5T1JA

Crystal structure of the tbox dna binding domain of the transcription factor t-bet
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
192
structure length
192
Chain Sequence
KLRVALSNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGSMPGNRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEPEAACSASNTHVFTFQETQFIAVTAYQNAEITQLKIDNNPFAKGFREN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-box transcription factor TBX21
publication title Crystal structure of the DNA binding domain of the transcription factor T-bet suggests simultaneous recognition of distant genome sites.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 29
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00907 T-box T-box
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.820 Mainly Beta Sandwich Immunoglobulin-like Transcription factor, T-box 5t1jA00
5T1JA 1H6FA 1XBRA 2X6VA 2X6UA 4A04A 5FLVA 4S0HA 5BQDA
chains in the Genus database with same CATH superfamily
4R97B 1X9RA 3S3SA 2ZIDA 2BFVH 4TQEL 2FSEA 1SOKA 2EVJA 3ESPA 3N42F 4X6BA 1VFAB 2YKLL 1T21B 5F1NA 1ZT1B 4X4XA 1HAWA 2YN3A 4Y16D 3FFOA 1Z1WA 1JDDA 1L9SA 2KDGA 1UD4A 2KPNA 3SCMA 4W6WB 3HI6H 4G9DB 2VXUH 2YRLA 3SDCA 5FYLL 3RNKA 3EXJA 5E8OB 4M8QB 2J44A 1SOXA 3AT8A 1O6SA 2BZ7A 4C4UA 5L2KA 1BAFH 1F58L 4PJ5E 3BOVA 3W3BA 4HOWA 2OSWA 1D5IH 3AU1A 1EK3A 3NUKA 4IMLB 3OB0H 1KCUL 2GSIB 3ULVH 4RESB 1HXMA 3S88H 4J27A 3WFZA 2IMNA 4YHPB 3TBVB 2VLLA 1KEGL 3LRMA 3QUYB 3CN3A 4UZUA 5EF2A 4K55A 1A1MA 6CGTA 3F65A 4L4VA 4Y2DC 2NUPA 3LQMA 5E1AA 5E6UB 3FT4B 2ID5A 1Z0MA 2JI1A 5CJBA 5E4EC 1MW2A 3N85H 4F7EA 1A3LL 3BDBA 2F8VA 5C0GB 4KAQL 4PY8J 3BUYB 4JO5A 5ACZB 3EUUA 3DV6A 3WUWA 4X6DE 1HAUA 4I48B 4JY5H 2DOCA 2M26A 1DDHA 4JBSA 1MHEB 4K5PA 2DY2A 3IJYA 1WIUA 3DURB 3U1QA 4ANWA 3D0VB 3BI9X 4YPGA 2VLJB 3ARBA 4DPAX 5HI5D 2A1WH 3MYZA 5ADOL 1HVXA 5GGSY 3TPUA 3BLPX 2PPFA 1MI5E 4XB3A 2FECL 1MPAL 1BFVL 5EZIH 4FEMA 4PRNA 3BIKA 3R7RA 3AMLA 1JZGA 3BUDA 3HE6A 1GC1C 1NLBL 1RUAH 2NR6D 2WBJC 2Y5QA 2WXJA 4F15C 4X42A 5EMYA 4H44C 3SY6A 3FN0H 2CJUH 3HI5H 1LDPH 2YAEA 5I28A 4KY1L 3QJVB 2BSCA 3ZE0B 3W37A 1NDGB 5J13C 3LSOB 4PCYA 1ASQA 4P05A 4Y5YC 5C0ND 5IV2A 2OJZL 1KXTA 3T3MB 1DCLA 2GY7B 1ZDQA 4FCHA 2M83A 5BZWA 5I6OA 5IFJB 4KJQC 5I1LB 1XR8A 2B8OT 5I8CA 2W60A 3IBEA 1NDTA 2I07B 1IBGL 4M7LT 1TJGH 3TZVA 1OM3H 1T22A 3BZ4B 4ORGA 1CK0H 4IJ3B 4MA1C 3B2UD 4HXAL 2XTJB 1CFSA 1IBZA 4CMMA 1TITA 3Q5TA 2BNQD 4FC3E 1U8KA 5ISZE 4QLRA 4UILH 3U7AA 2C9XA 4HMEA 2QZ5A 1U8MB 4M56A 4XC3L 1GW6A 1ZEAL 3DX0A 2J20A 3N1GC 5FYJL 5BV7L 4Q9RL 1I1AC 2P26A 1NCBH 2X4TB 3ZR6A 1WYJA 4EBQH 4L2YA 1OLLA 3UJIL 1BXUA 3OAUH 4GUQA 4DPRA 3FU5A 3O6MH 4E9QA 1C9SA 1I3GL 5CFAA 5CMAA 3GEFA 4K3JH 1BIIA 5FYKE 4DUXA 4KNTA 4ZPVA 1RK0A 4MKTA 2CXKA 3IGUA 1QI3A 1QFUH 4NBZB 3WI9A 1J9QA 1G1KA 5GJSH 3SKOB 1M7IA 2COQA 4H26B 2R8SL 2UZIH 5ABAA 2CKBL 4WJKB 1ADQA 2Z8SA 4OZHF 4PRIA 1NIBA 3MODH 4FOMA 1O5DT 4I0PC 5HYJD 3STBA 5IESH 2X4RA 4BHUA 3L3OA 4LBEB 3S37X 5JPNB 3WTYA 1YJDL 2MIZA 2VN3A 1A3RH 1XGRB 4DO5A 5D4JA 1CURA 1E4KC 4ICXA 4NUMA 1A6TB 3GBNH 2DMBA 3CVDA 4E9RA 3DSFH 4IK7A 4YK4C 2G60H 4LMQI 3K72B 1NFIA 2EICA 4D2NA 3VMPA 3C75A 4HK3J 4NC0B 4PG9A 4GIAA 3ZIYA 1WT5C 5T5NF 2WWKO 4APQA 4YHYB 1KTLA 3F6LA 2X4UB 2CBTA 2DM4A 1RZKH 3O41B 4I18B 4A37A 4LSSH 1RU9H 1MRCL 2FVNA 4J6RH 1L0YA 5AAPA 4FFZA 3LEVH 3TVMA 5LNDA 1UKSA 3SO3B 1RZJH 4L1HA 1SUHA 1HQ4A 4PJ5A 2HRGA 3L5XH 5LBSL 4R26L 4G7RB 1KENL 2IDSA 4YHZH 5LLIC 3UPRB 3IM1A 4GSUA 4ODSH 3P77A 5IVXE 2FB4H 3EJTA 3H56A 1WCQA 3GPSA 1NBVL 5E94A 5TE4L 2GJZA 2RGSA 5T1MB 3V52L 2WXFA 1AD0A 1C7SA 2KQNA 2VNCA 2ZF8A 2D7MA 3MV8B 5JLZB 1PJ9A 3GJFA 2JF1A 1JZ6A 1ZCRA 1T1XB 3FQRA 2N7SA 4GKNB 3FMGH 2YUZA 4JPSA 5JDSB 2YK1H 3NJNA 4KTEH 3WTTA 3FB6B 1ODAA 3EGDB 2N4IA 5L2JA 1TJHL 2ADJB 2AJZB 4AKPA 5G5DB 5A2LH 6PCYA 1A6VH 2YGVA 4X9YA 5CBAA 2LT9A 3L7FB 5EEWA 2HSIA 1UUNA 3CVHA 5FLUA 3IFNH 2YEQA 3MUUA 1X4YA 4PJBB 4O2CA 3MZTA 1A7OH 4W4OC 5LCVH 4KROB 2OJ1A 5D5MF 2XIBA 3LVTA 3VW3L 4H1LG 2BIPA 2YOCA 3NT0A 4WGWB 3DX7A 1MCCA 4UQBA 1YCSA 3D2UA 4IOIA 1EGJA 4NQED 3GSRA 1K2DB 4ELME 3CMGA 3FDWA 5DRZB 4AQ8A 4HDIB 3V6BR 4XMZA 1V3JA 1SYVB 1WK0A 1C5DB 1ETZA 5JW4Q 4M8RA 1PZDA 3FT3A 3KWWA 4LVHB 1GGUA 5FM4A 4IU2A 2A9NL 2XPZA 2AXGB 2XV0A 2HUHA 3S5LG 3PU7A 1W2KT 5IHZB 3NZUA 3MFGB 1E4XL 3VTMA 5DD5H 2ZSWA 1BP3B 4A7SA 4EZJA 1TZGH 4HBCL 1SQ2N 2V37A 3QJSB 1W80A 4BK4A 5ERWA 1IAIH 4LLUB 4YMPA 1KWKA 1GMEA 1NPJA 5DTFA 4F9PA 1SM3H 1CF8H 3RDTD 2JCCF 5BQ7B 4X9FA 3NDZE 5GS1C 3T2NL 4TNWK 3IDYC 1XGTA 3Q6FB 4I13B 3T6XA 1V10A 4MB1A 4CC1A 1BQSA 2R29A 2DH2A 3I6KA 3HC4L 3Q0HA 4A66A 3Q48A 2UZXB 4CC4A 4LSUL 2CRIA 1M7IB 3WHE0 4OGYL 3JWDL 2OXHA 3CK0L 1R3HB 2BERA 2W9LA 1PIGA 1UGNA 3NEEA 2OZNA 2R1YA 3STLA 3WGVB 2BHFA 2J6WA 3GMPA 4FQCH 4Y8DC 3JWNH 1FNLA 4YBLC 4GG8B 4OLVL 4TVSa 5GZNC 5FW6A 2ALWA 4HKJB 1NEZB 3MU3A 2B5IC 1KYFA 3QYCA 3W0WB 5I2IA 3T3PF 2NYZA 3ZZSA 1QSFD 4YDMA 2X0UA 3OZ9L 1NCGA 3PWPD 3KPQB 1WISA 2JKXA 5FECB 4KHTL 1CU4L 2I7SA 1B9KA 4RWYL 4IS6B 2Z65C 1BZ7B 3OZKA 1B0GB 2EE6A 3ZYJA 3AITA 3SODB 4LCYA 3B9AA 5KTEL 1UOWA 2QKSA 1L3NA 4Z7UA 3B43A 5J89A 4UTAA 3LRKA 2MHAB 3BT2L 4N8VB 4PLKC 2CLRB 1NSNH 4H5SA 1QRNA 3HBGA 1CYWA 2J1XA 4YC2B 1I3VA 1EJFA 2EDRA 2NZ9D 1TOXA 1J1OL 4LEOB 2I5YH 2V17H 4NHCH 2DQCH 2WGNB 4K71B 2Y3AA 2BSBA 4R84A 4EKXA 1I8MA 1ZAGA 2VL5B 3DUSB 4AENB 4EIBA 3SYOA 2ED7A 3LZPA 1T5XB 2ZOUA 4AYGA 3A6CH 2Q10A 3T0XA 3HJEA 3ZQWA 1UZGA 1I75A 1U9KA 2AC0A 2XHNA 2DEXX 1IEAB 3MJGX 4ERSL 3ULVL 3J8F7 3QK0A 4PRHB 3RVTC 4U3HA 2C26A 2J2ZA 1UB5B 3CBRA 1BJMA 1F11B 4ZUTB 4JFYB 4WWKD 4GRWH 2NUTA 3UBXA 4O2CB 5KBNC 3PQYE 2D3LA 4LGSB 2GJ6D 4XMWA 1YEIH 3SO5A 4Y19A 3CXDH 4R7DA 4Y2NA 1D7FA 3NP4A 2ZXWB 5HHOE 5IB4B 3NJIA 4N6QA 4GOSA 5E56A 1FPTL 3IFOA 5D7EA 5E8DL 1VGEH 1ZWIA 1F18A 2FX7H 2DQFB 4L4TD 4OF5A 5GRXG 3MQIA 3DJZA 4FLRA 4UQAA 3BQUA 2HG0A 4PWFA 5D70L 2UYLB 2C7UA 4U4IA 3BVWA 2HG5B 4F5CE 4IDJL 5CD5C 1A0QL 1F00I 5INDA 1IKOP 2PO6B 2NNCA 3VXNB 3FUHA 1EJOH 4ZSOB 2PP7A 2F08A 1RZKC 4LCWD 4JFDD 2KS0A 1JZ7A 2JKNA 3M8OH 3RJOA 1JVKA 2VDQH 4XBMA 2IIJA 3U9PH 1RK7A 3DIFB 4PGJA 15C8H 1T7WA 3QIBD 5E2WH 1LEIB 1OW0A 1WBXA 1KTCA 1A25A 3TNMA 3MFFB 3PY9A 5F2FA 1RZJC 2WIMA 5K33A 3IMUA 4MJ6A 3PWLA 4MHHI 4GBXC 4R83A 2FWOB 1OVZA 3RAJH 4GXFA 2WQXA 1QUPA 5AVZB 1KIRA 1DQIA 2BCMA 1FBIH 3NIDF 3Q6GL 3NIFB 4P9HC 5DRNA 5A16B 5J9PA 1UEMA 2OXHB 2XFXA 1ORSB 4LP5A 3SPCA 3VWKC 4L5FE 4IEFA 3LN4B 4PEEA 2DBLL 3FK3A 4G11A 2F19H 1E5UI 2XWTA 3DO7A 1JK8B 1ZGLA 1IM3A 2XWXA 4F27A 5DC2A 4BK8A 3X17A 3FOLB 3EJQA 3WS6A 2H32H 3QUZB 3ZGHA 3QT2A 3V4VH 2E75C 1PZ3A 3UC0H 1OLZA 3IKCA 4HIJB 1PNDA 2P49B 3G6AB 3ZSSA 3LPFA 4UV7H 4HLJA 2K6YA 1V54B 4XC1L 2GIYA 3DMMB 1DBML 2EDDA 3DHPA 4L3CA 4PW9A 1DQLL 2ICEB 2EE9A 2FECI 3F64A 2ENJA 2YAHA 5EIIA 1E0OB 3VTTA 1YN7B 1U3HB 4OCYH 1N64L 3I3EA 2GSGB 2O5ZH 4NDMA 4O00A 3GIVA 3BZEB 3IBOA 4JM2C 3RQ3A 5HI4C 1SF5A 4EI5A 3QEQB 1II4E 3QP3A 3W82A 5E6IA 1F4YH 3Q06A 1QR1B 2ZPKL 1Y18A 2GCYB 3HKFA 5BNXD 4OBRA 3BRGC 2ZOKA 3F12A 4RGNB 3ZDXE 4HUVB 1HJBC 4GS7C 3RPIB 2VJ0A 4WUUD 1BF8A 3LPOA 1TZIA 3EO9H 3WY3A 2ZUVA 1XGUA 1ZHBB 3PG2A 1G6RL 3K4AA 2VDLL 2YLHA 3KL0A 4JCMA 4K9EL 4M48L 5JHLA 5EZPA 2OMYB 1GIGL 1RIHL 2DLEA 4PJ8B 3IDXL 3QCTH 2V2XB 3KNBA 5FUOH 5HDQH 4MSWA 1HSAA 4MXVE 4UCFA 4XMKH 1BVKA 1PG7W 3TP4A 3WO4B 4NRYA 4N26A 1TJIL 4O2EB 5I6PA 2XICA 2IAMC 3GRBA 1S9YA 4JDVA 4NQXA 4H0GA 4N0YH 2DQHL 3HLAA 5C0AB 1BYOA 2P48B 3EW3B 4YE4L 4UM8B 5MI0B 2WZ0A 1JJUA 4DO4A 1SMOA 2BH0A 4ANUA 3CFQA 4Q2ZB 1T1YB 4ZW5A 1NIAA 1HWGB 3P0VL 2IMMA 4OFIA 4UDUA 3W9EA 1KJ3H 1M71A 3AY4C 4J12A 3VVVA 5K9KA 1ZHNA 2E7DA 4ZQKB 5E24E 5IOPA 4ZAKA 2XQBL 4FA6A 3LD8B 4HHWA 4Q89A 3PQYA 2G3XA 4NSKA 5EUKA 4AX3A 3L13A 3GBML 5DO2C 4DQOL 1YEDA 2Q8BH 1U58B 1CICC 3MJ8B 3MJ7A 1EX0A 2W94A 4MJIB 2AW2A 2W91A 3QUKB 4YO0A 1J1PH 1EIBA 2J6EL 5DJ8B 3T6WA 1G6RB 4IJTA 2N1KA 5K1JA 5CAYB 3P40A 2YAFA 3L1GA 1ZLDA 1WGOA 4Y2OA 3HNVL 3QO1B 1QPKA 3MNDA 3T0WA 1S46A 4POUB 1BXVA 1I8UA 3V7AE 1UD8A 3VE0B 3SDDB 1T4KB 4OIAA 2OMXA 4FZ8L 1AO7A 2DMGA 1AKJA 4NFBA 1MFMA 4QOKE 5GGUB 1DBJH 3FUMA 4AYFB 1T03H 5CGTA 3OKMA 1J8SA 1I7UB 1OGTA 2P8MB 5DD3H 2H0PA 1HI6A 3CDYA 1RZ8A 3BXNA 4P23B 5HTSA 1BW8A 4Q8BA 4IU3A 4YHMH 1CF1A 2XFXB 3KPSB 2WLNA 5FFGA 2CRYA 3MRRB 2XWTB 4QO1A 3T2OA 1N8OE 4MXWL 1E9PB 3UZVA 3FB5A 5EOQH 1HC1A 2JKRM 2DMHA 1P4UA 2B1HH 1OGAB 1TEFA 3QZOA 3PDOB 5INCB 4NKMB 2CLVA 3WDIA 2XY1A 1YDPB 4FXGC 3JZ7A 3NABL 1HCYA 1TKWA 2YEZA 2IADA 1RAMA 4EZMA 2W38A 2WYTA 3U30C 4QXUH 3DUUA 1KLFB 3BUQA 5J11C 4TXVB 4APXB 3D9AL 1QFHA 2VABA 4U1IA 1W0VA 3L5WB 5J3HD 4D9LL 4RDQG 3CG8A 5DUMH 5IW6A 2LTQC 2XZQL 2UZYA 1HZHL 2YXFA 1SEQL 4YHOH 3AG1B 4YBQD 2YD5A 1JYNA 1XD0A 1A4JA 4BCXA 5FOBB 1KN2L 2KKQA 1RZQA 2EXWD 3EGXA 5DVOA 4QWWD 3W39A 1L6PA 2BFGA 3F7VB 3ZJAA 5PCYA 5B21A 2Q1EA 1JG9A 4HHAA 1XIWA 1JNLL 5IROA 3U2JA 5MEPA 4R2GB 1QRKA 1RD6A 2ICWA 4KI5D 3UAAA 1NWPA 1E4XI 2AK4B 4O02A 3OQ3B 2AEQH 1GJIA 2YA1A 2FCBA 2C9PA 4GNKB 4GRLC 4KPHH 3V0JA 1KB3A 3HLAB 1CGVA 1X9LA 4GY4A 3WNIA 1JPGA 1RZIA 4HUXA 5C6TH 3NTCL 4XVUC 4Z0BL 7PAZA 4WW1A 5BRQA 3ZXAC 4AK1A 3UAJC 4EJ1C 1Q72H 4GFXA 5K1NA 2VLME 1WV7T 4YNYA 1W72B 3BWUC 2UWEB 1C16B 4E41E 3U7YL 4AM0A 1WA1X 4KVNL 3ZBMA 4GO6B 5J12C 5KN5B 5DEJA 3AY2A 3GB7A 4Z7QF 1OCZB 4O51A 3F83A 2EUXA 5C8JB 1MFAL 4L2LA 3CDGB 1CI5A 4L8SA 4LRNH 5DMKB 2C9QA 2UX7A 3CV5A 4FN0A 5JOPD 5T3XE 4S1QH 3LRHA 1YZZA 2X4NB 4UB0L 4W70A 4IGBC 1K8IB 2QDVA 5DA0B 5C92A 5EEVA 4N5UA 5DJYA 4N0UB 3ES6B 4LZKA 5DRWA 4LMQE 1TZHB 5T3ZD 3P3SA 2F54E 2CD0A 5C7ZA 2E7LA 5F9OL 3MGAA 4GW4B 4RSYA 4X6CA 5LGHL 2ZX5A 3VCLA 1N5YL 1U2YA 1MLCA 2AXFB 2OJEA 5CZKA 3VXUB 1D2OA 2PYEB 5LB1A 4F91B 3DXAD 4XE5B 1IBBA 4BKSC 3FZUC 1RUPL 4R7VA 1DN0A 4UQEA 3VXTA 1UA3A 4BDVB 1R3KB 3GPEA 3HHRB 3OC5A 4X8GA 1K72A 3RY5A 4BJLA 4D0DB 2EIZB 1RZPA 3P73B 4PV8B 2HYMA 5EC2A 4H1LB 4BZ2H 1IGIL 2EDLA 2NYYD 1LE5A 5MEQA 3DOIA 5DR5H 2NXYC 3REWA 5E2VH 4QOKA 2H41A 4GG6F 3MLXH 3ZTCC 2UVEA 3W38A 2QKIA 1P9MC 4F80A 4PV9B 1RI8A 2DIEA 5TQ2H 3WLBB 3PAVA 4U6HA 1KBVA 1EO8H 5TFSL 3WIIL 4MAYC 1HXYB 3AGVA 4IBUA 3FSAA 2IFGA 4XMPL 1UA6L 2DJSA 3IU3A 5EFIB 2QHRL 3TIDA 1WZKA 1WWAX 3CPLA 3OKEA 2E6QA 2X6CA 2XIDA 2XN0A 3S5LB 4E2OA 5KVFE 1HHJB 1ZA3B 5TE7L 1L9MA 2Z35A 3R8QA 3EBGA 1NLDH 1XTLA 2E3VA 2HJKB 3CSGA 4PJFE 3W2DH 3ASNB 1QLRB 3EYFA 5KVGE 2FUQA 3CVHH 3D39A 3HG1B 1Z66A 3Q3GA 4ZT1A 4YHLL 3IDJA 3SGEI 2CDGA 1Z32X 3MLRL 2EDEA 4XN7A 3SKNA 3FUIA 3MRHA 4GAFB 5DD1H 4H40A 1KDIA 1K3ZA 2ZUQB 4LOVA 4DT2A 3MC0A 1MFBH 4MHHG 4LASH 3C5ZB 3KPNB 1LO5A 3OSKA 8FABA 2ENPA 4PBWD 1U42A 3UACA 3SCMC 2YPLA 4JANB 4P3DB 3EGXB 3E1F1 2E9GA 3JQOB 2VN7A 4K94H 5GSRB 2CIKB 4FQXA 1YQ2A 3FHQA 3QCVH 5DVPA 2HFEA 2HN7B 3MCYA 4M5YL 3EZJB 3MBXL 4F8QA 3TNNB 4K15A 4QXGH 1SMAA 4NO0A 3UYPA 2Y1ZA 4MGXA 2ENYA 5LDSA 1INQB 4Z7VA 2E46A 2IDQA 2EDMA 3LEXA 3P69A 5JHDB 2JK5A 3L3HB 1JYXA 1ZRUA 4N9OB 4LAQL 1HNFA 3IKKA 1QEWB 5ESVB 1IGYB 4F3FB 1H15B 3FTGA 1WLHA 1AE6H 1GY1A 1U8LB 1A9BA 1ZS8A 4WI6A 3QORB 2C4XA 3I74A 1QFOA 1RULL 3QJXA 5LG6A 1SLWA 1Q1PA 2BOLA 4YGVA 2LQRA 3BH4A 4QRBA 4PRAA 5DI8A 1ML0A 4AC2A 4AM0B 4JO2H 3QI9B 5JUEL 3F7LA 3EDDA 5J6GA 4TNFA 5CWSB 1FFRA 3MBEA 3NA9H 4UQ2A 3C6SA 1F2QA 1SN0A 1UD5A 2F18A 1BYNA 3D4CA 1WA0X 4NQDA 2ZUTA 3ULUL 1F4AA 1WP6A 2ARWA 5KZCD 3ARBC 1T1ZB 2LLLA 4RGMC 1CYXA 5E0QA 5FYKH 5EO1A 5DUBA 4X8CA 3QXUA 5C0JA 1PNCA 1JWMB 1BG9A 1W16A 1E28A 1NGWB 4PGZA 1FYTB 1CI3M 2R0KH 4QNPF 5DRWB 1YVLA 4JFEA 4YXLL 2OCFD 2E9BA 1UURA 2NXZD 1WAAE 3QWOA 5DHVB 3X3GL 4N3TA 3O3BA 4KZEL 3MMEA 1R24A 4Z7NE 1MLCB 1X9QA 2R56L 3WJMB 1NFAA 5FW7A 3VD1A 5ICXA 1OAXH 3FB7A 5IMLB 4PJGA 3HBZA 5E1IA 3PE9A 3VGHA 4N9GB 4GW5A 2F54A 4A6YL 2P8PA 5CS7A 1FFOB 3VFVB 2A83B 2VC2H 3AG3B 4JPQA 1EAJA 3RY4A 4JN1H 2VR4A 4HIIA 1ZHKA 1D6EB 2E6JA 4DKDC 4POZC 2ROXA 2IWFA 2NY1D 4LKCA 5KANG 3SQOL 3RWCB 1KLUA 1ZLEA 3ERXA 3TZVC 1EMTL 1XCQA 4ODHL 5SWZD 1PDKA 2WQ8A 5BZDA 4XNXH 2WLKA 4OLYL 4Y4HB 1IGFH 1HL9A 1UUSA 2FYVA 4FD0A 1CLZL 2EKSA 2YGQA 3QUML 3KGRA 3VQMA 5CIPB 1EZVY 3GJEB 1JOIA 4HC1A 2HTKC 4FXLA 4KV5F 3CSFA 2F2HA 3OPZH 4C54A 3NFNB 3H4FA 1VB9A 3QS3A 1B6UA 1FVEA 1MCPL 2NTSP 5DDHB 1FCCA 5BS0D 1L9QA 2A0LC 4NENB 2NX5D 1D5XA 1QVOA 1IGML 1XMEB 3H9HA 4HCFA 4BKLA 1OOAA 1BWWA 5IM7B 5DGQA 2ZWKA 4ODWA 1WQVT 2FGWL 4MMYA 4BINA 2CDGB 1KJ2B 1U93A 4A2GA 2RQEA 3OLIA 1I8IA 3K71B 3QDJA 2RB8A 3H7LA 2EIMB 4PJCE 5TH2B 3IDUA 5CJXA 4W9ZA 1CFTB 4L48A 5IF0B 4GMTL 4XOAA 4LIQE 4H2AA 3A47A 4XZUB 1PX3A 4FMKA 3L3OC 3EBIA 1E3ZA 4MXQC 1HE8A 5CNHA 3VFTA 4MQ7A 4UZGA 1AXSA 4FLOA 4I88A 1EHXA 4OM1L 5F3HB 3PPEA 4B9KC 1WBYA 1FHGA 3OXRB 4S1SH 2KYIA 4KKBC 1IC7H 4LXFA 4S0HA 4NO0B 4YHNB 3M46A 1A66A 3QFDB 3U36B 1PY4A 2H7WA 1N12A 5DT1H 1M9SA 4BGDA 3ULVD 3SQBA 4UIKL 5FYLE 2PW1B 3T4YA 4APQC 4PGBB 1SBSH 3HS0B 1EEQA 1MUJB 4YSQA 3E6HA 4CGTA 5D2LE 2B15A 4G72B 3VUAA 4V1DB 1KCSL 1OARH 2XX0A 3IJHA 4K73A 4NC2B 1MCIA 5TF1H 1TTBA 4TUJB 4YXHH 3TVMC 4EEEA 1FWXA 4QUOA 5F93C 5TDOA 3FQNA 3RGVD 3WL9A 4JUSA 4WI2A 4YGVB 4EDXB 1SOSA 1VEPA 2DDQH 4U7SA 2HRLA 3EOTL 4TQPA 4Y5XA 2IPKB 1LEKA 4LGRB 4P07A 2Y36L 1E4WH 4QRPD 1VEMA 4G80B 2IQ9L 3O6FA 3T3ME 2J8UF 3RU8L 3S34H 3QNZB 1NIFA 3SDAD 4ALAL 1FFTB 2D73A 1NC2D 2YUVA 2GAZA 3TO2B 5I0WA 3QWRD 4LEEA 3UBHA 4PJHF 3NOIA 4GLRI 2AJXL 2NY4C 2X12A 5I76B 1QSEA 2ARJA 4OIFA 4ZW6A 1FFNA 3IN0A 3QA3A 2P5EA 3S4SG 1I85A 3UJJH 2X6BA 2XTJE 3QZNA 4UQ3B 1OAUH 1NA8A 3LPPA 4WK0B 5LNGA 1CLYL 3F58H 4S1RL 1BBJB 3OAZK 4YIQA 3MRQB 4MB4A 3B7SA 5I6XB 1S78C 4Z3IA 2EEXA 4ZRGA 3BUIA 4W9KC 2WLHA 4XRCB 2A6KB 4J8RA 2VIRA 2BXYA 3FB7B 1PSKL 1CUOA 4N1CA 3PREA 4UANA 3S8FB 4DIXA 1UWEH 1UXWA 4KH2A 1C8QA 4GW5B 4PLKD 1HQRB 4I9XA 4A2EA 1JXDA 2NNAB 5CLWA 4K94C 4OGAC 4F7MA 1WAAA 4Z7WA 1IE5A 3RZWA 4JDTH 5SWSE 3ZK0A 1A9EA 1WHOA 4ONHB 2A6DA 3MACH 2LE9A 5IB2A 5IUSA 4E0RB 4LLAA 1U8JB 2P1YA 5K69A 2EAEA 2MNWA 4NWUH 4LVNC 1R0AL 2DQIH 3MRDA 4XTRC 1JV5A 1R17A 3D18A 3WEBA 2BXZA 1KGUA 2CBPA 1KXVA 2BW5A 3TT1L 5DJ6B 1ULVA 1UC6A 4LLMA 4XMLL 3DX8B 1G87A 4FQHB 1RZFL 4KFMA 1YECL 3II2A 3PJNA 5D96C 5DEGA 2YARA 5B8CA 3RFZA 3TEWA 3VD2A 1FN4A 1JP5A 5FYJE 1DVFB 2BVQA 1Y6MR 2X6MA 3L7EA 2C3XA 5FO8A 3OHXA 4MB5A 2CIIA 2Q20A 4OZIF 4P5KA 1C5CH 1QACA 3IJ8A 3HB3B 3QDJB 4XAWL 1QSZA 3OJDB 3PJLA 3FH7A 4OGZA 4FNTA 1YNTF 4NKDB 1A6AB 5FDYA 3KH3A 2Q6WA 3CLWA 4ZUWA 4M43L 3FQTB 5E08H 4ZNEE 3ZTJH 1KPVB 5AVXB 1FH5H 3P4NA 2YQBA 3VXMA 1JF5A 3O8XB 1F3DJ 1LO4L 2Y1YA 3OKOB 4F57H 4BEIA 5CR1A 3SYAA 5CD5D 2WQSA 5BMFL 4RX4A 4PJCA 2JIXB 2H8PA 3Q2WA 4TSCH 2WZ5A 3TBSA 4WV1C 3MV8E 1IX2A 3IDGA 2H9GB 2QQLL 3D4ZA 3NPZB 4IBTA 3RUGA 1NCCH 3LKNB 4XWOD 4FLSA 2DYPA 2AK1L 5EOTA 1N6QL 1JI2A 1G5AA 4JLRB 2J88H 3E6HB 1AKPA 2FX8L 3DBXB 4YDKL 4HQQH 3FF8A 5F6IB 4PJBE 1HHHB 2R7EA 3QFJA 5LJYH 3BPOC 2NSMA 3DRTB 3HA0A 5KSAC 4X5QA 3FQNB 4G3YL 2E47A 3I6LD 4ZTPH 4TRPL 2PYFA 3VI3A 3L3DB 4NO5B 3WNOA 2WVTA 3EYVB 4G59C 4FQIH 5D2LA 3MROA 5E5MA 3VWKD 2I9LA 2MRYA 3P4OB 4HJ0D 3E8UL 4WW2F 1DQML 4LPWA 4BQ9A 1XZWA 3FHEA 2WLZA 4RFEB 4BSWA 1RJYB 2KC0A 5I9QC 4ZPTB 1YPZA 1WCBB 1TZAA 4YSSA 3UTTD 3ZYZA 4DOHB 3SBRA 3V6FA 2I9TA 2LLNA 1GHFL 1KGYE 3QXDB 3WNKA 2GPZA 1RFDL 1XFPA 3RWFB 5B22A 3RVVD 1O9ZA 3WLWD 1NCHA 1KJMA 4ZYKA 5LWYL 3D30A 3K1DA 1O7DC 3C6LD 4PCTA 5D1XD 3LQAL 3WN5B 4L5FH 4FNUA 4QT5A 3WFDH 4IHOB 4TL4A 3OAYH 4JHAH 5EUOE 1CYGA 3CC5B 1LMIA 1FNHA 4K3EH 3U0TB 1T20B 1TEYA 3V6ZA 1IAIM 1CT8A 3FO1A 5HHMB 1AIFA 2Q8AH 5EBMA 1MIEL 4JM2D 1CG9A 1J8HB 2EIDA 4OVUA 3DSNB 4PJAF 1F0LA 2V6HA 4H25B 4NM4L 2PWGA 4NUJA 5T1DL 3MSPA 5GHWH 4PREB 2FQDA 1CVSC 4P46D 2BC4B 3F7YA 1X5IA 3BQUC 4AQZA 2XXMB 4WU7A 4J3UA 3ULSB 4F8OA 5I1HH 2EZ0C 1MAML 1U33A 3D48R 3HUJA 2GI7A 5K59E 1OAKL 1LO3L 3JXAA 5C07A 5TJWK 5T3ZL 4CN1A 4YR6A 4ODBD 1PZ5B 2FT6A 3AM8A 3NIGF 2OL3H 2NNFA 5A6MA 4MD5B 4KRPC 3OG6B 4FG2A 2A77H 1ZVYA 4XHQA 4NNYA 3LIZH 1ZVNA 4D0BB 1HN1A 3NCCB 2Y6TE 5SWSA 3N9GH 3GIZH 1OW0C 1E8WA 2L7UA 3PPSA 2JB6A 3GEWB 5C0DA 3TA3D 4ZNCD 4HPOL 4KDVA 4A2HA 4WJ5A 1JXKA 4M03A 4D3CL 2BSSB 3OGCB 2VN4A 4Q58C 3W0WE 4G5ZH 3PF2A 2ZZUT 3IWUA 1NGYB 2XA8H 5B8CB 2YD9A 2AEOA 5D93C 5CEYB 2HT3C 3HBPA 1S8DB 4LKXA 5BZZA 3MCKA 3BPCB 2BOCB 1BQLL 2YD4A 4G8EB 4KQ4L 4PH8A 3OHXB 4PJ7B 5C0EA 4PHZA 1R33A 1WUNT 2OMWA 2D7QA 3L4WA 1AP2A 2D8KA 5F3BB 3IFPA 2E4TA 4FQQA 4OVVA 4J3BA 5ILTH 2NY5C 3HVNA 3QO0A 4FCAA 4J7RA 1CD0A 3CZFA 4TM9A 4CVZA 3ILQC 4DFHA 1HSBB 5E2JA 3WS6C 2GSMB 1YMHB 4U6XA 5D1ZD 5L4JA 5B1AB 2BZCA 4HXBH 1EEYB 5D71L 4AC4A 1YYMH 2WXGA 1AHWB 2EYRA 4YDJA 2QGDA 3ARZA 1JF6A 2AMGA 3IXAB 4JW3A 5HDRA 3WS3B 4DP6X 5A2BA 2NW2B 3ATAA 2EYTB 2AJUL 2CKBA 1MF2H 3WCYA 3QPQD 4W9FC 2X7LA 3A23A 2O61B 4XCNB 5D72L 1KBWA 2B2XL 3GMNA 2BHYA 1IZKA 5FS5A 4FP8L 4EI5C 1J87A 1B4RA 1VCAA 1ZKAA 3KPPB 3UGXA 5JW3L 3O9WB 5E6IC 3BT0A 5AG9A 4UQIM 4P4KA 4LO9A 4WEBH 3FFDB 2AABH 2PYFB 3WFBH 2VE6B 4HPYL 3AS2A 1G43A 3H3BC 3FRUB 1I8AA 2E7MA 4DN4H 5BRZA 5A6LA 5TPWL 2Z7ZA 3CFMA 1W0WA 1ED3A 3FQ4A 3O3EB 3KPRA 3RTQA 5T5NG 4CSSA 2W80C 4X7FC 4DP0X 2BCKA 2NTFA 3MNVA 3D0LA 5CILH 2FTAA 4L1SA 1TYEB 1JTPA 5K39A 3EDKA 2BHZA 4PPTA 5DMYA 2WJ7A 4OB5H 2O5XH 4G8FB 3ECWA 4IBQA 3K2UL 5C6PB 5I19H 3UJTH 2VR8A 2VM4A 4FX5A 4ZSOE 1AXTL 4MNHB 1NTDA 1KGCE 5LBSA 4AVKA 1JPEA 2AQ1A 4FI8A 4XCEA 3U79A 4ZBJA 4PWHA 2JKJA 1E6JH 4LQFH 5GPRA 4PS8A 3QZLA 2GUOB 1FHNA 4JFQA 5D7JA 5D7IB 3WFCL 4GKSB 1YNLL 3MLYH 2CR6A 3I6GB 3AWEA 1L9PA 4HGKC 5F7WC 3L9RB 1S7QB 2E8YA 1LP9E 3BFOA 3MGOA 5IHHA 4ZAKC 2XN1A 5D1QD 3FFCE 2HKFL 3VFSA 1AZUA 1BBDH 3OR6B 1U8PB 2ZAGA 3UO1H 1U8CB 4ODUA 3F7YB 4JFFE 4U1SA 3GXNA 4J4PA 2C9RA 4AJYV 5K9OB 4KTGA 4L8CB 4NCC1 1IGJA 2Q0ZX 5FYKU 2WINA 5DJDA 3MNZA 3PGCA 1ASOA 3GKWH 1I9RL 2MOQA 3MRLB 4ONFH 5AVTB 1R34A 1AR1C 1H19A 4NO2B 5HHXL 1QLEL 1VZGA 3V5DA 4G7YL 1MY7A 4FXTA 4JRXB 4DZBB 4Y5VC 2VZOA 3PCYA 2EE0A 4E9SA 1FAIH 1WZ1L 4EOWL 3H9ZA 1XB3A 2V8LA 4PLJC 3VG0H 2EUVA 1JWUB 1D9KD 2A5UA 3EADA 3S4SA 2QGCA 3ZVVA 1V7NL 2CBQA 4DKAA 4GRMA 4LCUB 4QIRA 3VVWA 1QABA 2A38A 4HU8A 2OQJA 3T8VA 2WIIA 4JDZA 4JR9H 1DJHA 4G6JL 1OPGH 3CDFA 4FTVD 3EYOB 1BMZA 3QQDB 1AIZA 4MZ2A 3SE9H 3VYPA 4KK6C 5DWPA 3GMLA 2CMRH 4M6MH 2DQUH 1BMWA 1OTTD 5E99H 3LRSB 4HMDA 2KZBA 5KVEL 2BVOB 4OGXH 2IC2A 4RGNE 4Y1AB 2R0ZH 5DJAB 1GVIA 1JZ4A 1A47A 1RIVL 4FJYA 1NFDA 1FF5A 3S36X 4K23H 2K3TA 3PABB 1ACCA 5CM1A 4MA8H 5I16B 2K4WA 1DLHB 5KOMC 4OI9A 2WTRB 1JSYA 3FO9A 2BFVL 2EYRB 3A24A 5EU6D 3WY2A 5HHQA 2PP9A 3QC6X 3F7KA 3MZGB 3QCUL 4K7PH 4LGPB 3TBWA 4M00A 4L37A 3LPWA 4Y0GA 1WFNA 1MH5B 3A6BH 5LG1A 5SX4I 3DIVA 1XF5B 2WVVA 3D05A 5ETUA 3ZSTA 4LLDB 4GIOA 4M5SA 1Q1JH 3EHBC 3H9SB 4PGCB 5C0AE 4KMQA 2JELL 3OHMB 3H6AA 2VXUL 3DETC 2NRDA 2YXWA 5FGCB 4KNSA 2DQDH 4JG5A 4P59H 3OKKB 2X0VA 1J5OL 3B34A 4X5XB 2HFGL 1AZNA 1ZLWH 1BAFL 4KZ0A 5FO9B 2O5YH 4NNPL 1X6NA 4IRJB 4WGKA 4HK0A 4G6AD 2NXYD 4XAKE 4WO4B 2R2CA 3V4UH 4PFEA 1LO0H 2XOTA 1GRWA 3IDNB 3FCUB 3KXFD 2YWYA 2O26U 2CM6A 4J8QA 3VXSB 2IAND 1F4WL 3JV6B 1MXGA 3PYCA 3MNVB 4KKCD 3MXWL 3H2QA 2DWEB 2ZX8A 4MJIE 4UIMB 4JRFA 1XIWC 5IROC 3VYNA 2D9CA 2BSEA 3P11L 1ANUA 1IC0A 1XR9B 5KYXA 3EH1A 1N0XH 4LAJH 1XSIA 1YUHB 4JKNA 1MWAA 2NY6C 4GPVA 4J3WA 5C09B 1U8HB 1Y7VA 4X5PA 1Z5LA 2AANA 1R75A 3DVGA 5B1JA 4FDWA 5HJBA 2YEVB 2I26N 1KJVA 2WB7A 3VXOB 1ZV9A 4NUGH 2RFXA 3UMTA 4JFOA 2UVFA 1EO7A 3SJVB 1BPLB 2KT6A 3VFOA 5K5YA 2A1WL 3WG7B 1DE4A 4N90D 5CZXC 1P7BA 1E9QB 2IDFA 3BSZH 3CBJB 3P9MA 1KB5A 1EXGA 3DGGA 1VRSA 1TQBB 5EZJB 3ZTDC 2VLKA 1LNUB 5ANMB 5GGSB 2AQNA 5D7KD 3TYFA 5KVFH 1G7JA 1MIML 2HLFD 2Z91B 4ORZC 1JVOA 5A7BA 3KPSE 1CDUA 1BCIA 1LP9A 3KPMB 5DQDL 4HA1A 5DJDB 2OMTB 4G71B 2VMCA 3FN0L 2CJUL 4L8SC 4D0CA 2FO1A 5KVGH 2CO4A 3HI5L 4M3JA 3S3BB 1SXNA 3BWUF 43CAB 4PU2A 2Q5BA 5JOFA 1N6VA 2VDRH 5D2NB 4C47A 1CD9B 2FJFB 3TT3L 4L0ZA 1ETA1 1OP9A 3V4PB 2EH8H 2Q86A 1SXBA 3IS0X 2VMDA 2E7LC 1HCVA 3D87B 1NPNA 3QB7C 3TO4A 3T0DA 3S4SB 1CFVL 1TJGL 2PUQT 4ECNA 1QBLH 4H4NA 4ZXBD 2XQYK 2XWJB 1NC4A 1BM3L 2WIIB 5B38A 1E6OL 2BY2A 3HG4A 1CPUA 5IHWA 3I3BA 4LBAA 3V0WH 5DWUL 3DIDA 3GSWB 1NANI 4YSPA 4IRSB 3CLFH 1U8OA 4DN3H 1WC7B 4JHWL 5H37H 2VDKH 5FGBA 3IVKB 5JNYA 2QKIC 1MCFA 1BJ1J 4TPRH 1UKTA 3OAUL 1OD9A 3ECUA 3O6ML 3T4AA 3ESVF 4KOCA 2VUOA 1JXJA 4U6VH 3ENEA 3HE7D 3ZE0F 3T0ED 1N0LB 2BNQE 5K93A 4I3RH 1KXQE 5CSBA 1DLFH 5EV7A 1JDCA 4HIHA 2NY3D 4TOYL 4MDRA 4XNUH 4HKZB 3LQZB 4QRSA 4H8PA 1HEZB 1O6VA 3ET9F 5IESL 4HISA 2AK4E 2QSQA 1P7QA 5GIRB 2BW4A 1WIOA 3VRIB 6PAZA 2WZPA 1KC5H 4A67A 1UB6B 3GBNL 4XX1G 1A21A 4CVUA 3DSFL 3T71A 3QJFA 5F7UA 1JCVA 1T1WB 2G60L 3HC3H 5T1JA 2J3SA 3HMWH 2HX8A 3BEVB 3JVGA 3ECBB 2BNRD 4NQCD 3VJ6A 4EKJA 2WO3B 3ZE1B 3G5VB 1H5BC 5HYJE 1MCNA 2EDFA 3WDJA 4AQ1A 1B4JL 3CFJB 3TBCA 3ARFD 3CFBA 1SJHA 4NWTL 3G3LA 5FM5M 4LSSL 4XCCH 1BQHG 3KM2A 4FQXC 4KVCH 3NJVA 4CU6A 1IKNA 4Z76A 2J57A 3H55A 5KBLA 2D2OA 1RJCA 2FBJH 3GTVA 5IQLA 3LEVL 2MKLC 5C0BB 4QRUB 3WBDA 4Y16A 1EO5A 3C2AL 3L5XL 1XCXA 2HJLA 2DM3A 3V10A 1MWAB 4LEXL 4BH7B 5IVZA 4LQ1A 2ZSVA 1WHPA 1COBA 2W07A 2E86A 1T66C 5ACMA 4MCMA 2FB4L 1FJ1A 3O6KH 4FKHA 1PG7L 4YDVA 5DXWA 1K8DA 4TLSA 4GSRA 2Y7SA 4PJDE 4O2FA 2A7BA 1T4WA 1PAZA 4TUKL 4MCZB 2YBGA 1VJSA 4B9YA 1JHKH 3KR3L 3HAEA 1DE4B 3N42B 1FIEA 4OUUB 4ONGH 3S96A 3VXUE 4Y4KD 2DM2A 4W1TA 4LLWA 4HJJH 2A4ZA 3MYJA 5AZ2L 1A6VL 4E5XG 3BVTA 3MBEC 3FUNA 4BUGA 2EJ1A 3T1FB 4MXQD 5LCVL 4AGPA 4ZMTA 3O3AA 5HGGS 2Q3XA 5JQHC 4OLXL 3NCEB 5F7NC 5TQ0H 1UQSB 1L5GA 1RUQH 3OB0K 2KZWA 3VX0A 1IM9D 3MLWH 2I60H 1LQSR 3SKJH 4UBDC 4M8VA 2MQCA 3ATFA 4L4JA 5KVDH 2XDHA 3NACH 4B9FA 5E8PA 1SN5A 4FQ1L 4QHLA 1IBDA 4LIQH 2I25N 2Q86B 4JY6A 3ZL1A 4E9TA 4MWFB 1G9HA 2AXHA 5SX5H 4WUKH 3HNTH 4NQVA 1Y0LB 1VPOH 2CA3A 3C60C 5TDPB 3WXWL 2BVEA 4TQEH 5HYQB 5H2BA 1J5IA 4Z7IA 4NCDA 2QR0A 2YKLH 2ZP9A 2VW4A 3QEHB 1UVQA 3LKRB 2WLIA 3HG1E 4OZFG 4G9FB 2NR6A 4JGNA 4DSYA 1OSEA 3NQKA 1G7MA 1TVBA 1JZ5A 1TZGL 2E59A 3BWAA 4N6RB 1OCCB 1HYSC 1SM3L 1ERNA 4HX1B 1HH6B 1CTNA 3BUTA 2OW6A 4LHUD 5EU3A 2BLFA 1BZ9A 1F58H 4NT6B 5A2KH 2VQ4A 4K7FA 3VRLE 4L29A 1PKOA 3BE1L 1EJ8A 1NWOA 1KCUH 3ESMA 2ZOOA 4P2OB 4W9GC 1HL5A 3DX9B 1XH2A 4HIHB 3ALWA 3EJRA 5EO0A 4R8WH 5J6HA 2L8AA 2B77A 4QRSB 4K7PX 2YPKB 4PVNA 4BFJA 2XV2A 4LSTH 3O4LB 1FYHB 1DP0A 3WIFB 2BNQA 3ATEA 1R3JA 1S78D 3MA7A 1AH1A 3QDMB 4RGOH 3IMWA 1A3LH 1KXQA 5GS0C 1MI5D 5JHMA 4AITA 2LFGA 2G2PA 3QNXA 4Q6IB 3QEUB 5IY5B 3UL4A 5IFHH 2KHAA 2ADGA 4HH9A 5CJXC 1YY9C 3VJ6B 2X9ZA 1CFNB 1RZGB 5AOIA 4BFOA 2XA3A 4KZDL 2UY6B 3UTSB 1G4RA 1QWHA 1NGQL 4V2CB 1MPAH 4IMKA 1N19A 1RMFL 3P0YH 4JKPH 3MRIA 4ZTEA 4YPJA 4Z76B 1DQJB 1G7HA 4FKKA 2PTUA 1M7DA 3KYNA 1FCGA 5HYJA 4NNXB 3SEPA 1EANA 3E2HB 1QSFE 1N5AB 2H6PB 1NSNL 3ARRA 1UADC 4BGLA 1T0MB 3QHZH 2ZKWA 2ZX9A 1HESA 5F1IB 5I1DA 5IIEA 5EZOH 2BVPB 1T83A 1H3XA 4KY1H 4ELKA 3NK4A 2C3WA 1C1EL 2FJSA 1NCTA 2I5YL 4HLEA 3GSNA 5IFAH 5IJCC 2DQCL 2ESVB 2WK2A 3L3KB 4L9LB 5E6ZA 2OJZH 3EJZD 5DFTA 2ZYSA 5ISZD 1IGTB 2SEBB 3AQDA 4XMXA 3ARUA 2CK2A 2CDEB 4H8WH 2Y7OA 4Y5XC 1BX2B 4WEUD 1JGDA 1IBGH 5D4QA 4PG2A 4LVOB 4JFXB 2JMRA 2XG5B 2Q7AA 3DDGA 4PJDA 3O6FC 4NN6C 2DI9A 1CE6B 4AV4A 4XN5A 1U92A 2IBZY 3CTTA 2IBGA 5FYKD 4EQ2A 3OG4B 3LKQA 1DEEA 3T0AA 1S9VA 4AE1A 5T1LB 4F9LA 1AZVA 4Q9RH 5FYJH 5GZOC 1D5BB 3SDXA 4N2EA 2O6FA 1PYWA 3PXJA 2G3ZA 3ULUE 4J3OH 1XF4A 1A7RH 3K2MC 3R06B 1I85C 5ECGA 1CXIA 5F7YC 2DPKA 1I3GH 4HG4K 2FX7L 4JFHE 2JB5H 3FN9A 3MREB 5FA3A 1BHGA 2GJ6E 4CADA 1JDAA 4JG0H 4Q4IA 4M7ZB 3UOAB 1F90L 4Z6AT 4IBSA 2WWMD 4N2FA 5BVJA 5FHBL 3ZE2F 4Q52A 4ZFOB 4AIXA 4MX7B 3QJHB 4PTUA 1UVQB 5KSAD 3TCXA 4ZOCA 5ICUA 4QJ4B 3WU1A 5C9JB 4L4TE 1EXUA 3MBWA 2VDQL 4X0KA 2OYLA 5KAQF 1EEZB 1I1YA 4JZOA 3BP4B 5E2WL 5AW9B 1S7RB 3GMRB 1BXXA 4NQEA 4UAOC 5DMIH 1KIPA 3Q1EA 3C8KB 3PWUB 3WEXB 4U1LB 4YFLI 1G0XA 3H1ZA 3EDFA 4LVEA 4LNRA 1JE6A 4JRYD 1KMGA 1LE9A 3EBAA 3RAJL 2FO4B 2ITFA 2MPAL 2X44D 3J07A 4PJ9D 1QO3B 2F68X 1ORQB 5AB0A 3PL6B 4JM0A 2Z31D 3IF1A 4R0LB 1NFKA 5D5MB 2E9WA 4DESA 5BO0D 1MXDA 3BO8B 3FTWA 3QZMA 4YSTA 1PX8A 4GAYA 4R96B 5D7LB 5CLXA 3FUJA 2N7AA 1XF3A 2TRHA 2BMKA 3OLEA 3MUJA 4LPVA 1LL1A 2OSLB 2XPGB 1JS4A 5KJRL 2XG4B 3LTVA 4WTZG 4RA0C 3UC0L 1VADA 1F4XL 5TE4H 3MRKB 3RDTA 4NIYE 1DQDL 4NJ9H 2IH9A 4DUVA 3FU6A 4P4RB 1GGCL 3V52H 3ZKMC 1ZT7B 3GHEL 3H0TB 5FCSH 5I75B 5B4MD 1TU2B 5ID0B 3VQ1C 1A9VA 2VO5A 4LK4A 2JQAA 1Q9OA 3S3JA 6TAAA 1MRFH 5C71A 2CXGA 5H4YA 4HS6A 1ZVHA 2YA2A 1JF1B 1YG9A 3QUYC 3Q8FA 4OJEH 4ZZKA 5B7MA 1KPUA 4W9DC 3N1MC 4ZD3H 3AMKA 4XBGA 2OULB 5IG7A 3KPOA 3G9VA 5DQ9A 1TTFA 4PCSA 1F4YL 3T65B 4MLIA 2DB8A 2JCCB 3O11A 3TURA 2DM7A 4EI6B 4DGUA 3L4CA 1A14L 1I7TB 2FSDA 3P2DA 3TGXA 4DVBB 4C56B 3UTQB 5DHXB 3GSNB 3GRWH 4U1KB 5F1SA 1QSFA 3QCTL 3S6CA 3X1GA 5HDQL 1A6ZA 2ZOWA 2EO1A 3ULAB 4ZJ9A 2FNBA 3GHBL 3PWPA 5J56B 5EZLA 4NKQB 2NW3B 4UT6L 5IEHA 4NYLA 3MX0B 1WWCA 2A9NH 4IBYA 5JQ6L 4WNJA 3SPVB 2LU5A 2B3IA 4NN5B 2F7RA 2X40A 3RX9A 1OQOA 5HHPA 2OLDA 3ILQD 4N87A 5TE6H 2JCWA 4HBCH 3RBSA 4EXPX 5IWLC 1JXFA 3K4DA 2L0DA 2F8OA 4FXKB 3V8OA 2F7QA 4Z7UF 3K3QA 4OJYA 3ELQA 4MAZA 3T3PB 2P43B 1FFPB 1E5BA 1CFQB 1IL1B 1ET5A 5IQ7H 2TSAA 2VAAA 1I1RA 3KLHD 3DKHA 2Q8BL 3BIBX 2DQTH 4P5MA 1J0KA 4EN3D 4MD0A 5CP3A 4EI0A 4J39A 4OGYH 1H6UA 3CK0H 3QARA 4IHBA 2WUBH 3NEOA 5L8KB 4M4RB 2XTJC 1WS8A 2O6DA 1A4CA 2PXYD 4RMSA 4WWKA 3NG5A 3FQWB 4U3XA 4URTB 5GGVH 2GJ6A 2G2RB 3ROOA 2IH3A 4RAVA 1BQKA 2WWKT 2DI7A 2F61A 2X1XR 5B39A 1QYGH 1SYSA 2DWDA 5FR3A 3DX4A 2A73A 2VDOB 4YBHA 3LKOB 1AANA 3AM8C 4L4TA 1XGPA 1T03L 1MCHA 1G4MA 1EHLH 1KCVL 1S7XA 3LV3A 3VXRD 1CU4H 2P7TA 4RWYH 4XOCA 5DD3L 2OK0H 1BV8A 2VXQL 4AT6A 5KSBA 3WTUA 1R46A 3K8LA 5HJ3A 4A6YA 1BSIA 5FA4B 2HVKB 4AOFA 4MCYB 2APWA 1BZEA 4RFNC 5ENWB 2ZKMX 1XF3B 4LCWA 4JFDA 4DW2L 3GLAA 1G0YR 4HFWB 3G6JA 3QIBA 5JXED 5I8KL 1JNHA 2JKLA 4FL4C 1J1OH 2BWQA 3U4AA 2WYHA 3U7WH 3UZEA 3QUMA 3T77A 3AS1A 2B59A 3CZGA 3RWIA 3GNML 4FI7A 3IJEA 1WAEA 1PQZB 1UENA 5BV7C 5HGBA 1OCWH 4OZFA 3DX6B 2NMSA 4QXUL 5I1AB 2BRRL 3B9KB 3FO2B 5FO7B 5HHOD 1F6LL 4J3OC 2A9CA 3CVCA 3BPLC 4KTYA 3ARYA 3QG7L 3F6IA 2DLHA 2NY2B 4XP6H 1KPUB 4AZ8A 5ITFB 5C0RH 1NL0L 3GXPA 3SZKC 1KELH 3WE6B 4PI2A 1GY2A 4Z78A 3CZEA 2WNGA 3SYQA 5TK4A 3PNWB 3SGEH 4G2AA 3BESR 4QRAA 2Z9TA 4C59B 1JIBA 3L3GB 3Q2LA 3GINA 3TXAA 3V5HB 1YEJL 1FRGL 1CLCA 1X5HA 4NFDA 3T8XB 4LFHD 1H3GA 2ADFH 1FPTH 3WE1A 3C5JB 3ZL4L 1YJDC 4QHKJ 3X14B 4XPAH 2WLLB 3NIDB 4YLBA 4HKXA 5EU4B 1A6ZB 4PRPD 4P4KC 3MNWA 4U1NB 2J5LB 5D4IA 5LGJA 1J8HE 2YAOA 2BP0B 4S2SB 4BH8B 1JN6A 2XQYG 4IDJH 4MMXB 3HN5A 3BAIA 5CSZB 2AEQL 2WP3O 3GKZA 4WFEE 4KPHL 3BKML 3RTQC 4CUCA 2MMXA 3HRZA 3PGDB 5IW1A 4K07A 5KSVA 1VZIA 1KCKA 3FQXA 2ZOTA 4XBPA 3RWHA 1QG3A 4ABUA 3HBQA 1Q72L 4X8XA 5IMKB 1FO0B 3ABMB 4RISH 3L3JA 1AQDB 5LAPA 1BQHB 2EYSB 2FZ3B 4WUUA 5I66A 4MJJA 2QL1A 3CLEL 4H88L 1AG6A 1A02N 2DW5A 1MRDL 3B83A 1JWSB 3ZX1A 1JFQH 4XNQA 4G83A 5D7JC 3TYGH 3EHBD 1MJ8L 3GK8H 3Q6GH 3VXQB 2QQKH 3L4UA 2IOMA 2QVMA 1EA9C 4LRNL 3DETD 3BYYA 2XJKA 4PUBH 4HG4J 1H6FA 1BGXL 1FNEB 2DBLH 4FI6A 4S1DC 4UWQB 2GITA 1E9OA 3L95B 2EDBA 1DJWA 2X1PA 4RIRA 3ARED 4JB9L 5KYWB 5IR1B 3LKSA 2L7EA 3ECVA 2W1NA 3GUTA 2IGTA 2APBA 4J4PC 4OBSA 4C83A 1JD9A 2CDFB 5D1ZI 5D7HA 2K6ZA 1LWRA 4AQEB 3HMXA 5HGHA 1DZBA 1UXMA 4XC1H 3KYOA 1IARB 4L1DA 1DBMH 5DFVC 5JOPE 5F9WB 2ZCLH 1DQLH 5EO9A 3STZA 4B5ZA 4E5XB 1MY5A 1TCRA 4EVNB 5JIPA 2UWEF 2WMPB 2R2BA 4FNPA 3N41F 4LOFA 2VSCA 1N6UA 1N64H 3SIKA 5JXAH 1U4FA 1Y07A 3CDZB 5T3ZE 1AQ8A 1K6QH 2OCJA 2P80D 2NY6D 3DA0A 5E8NB 5HJ3B 3GBLA 3DO3A 1OZUA 5DR5L 2ZCHL 4LHQB 3CHRA 4ANXA 5E2VL 4LOUD 2IVFC 1JPTL 3MLXL 1O7VA 4AV5A 3G5ZA 4BRVA 2NNXA 2ZPKH 2Z93B 1VGKB 5TQ2L 4HUWA 3RTLA 1DVYA 4TN9A 3MGTA 2PN5A 2UV3A 4XNBA 4HWEL 3QSKB 1AGFA 2Y23A 1A1NB 2Q7YA 1G6RH 3R1GL 2VDLH 1P5UC 3APDA 1V7ML 3THMH 3HAEH 3RWIB 4UM9D 1NLDL 3X13A 4AXWA 3W2DL 4JHBA 1PEZA 4I4WB 3GLZA 1TJIH 3FBKA 4JDEB 2YPVA 1HKFA 2DQHH 2H6UA 4R7NA 4RNRA 4YE4H 5TF0A 1CD1B 3EYUL 3DNKA 1ZD6A 4HALA 4OT1H 4WKZA 1NIEA 1BJ8A 1Q8MA 1MFBL 3JWDC 3QIUB 4YC2C 4BUQA 5BJTB 2J73A 1IAMA 3S2CA 5F9JA 1GGIL 3QDGB 1H3UA 3U6RB 2QV2A 3LB6C 4P5TD 2WAHA 2O6EA 3TCLB 3QCVL 2VZ3A 4HVBA 1RUMH 3HR5B 3QFGA 2XRAH 4QXGL 5FCUH 1TYRA 4ZFGL 3GBMH 5D7IE 4R90L 1LVEA 3UTZA 2HLAB 1NCWH 4OKDA 1PAMA 5IT2H 1A4BA 3FQUB 3QIWB 2J6EH 1NGZA 3TN0D 1I3RB 2Y2TA 4WTZA 5JW4R 5D6CB 3ABZA 2D31B 4U1GB 1J11A 1Q0EA 1I4FA 2HX9A 4KUZL 3U2SA 2IJ0C 4XMUA 1PFOA 1HL4A 2Y06L 4N28A 2QSVA 3FUKA 3HNVH 5DLLA 3NFPA 1IC4H 4XH2A 8PAZA 3JV0A 3AAZA 3BKCL 4KJPC 3LDBC 1DVUA 4N0FB 4ZDHB 3AB0C 4JO2L 3GBDA 4UT9A 3QJTB 4AYDC 4OF3A 1UD6A 1CGWA 5B1JC 2DIAA 4TTDD 2DQEL 2ZCZA 3NA9L 4YQXL 4MA3B 4GXUN 4XNQB 3L9YA 4OGQC 1KLGB 1BEYL 4ETQB 2EDWA 2C8NA 3VG9B 3RG1C 1MELA 3ARXA 1OSYA 2PO6C 3QR0A 3U6XS 4M5ZL 5FYKL 2N01B 1UACL 3CH1B 1KTDB 1KXHA 2EC9U 1E9OB 3DK0A 2H2SC 3S5ZA 1GZPB 2EINB 4DPCX 4R3SA 5A7EA 2NY0D 4CMHC 5A43C 3IPFA 4GLRH 1KGJA 5C70A 3KGUA 1WTGT 4F93B 3GUTB 2Y3NA 3RI5F 1HZKA 2YSSA 4ZS7L 2DQGL 5BO1L 1FSKB 2GK0B 1JNNH 3VMNA 2X2UA 3JTSB 3WKQA 3NVQA 1SEBA 1WBZA 3KLAA 1RJZB 2EXYD 4X98A 1ES0A 3EO1B 4Y1AE 3ARWA 2X4PB 4HS3B 1FZMA 2CWRA 2R2HB 4HUUA 3UP6A 4X83A 2KPWA 4JN1L 1IGCL 4PJXA 2N0KA 1W72H 1MLBB 4D9LH 1CDGA 2WAQA 3UIZA 5A2IH 3TO4C 5FHAH 1XDTT 1MJUL 2J1WA 3JTTB 1SEQH 3S3PA 1I31A 2FWLB 2V7HB 3CSYB 1UT1A 1NGPL 2QQQA 1KY7A 1MFEH 1XAUA 1Z0NA 3JYCA 5CGYC 3QZWA 5AKRA 5DUJA 3VFMB 4QR7A 4RRPM 4Z7QB 4JZNB 5CP7A 2DJ4A 2A9BA 3ARDB 4QY8B 4HZLA 4JREB 3ZDWA 3MV9B 3D25B 2ERJB 1UZ8B 3FU7A 5CN1A 3DXAA 4X6CF 1RPQA 5FGBC 5F8QC 1JNLH 1KZQA 1IFGA 4P2QD 5IQ9B 2QT6A 2Y5TA 1S7WB 2VLMD 3RZCB 1ZGLP 3EOAA 4ZO7A 3OWRA 3BN9C 4E41D 1HOCB 3FNKA 3MLUL 5HY9A 5GRVL 3O3DB 5KVEE 2CG9X 3VD9A 3HG3A 2ZKHL 4P2YA 3A21A 3I3DA 3B7TA 4RGNC 5BS0E 1EFXB 2BOBA 5DQJA 3AS3A 3FO0L 3RYMA 5C09E 3B8YA 2Z0UA 4H1LH 3C60D 5HGDB 1CFBA 4OLEA 4KVNH 1ZXQA 4X4ME 3X1EA 1DUZB 4PJ8C 5F7LB 2CNYA 4S1SL 5KSUA 5IVNA 3VU1A 4F7PA 3L1OL 1S3RA 3GO1H 4N2BA 5HI3C 3IDIB 3JVGC 3SJVE 8CGTA 4PM1A 4N2AA 1MFAH 5DT1L 4IIQA 2H2PD 4GG6B 4M1GH 4LEBA 2FIKB 4IBLT 4ZFFB 3AXLA 4AQ1C 4NAQA 3PIQA 1AGEA 1SBSL 2W65A 3CHPA 2ROYA 2R2EB 4U31A 2IOIA 2YQ3A 3IWVA 5CGBA 4PW4A 2YUXA 1QA9A 1E5YA 1ZLSH 3D0AA 3AW5A 1IKNC 1YUKB 2X9YA 5TD4A 2YMTA 2R59A 4WU5B 5DHDA 3ZR5A 2DJMA 3VFUA 5FUCE 5F9OH 2XN2A 3JV5A 2CUMA 2A9MH 3AAZB 1FZKA 5AVRB 4BSVA 2BRQA 3X14A 4MNGB 3VFWA 2DDQL 5JPMB 4Z8FH 2ZWYA 1NKGA 3FCSB 5D2NE 4XP9L 3KYAA 3P4LA 1HOEA 3BLBA 5IK3A 1F3JA 5HD8C 1XX9C 1BLIA 3LN5B 2ZD0A 5JYLA 2O93L 4K9EC 2APFA 1IGIH 4NZRL 1U91A 3ZTEA 2WTOA 2V7NA 1IEBA 1MVUA 4GKZB 3APFA 4TVPD 4Z7VF 2AZUA 2XX1A 1DO5A 4TULH 1U8IB 1C7TA 3FULA 2VT0A 4FQLL 4NB7A 5DJZB 3RILA 1YY9D 4GAAA 3WAJA 5KS9A 1TT6A 4WSGA 4HU2A 2BSRA 3F58L 3B6SB 1ZT4B 3HVDA 4GYBA 4X99A 4N2IA 3WIIH 2VLRB 3L16A 1QMUA 3ZKNC 1RXLA 3OTTA 3KBPA 1GXEA 2QHRH 3U0PB 3K2KA 3U9UA 2HMID 3DROA 5TE7H 4AYBA 2X5PA 5FV2A 4PP2A 5JDJA 3GTTA 3GSOB 4XI5C 1A64A 2CO3A 3BP7A 43C9A 4AMKL 5KUKA 1FZMB 3O0RL 3X11B 3TPKA 5IB5A 1BD2B 1P84K 3N6YA 5ESQA 1FZJB 4TQIA 2PMZA 5SV4A 3UH8A 5HI5C 1NOFA 1MCLA 3CCHA 4Q9BA 4Q6KA 5FUZL 4ZX3A 3MLRH 2ATPA 3FYIB 2YBRA 2HPOA 1UASA 2GTQA 3V0VB 3MACL 4OI7A 2NR6C 1BG1A 3UBGA 2WKLA 4UI2A 5FB8B 2ATKA 1DBBL 3C09B 2MQ3A 4LDOB 1L7TH 3II1A 2GY5A 3JYBA 3MBXH 1MHHA 3ZE1E 1JI1A 1N18A 2FEJA 5ESAA 4BKTC 4Y2DB 1XAKA 4IIZA 1CE1L 3SOBH 5C0NC 3ETSA 3N91A 4M3HA 3WEOA 3F00A 1PKQB 1CTOA 3B3IA 4PJGF 4LAQH 4PBVC 5GZOD 5DHVH 4DWHA 3DHJA 2KH2B 3TIEA 5JHAA 4FFWD 4Z0XA 1UA7A 3VDAA 1B88A 2V9TA 5SWZA 3BAKA 4FAAB 2X10A 2Z4TA 4X50A 4N1HB 3JT0A 4G1EB 2V9RA 2BOBB 4JAMB 3TONA 4CBZA 4F7CA 5JW4M 4X7CC 3NDYE 3N1FC 5MHSD 3FONB 1FH5L 4OLZL 1ZTMA 3CD4A 1ZHLB 4F57L 5JUEH 2JXMB 3G5YA 3PS6A 5I24A 3FOMA 2AV7A 5I5JA 3S36L 1BM7A 1N59B 1T89A 3OC8A 3MO1A 4XR8C 2PPDA 3JUZA 2WBJB 3OKDA 5BS0A 1BQ5A 2FUTA 2NX5A 2ZYIA 4PIBA 4UTBL 4W4OA 1HHIB 4XN4A 3VFGH 4F15B 3ULUH 4RWHA 1E27A 2Q76A 3QUXD 3VWJD 3WIAA 1CXEA 1Z3RA 3AXLB 2QADD 5CIPH 5C0CB 1TLMA 1TVHA 4X4MA 2I69A 4EIZC 1KTRL 4PB0L 5E6YA 3ZW3A 2J88L 2Q9OA 2BM3A 2XXFA 2ZYHA 3IGAB 4IMKC 1TETL 4M61B 1IEHA 1SY6L 5J13B 3GLDA 3DLQR 4Y5YB 2A4EA 3MRGB 3ZUNC 2F1AA 2GTWB 4XN2A 1JRHH 4WDIA 2PLTA 5E4IA 3D33A 4P9ML 5B3JF 3OZLA 5DJCA 5JZ7D 3X3GH 2XWCA 1BREA 4K3DL 4DP7X 2Y2YA 2R23B 1T83C 3MCLL 1KJ2H 2J72A 3PFUA 4UOQA 1E3FA 3QHFL 5IB3A 1YSOA 4ZOAA 2YGPA 4N8PA 2OMUA 1ZA6B 4MA1B 5FF6A 5DZAA 4A6YH 5F0PB 4N20A 2X3AA 1WD8A 3U46B 3I85A 2APVA 2DWTA 2YMXH 2ZNXA 3D3VB 1IEBB 3OR7B 4NFCA 1PZSA 1XCWA 5F7BA 1I1AB 3SQOH 4I8DA 2CALA 5JMRA 3RIKA 4L8BA 1EMTH 1OOWA 5KS9B 4G9FE 3GZQA 4OLYH 1KGWA 4QYOB 3RGVA 2EDOA 1Q94B 4KUCD 5EN2B 4NHUB 3SD2A 3MV7B 2EIBA 3UTTE 4Z3HA 3UABA 4AYSA 4F9LC 1W8NA 2QJDA 3QUYD 1URIA 4HKBB 4QRPA 1MCPH 4U6YB 1MG2C 3M1BA 1SZNA 4I0PB 1I7ZB 5HGAA 5GHWL 5D1XE 3SDAA 3RRQA 1OV8A 3BKYL 1NC2A 3QWRA 1WIPA 2FGWH 3ZRCC 4HWBH 5I1HL 2WQUA 4M93C 1R5IA 4YK4B 4JHUA 4QXVA 1M1XB 1ETJA 2VXVH 1GGBH 2VLJD 4GMTH 3O4LE 3C8DA 1J0YA 1S7UA 2OL3L 5J4MA 3QDME 1YMMB 2DLIA 2A77L 1QI5A 2CUAA 3ESNA 3LIZL 4M1DL 2IQAA 1ACYH 4LARL 1TCMA 4Z7OB 3N9GL 4OM1H 1AGBB 1WA2X 2AF2A 2J8UB 3VACA 4FFYL 4Z5RB 35C8L 3K6NA 3P9LA 5MERB 4PJHB 5KYUB 4LL9A 4G5ZL 4OH2A 2FDBP 5LQBH 2WXIA 5LGYA 4D7BA 3HZYA 4HJGA 4PRDA 4UIKH 2IXQB 3CX5K 4YS4A 2P5PA 3DOSA 3B3IB 1M6OA 4QHUB 4AJVA 7TAAA 1K4DA 2V5RA 3U0WH 4MD4B 4DH2A 1WAAF 5JPMC 4Z7WF 4I1PA 2ZE0A 4JY4A 1CL7H 5T33H 3RX5A 5LAXB 4AY0A 2DD8L 1NCJA 3GD1C 4WGVB 1CGYA 5HDBF 5C0FB 3BEWA 4PVLA 1RLBA 1XF2A 4LSRL 2K4AA 2O6PA 3RX7A 5IB1B 5T1KB 4RMBA 1CIDA 32C2B 2OAAA 3J7HA 3BD5A 2Y36H 2ESVE 3WJJC 2XTJD 5CEXB 3RDTC 1F42A 2MOGA 4HXBL 1JMZA 2ADIA 2IQ9H 3EFOB 4QJ3B 3OKDB 4ALAH 4K7PY 1PL3A 2CRZA 3V95A 2RHEA 1PD6A 3G08A 4OZHE 4OCSH 4BXVA 2D7TH 2AJXH 5DRXB 1QBBA 2BS8A 2W8CA 3QQ3B 1L0QA 2NZ1A 1DVQA 1UXSB 2Y7NA 1NEPA 1NJ9A 3S97C 2YFNA 4S1RH 4PJ7F 4QRTA 1XEDA 3F3HA 1WFTA 4WEBL 5EOCJ 4D9QE 1I1FB 5DJCB 1J0ZA 1BFOB 2WSKA 3WFBL 1BZ8A 4R4NC 1EJ6A 2ZAIA 5F88A 4DN4L 1CR9L 3DRQB 1OSPL 2XWZA 5HVFB 5E51A 2YD3A 1VLXA 5IB3B 1XXFC 1OF2A 2QTEA 3P4MA 3IETA 4C8XA 4OZIB 2MQ0A 1XH3A 5H35B 5DMGD 2W0FA 1YNTB 2F53B 5EC1B 3RUGF 4OB5L 1D3CA 2O5XL 5E03A 1RK1A 4RZCB 2QHLA 3K5SA 4YFDB 3KW8A 3KDMB 5GS1B 1P7KA 1R0AH 3IDYB 5FYJD 4QTHA 3MRBA 2E0PA 4XXDA 4CKQA 4XMLH 4J3OD 3MLYL 4PTTB 1JK9B 2FJUB 1JD7A 2PCPB 5JHBA 1Q0XL 1U3ZA 3VWKA 5DD6B 4DK5A 1YECH 3PV6B 3VI3F 2NZ9C 4TF4A 3EO0A 2Z0BA 3QQNA 3N40F 3HN8A 1NCAL 1FLRL 3BMWA 3DHMA 5DFWH 1E8ZA 3UTTA 4YBLB 4CW1B 3OKNB 3WTSA 5DK0A 3OJVC 4BZ1L 1LK2A 1YPZF 3MV8D 5CBEB 5JIMA 2EH7L 2B5IB 1LDSA 5LCVA 4Y4HC 3ULUC 5D7LE 4ONFL 3C6LA 3A22A 1P84J 5D1XA 4M43H 1AD9A 4KKPA 4WWKC 1IV8A 2R1WA 5FAAA 4X5WA 1ZMYA 4WW2B 5BZXA 1BAGA 1AG0A 3VH8A 5AW5B 1L9OA 3D69B 2PKDA 3VG0L 3K5RA 3NP3A 4JM2A 4UYQA 4AYEC 5D9SA 3WUWG 3B3BA 1BPVA 2QQLH 2IGFH 4KROD 4P2RB 1BVOA 4DVRL 3KZ8A 2PCFA 2IH1B 4P46A 1P7HL 5IJBC 4QCIB 3OAYK 1N6QH 3ZUCA 2FX8H 4X4ZA 4JR9L 1MVFA 1OPGL 4OCXL 4H8VA 3SE9L 1FVCA 5LGKA 3K6DA 3KCPB 3OMIB 3POHA 3CIAA 2CMRL 4TNWF 4E9YA 2V9UA 2JCCE 3GGWB 3K6SA 2FL5B 4Y1TA 5L7XL 4G3YH 1NANH 2GHWB 3PXHA 1RSFA 3EH4B 3HUJF 4LDCA 4OGXL 4PJAB 2JKTM 5B1CA 1IFHH 5I6KA 3ZDYB 1KG0B 3VSUA 1MNNA 4I2XB 4C56E 3QIBC 2LU4A 3TA3A 3SGJC 1TPXC 2KERA 5ID1B 1WZMA 4KNUA 1ONQA 1Q9WB 3BHBB 5IEKA 1PZUB 3BPNC 4FTVE 3CC1A 4O5LH 4XNZC 1OXYA 5C2UB 1BOYA 2AAVA 4A38A 3FTUA 3Q9PA 5EDXA 1QWNA 4XBEL 5C08B 2H4EA 3UYRL 5E0FA 1VKXA 3HS0C 2B1OA 3PHOA 2VDML 1GHFH 4ZS6D 3AY4A 1XEUA 3NIGB 3PWVB 3QXTA 1NDMA 5EPMB 3M88A 4OIIH 5LWYH 1Q1JL 5DFVD 4EF3A 5GSVA 5G4NA 3V5KA 3DGDA 1U8QB 3P9WB 2BO0A 3FH5A 3LQAH 1CGTA 2DQDL 3IYLW 4P59L 4QRFA 4V33A 5TDNA 4MJHA 1MHPH 2W5PA 4CILA 1RPUA 1FL5B 3FT2A 4HS8L 3MUY1 3FRPA 4HWZB 5ECJE 1JHLL 2WJ5A 3UGUA 1QLFB 2O5YL 3ILPA 1NAML 1U8NB 4PJIA 1MIEH 5DSCA 4CDGC 1I9JH 3GMQB 5D1ZA 3V4UL 5KBKA 1T04B 1LO0L 2HT4D 4NM4H 1S9XB 3MRNA 4KJYA 4CDHA 3GSUA 3HPLA 2WYIA 2CR0A 4ZMYA 2UY7A 1PVHA 1R3LB 2P5WB 2XXCB 3NGBC 2W92A 3K0WA 4UDTA 4XPHH 5GGRA 2PR4H 1U30A 4JKLA 3FU9A 1MAMH 3UADA 4DZ8B 2NYKA 3DJ9A 3FCTB 2EVFA 1GCYA 2F1BA 3W0WD 1OAKH 3VD0A 4OFYD 3FCGA 1IE4A 1MAJA 5T3ZH 3W5NA 1PPIA 4GI6A 4GBXB 4QRRB 1SLUA 3BDXA 3G5XA 1OK0A 4D8OA 3HRZC 1WPCA 3WKYA 3AQYA 4P3CL 2VDMB 2BPBA 4NUGL 4NO3A 2V3EA 4U1JA 1ZSHA 3LRLA 5DJ2B 2VQ1A 2UXVA 1RIUH 3HI1B 3NCBB 4PRBA 2ZJSH 1A2YA 2P9RA 3GRGA 4HGWB 4D3CH 1G7PA 1GOFA 1SDAB 2A6IA 3WNNA 3UG4A 2WCPA 4TVPL 1LWJA 1WSST 3AXHA 1DUYA 3FTVA 5H94B 1A7NH 4ZMPA 2D7OA 4B60A 2Y7QA 4KQ4H 4O4YL 2P24B 3GMMA 2HVBA 1QHQA 2EIKB 4LLQB 3LB6D 1XB8A 3HZMB 3TV3L 2EVIA 1TSHA 2JTYA 4ALAC 1CDBA 1Y1UA 2GT9A 4A7TA 1F6AA 2PF6A 3GS7A 4QXTA 3AQXA 1TZ8A 2XZAH 2AJ3A 2VDRL 4PRHD 2CO2A 3DTDA 2WN2A 1LQBC 5D7KE 2OKMA 4U2ZA 1BDYA 5MENB 2J8OA 3GSQB 2EH8L 4HT1H 3QNYB 3SKMB 4G1MA 4JM2B 4YAQB 1R9FA 4MZRA 5D71H 1TQUA 5IJVA 2AVFA 5D1QA 4IKLA 1NUNB 1AGDB 1E3XA 4I7ZC 1EPFA 1P1ZA 2VJXA 3GLEA 4GEIA 4KJPD 4GS7B 5PAZA 5HYEA 3KJ6L 3GS4A 3QXAB 3HHSA 5D72H 3V0WL 2B2XH 3QJQB 4OFPA 4U1MB 4F2EA 1Z9NA 4NZTL 4WNQA 5HYSA 5JW5B 4DN3L 1Y6NR 1JZ8A 2EVGA 4XN9A 4QGTA 3MR9B 3CX5J 5DK2A 1HL8A 3RWEB 2Z1PA 4UU9B 3TEXA 2VDKL 2YD1A 4ZMWA 2OSXA 3KDPB 3MLVH 2CA4A 4OAWB 5F8RC 3FT9A 1XH0A 4Q0XH 3ZL2A 1YYCA 2J5WA 4HPYH 5JMOC 2ZXDA 4EUPA 4U49A 1F2XK 2PO6D 1UT9A 5DS8B 2IAMB 4NX0A 3Q44A 1D9KA 1KGCD 4I3RL 4K3HA 1DHKA 5CHNA 4ZMLA 3NIDE 1WUZA 2CCVA 4PR5A 3HKZA 3ETBF 4QRQA 1EQWA 1XL6A 5E2TH 3IS1X 5EBWB 1MOEA 3V4LA 4XX1E 3ROLA 1BLNB 1R47A 3K2UH 1CS6A 1UYWL 4FTVA 4G43A 1QUNB 1A6WL 1AXTH 1UT2A 3FFCD 3LRGA 4LP4A 3MRCB 5GSVB 4DEUA 5FDWA 4OR1A 4PWEA 1PW3A 1C8PA 3E6FB 1TJXA 1WZAA 4ZW3A 1M2VA 2H32A 2I85A 2HA1A 2ITDB 4JFFD 3HMWL 1CICB 3V4VA 3RL1A 4LF3B 1B4LA 5DJXA 3WFCH 1AJ7L 1G7LB 2XKNB 1I82A 4KMTL 1Z9SB 1DSFL 2OR9L 1PLCA 2J55A 2YGNA 2H3KA 5F6HI 1AZCA 4G8GB 4XCCL 2X2IA 3GDCA 4RAUA 4X8JB 1FL6A 3GSUB 1GKOA 3MLTA 1NFDF 2A6JB 5EU6A 2XIIA 2ZX6A 3LZQA 3QUZD 4HSAC 2EECA 2FBJL 2BNRE 2VZ1A 3V0DA 3ARGB 3DMMD 4LSPH 3SBQA 2WBXA 2WVSA 1GZQA 5F7DB 1UJTA 2BY1A 3JZYA 3PUUA 3TBYA 4XB8A 1I9RH 1KPRB 5J3HC 5HHXH 3N40P 1EXHA 1U3HD 2X0WA 1GMIA 5ICZA 2VDPB 4YBQC 5J57B 3E3QE 1HCZA 1M9WA 2DTML 4AH2B 1AFVL 3QEQD 3K1KC 2HVJB 3BMVA 3V2AR 1G7QB 4MASA 1X7QB 1B0RA 4DEWA 4M6NH 3KXFA 3SE6A 4QWWC 4X7TA 2A6IB 1DSWA 2ZICA 2IANA 5BVPH 4BFEA 1OHQA 2YRZA 1QFWH 4HJJL 2LABA 4RMQA 4S0TD 1L7IL 4RGND 4UT6A 2VITB 1MWOA 3FKUS 1N3NA 2NLJB 4ZUSA 1JHTA 1MZZA 2CO7B 4G8IA 1X44A 4Q56A 4XP4L 2XN9B 2ZOLA 4C57C 4LE8A 4UUJB 4NKIH 4AV0A 4G6JH 4KI5C 3LJ3A 5E9DB 4NJAL 4PJ8D 4FXGB 4LCCB 3U4EA 3VD7A 3PDDA 4BFIB 2WGXA 1U3YA 2MOVA 3AADB 3PWNA 4EO5A 5FKPB 1XGQB 3U30B 4HJEA 3SKJL 4PVBA 4AUYA 4JFPA 5HPMB 1JFHA 5J11B 1AYRA 5KVDL 4A2MA 3GMOA 3NACL 1RIVH 4KRLB 3TBBA 5C0AD 4WF7A 2J7LA 2YSTA 2YS4A 3LQAC 1E2ZA 3EIFA 1FV1A 3SYPA 3HPJB 3HNTL 4WUKL 1VPOL 4V2BA 2LTQB 1TQCC 1T6VN 2E27L 1IIIA 1T2QH 3FQYA 1UD2A 5KBMA 1FFQA 3QCUH 5GRZA 3K7UA 1KGIA 2FJGA 3VI4A 5J06A 4XAKD 5E8EA 2JELH 1UCTA 4PS3A 2VSKB 5I1EL 3CFIC 1PY9A 4QHNA 4Z3FA 5DHMC 4URKA 1Q90A 1LP9F 5HD8D 1J5OH 1OD7A 4MJID 3D06A 1U3JA 1E43A 2HFGH 4YZFF 3UBXG 1P4LA 4JGJA 4DCQB 3HFFA 4NNPH 2ENSA 3OX8A 4HIEA 3E38A 2QPSA 4OF7A 3GM8A 4GRLB 3BH9B 1AHWC 1MFCL 2P3YA 3AQZA 4TL5A 1F4WH 2P8LB 2HT2D 3NRFA 4OU3A 5AD0A 3MXWH 2VXQA 3K6IA 1J05B 2BP8A 4R8WL 3LX9A 1LXMA 5A40E 4ZXBA 2OI9C 3SDDD 3LXAA 3P11H 5I8OH 2X9WA 3ZKND 4F2ME 4LSTL 1IQDB 4HMCA 2OMVB 4KTDH 4RGOL 4XO4A 2NYYC 5J12B 3CQQA 2FBOJ 1MHCA 3KYMA 1A1OB 5IFHL 2CZNA 4M3KB 3D85B 3O2WL 4XI5D 4F1ZA 4AGNA 4P23D 1FL3B 2AQSA 3RX8A 2G9HA 4XP5L 4CRPA 3KPSD 3OQRA 3SE8L 5CJ5A 2W9EL 3U48A 3HE7A 3T0EA 1T0NB 5F9AC 2E6PA 3GSXA 2ICWJ 3FC8A 4FG4A 2V9QA 4IGBB 2DAVA 5I74B 3P0YL 4RAUB 4JKPL 1C12A 3PWJB 2AQQA 1OGAD 4RZKA 3BGMB 3ZHNA 5J1AB 2CU9A 5EBLA 1MIMH 1NMAH 3GSVB 1VCBC 1YA5A 3BW9B 4IIQC 4F8NA 5DQDH 2DKMA 1YN6A 1ND0B 3F7RA 3EG9B 3F7QA 3QHZL 5EZOL 1G5GA 2X4OA 4HEPA 5ACLA 3CNKA 4H13C 1SDDB 5IFAL 4DJMA 2BNRA 4NQCA 3TT3H 1I8KB 2WN3A 1MCSA 4WFGE 4OCRL 1TTUA 2FLMA 2FHFA 4OD1H 2NXYB 2D03L 3ARFA 4L3EB 1T3FB 4H8WL 2X4SA 1LILA 4UYPA 3HG0A 2IANB 1CFVH 2ED6A 4I89A 4NRZA 4P57A 1RHHB 3O3UN 4R4FH 4QHPA 3WN6A 1I1CA 3IJSA 1REIA 2VZSA 2H3XC 4FQPA 1ID5I 2Z4QA 1BM3H 4MAYB 5EIIG 1E6OH 4LSQH 1G9NL 4U1HB 5DWUH 5IBLD 3GQFA 4FS0A 1NBZB 2ISDA 4MNQB 4FHBD 1HIMH 4YDZA 2X05A 1S7TB 4JHWH 1T5WB 2WHVA 4R2GD 3VRJB 3MRMB 5IKCA 4UZSA 1A7RL 2AK4D 2JTDA 3AUVA 1HILB 2EEBA 1W0YT 4Z7QE 2ORBH 4QTFA 1KWGA 2JB5L 2Y9RT 2WD0A 1J9TA 4JG0L 3MV9E 5DF0A 4Y4KA 1EDHA 4TUOA 4WI0A 4TOYH 3VYOA 5FKAA 3TH2T 4U3CA 3ARPA 1R5VA 2FSEB 3CWGA 4HSCX 4Z77A 4X6BB 4PJEA 5F1NB 2CHNA 3BZFA 4X4XB 1EHNA 1GH7A 2D7PA 3F5WA 2CLZA 3BN3B 2APTA 5KYYA 3SCMB 3VM5A 3I84A 2IO5A 5KEZA 3BGFC 3HZKA 3SDCB 2YC1A 1NGXA 3RNKB 4HV8A 1IM9A 5DMIL 5FXCH 1O6SB 2O72A 1IAOA 4N5ED 5L2KB 1RSYA 3BH8A 4N8UA 3BAXA 1JL8A 2DL2A 1B4JH 4L9DA 3AU1B 4FNLH 2NXZC 4NWTH 4R4BA 1VACA 1HXMB 1DVSA 2ZT9C 2OV0A 3QZBA 5BCAA 1HT6A 3ZTJG 1XCTA 2VLLB 4GG6E 4BZ2A 2R4SH 1A1MB 4L4VB 2NUPB 5E1AB 3C2AH 4XCYA 2OMZA 3VXUD 4JRYE 1TTRA 4F7EB 2PYED 5C7XL 3RGBA 1QR4A 1E2WA 1Q9LA 2BIMA 2EXSA 4LEXH 3JV4A 4X4KA 4D8PA 3UFIA 3DV6B 2NY1C 3WUWB 5SX5K 5I1CL 4PY7A 1PG7H 3AT9A 2V2WA 4HJUA 4AE0A 3D34A 4NJ9L 2C1PA 4HSQA 4B27A 5IOKA 2MTAA 1DDHB 1JTOA 4LHUA 4F2MA 4QI3A 3LHAA 4HOXA 3IJYB 4TUKH 1RQ5A 4PQXA 4YPGB 5AAMA 1QTPA 4PS4L 3ARBB 4HJ1A 3KR3H 4MNGE 4RDBA 5HJGA 1YEFH 3VFPA 5CKGA 1J10A 3WTWA 1DQTA 1YLBB 3TPUB 2VZUA 4NRXA 2AVGA 1MRFL 2O1AA 1TMCB 2LFEA 2BP5M 3IGFA 4X6DA 5AVWB 4FFVD 3HHMA 2YR3A 5AZ2H 4PRNB 1T89C 3BIKB 4ZD3L 3IMRA 3TM6A 1B0WA 1N2RA 3HE6B 5CO1A 1UTDA 4NPYA 1S7VA 1JPSH 2AMUA 2HWZL 1BECA 4FYTA 5CCGE 3T6VA 3GHPA 4OLXH 4K5LA 2X70A 1C08A 1MI5A 2X1OA 1KT2A 2G5RA 5AEAA 4EDWL 3C87A 3KWXA 3V0GA 1F56A 3HG1D 1U2HA 3GRWL 5IV2B 1X4XA 4P99A 3FQ2A 1KXTB 2WNXA 1A22B 4FQ1H 4J3SA 3LEYH 3LXBA 5ALCL 3T9WA 4GT0A 5BZWB 1CVRA