A 1UXSB 2R0ZH 5CJBA 3DUUA 3CFMA 1YNKL 3QJXA 4XO9A 1NPNA 4ZMYA 4UTBL 2EUWA 1FFNA 4C54A 1MCOL 4PMEA 2VAAB 4LK4A 3GMMB 5E03A 1S5HB 5DGQA 4XI5C 4FAAB 1N59A 1ZHKB 1CZ8H 4WFGD 2A6JA 3OLEA 5DD0H 4XCNA 1LQBC 1OCWL 4TULH 5JW4R 3BE1L 2R51A 3KYOA 2WWNA 3QJHA 2H6PA 4PLNC 5HPMA 3ZE1F 2YO3A 1XF4A 1KUMA 2NY1D 1JBJA 5C7XH 4ICXA 1DJSA 2KUTA 1KJVA 4LEBA 1BAWA 5D6CA 1KTLB 2H9GA 3WKQA 1J8HE 2ID5A 4KTGA 1R5IA 4LESA 3FKUS 4QGYA 1EEYA 2YPLA 5DD1L 2YLKA 3W56A 4U6HB 4WGKA 3Q2NA 4K9JA 5AOLA 2WBJB 3X13B 3IMBA 2JLPA 5JPMA 3GZOA 5FS5A 3SKMA 5HI5C 3GM8A 5DJXA 1L7IH 5C08E 1BQ5A 5FHBH 3AG2B 2ZNWA 3H9ZA 1KN4L 2CO1A 4I1NB 4APQD 1J0ZA 2B0SL 4D7BA 4QWWC 3M1CA 5KG9B 4TUJA 4BH7B 1GSKA 1GPOL 1P9MC 4MA1B 4BE6A 3MOBH 5J9PB 3KL0A 1YPZE 1I7UB 5I75C 4YZWA 3GBLA 4XMLH 3UZQB 1QVOB 2GFBB 4NIYE 3OMAB 3F65A 1A1NA 5KVMC 5SWZA 1RIHH 1CFNB 2Y4SA 1WBZA 1BVZA 4FNSA 4QTHA 1Z9OA 1E3ZA 3UX9B 3V8CA 3SDAB 3G6JA 3HC0B 3QK0A 1OAQL 2NLJA 5D1QA 1H9VA 4NRXA 3R0MA 4JL1A 5KBDA 3KDMA 2MQ0A 3PWPA 3FAWA 4U4IA 3D3VA 1EZVY 1NCWL 5EBMB 3OZLA 3QC5X 4AXWA 2R29L 3BWAA 3NPZB 2JSFA 4JO1L 3BZ4A 4X7DC 5FW8A 4R7XA 4JZJC 3DK2A 3E3QE 5E2UH 4WWNA 1FVCA 2OQJB 3VD7A 3JUYA 3L2LA 3K6NA 1D2OA 2ZUUA 1IGJA 4MWFB 4ZW7A 3ZRCC 3WMQA 1G9MH 5IMLB 1IM9D 5J13C 3FJTA 4BSWA 2WYHA 3D9AL 4JO2H 3SIKA 5BRPA 5MEQA 3H7LA 5HHQA 3MJ9A 3PNWA 3CFEA 2WXGA 4NKDA 4J2QA 2PP7A 4GKSA 1MIMH 1KEML 3IN2A 2CBOA 2VJ8A 4IRZH 5DJCA 1CGYA 4FHBD 5TQ2H 3ISYA 5KJ7E 4NN7C 5BOJA 4QHUA 4RSVA 3C2SA 4WFFD 4NKQB 4NZDA 1IAIH 3RDTB 2XX1A 4NSKA 3V7AG 5IESH 4LO9A 3PIQB 5F9JA 3RPIB 1X7QB 1BJMA 1U3HB 4BA0A 3BIAX 1QFUL 3P77A 2PMZA 4RCAA 2RR3A 4MDJA 5LBSA 3WE6B 1S4IA 2VC2B 1UXWA 3NCMA 3C08H 4JREB 4GLRH 4ZUSA 3FRUA 3KCPB 1H6UA 5HD8C 1BWWA 4HGMA 4GPVA 5B22A 3QEGH 3ARPA 1MHCA 2OMZA 3OLGA 1URIA 1V7NH 3D69A 5HGAB 4BZ2H 1EJ8A 4FQ2H 4FABH 1KGXA 4CKQA 1CLYH 1JGVH 4LEOA 1ORQA 1J11A 2BSEA 4ZK8A 4BUQA 3EOAA 2CKBB 1I8IB 3FQ4A 2NQDA 3U7AA 4ANXA 2WUBH 3TBBA 5KN5B 4XAKE 1P7QB 4G5ZH 2X6MA 2WM0A 3BFQG 5DYOA 3W0WB 1EJ6A 1SY6L 5CSZB 3X1EA 2CGRL 3NA9H 1F1GA 2FBRA 5DUMH 3AM8A 4M5TA 5FOJA 3QUKA 1S7QA 1EHLH 5BMFL 3FQUB 3VG0H 2F54E 4RAUB 4G3YH 1TTFA 1IGIL 5DI8A 2AJUL 4BRJA 4L23A 1WUNT 4R2GC 1BEYH 3ULVC 4KOCA 3FCBA 3IRZA 1AD9A 3M8OH 5DVLA 4A66A 4JGUA 1IEAB 3FQRA 5AL0A 1QX1A 5HJDA 3U4KA 3ETBJ 3ZBMA 4K8RD 4Y19A 1NUDA 1Q72L 1A4JB 4MX7A 4W9CC 1NCDH 4J3OD 4TTDD 4EI5A 5LQBL 3FQXA 5LKNA 4IK7A 1MNUL 3O9WB 5F7DA 2B8OT 3B2VL 3WSQL 3G6DH 1BFOB 2DMHA 4E5XA 5FFLA 2VR4A 1OPOA 4X83A 1OP3H 5LGHH 1WPCA 1JYNA 1SXCA 3CH8A 4G8GE 2AC0A 1PJWA 2XQBL 1BM3H 3HJ0A 3NIDB 1HSBB 3ZTCC 4KNQA 5TK2A 4QRRA 2ZCZA 4C4KO 2CCLA 4F80A 4UDUB 3ISRA 3VXSD 4R3SA 1UWXH 5DHDA 4FA6A 4PG9B 2P5EA 3MKKA 4NHUB 1VB9A 2X4SB 4I8DA 2UZPA 4YDVA 4L4TA 4QRFA 1KCUL 2JB6A 3KYMA 5I1JL 3EUUA 3OB0K 5J1AA 5F6IC 2XTLA 3O2DH 4LVEA 1IKFL 3H3KA 1KJ2H 5IB4B 3QQ3B 5GGTA 3RTQA 2DPKA 3AG1B 3DOHA 1AQHA 4Y1AA 5DD5H 1X7TA 3VRIA 1KT2B 1JD9A 3LOWA 3L7EA 3BGAA 3NJJA 4L18A 1H3XA 2A3TA 2F18A 2ICWJ 5BRZE 4KZDH 2Y0SA 1L9OA 3P9LA 4GW4B 3UZVA 2R4RH 2WPGA 1A9BA 1ONQA 3TBVA 1YLBB 2BIOA 5CIPA 1ET8A 3G5VB 1SN0A 3G6JF 1MF2L 1E3XA 3TIDB 2AXGA 3PPSA 2ARWA 2WNXA 2IDTA 3BSHA 4HVBA 2CKNA 5AENA 5A2JH 2XG5B 1I3GH 5KANG 1VDGA 2NR6D 2YS4A 1SPDA 2YXFA 3A24A 1GTNA 1OCRB 4PRHA 5L7XL 3LZPA 2AABH 2I07B 3K4DA 5IBTL 3HRZC 3DXAD 4BA8A 5KYXB 4O2FA 1Q0XH 3FFCB 3S37H 1DLFL 1TEYA 3ILQC 4GO9A 4P9MH 2BS71 1A3LL 2ZG2A 2Q8AH 4RWHA 1Y7VA 3L5JA 1DZBA 3H4HA 4CJ0A 4NQDB 2HX8A 4TNWF 1E8YA 2XJLA 3ZPDA 4Z7QF 1E2ZA 2XIBA 4J6RL 2YGQA 4PRPB 3X17A 1GGCL 3LHPL 4NO0D 2B1AH 2BIQA 2K8QA 1NIDA 1NWPA 3EGSB 2PCPB 3FT3A 1XGPB 4OI8A 2ZX5A 4I1RA 1ES0B 1DJWA 1E50A 2F53B 2IBBA 4LF3B 2DLTA 1I8LC 1UKTA 3ORJA 4QY8A 5CLXA 4MZRA 3T6WA 4CVXA 4DGVL 1LD9B 3KLDA 5FKAA 2FGWL 3L48A 2WLMA 4PS4H 5DD3H 3PV6A 1E7UA 4AENA 5IWLA 1Y18B 1KFAH 2HTKD 1NCUA 1WS7A 3FW6A 4H8WL 4GSXA 3BVVA 1VPOH 3ARWA 3CUPB 1IE5A 2GT9A 5KSAB 4J3BA 4Z3TA 1DVZA 1PZ5B 4HUWA 4H25A 4RMWA 3H9SB 2BRRL 4P46D 2DJUA 4QXUH 3OJ2C 2VC2L 3QWOA 4IBLT 2N1TE 3PWLB 1SRDA 1JF1A 3NG5A 1DEDA 1HX0A 2ATPA 1U3HD 3MGOB 1HCVA 1A66A 1JGLH 1QA9B 4ADGA 3GMQA 4MB5A 4P2QB 2AZUA 4JPIA 3VD5A 4YBQC 1YEEH 4XWOD 3L1FA 3VXNA 3U46B 2EDLA 4WSJA 1ZGLP 4I3RH 2DQUH 3KNBA 3KGTA 1T83A 2OYKA 3ZT6A 2CLRB 2CKBL 5HI4D 4OLEA 5GZOC 3N41B 2DBJA 2JKSA 3ME0B 2BSRA 4XTRD 2MCG1 4L3EB 3V9FA 3M07A 1D5BA 2R9HD 2Y36H 3TFBA 2ZSWB 5T1DH 1DSFH 3IJSA 4R7DB 3EO1B 4X0NA 3CVIH 2A74A 1F4AA 2L7UA 4IS6B 1JK8B 3Q05A 2QSCL 3P9MB 4WSKA 3GXNA 3MRFB 5H37H 4M8QA 1P7QD 2HFTA 3V4VA 4W93A 1FA4A 2VDOB 4OLVH 3R06B 5F3FA 4YXKH 3RWDA 3NCWA 5K9OA 5FOBB