5T1LB

Cetuximab fab in complex with cqa(ph)2dlstrrlkc peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
221
structure length
216
Chain Sequence
b'EVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CETUXIMAB FAB LIGHT CHAIN
publication title Natural and non-natural amino-acid side-chain substitutions: affinity and diffraction studies of meditope-Fab complexes.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 45
structure length 216
sequence length 221
ec nomenclature
pdb deposition date 2016-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t1lB02
4UTBL 3QG6A 2IPKB 3V5HA 4RFOH 4LPXA 4MXVE 1T22B 4PB9H 2LU4A 4JFZH 3SY0B 1T66C 2X5PA 2WP3T 1DUYA 1FZJA 1FORL 1FZMB 1SBSL 2WBKA 2WLYA 3GBMH 1CFQB 5HHNB 2DOCA 1TVBA 4PG2A 5KOVC 3K74B 3DSFL 1NCAL 3VFVB 5EPMB 1RJYB 2GT9B 4JJ5A 1DBML 4GW4B 5EU6A 2FB4H 1R24A 5E00A 2ZZUT 4BFIB 1WICA 3FHQA 2XNAB 1HNGA 4XHJD 4Q9QH 1BX2A 4G9DA 2HTLD 5DJXA 1AD9B 5GRZA 1RUMH 4P5TC 5EFIB 5F9WB 1OPGL 4QWWD 2VXTH 3D2UA 2L0DA 3W2DH 1KCRH 4JFPA 4QHUB 2VLJE 2P48B 1A0QL 5D5ME 2K1MA 3P9LB 3T8XA 3FFCA 1IT9L 2P8LA 3TV3L 3L7FB 3WL9A 2EZ0D 4GUPA 2W9EL 3CFKA 1OAZH 2LAAA 4XVUC 3VXRE 3OJ2C 5EU3B 2OZ4A 2FGZA 4N8VA 4OIBA 3RUGE 3RWFA 2HVJA 2A6JB 1J7VR 3WMSA 3BDYL 4R8WL 1NAMB 1EAPB 5C8JA 1HYSD 3C6SB 1MCCA 4M6NH 5FKPB 1BZ7A 4KFZC 3V7AE 4MYWB 4FTVB 4PYGA 3QUZC 3RIAF 4D94A 3RKPA 5I71C 3RIFK 5I1EH 3TBWA 4ZFOL 5IHUH 1EO7A 2ICES 4GRWE 4CN4A 2HN7A 5FCUL 2VMFA 1AKJA 3FB5B 1KCKA 5CEYB 2APFA 5E08H 4EJ1C 4GG8B 5FYJE 4X6EA 2R1WA 5JTWA 1KFAL 3S3JA 4R4NC 1LO4L 4PJGA 4ZFZB 3QIWD 4M7JL 1F42A 3VXMA 4HZLB 1FAIH 2BVQA 2Y7QB 5EBMB 3VFUA 5HDBE 2Y6SD 1QLFB 4RX4D 1AGBB 3QIUD 1G9NL 1OWWA 3MRBA 1TNNA 4OUUA 5CKGA 5L8JB 5IW6A 1A7OH 5E8OB 2VQ1A 3C09B 3KYNB 1QA9B 3O0RH 1KCSH 2V5TA 1R3KB 2ENYA 3VFWB 3QFDA 4R96B 5EIQA 3JV4B 4XHJC 3DYMA 4NJAH 3BHBB 3B6SB 3E1F1 1NANH 1RUAH 2JJTC 4QWWC 3X12B 3KLSA 3QO1A 3ULSA 5BO1H 1IGFL 1FFOA 2PXYA 1A3LH 3QNZA 1I9EA 1UT9A 2VDNH 4HJJL 4NN6C 1YEDB 3VGHA 3FT2A 3P11H 1Q8MA 4HKBB 5DJ6B 4NHCL 5I6XB 2AKRB 4LLUA 4U0RB 3LCYA 1RZ8B 3FKUS 3U9PH 1W0VB 4LVOC 1JMXA 4KK8D 4XNYH 5DJYB 4NNXA 4NBZB 3FFDA 3ARUA 1HYSC 1LP9B 2VXQH 5GGVH 4MCZA 2B0SH 3HNSH 1E28B 4FFYH 1SHMA 3JVGC 1LO3H 5I66B 1TCMA 2DBLH 4FOMA 3WNNA 4X4XB 4LLYB 5DD3H 1Z2KA 4YZFF 1JRHL 1KG0A 5HI4C 2Q86A 3QXTA 2VERN 1IQDB 5B38B 2FBJL 2AI0H 3QI9B 4HKJB 2BVOA 3SDCA 2OZ4H 5HD8D 4KDTC 3DGGB 2PYED 2WINA 3LEXB 4GXUM 4X6CE 3B4NA 3VXUB 1CT8B 4RFOL 5EUOB 3O2WH 3QIUC 4OGAD 1HINH 4IOFD 4P2OD 4U4BA 4D8PA 4JFZL 1A47A 3TT3H 3Q5OA 3T77B 3ZYZA 4JQIL 5D7LA 3GBML 1YNKL 4YNYB 2ZSVB 1OTUD 3QIWB 3BZEA 2I9LA 5EO0A 2FEEL 4WU7B 1IAOA 5D7KD 2ESVE 4W4NA 5IBUB 5C0DB 3PWLA 1NUFA 1ZHBB 5F7DB 1RQ5A 1KJVB 3BP6B 3ZTJH 4ONHB 1DEEA 3HE6C 1RUML 1Z6JT 3VFMA 2FRGP 3W2DL 1KCRL 1T4KA 3CPLB 3AUVA 4XXDB 2VL5B 4AYFA 3KPLB 4IHOA 4LHQB 5ACMA 2WV3A 4X5LA 1OAZL 1MHHA 4H1LG 5J6HA 4D9QE 1MCOH 2X4QA 3BIAX 5KSAB 4EI5D 4KK8C 4WDIA 3MRRA 2AVGA 4ZG1A 1Q72H 1BVKB 5EOCJ 2KDGA 4DQOH 4WV1C 5D2NB 3D69B 2LAGB 2EKSA 4AIOA 3GM0A 4M6NL 3T2PA 2HFFB 2F54D 2JKXA 3MRFB 4KKBD 2V5YA 5INCB 3MGTA 2NYYD 4Z95H 1J18A 5E08L 1YEJH 5EORH 1OP5K 5E99H 3O4OB 1H5BC 5ERWA 2X4PA 2WK2A 4KJQC 5TDPB 1XR8B 3JTSB 4WO4A 2FECL 1FAIL 3MLZL 2ADJA 3H9YA 4OGAC 4RQQA 3WHE0 3C60D 3NABH 1IILE 1UACH 1J0IA 3CSBA 4LDLB 1A4JA 2H3NA 5BRZB 1X6NA 2ZCLH 3SDAC 4AY0A 4KTDH 4JFEA 1ZLWH 4YR6B 4YIQB 3RY6A 4HWZA 1B4JH 1JTOA 3F58H 3O0RL 2PYEB 1KCSL 5C09E 1MREH 3IU3A 3ALXA 5C0JA 1MY7A 1YMMD 4P2OB 4NJAL 1ZVSA 4P3CH 3VWJB 4C55A 1RUAL 3H9HB 2P24A 4HSQA 5BO1L 1I1CA 1MCHA 3TF7C 5HDQH 3V5DA 4ZD3H 1A3LL 1AE6H 2K7PA 4RGMC 1C7SA 2VDNL 5MEOA 3EO0B 1K5NB 1XGPA 5A16B 3ARFD 2XG4A 3P11L 1H3VA 5E6YA 4EI5C 3RZCD 2JJWA 3CC5A 4HS3B 3U9PL 4JLRB 1GZQA 4XNYL 4JM2A 2DF3A 5J06A 2VXQL 1RK1B 5GGVL 2B0SL 2F5AH 3HNSL 3O41A 4FFYL 1CXFA 1LO3L 4Y4HA 3U30C 1F6LL 4PG9A 2DBLL 3MRLA 3N1GC 4E0RB 4FQCH 5I2IB 4HIJB 3SBWC 5DD3L 3BGAA 1S9XA 4R2GC 5GZNC 2AXHA 4FQ2H 5E8EA 5TH2A 1VESA 4U6TA 3QJHA 4K8RH 4AQ1B 2AI0L 5B39B 2C3HA 5K9QG 1N6QH 2OZ4L 3QWRD 5E5MB 3U82B 4QF1B 3C60C 2EC9U 4JFXB 1PG7W 3O2WL 2D03H 4UQ3B 1K8DA 5I73B 1SJHA 1HINL 3O8XA 2ZUTA 4JVWA 4YK4C 1D5MA 4XBPB 3TT3L 4M6OH 2EDKA 3G6JE 3VFRB 3H9SD 4HIIB 2ATKB 3KXFA 1Y6MR 3WHXB 4JFYA 2ILLA 5C0BE 4AEIH 4WGWB 3D3VA 2XPGB 4M5ZH 2Z31C 5DJDB 7FABH 1F11A 3WUWG 2ORBH 1FQ9C 4NRYB 5L8LB 5JPMA 3P3YA 1ZS8B 3OAYK 4TTDD 4LU5H 1LEKA 3LKRA 5JLZB 3HLAA 1A22B 2IAND 2W92A 4DCQA 2DQTH 2D9CA 3VD9A 4V1DA 2OL3A 4OD2A 5IMKA 1UJ3C 4Z9KB 3RZCC 5IB3B 1F4WH 3PWNA 3D0LB 1NGXB 4NNPH 5DZNA 1G7PB 2VIRA 5DRNB 1H3TA 1T04A 5JW5B 2PCPA 5IVZB 1Q72L 4W6WB 2VYRE 4DQOL 3QQNA 1U2HA 1FNLA 4FFWC 1REIA 4U6VH 1OGTB 3GSVA 3ARFB 3VGFA 5IMLB 4YHYB 2FNBA 3UDWA 5IHLB 4Z95L 4OFPA 4QRQA 5EORL 1B2WH 5E99L 5EIIA 4QGTA 5DUBA 5E9DB 4JKLA 5BVPH 5C07D 1GC1H 3SJVD 1ZT4B 3E8UH 3EYSH 1ZLSH 1A3QA 4P48A 3TO2B 4MQXD 3L9RA 3QCUH 2IADA 3NABL 2H26A 1UACL 5D6DA 1NC2D 3LKPB 4Y5YC 4BH8A 1JV5B 3MRNA 1N0XH 2ZCLL 4KTDL 4KRMB 4WNQA 1QLEH 2YUWA 5IWLA 1B4JL 4NYLB 3F58L 5D7IE 1B6DA 1MREL 2A0LD 1LHZA 4CRPA 2X7LA 3VD7A 4KMQA 1WUNT 1G1CA 2HJLA 4RIRB 5HY9A 3L3HA 2IH1B 4TTDC 1NFDA 1XH3A 4P3CL 1J0HA 1F97A 4K71B 5FECA 4PTTB 4I4WA 5F89B 5IF0B 1CFTB 2C1OA 4MX7A 5HDQL 4ZD3L 1AE6L 5JQHC 4MDJA 4P0DA 1IBGL 4LK4A 4JM2F 4WCYH 3LKSB 4GQPH 5CWSA 2YC1B 4BUGA 4PGEB 3T0EE 2I26N 5EZLA 3I84A 2M26A 2IAMD 4WJ5B 2W1NA 5F1OB 2ZG1A 3WLBB 2MWCA 4F7EB 2F5AL 4G8GD 4PGDA 3U83A 4TPRH 1CLZH 1OM3L 2E6PA 4NHUB 4UQ2A 1FZKB 2VN7A 3H0TA 3ILPA 4FQCL 1DN0B 5CD3A 1FNAA 1GJIA 3K2MC 1OF2B 4QRRD 5DTFA 4FQ2L 3ES6B 3EFFA 3PHQA 3AXLB 4K8RL 3U2SA 1NMBH 1CD0A 5AYUH 1N6QL 5IFJA 1FIGL 1ZE3C 5DURD 4MQXC 1WBXB 4RAUA 1KB9K 1CVSC 1NBVH 4QY8A 1NGPL 3WHE1 2IALB 2D03L 5K93A 5L2JB 4CBPA 4MAUH 2NXZC 4RAHA 3P4OA 3HE7C 4XH2A 4M6OL 5JW4N 3TN0D 1RUPL 3HPJB 1YUHB 1U8JB 3ALPA 3MMEB 3S36H 4QRPE 4M7ZB 3SJVB 4XPAH 2R2BB 3MRCA 3C6LB 3GI8H 4M5ZL 5L6YH 4NQUA 4FFZH 3VXOA 3WCYA 7FABL 1DVFA 3MJ6A 4MXQC 3VRJA 4P5KB 1H8SA 1NC2B 2ORBL 4PGBA 4HWBA 1A6PA 4LU5L 1L7IH 1XGYH 3BX7C 5I16B 3QJFB 1LE5B 4MLIA 4RCAA 3VW3H 1TLKA 3MQIA 2P47B 4LQ1A 3VXQB 2FYYB 5JO5A 2AEQL 5ENWA 4UZGA 1QFHA 4Q6YA 1F4WL 5ESQB 1QLRA 2XTJE 2MJWA 3PWVA 2DMBA 2IAMC 3M07A 1ZT1B 4IDJL 5DO2D 1ZVYA 5GGSB 1JHLH 4NFBA 3QQ3B 3VRIB 3S34H 2MPAH 4OTXH 5LGJB 4S10A 4DEPC 2XQBH 1CE6A 1X4ZA 4U6VL 3RGVC 3ARGD 2RCSH 3ARSA 4KQ4H 4JJHA 4PR5B 1T1YB 4IIQC 2XKUA 4Z6AT 4JM4H 5ACZB 4D3CL 2DWEA 4F33B 2FO4A 5H37G 4TSCH 5J1SC 2J8UE 1T2XA 4NC1E 5DD5H 1T6WA 3TGXA 4GAJH 1JYWA 5BVPL 1GC1L 4G8GB 1VSCA 4P2YA 3CLFH 4KQ3L 3U4EB 3E8UL 3EYSL 3D48R 5DMIH 1YQ2A 3QCUL 3V4PH 1G7QA 2VUYA 4UAOB 4B50A 4L8SB 4QRRB 3DXAA 2BSRB 2E9BA 3ARXA 4HKXA 5I75C 1QLEL 1YN6A 2GJZA 1MVUB 5JDJA 5DURB 4KJYB 1NFDF 1IJ9A 1UB6B 4ZSOA 3TZVD 1MIEH 2X9XA 5FAAA 5A43C 2OCFD 1XAUA 3DROB 3T3ME 5T3ZD 1YDPB 3JWOH 1R3LA 1GGYA 5BW7A 1GGCH 4PJEA 5HVHB 3TN0B 3C5ZD 1R5IB 3UTZA 3MRGA 5HYEA 3H3KA 5C0CE 5EU7C 1HXYA 4NQXB 5A3ID 4WCYL 4DKFH 4QCIB 2JB5H 2GHWB 2HT3D 3I9GH 1MELA 2MKWA 1W72A 1MCLA 4U1HA 3OV6A 3PDOB 3R1GH 5C9KA 3GSOA 3OR6A 3DOSA 4X5WB 5B3NA 1U36A 3LEYH 4LASH 3FQNA 4TPRL 1CLZL 1VKXA 3OKKB 4Q6IA 4ZS6D 3RTQD 1JI1A 3WFCH 2F5BH 3B2VL 1UFUA 3RPIA 2WBJB 5ALCH 5IVNA 5L8KB 1K2DB 4JGUA 4K55A 3SOBH 3IXTA 3AM8C 1S5IL 3TJHC 3HMXA 1NMBL 3AB0C 4XGZA 1RURH 5F1NB 1NANI 5AYUL 3CK0H 2X4SA 2Y4SA 4WIQA 5DSCA 1IKNA 3ARBD 2OI9C 1NBVL 3ARGB 4OV5B 3G5XA 5D2LA 2I5YH 3NZ8A 3D85D 4N90D 4U1IA 3L5WB 3WSQH 4MAUL 1AIFA 1MCBA 3SDXA 4MA7H 3QFJB 4JN1H 2PO6D 1KCUH 1GYAA 5E4EB 1MCJA 1T7YA 2QADD 4XVTH 3ZDZF 4P99A 2DQGH 1PBYA 4MB3A 5HYQB 5CIPA 3S36L 4XPAL 5DRXA 5JIHA 5D4QA 2BOCB 5L6YL 2NXYB 2A1WH 4FFZL 1KXTB 2NY3D 5D1XB 1T1XA 1MCRA 5IG7A 4O51B 4RSVA 3PL6C 3AS0A 2WWKO 2HTKC 4OAWB 1XGYL 3OGCB 4ODWA 2XZQH 3ZO0A 1IGTB 4ZDHB 3VW3L 2ICWJ 1T5XB 3TZVB 4LCYA 4NQDE 1PKOA 2BX5A 4PRHE 5EU4A 4KI5C 1BF2A 5I8CB 3MBED 1D5ZA 3VXPA 1SY6A 1OL0A 2AQ3A 4JRYE 5GRWA 1JHLL 1QUNA 4QHKJ 3C5ZB 4WEUD 4J2XA 1FL3B 3T1WA 3WLWC 3S34L 2MPAL 4OTXL 1JGDA 1WIPA 2XQBL 1A6VH 5A2FA 3RTQC 4X5XB 1OAXH 2RCSL 3NCYP 1U8PB 3EJJX 3AC0A 4N0FB 4DJMA 4KQ4L 2GYSA 5TDNB 4N1HB 1EV2E 1JJUA 3LKNB 5C0AA 4HS6A 4GQ9H 4WFGE 1KIPB 3F5WB 3T1FB 1AHWC 1YYLH 3WNMA 5DD5L 2AJSL 4DWHA 3F7VA 1W72H 4GAJL 4JFFB 3MRQA 4NO2B 2NY7L 1HHJA 3CLFL 4L9LB 1UZ6F 2R0WH 3EHBC 5DMIL 1TVHB 3NIGE 3DPBA 3O9WB 1M71A 3PHOA 4GRLD 4YBQC 3MA7A 1QSFD 4HUUA 3MV7E 3V4PL 4XT1C 4OCRH 2CDGB 1GOFA 2PO6C 4OFVA 2GTZB 4P46D 5E4IA 1FBIH 4NO5B 3AMLA 3PV6B 4GJTB 1YA5A 3THMH 3ZZ1A 3MJ8A 5IW1B 1F5WA 5DVLA 2FDBP 2J6EA 1IEBB 1AR1C 1D6EA 2SEBA 1YEFH 4PJEF 3ARBB 1LGVA 1MIEL 3P77B 2EICA 3HMXH 5BZDB 4MA3B 3D85B 3KYKH 3JWOL 3NIFF 4NO0D 1WBZA 3GSWB 1GGCL 1NGWA 3BZFB 3P4LA 3BP7B 3VI3F 2QADB 3MV9A 3TVMC 2KH2B 4EI6B 3MOQA 2O5YH 4BM7A 3TNNA 3QEQE 1XT5A 3J8F7 4LVEA 1U8MA 5TQ0H 2NY3B 2H2PD 1R5WA 2JB5L 4DKFL 5J1TC 3HZKA 3I9GL 5CIPH 1RJCA 1EVTC 4ZNEE 1H8NA 4OUOA 2EXYC 1IEAB 3QIBD 3R1GL 1PW3A 3QPQD 3VD3A 3C9NB 1UZ8B 3GUTB 1I7ZA 4NC0B 3MV8D 4LASL 1OSZA 3TLRA 3L5HA 3RDTA 3WFCL 1P7KA 2F5BL 5F7NC 3MBEB 1PX4A 2E27H 1FPTH 5ALCL 3LKQB 4DVRH 1OP9A 2HJFA 3SOBL 1Z3GH 3QHZH 2HFEB 4I3RH 2RQ8A 1RURL 3RVVC 2WBWB 2ZPKH 3SDXF 3I6GA 1SY6H 3O6FA 3CK0L 1NJ9B 4G8FB 3SGDH 4X0KA 4OV6F 2I5YL 4MZ2A 2GITB 2QJDA 4P46C 3WSQL 3BP5A 3HPLB 2E9IA 4HK0A 4JN1L 1KCUL 4EQ2A 4XVTL 3VGBA 2DQGL 2XXCB 4JCMA 5DUPH 2QQLL 3MRKB 5IEKB 3FT4B 5B8CA 4R4BA 3VWKB 4LHJB 1U3ZA 3IFNH 4GRLB 2X41A 4OF8A 2A1WL 4UT6H 4AT6B 3CAFA 4PRNA 4ONFH 3FTGA 2GTWB 4P59H 3QEHB 2XZQL 3RJQB 5BCAA 4C4KO 4BSWB 4MJID 3BPLC 4P2CG 3VG0L 4HLJA 2J6EH 4Z0XB 1B3JA 4NO0B 1U8KB 3P4NA 1JZ8A 3QPQC 4IMLA 5JNYB 3W5MA 3BRFA 3UPCA 2BHUA 1IVLA 4JFOA 5GS0C 2PYFB 4ZUWB 4HF5L 3HRZA 1N4XH 1A6VL 1FO0B 3ULUE 3AAZB 5B38G 1OAXL 4MCYB 4PJXF 4HAGA 3JUZA 3NACL 1F4YH 3MRMA 3QIBB 2J5LC 4GQ9L 1KIQA 1G7JA 4J3WA 1YYLL 4F7CB 4HPOL 1QG3A 1W72L 3RL2A 3VE0B 3SPVA 1J11A 1XF4A 3GMNA 2R0WL 2P5WA 1VEMA 3W11D 5HHOB 4JPIB 5IVXB 1A6TB 1MFAL 1FL5B 4DUWA 3MCLH 4OCRL 2F58H 2DM7A 4JKMA 2W38A 1FBIL 3WNOA 3L3JA 5IBUG 1QSZA 3ROLA 3THML 2XWBB 1Q9WA 1GVIA 3DVGB 3QCVH 4MGXA 4NSKA 2ZOKB 4JFFE 4EUPA 4UV7H 1YEFL 3LB6D 5L2KE 5HHQB 2DWDA 2HKFH 3CVIH 3F7RA 3HMXL 2O93L 1EFXD 4ZXBA 1WWWX 3BQUB 3KYKL 1FAKT 3GSQA 3RY5A 1QOKA 2X1WL 3TFKD 1L9NA 2IH3B 3ZKXC 2VDKH 4MQ7B 1WC7A 3IFOB 1U93A 4NQED 2O5YL 2FD6H 3V4VH 2P5ED 3K8LA 5BZWA 1T1WA 3MUGB 4KKCC 2C3XA 1OHQA 2IPTH 3DX6A 1I8MA 1T0MA 5TQ0L 3VXSD 2R1XB 3CZFA 5GS1A 3U4BH 2V2XB 3IDMA 5I1GH 3PWPE 3BZ4B 1HWHB 2IBBA 1N3NB 4ODUA 1O5DT 3MNZB 4HJGA 3GMOA 3QCTH 1JHTB 4OJFH 4I18B 4K7PH 4YJZL 4ZPVB 1IARB 1A6ZA 1N2RA 2EKJA 1I1FA 3HS0A 4Y19B 4AM0A 1HI6B 3PABA 2E27L 1FPTL 4UU9B 3UTQA 1I1AC 3BGMA 4DVRL 2C4XA 3FB8A 1Z3GL 1SEBA 3TCLB 4I3RL 2C7UB 1BIIA 3CLEH 1F6AB 32C2B 4GBXB 4ZOCA 2GJ6B 2ZPKL 3MNVA 5HHVH 1SY6L 1DE4A 4E9LA 3MRPB 4G7YH 2VLJA 4F37F 1TTFA 2OQJA 3Q3GA 4XCNB 1AGCA 1NUNB 5D5MA 1XF5A 3AFLA 1SEQH 5F72S 1INDH 3IDGB 3VXRA 5FYKH 1TQCB 4LCIH 3RUGA 4P5MA 2D0GA 3H7BA 4JFHE 1MEXH 1QBMH 4GH7B 4XP6H 5HHPB 3MX0A 4EOWH 2BNRB 3KPNB 4RMTA 2YD3A 3IFNL 4U1LB 5C71A 3UZQA 1XMWA 4FMFA 3WIIH 4U1MA 4UT6L 5DQJB 1E0OB 4XPGH 4L8BA 1HQ4A 5H2BA 4X8XA 1XF3B 4YGAB 3ZKMC 4HGMA 3SE4A 5FO7B 1X5JA 1FJ1A 5C1MB 5ID0A 5KVDH 2FL5A 3ZLQC 3EYOA 1XIWC 4KTYA 3ZKSD 3JV6B 1EFXB 2Q87A 4W68A 1PZUB 5F3HA 5C0GB 2AEWA 4HIHA 4EUPH 4Z5RA 2NY6D 4BKLB 1AO7D 4DVBA 4LEXH 3GB7A 1UEYA 4QGYA 4LCCB 2YPLA 4NQEB 3RJDA 2BY0A 2F9BT 5C7XH 1N4XL 1Q0YH 4LCWD 3Q5TA 2CK2A 3QQ9D 4Z78B 1JNJA 4U1NA 3VXSB 5B39G 4HULB 4RFEB 3RI5F 4YO0B 4KU1A 3L6FB 2ZCKH 2DQFA 3MNWA 1F4YL 3KYOB 5FV2A 3OHXA 2YHGA 5GZOD 2AQ1A 3IXAA 3RP1A 4YFDB 1UWEH 1BPVA 1Q1JH 3GMPB 2APXA 3ZT6A 2CXGA 3IS1X 4HKZB 4UT7H 3BO8B 5JMRA 5IR1A 3V0VA 3MCLL 4YGVA 1NKRA 2V5MA 5EO1B 3MBXH 4EBQH 4XC1H 3TIDB 1KTKE 4IBLT 4Z7VE 4DAGH 3QCVL 3LIZL 4WENB 3Q0HA 2NQCA 3IDYB 4P9MH 1MJ8H 2DB8A 4JRXE 4UV7L 2XN9E 2O61B 2XQYG 3WEXA 2HKFL 3CVIL 1G0DA 4UOW0 3T0XA 5HHOE 1KLUB 4M7KH 5TJWK 1G7IB 2X2YA 4N9GA 3UTPE 1Q9LA 2H32A 2D7OA 1LDSA 2BSSB 2V6HA 2VDKL 1A4KA 2BJMH 3D18B 1CR9H 4OZFB 4ZUVB 3KPRE 3NPSC 3LHPL 1OWRM 4Y5XA 4MXVF 5CEXA 2X89A 3IB4A 2IPTL 4FQXC 4U1GB 5IQ9B 2AS5M 3RHWF 3DRTA 4X6CA 4JFDE 3TA3D 4R97C 4U05A 4O2CA 2NY6C 3U4BL 4OZIA 2BDNH 3SGKC 3T04D 1IM9A 4JDZA 3UC0H 1S7UB 3W82A 1I9IH 2ZOLB 5I1GL 1A7NH 1DDHB 3BIKA 43CAA 3QCTL 2XKNB 3WS6C 1R3HB 3NZHH 4OJFL 2CLRA 5MEQA 4K7PL 3VH8B 2BSTB 4JG0H 3AREC 1R5VA 4JREC 5GGVY 3EYFB 3V6OE 5GGRB 5C0IA 4DZ8A 2ESVA 4NBYB 2ZUVA 4X6BA 5FYJH 3EOAA 1AO7B 4NOBA 3X11A 4ZQKB 2Z93B 3AU1B 5D5MF 3CLEL 4MJ5A 1MFBL 5HHVL 3EOBA 1ZHKA 3E2HC 4G7YL 3RNQB 3RUGF 4CJ0A 3EIFA 4OLVH 4PJBB 3IJYB 1RJYA 4PBVC 1QP1A 4JB9H 5D1ZC 1U91B 3PP3H 3BPNC 5F1IB 3VDAA 1SEQL 1INDL 2UUDH 4ONOA 4D0CA 5FYKL 1KJMA 2AJUH 1UB5A 1X5KA 1MEXL 1NLDH 1QBML 3VXNB 4PJFE 4NN6B 5BMFH 5MENE 4UDUB 3HZVA 4EOWL 3S97C 1C16B 4GRWF 3X13B 1YMHB 3O2DA 3O4LE 1AD0B 1WISA 2XXMB 4LRIA 3NFPA 4MA1C 3D0VB 3EYQD 5KVGH 3P9WB 4XPGL 1YJDH 3L7FA 2BVEA 3MJ9A 3MOBH 3ZTNH 2CDFA 1NDGA 2NY1D 3FO1B 4R3SA 4XMPH 5SWZD 3EO9H 2DKMA 4H0IA 5HDBF 2BHYA 5KVDL 4PRPE 1NAMA 1JWUA 1EAPA 2VZ1A 4OCLC 4PRIB 1B6UA 1AGFB 2J1KA 3OKOA 3N0PB 1C08A 1Z9LA 4TULH 4LEXL 5GISH 1PYWA 1U42A 2H32H 5C7XL 5M7QA 3RWEB 1F2QA 1Q0YL 1CBVH 5DJAB 3QWQB 2IQAB 4N1EA 3PQYD 5DS8B 1RZ7H 5C09A 4HZLA 3LN5B 3TA3B 1V3JA 2IPUG 5DEZA 2EH7H 3DI2B 1AY1L 2ZCKL 4K9EL 5BS0D 1QLFA 1UWEL 1NH6A 3L3DA 4NZRH 3C8DA 1KBGH 5F7EL 4CL7A 1ZGLP 1U8OB 1HHIB 1VACB 4GW1A 3SE9H 2A2QT 1M7IA 4UT7L 4UTAH 4LSDA 3HC3L 1G9NC 1ITCA 3MBXL 5CSZA 4R96A 1E6JH 1TENA 4XNZB 4EBQL 2EXWD 4XC1L 1X44A 5IBTH 4HWNA 2G2RA 3MXVH 4DAGL 1FVCB 4HMCA 1G9MH 3ROOA 5BOPA 4P9ML 1MJ8L 5ISZD 1A64A 2A74A 5INDB 2Y72A 2COQA 4M7KL 2GK0B 1YEDA 1J1XH 1S7WB 1QFUL 2GUOB 2MQ3A 4MHHI 1T89C 2BJML 1CR9L 4PGCA 1V5JA 3TC9A 5T1LB 4X6CF 5FKAA 4OZIF 3QNYB 4KZEL 3DURA 3KLHC 2XZZA 1LP9A 1NKOA 4OT1H 4WTXA 1G7LA 4Q97A 3D39E 4U31A 4QHLB 5IJKC 4QO1A 3HAEB 3MFFA 4C56E 1I1RA 1Y18A 4PREA 5KANI 2ATPB 5TGBA 2BDNL 5B4MC 3UC0L 3IDJB 1I9IL 4C57C 1ZA6A 2NY1B 1A7NL 3O2DH 5SWZB 1HHKB 2BRQA 4KRPC 3IJHA 1JPFA 3G6JA 3T4AB 4NC2B 4HC1H 3FONB 4EN3D 5T3XH 3REWA 2DM4A 3TO4A 2NY4D 3X14B 3LEXA 5FYJL 1NAMH 2V9RA 3CSYB 2DLHA 1XGUB 4QXWA 4F7TA 4OIIH 4IJ3C 3UPAA 2R39A 3S4SG 4L3AA 3LV3A 3KPQA 1I8IB 2ZUSA 1WT5C 3VGAC 4OZ4B 4APQD 3PQYB 4OLVL 4JB9L 5DMYA 3QDJB 2J8OA 1N7MH 1MUJA 4F8TA 2JJUA 4ZUSA 1BBJB 1ZHBA 5F21B 2G60L 3CX2A 5BS0B 8FABA 3BP6A 1U41A 4UUJA 2X70B 2AJUL 2B2XH 2EH8H 1QD0A 2R0LH 1NLDL 4ZNCD 5BMFL 1BD2D 3OL2A 4ONHA 5TDOB 3GSXB 1K85A 4ODVH 1U8NA 3CPLA 4DFHA 3T2NH 2GIYA 4UOW1 4XXDA 4JGMA 1I7RA 4P4KD 5KN5B 5KVGL 1YJDL 4HT1H 1EEZA 2NX5D 3MOBL 5A40E 4EDXB 2ERJB 2B1AH 4JHBA 3IRZA 3ZTNL 2Q76A 1FNFA 3SCMA 4XMPL 3EO9L 4LMQI 1GXEA 4JR9H 2QQNH 1FCGA 5F3BB 5CMAA 1KPVA 2AP2A 1IGCL 4TOYH 2R15A 4OCNC 4PYHA 2XT1B 5HSFA 2VWEC 3KPPA 4XNMB 5EU6D 4TULL 2D0HA 1CQYA 1FSKB 4N68A 4YHZH 5GISL 5EBGA 2AABL 5CLTA 5SWSE 1JZ5A 1Q9KA 2E7HA 4KRNA 1CBVL 4U7MA 5D7IA 2NY4C 4XCEB 3MODH 1X7QB 3JTSA 3KLAA 4NRZA 2A77L 3D2UD 2EIEA 5L7XH 2EH7L 1P7QB 3BISA 1K4DB 2ARJB 4S0SD 1QVOB 4NUJA 3FFCD 1N59A 3IGAA 3CCHA 2WQRA 1CICA 4K3GA 4NZRL 4U1SB 2VDLL 1S78C 4RDQG 1KBGL 1YNLH 4YR6A 4HIEA 5F6IC 3DO7B 4CVXA 4EN3B 3DHJA 2X9YA 3SE9L 3PGFL 2Q8BH 4C59B 1IC5H 3BRGC 1KN4H 4LARH 5BQ7B 3RIFF 4GAYB 3PIQA 3S5LA 3FZUD 4CAGA 2GJJA 1KPUB 3U0WH 1E6JL 1SYSA 3HG1E 5IBTL 4JPWH 1PQZA 3T0EA 1J9CT 3MXVL 4FXLA 3RBGA 4LLVB 1EMTH 1MLCA 3VWJA 1G9ML 2BSED 2YSSA 1JZ6A 1AKJD 4PRBB 2QV2A 4APQB 1FN4B 3ZE2E 2G75B 4P4KC 4X4YB 2Q20A 3D5OF 4GG6E 2A6IB 3GGWB 1A6WH 3QAZB 5BVJB 3MRJA 1LP9F 4PTUB 3S37H 4HS3A 3MRHA 2XG5A 2RIKA 4RMQA 4YC2C 4OT1L 3U79A 4Y16A 1EEQA 5IV2B 4OLYH 1J05B 2UZYB 2UYLB 3V9FA 4I77H 4UIMB 1ZGLA 3G6JF 2VITB 3OG4B 3WN5A 4PUBH 1YC8A 4YDLB 3QG6B 4HIJA 1CL7I 5GHWH 3V5HB 3O2DL 2HG5A 3BKYH 1J5OH 1WIUA 3GZKA 3QUMA 1DUYB 4HC1L 4PLJD 4MNHA 4QRPA 5AAMA 1HEZA 5T3XL 4XBEH 4QF1A 3T0VA 1TVBB 2PXYD 5DJ8A 4ZS7H 1NAML 4UQ3A 5EU6B 1R24B 5E00B 3E6FB 3PXJA 3NA4A 1MI5E 4OIIL 3U36B 4MD5A 3PF2A 4LIQE 3MPCA 1F58H 1D9KB 4HIIA 3BAEL 4G9DB 4A6YA 5DJXB 3RVXD 5J1AA 1OP3K 1TTUA 3D2UB 1N7ML 1CXKA 1BFSA 2XPGA 3DMMD 2D4FA 3UTTB 3FFCB 5D7KE 3UJTH 2P8LB 2B2XL 1VENA 2EH8L 2R0LL 3WL9B 4GUPB 4BFGA 3CFKB 4JFQA 1D6VH 3OTTA 4AMKH 3RWFB 3O45A 4KXZH 4N8VB 4ODVL 2HVJB 2UY7A 3CFBA 3P73B 5IFHH 3T2NL 2OP4H 3LKOA 3SDCD 5C8JB 5ETUA 5IB3A 1OTTC 4HT1L 2KBGA 2B1AL 2X10A 3R8BB 3F7YA 1WJ3A 5JW5A 3FT3B 2YD8A 4G3YH 2HN7B 2J8UA 1AKJB 3G6DH 4JR9L 1MCSA 2HLFC 4X6EB 2R1WB 4N8CH 1OGAE 4U2YA 2BFVL 4PJGB 4TOYL 5JDSA 4NZTH 3VXMB 2ARJQ 2BVQB 3CMOH 5D7IF 3VFUB 2F54E 4YHZL 1AQKL 2VLKE 4PLJC 5HXMA 3L3IA 1RAMA 1ZA3B 1T21A 3MRBB 5F44A 4J3XA 5E9DA 5EWIH 4YHPA 4W4OA 4JY5H 4OUUB 5IW6B 4ZFFA 2HH0L 5L7XL 4XTRC 1F02I 4LHUA 3OJDA 1PG7H 4PGZA 4FHBD 2NY2D 2MOVA 3QFDB 4K8RD 4JPKH 3EOYG 4KV5E 4ORGB 1YNLL 2FEDD 5EBWA 1QFOA 3RVXC 5C0CA 3QO1B 3ULSB 4WTZA 2Q8BL 4H26A 3SDDA 3FOLA 1FFOB 1IC5L 2PXYB 2LVCA 3DMMC 4LARL 3QNZB 4NNYA 1EHLL 4PY8J 3U0WL 2H6PA 2L4OA 4JPWL 1CTOA 1KTDA 1YMME 3FT2B 1NGQH 1YEHH 3JV5A 4M1GH 4I0KA 2YXMA 4XWOC 3B8SA 3K7UA 2ADGA 5SV3A 4NNXB 5C92A 4JZJA 2CSPA 1UWGH 3FFDB 4DUVA 2XA8H 4Y2DD 4MCZB 1A6WL 3EYUH 2EEAA 5KVMC 3LKSA 2PTTA 2EEBA 1NQBA 2G5BA 3S37L 3CUPA 1E4KA 3QUYC 5EA0H 4WJ5A 1FIEA 1ETZA 4WW2C 4OM0L 4OLYL 2Q86B 2E7BA 4JFED 5DHYA 4I77L 2BVOB 3SDCB 4AH2B 1V7NH 1NCBH 1IC4H 2WINB 3QDGE 3PGCB 3ARDB 1IFHH 2WMPA 3ARVA 3DX8B 1RZKL 5F9OH 3BKYL 4D8PB 1CDHA 2C1PA 3MV11 5IROC 1G9EA 5D7LB 5JR1H 2J3SA 5JIPA 1T3FA 4J3VA 4ZS7L 5ABDE 2I9LB 5EO0B 3BZEB 3U7YL 1IAOB 3PWLB 3HHRB 1F58L 3CH8A 3HPJA 3FQRB 1NGZA 3DX7A 1DEEB 4KI1A 1JGVH 1F6FB 3MYZA 4JM2D 3H9SE 5FGCB 4NQDA 3C6LA 1T4KB 4PRHA 3T08A 1ED3A 4Y4HD 3UJTL 1AC6A 5DFWH 4IHOB 3OAYH 1FFPA 5HGHB 4JRYA 1T2JA 1D6VL 4AMKL 1WTLA 4ZO6A 5J6HB 2X4QB 4OFKA 1UXSB 3QJFA 5IFHL 2DKSA 3MRRB 2A9MH 4Y2DC 5MHSD 2OP4L 2JB6B 3VFSA 1S7XA 2XWJB 4NUGH 1J0KA 2IANE 2EKSB 5ESQA 3UTTE 2J8UF 4H88L 1UC6A 4YWGH 1N6UA 1T0PB 3ZKNC 1WCQA 1PFCA 2ENSA 3GKZA 4WUUB 1HH6A 1MF2H 3MGTB 3QQ3A 4G3YL 5FDYA 3G6DL 2E9WA 5DK0A 2F53E 2C4FT 5ERWB 4G8IA 3KXFD 3MV7A 4WO4B 3CMOL 3D3VD 3BEVA 4PR5A 4GAFB 4UNTA 4D9LH 1X5YA 1A4JB 4F33A 4HEPG 2H3NB 3T3MF 3WFEH 1MPAL 5EWIL 2DI8A 1JZ2A 2MNUA 5EZIH 1ORSA 5C08E 4BK4A 2NLJA 4HWZB 5IB1A 2WWMC 5C07E 1PG7L 3HNTH 4V1DD 1MHPH 3IU3B 1TJIH 5C0JB 1IGIH 2VJXA 4JPKL 4G6FB 2H1PH 3GIZH 1GC1C 2NMSA 3E0GA 2VLRB 3OKNA 1ZVSB 4I1NB 2P24B 1MVUA 2XI9A 4I2XE 1U0QA 3QEQA 4YFLI 4WGVB 1U92A 1TJGH 3V5DB 2BERA 5I8OH 3L3KB 4L4VB 4NN7B 2XZAL 5L9DH 5TE7H 1YDPA 4NOFA 4ZNEA 5EB9A 1XGPB 2IWGA 1NCDH 3RVTD 1RZJH 2VH5H 1NGQL 1YEHL 3B43A 4M1GL 5DRWA 3K1KC 3OPZH 3VA2C 1R5IA 2A73B 3O3DB 1GZQB 3B3IA 5DVKA 2LFGA 4NQCD 5GS2H 4JM2B 1UWGL 2XA8L 1CVRA 1JPTL 4QOKE 3EYUL 2DQEH 4QCIA 3O41B 5E70A 3KS0J 4U0QB 4YFEA 5EA0L 1PAMA 1KB5A 4WFED 5KBNC 5KVFH 1OW0C 5LAXB 5D1QA 1S9XB 1PZ5A 1DBBH 4X5WA 4I48A 5E8EB 5TH2B 4UT9H 3QJHB 4NKDA 4NFCA 1V7NL 5MI0B 4PJ8C 5JXEA 1IC4L 1IFHL 5F9OL 4GS7B 1SJHB 3O8XB 5KSUA 4DZBA 3ZYIA 1D5MB 5F1NA 1ULVA 2Q7NA 1FC1A 1HZHH 2FSEA 5CZXC 1AP2A 5LCVH 5JR1L 3IU4H 4M43L 3ORJA 5K9OA 2WIMA 2CQVA 1BJ1H 2WUBH 4JFYB 3L5WA 3QDHA 3L3OB 3D3VB 5GRXG 4WWKA 1MJ7H 3DNKA 1CIUA 1A3RH 1MFCH 2X4RA 1LEKB 1JGVL 2R8SH 3GJFK 3TVMB 4E5XA 3HLAB 4MMXC 2VOTA 4AEEA 3T65B 5ADOH 4DCQB 3BMVA 2VISA 4Z7UE 2CKBA 2BHZA 5D1XA 4V1DB 2OL3B 4OD2B 2D31A 5IMKB 3PWNB 1D7FA 1EDQA 1G1YA 3CFEB 3CFDA 4H8WH 1WBYB 4NCC1 1RV6X 1OAYH 2BXZA 3P0YL 1T04B 4HMDA 2PCPB 4OZFG 1T5XA 2AJZB 2A9ML 4CNIA 1X5GA 1OD7A 4JRWA 4JPVH 1RIUH 2ADIB 4NUGL 1QNZH 5IB2A 1OB1A 1ONQA 3GSVB 4YWGL 1INQA 5EU7E 2E6QA 3WO4C 3DVFA 3O81A 4M93B 4RBPK 1MF2L 5MERA 3HFMH 4QRQB 5EN2A 1WFTA 1QRND 5EIIB 5DUBB 1A2YA 5CEZH 4FQJL 1NUDA 2V7NA 3MROB 4PJ5B 4BYHA 4FNLH 1FG9C 4P2RD 3GJFB 3L9RB 2ZSWB 4N5EC 3W5NA 2IADB 2ICWA 2R56L 3OB8A 4WFHE 2H26B 4D9LL 4YHLH 5GGTA 3F5WA 1SJEA 4WUUE 4BH8B 3MRNB 3WFEL 3AVEA 4PJ9A 4JFFA 5JPNA 3S8WA 4NO2A 5L2KA 4WNQB 4PY7A 3NCMA 4M7LL 3QXDA 2E7MA 4XCCH 5EZIL 1KB5H 2VNCA 2FGWH 1FH5H 3BWAA 4JG1L 3HNTL 5IEHA 1MHPL 1YECH 1IGIL 3HUJB 3GMRA 4OF6A 3QHTC 5E0QA 2X7LB 4NO5A 3RFZC 2BVUA 2M2DA 1RHHA 5I1CH 3VXTB 2H1PL 2HJLB 3GIZL 2FR4A 5HY9B 3CDYA 4WI4A 3WXVL 1NFDB 1XH3B 2CIIA 3WFHA 3B8YA 5FECB 4I4WB 4P23D 2AERT 4PJCE 1YEGH 5TQ2H 5GGQH 2C1OB 1L0XA 3BPOC 3P77A 4MX7B 5KZCD 1NSNH 5L9DL 5TE7L 1NCDL 3BZFA 3PWPA 1RZJL 2VH5L 3BP7A 5CWSB 4BQCA 1S7SA 3FRPG 3OPZL 3O3BA 1FYTB 2KUTA 2VLRE 3RX8A 4BH7A 5EZLB 1NL0L 4X6DE 2FIKA 2AQ2A 2Y9RT 1CFNA 4TVPH 4KKAD 1F45A 1C7TA 4FQHA 1EERB 4L4VE 2ZCHH 2DQEL 4RMVA 4EIGB 2R4SH 5DC9B 1IEAA 4UQ2B 5CD3B 3H0TB 3ILPB 3TP4A 5KVFL 2B8OT 2NY0D 4PV9A 4KI5E 5DTFB 3E3QC 3DXAD 3SGEH 5KS9B 1FLTX 4UT9L 3EFFB 3PHQB 3U2SB 2J5LB 4HK3J 5IFJB 1UH3A 1FFNB 4HCRL 3SO3B 4PJHE 1G7MA 2EEDA 1YY9D 4RAUB 1HXMA 2AJVH 4QY8B 3LKQA 4L29A 1A6AA 3ULUH 7CGTA 5CSGA 2HFEA 3ME0A 3K8KA 5DWUH 3P4OB 1ZVHA 4XH2B 4OF0A 1HZHL 4DN3H 4E41D 5F88A 4W81A 4G8FA 2YN3A 4H5SA 4PJIB 1C5BH 4M8VA 2WUBL 4H25A 5IGXH 4DW2H 3DWTA 1ACYH 1MJ7L 3VXOB 3IAQA 5J89A 1DVFB 3VRJB 1A3RL 1N8ZA 2JELH 1MFCL 4PGBB 2E8ZA 1M7DA 4P23C 3MZTA 4PJAB 4RGND 2R8SL 5DQDH 4PJ7E 1YN7A 5ADOL 8CGTA 1F3DJ 4LKCA 4U2ZA 5JO5B 3H6JA 4AT6A 4JO3H 4OD1H 5SV4A 1QLRB 5I74C 2GTWA 1BREA 4XX1E 3ULUF 3PWVB 3GBLA 4H8WL 5D96C 1EHNA 1YZZA 1EJOL 4X99A 1OAYL 1RY7B 2Q8AH 1JNLH 5HYFA 5HPMB 4EZMA 4NCDA 2PTUA 1PVHA 1RMFL 4JPVL 1RIUL 5KZCB 1QNZL 5HHMB 1CE6B 5H94A 2P1YA 5JXAH 1CG9A 3HAEG 1IAII 1TJHH 1JK8A 1JYVA 4F9PA 3EGSA 4Z7OE 1MHCB 2RFXA 2NY5C 1YNTA 4U6YA 4LGRB 3HFML 3WFDH 2DWEB 4X80H 1WSST 1U2CA 1OAQH 4NM8H 2XWTA 5DUMH 5CEZL 3FAWA 4MCYA 4FNLL 4CVZA 1G6RA 1KYOK 1G7QB 3ZDXF 3NCBB 2LABA 2QEJA 4YHLL 4Z7VA 2G9HA 2NY0B 3DXAB 3VI4F 2C4FU 5F9AC 2ZUWA 4JRXA 2XN9A 4HKXB 3IJSA 1FNSH 4XCCL 1KB5L 1YN6B 2GJZB 2ZNWA 2FGWL 5HHOA 1FH5L 4JPIA 1S5HA 1A6TA 5MP6H 1GAFH 1FL5A 1KYOJ 4PJ5E 2E3VA 1JUFA 3AY4C 1YECL 1QSFE 1AXTH 1R3LB 2WNGA 3KPRA 3Q6GH 4PJEB 5F7FA 3MXWH 2ZOKA 1JYXA 3L95B 1YEGL 1P4IH 5GGQL 3QUXD 3UTZB 3RX5A 3MRGB 3UEZA 3NCYS 1NSNL 1QQDA 5GSVA 2VXSH 1HXYB 4NWUH 3VFPA 3K4ZA 1UEMA 1T7XA 4QXUH 4LVHC 3VA6A 2JIXB 1W72B 4U1HB 1IC1A 5C0AD 3WFBH 4RGNB 4Z7NE 2EYTB 5KAQF 3GSOB 1RZFH 4TVPL 3MUGA 3OR6B 1CGUA 2CLZA 3AGVA 1UH4A 4NRXA 1MVFA 2ZCHL 1VA9A 3JZ7A 4NWTH 3FQNB 1KJ3L 1VKXB 1PEZA 4Q6IB 2R4SL 2I25N 1T83A 3BZ4A 3BJ91 3L1OH 1FYTE 5F7YC 1EBPA 4P9HH 3IXTB 5C0FB 3ULVC 4I18A 4XGZB 2YBRB 3FJTA 4Y5VA 5E6IC 5DSCB 3REVA 5E7BA 3MV8E 3FQXA 2AJVL 5D2LB 4HDIA 3C5JA 3G5VA 4KAQH 3TCLA 1AIFB 3SDXB 2DTSA 1M1SA 4PJFA 1MHEA 2FX8H 5T3ZL 1NLBH 3NN8A 5MENA 3L7EA 1UKTA 2VLLA 2DI9A 5KS9E 2O26U 4QTIL 4FG6D 5LBSH 1J12A 3O4LA 4RRPA 1C5BL 1XF2A 4JKKA 2WZPD 5IGXL 5DRXB 4DW2L 1HNFA 4L3CA 4MXWL 4ZAKB 5DFTA 1ZTXH 3GBNH 1ACYL 3HB3D 2JE8A 1KGCE 1FO0H 1T1XB 2H2SD 5IG7B 1TMCB 4Y4KC 2JELL 3MSPA 4POZC 5IT2L 4PRPA 3QUXC 3BRDA 2YKLH 5DQDL 4GSDH 2CUIA 4U1LA 5BJTA 5GQBA 3P40A 2ZUUA 3OG6B 3NPSB 3PXHA 5CCKH 4LCYB 4JO3L 3I75B 2FCBA 5D7JC 5T33H 4OD1L 5EU4B 1ZWIA 3BD3A 4FQXB 1CCZA 3RDTD 3SKJH 1URLA 4OCYH 4LLQA 4HBCL 3BWUC 1IL1A 5FO7A 5EUKA 3HCVA 2Q8AL 4ELME 3UAJD 3EJZC 4PJAE 1IC7H 1VPOH 4GLRH 3JV6A 3O6FD 3GFUA 1JGDB 5D72H 1AXSA 4MJIE 3AREB 5JXAL 4OB5H 1IZKA 4AEHH 5CUSH 4CMHC 2NPLX 3RNKA 5I9QC 4HS6B 3B9KC 3WFDL 4L3EE 4X80L 4LNRA 1OAQL 4NM8L 2K7QA 5DUML 1IGJA 4Z7VF 5ICXA 3F7VB 3MRQB 4I3SH 1HHJB 1PKQB 1CD1A 1OT1A 4Z18A 4OI9A 2W0PA 3GSNB 5CZVH 3GK8H 1M71B 3PHOB 3TPKA 3LMJH 1OAUH 2JLLA 2WIIA 3KYOA 3MA7B 4HUUB 4JKPH 3BESR 5D1ZB 3BPNB 5IVXF 3X17A 3LRGA 5CJQH 3QG7H 3GMPA 1TZIA 5HI3D 3MJ8B 4FG6C 2PN5A 3C8HA 1DR9A 5C70A 1FNSL 3FQTA 1JF6A 4ODTH 4CMMA 1D6EB 1JI2A 2YA1A 4P5TA 3DSNA 3HB3C 4JQVC 4R7NA 3TIDA 5IB5A 1AXTL 1WBZB 3E6HA 3R0NA 4WU5A 3Q6GL 4P57A 3MXWL 3MV9B 2O61A 3D39A 1P4IL 1ZT7A 1ACZA 1AR2A 2EDNA 4HLZH 3JWNC 3EYVA 3KDMA 4N8VG 3TNNB 1KLUA 3GSRA 5DI8A 3UXFA 4C56A 2VXSL 5FYKD 4NWUL 3GMLA 5M95B 1S9KC 1U8MB 2BSSA 4YDKH 1EHAA 1R5WB 2N7BA 3HZKB 4QXUL 1QSVA 3QUZA 2DM2A 2YUXA 4UOJA 1RZFL 1MH5B 1LVEA 3N1PC 5D93B 4IRSD 1IGMH 3OXRA 1ZOXA 5HYJE 4NWTL 1U8IA 2P5WD 3H9ZA 1OSZB 3HI1B 3TWCL 4KPHL 3RDTB 1DANT 4F57L 3A67H 4F2MB 3BYYA 2NR6D 4L4TB 5ALBH 5FO8A 3L1OL 4KKLC 3DX9A 3ZTJG 4QNPF 2HJFB 4P9HL 3G9AB 3CSPA 3VH8A 3LRSA 4R26H 4PBWD 5I17A 1GL4B 5GGRA 5KSVA 1CD9B 3O6FB 4PJFF 4MNQB 4ZXBD 3BP5B 4NN5B 4HK0B 2FX8L 1DFBH 1NLBL 2JJSC 1JNHB 1VFUA 5FCSH 4LP5A 3H3PH 1KXVC 3RWJB 3CD4A 4B5EA 2MCPH 2F74A 4E42A 3QRGH 2JJTA 5LBSL 1P4BH 5B8CB 4R4BB 1WCBA 3IDNA 4JANB 1C5CL 1ZTXL 3GBNL 2LU3A 1FO0L 2AAVA 4PRNB 4Q0XH 1LO0L 1S7RA 4UDUA 1LO5A 2YD6A 1C16A 2YKLL 3UBXA 4GSDL 1ZEAH 3X13A 1DP0A 3TBYA 1RUQH 4D9RE 5CCKL 5T33L 3CSGA 4OD3L 2FJGA 3SHSA 4OCYL 3JVGA 4IMLB 2VZOA 5SWSA 3V95A 4JFOB 1IC7L 4IRSC 4LSRH 3RX7A 5J3HD 1VPOL 4M6AA 5LKNA 3B5HA 3IKCB 1MOEA 1AGEA 1E6OH 5H35A 2VLJD 4MAYC 5D72L 4OB5L 2VDPH 4KDTA 4AEHL 5CUSL 5EIVA 4L8DA 2A6DA 4O5LH 3MYJB 4YXHH 3RWGA 3VXRD 3MRMB 1MRCH 2FATH 3QIUA 1KIQB 1G7JB 3RBSA 3RWEA 2WQ8A 5C9JA 4OZFH 3EO1A 1C1EH 4Y4FC 5E2UH 5I8EA 1XGRA 3RL2B 3M8OH 3SPVB 4POUB 1XF4B 3GMNB 3KHQA 2P5WB 3DYPA 1XR9B 4LCWE 5D6CA 3GK8L 3LMJL 1OAUL 3HG1A 25C8H 4JKPL 2A83B 1JZ4A 4OM1H 3LRHA 4S2SA 1WK0A 1OTSD 3F7QA 1H3GA 3VFGH 5CJQL 3L3JB 3ROLB 3OZ9H 3QG7L 3WE6A 5JW4M 1U3JA 1Q9WB 4NSKB 3R0MA 3OBAA 4KGJA 4ODTL 4K9EC 5FYJD 3HE6A 4GG6A 2DWDB 3HC4H 4KGLA 2P8MA 4ZXBB 4OBRA 1J8HE 4BZYA 3GSQB 1U6AH 1HCFX 2OTPA 3DJ9A 1QPPA 3LH2H 5FOBA 4DN4H 3MCKB 1WC7B 2YPLD 1U93B 4LNVA 5BZWB 1QSEE 2ED8A 3DX6B 1I8MB 4NPYA 1T0MB 4WV1A 4YDKL 3CZFB 1E4XI 3KWWB 3LVEA 5GS1B 1FDLL 4KROC 2P42B 4I0PC 5LGHH 1P53A 3IDMB 5T1LA 3KPSD 5J3HC 1P5VA 5DF0A 3EDJA 3PP4H 4ODUB 4HJGB 3GMOB 3L5JA 4YXKH 1IGML 5F7MC 1MLBB 5I1KH 1N2RB 4HFWB 1H5BA 1I1FB 2E7CA 3ARPA 4N5UA 4AM0B 3LD8C 4POYA 1MI5A 3CDGA 5ALBL 3UTQB 3BGMB 2RJMA 3FB8B 5L0QB 1SEBB 1Z0MA 1BIIB 3CGTA 1EVUA 3UO1H 3UPRB 4R26L 2ZWLT 2BOBA 4MS8D 5E03A 3SDAA 2MFNA 4LPUA 2VLJB 1IM3A 1INEH 3L5IA 1AGCB 3WBDA 3MJGX 5D5MB 1XF5B 2P46B 4CU8A 2F8VA 1A9BA 1OTSC 1XGUA 2X9WA 4OGYH 4L4TE 4PRAA 3VXRB 5ITFB 1DFBL 4W6YB 1JFQH 3RUGB 4YPJA 4P5MB 3H7BB 1I8IA 4YQXH 1M4KA 2MCPL 1I3UA 2P4AB 1CXEA 2PUQT 2J12B 1IGYA 2X89D 1BVLA 4MNQE 1JPSL 1Z9MA 4QRUA 4OGXH 4U1MB 4YUEH 1X6LA 2YD5A 2X70A 1H15A 2ITDB 3VCLB 1WEJH 1HQ4B 1TPXB 4L8BB 4H20H 1IM9D 3MLYH 4Q0XL 2X4NA 5H2BB 4GRWB 3RL1A 1OCWL 1UGNA 2N1KA 1B9ZA 1FJ1B 4KK6D 2V7HA 1ZEAL 3CU7A 5ID0B 2FL5B 3RKDD 3H2WA 1G6VK 1GGUA 1OGAA 1RUQL 2AK4E 4F15B 5KN5A 5F3HB 4HXAH 5LWYH 2ESVD 5GRVL 3CX5J 4HIHB 2BY2A 2F54A 4Z5RB 3WDJA 5CP7A 2VLKA 4PBXA 4DVBB 4RFNC 3BD5A 3WJLC 3GB7B 4LSRL 3SBWA 4CN6A 2AJXL 4NJ9H 1YJDC 3JSSA 3KJ6H 2R0ZL 1LD9A 5GRJL 2HRLA 5EC1B 1E6OL 4FP8L 4D0DA 4U1NB 4QHNA 3BE1H 2VDPL 5T5NF 5TFSH 3CMGA 4YXHL 2YWZA 2DQFB 3MNWB 2PTVA 3OHXB 1MRCL 2FATL 3MA9H 5JQ6H 2W59A 1X9QA 1YQVH 3DTXA 2XOTA 1WZLA 3ARWA 1ZHLA 3LPGA 4XXCC 3V79C 2ICWI 3M8OL 1X7QA 2YMXH 5CJ5A 4U6HA 4OF3A 4U6XB 2ARJA 25C8L 5IR1B 3V0VB 1QVOA 4YGVB 5CJ8A 5DFVD 3ZE2F 1YMMA 4OM1L 4OCXH 3UYRH 1I7UA 4GG6F 3TBVA 3VFGL 2Z31A 3NCEB 3OZ9L 1WF5A 3LSOA 5DJ0A 4HUNB 1MIMH 3R4DA 5T3XD 4QHKI 4BQ6A 3HC4L 2DM3A 1KPUA 5CGYC 5DEGA 1BF8A 2GSGA 3DUSA 2ICEA 1U6AL 4LPVA 3SO5A 3CFJA 4N9GB 2HT4C 4UILH 2H32B 3CVHA 3LH2L 1A4KB 2VSCA 3RZCA 1HQRB 2UV3A 5HJ3A 4RMWA 1A6UL 4PRBA 2W60A 4Y5XB 5CEXB 4X4YA 2DQIH 3SE8H 5ISZE 4L1HA 2UZXB 2QSQA 5C09D 3DRTB 4X6CB 3QDGA 3LZFH 5LGHL 5CJXC 4IS6A 4OLEA 4JDZB 2OSLB 2VUOA 5F6HI 3K3QA 3PP4L 2EE3A 3BIKB 3BH9A 4OGZA 1RIVL 5MEQB 4YXKL 2CLRB 4PP1C 1GSMA 3V6BR 1R5VB 3QWRA 5I1KL 5C0IB 4DZ8B 2ESVB 3BGFB 4X6BB 1A1OA 5DMKA 2BVYA 3EOAB 5FM8A 1K8IB 4HX1A 3P0GB 3X11B 5CFHA 2VWEE 4M02A 4QTHA 1ZANH 3UO1L 4MJ5B 5F9WC 1VGEH 1SMOA 4Y5YA 3EOBB 3JV0A 3H9SA 1ZHKB 4L4JA 3CNKA 1INEL 1DANU 4LRIC 5DFVC 2BVPA 3ZE0E 1U3YA 1KLFA 3E6FA 4ACPA 4OGYL 2EDQA 3U36A 4LKXA 4D0CB 3PJSB 1JFQL 1KJMB 1UB5B 4LEOA 1D9KA 4MD4A 3OSKA 1KCLA 4CW1A 2I9TA 4JO2L 3FL7A 3HZVB 3BN3B 2OJZH 1C8PA 3TT1H 2IANA 4FZEH 5B21A 3UTTA 2EDXA 4OGXL 4WY7H 1I9JH 3NFPB 4YUEL 3SQOH 3H8NA 5DA4A 1WEJL 3MREB 4H20L 3MLYL 4XP4H 3LPFA 3HZYA 2CDFB 3JXAA 1NDGB 3VU2A 4R3SB 3OKEA 4C83A 4BFBD 3P73A 2IBGA 1LE9A 1BD2E 1CDIA 3QUYB 2F53A 1MCWM 3FO9A 1JWUB 3QI9D 2MMXA 1F2XK 4J7RA 4WFFD 1JP5A 1J8KA 3TO4D 1BWWA 5I1AA 4HXAL 5LWYL 3WYRA 4TUKH 2NTFB 5CHNA 3VXUD 3WIFB 3OKOB 1Q94A 4YZFE 1C08B 2NX5E 3DHMA 5BV7B 2FX7H 3FT3A 3KLDA 2JCCE 1PYWB 4NQSA 4NJ9L 1R0AH 3UZEA 3KJ6L 1U9KA 2FH6A 3C09C 2AW2A 3CVHH 5C08A 1KELH 2V9QA 4KV5F 4JO1H 2ICCA 1EZVY 1GOHA 3BE1L 5C09B 4KK9D 5TFSL 1VCAA 1UM5H 3MA9L 1DTUA 1NEZA 5JQ6L 2YR3A 1ZA3A 3L3DB 4I2XA 3HE7A 4XP1H 4XP5H 2YMXL 1UENA 3QULA 3LN9A 4IEFB 4GW1B 1M7IB 5GRUH 5IKCA 4IRJB 1RK0A 1I85C 2I24N 5I6XC 5CSZB 4OCXL 4MMZC 2EC8A 3UYRL 4U0RC 1GCFA 4ORGA 2HTLC 2G2RB 5KSAD 3SCMD 4FS0A 4UDTA 4YXLH 1JN6A 2Y06H 2ZUYA 2H8PB 3ROOB 1SYVA 4MD0B 4XAWH 4GLRI 4QOKA 2A74B 2IBZY 2DJ4A 1DQQA 5EZJA 4HPYH 1T7VA 2EE9A 2EZ0C 4Z0BL 4UILL 3DBXA 1S9VA 4LVNB 4F8QA 4PGCB 4DKEH 2AXFA 2DYPA 3H42H 4JHAH 2IAMA 3QI9C 5FKAB 5GRYA 3DURB 1HH9B 2DQIL 4LSQH 4RMUA 1G7LB 3SE8L 3PWUA 2YS4A 3UX9B 3MFFB 1Y18B 4PREB 5JHLH 2R2EA 3LZFL 5TGBB 3RGVA 3B9DA 1ZA6B 3IKKA 2VE6A 3J7HA 5BRZD 4WI9A 4M7LT 3IJHB 1JPFB 3G6JB 1KNOA 4IIQA 1ZXQA 1UCBH 3QIWC 1RZGB 2N4IA 4AH2A 3REWB 4KK9C 5C0BB 3TO4B 4URTB 5I19H 3PGCA 3ARDA 2Y6SC 3DX8A 4YHOH 2AV1A 1QHOA 4PB9L 4X9GA 4F7TB 3VWJD 1CDBA 1ZANL 1VGEL 4KWUA 5C3LD 3LV3B 3GHBH 4L9DA 3KPQB 2Y1VA 3A0OA 3A6CH 1RZKC 4Z7UA 4ODBD 2HJKA 4XAKE 3GMQA 1MUJB 1Y6KR 2FB4L 4ZUSB 1AXIB 2CD0A 3NGBB 3MGAA 8FABB 5KSAC 2CR6A 4UUJB 1JPGA 4Q9QL 3FQRA 1U8QB 3D25B 2W0FA 1OP3H 5AAWA 3MLSH 5A2KH 2OJZL 1U8NB 2VXTL 5D2NC 5GGSY 4Y16D 3TT1L 5D70H 2A38A 4KJPD 4X8JA 4FZEL 1I7RB 4MHHG 4WY7L 1I9JL 4MWFA 3SQOL 3F6LA 3I6KB 1M05A 4GT7A 5HGHA 4M62H 1EEZB 4O9HH 4PD4J 2BVTA 2Q76B 3BMWA 3SCMB 1UXSA 3O4OC 4HS8H 2JB6A 2XWJA 3RWCB 4ZUTB 5FGBC 4U3HA 5CMAB 4HD9A 5TF1H 1KPVB 5FUCC 4TUKL 2ADFH 1I8LC 3EDEA 3LDBB 4HUXA 3VRLE 5I1EL 3IFLH 5IHUL 2PW2A 3KPPB 1BFTA 4PJGF 2FX7L 2OS7A 4WUUA 3QB7C 3BPCA 1EUTA 5FO9A 1R0AL 4LSTH 3KNBA 5HD8C 5F71A 3AM8A 1KELL 1Q9KB 5J12B 5D7IB 4JO1L 4YHMH 3VG9B 4NRZB 3KLAB 4R4FH 1EO5A 3SGJC 4IOFC 4P2OC 3TPUB 5JORA 1BLNA 4Q9CA 1UM5L 2YK1H 3DVNA 4NUJB 1N59B 3VWJC 3MUZ1 3IGAB 3G08A 3CCHB 5CS7A 2KQMA 1CICB 3RPKA 6CGTA 2VSDA 1OLLA 2A6KA 1VFBA 4PJCA 4XP1L 4XP5L 1OTUC 4HIEB 1A7OL 2CRMA 2DLEA 4CVXB 1OD9A 5CJBA 1ZLVK 5GRUL 3HMWH 1RVFH 5E24E 3S5LB 3PIQB 1KJ2A 3EDFA 3T3PE 1J88A 4K3EH 1SYSB 4PP2A 1QBLH 4J3SA 1PQZB 3PWJA 2CK0H 2VLRA 3AROA 5T1KA 1S9YA 3T0EB 1MLCB 4X6DA 3PL6A 2YSSB 2Y06L 2FH8A 4ZPTA 4XAWL 35C8H 1ZKAA 3Q6FA 3L3KA 4L4VA 3GIVA 4AIZA 5SWQB 1LK3H 4HPYL 3SEPA 2UWEE 3O6MH 5J11B 3MRJB 4CADA 4M61A 4XZUA 4DKEL 3BI9X 3H42L 5EC2A 2A73A 4JHAL 3MRHB 3O3DA 4ISVA 4NFDA 4LSQL 2FLBT 4Y16B 5E9DD 4PJHA 4G8EA 2W91A 1ZGLB 4KKBC 5JHLL 4LHUD 3WN5B 3RTQA 1NMCC 2NYYC 1P84J 5LAXA 2HG5B 1RI8A 5F97E 2LTQB 2IQ9H 4FQIH 3QUMB 3I6LE 1UCBL 1FGNH 4MNHB 1AHWA 4QRPB 1HEZB 3IFPA 4JFEE 1C5DA 4F7PA 3SDDD 2HMID 3ABZA 5DJ8B 5I19L 4DGYH 5GJSH 2WANA 4YHOL 3BYTA 3BT2H 4FQLH 5SX5K 4AL8H 3BEWA 1HHHB 2NZ9D 4Z7UF 4MD5B 2PO6A 3DUUA 3HZMB 4AJ0A 3W0WE 3GHBL 1P7HL 4A6YB 4PJ7A 2H9GA 3UP1A 3JWDC 4ZYKA 5J1AB 3MCG1 4V2CB 3L3OA 3PGDA 3PG2A 3BPOB 1WZ1H 2XTJB 1BOYA 1CYGA 4HK3N 4G80A 2VC2H 1PJ9A 4JFQB 3O45B 3MLSL 3CFBB 3TVMA 4PV8A 5D70L 3T65A 5KSBE 4Z7QE 5KVEH 3LKOB 3ARFC 3FB7A 4ZODA 5SX4I 1B0GB 5ETUB 4YHYC 4M62L 3UBXI 4O9HL 3CFEA 4DK6A 5FEBA 1MCOL 1WBYA 5B3JF 1GHFH 1G7HA 3F7YB 1JF1A 2QQKH 4Q2ZA 2AJZA 4PFEA 4HS8L 2J8UB 2ADIA 1KIUA 2DRUA 5TF1L 3NBNA 1UM4H 2ADFL 5I0ZA 1F3JA 4QT5A 5JDSB 3I02A 3IFLL 3KPOA 1Y6NR 3A6BH 2VDOH 2X6MA 5GS2D 4XCFH 4LSTL 1YEJL 3L3IB 1T21B 4YHPB 3S35X 3DECA 4YHML 4ZFFB 3MROA 4PJ5A 4R4FL 4NQDD 1P69B 3C6LD 4PRHD 3GJFA 2ZSWA 3KXFE 4LHUB 3OJDB 4PJCF 5DD6A 4TNWK 4ZOAA 3KGRA 4LSVH 2JTDA 2ITCA 4P46A 4JDVA 1CDGA 4K71C 3C08H 1X5AA 5EBWB 3ZHLA 5KJRH 5C0CB 1W8OA 4H26B 4M5YH 3SDDB 4X6DF 3FOLB 5MEPA 4LSUH 3HMWL 1RVFL 4NNYB 2QSTA 3HUJA 4K3EL 1E27A 1QBLL 2H6PB 4O4YH 3VXTA 2CK0L 1KTDB 4Y2OA 4WFGD 4F7MA 5I74B 1MAKA 4YDIH 3RZWA 1K9TA 35C8L 4GFTB 3W39B 2ADGB 2X4OA 3ESVF 4JZJB 4KI5F 2AK1H 4I5BA 3IRPX 1ZLUK 1GGTA 3O6ML 4WHTA 3ZT5A 3KS0H 3MV7D 4NBXB 4JQXC 2PTTB 4PJHF 1FYTA 4MNGE 2G5BB 3CUPB 3KJ4B 1G0XA 1QBAA 1T03H 3ZDYF 4HG4K 5CLWA 1EZVX 1ETZB 4Y7MA 5DHYB 4NQCE 4IMKC 2G5RA 2VAJA 3MV8A 3GRWA 2PF6A 3KPMA 5HYSA 4HG4J 2OL3H 2X1QA 1KTLA 5KS9A 4Z77B 4FQIL 4WFEE 2C1PB 4M7ZC 1D5BA 3N1MC 2CRYA 3QEQD 1FFNA 3C6LC 5HVFB 1T3FB 1OVZA 4DGYL 5GJSL 2VKWA 1BAFH 3IDXH 4KHTH 3BT2L 4PJ7F 4FQLL 4AL8L 2EIBA 3ZE1E 2B5IB 2EDHA 4G6MH 4HHAA 4WI8A 1JTPA 5CEZD 2IBZX 1NGZB 3DX7B 4PJIA 2A0LC 5JUEH 4AEIL 4NQDB 5F8RC 4PRHB 4XVSH 3X3GH 1RPQA 4EUPG 1ED3B 1WZ1L 3FO0H 3BOVA 1FFPB 4JRYB 4ELMA 1U58A 2VC2L 3GJFH 3DLQR 4PJAA 5D1QD 4KTEH 1BVZA 4YHIA 5KVEL 1V8HA 3QXWA 2DQTL 3VFSB 1S7XB 3T0DA 1FYHB 3EJYD 4MJIA 3V6FA 2J7LA 2DQCH 4LAJH 2IFGA 4MDIA 4P2QB 2GY5A 2IG2H 4JZNA 4NNPL 2WBJD 4WHCA 1GHFL 2QQKL 5HPMA 4L3EA 1HH6B 3IVKA 2QTEA 2O5XH 3KYMA 4DOHE 5DK0B 3UZVB 3UYPA 5KW9H 3K4DA 5ID1A 4G8IB 1UM4L 3MV7B 1ZGLM 4UAOC 4RBPH 5EOTA 3A6BL 4L8SC 1MCFA 3FMGH 3BEVB 2E8YA 3QFJD 4TVPD 1MHCA 4XCFL 1I1AA 4J6RH 4ODXB 1B2WL 5AG8A 1MAMH 3E3QE 4KMTH 1QRNE 3GJEA 5DVMA 1D5IH 1ORSB 1ZLSL 2NLJB 5IB1B 2VAAA 4S1SH 2NXYD 4RWHA 3BW9A 5D1XD 5GS0H 5HVHC 4P2RE 3TN0C 4TN9A 4XHQA 3C08L 1N0XL 2VDMH 3OKNB 4TQEH 2HAZA 3HUJF 1CQKA 4F3FA 3C8KA 1ERNA 1KLGB 2FWOB 4Y4KB 5KJRL 1CU4H 4CDHA 1QKZH 3QEQB 4M5YL 5D9SA 1U92B 1B0WA 4Z7NF 4LSUL 3ULUD 2ZUQB 3ARZA 4S1DD 4F9LC 1WZMA 4G43A 3V7AG 5DRWB 1L0YA 3I2CH 3L95A 1BFOA 4G5ZH 4OFIA 4YDIL 1H3WM 3B3IB 1DBAH 5HGAB 3EJYC 5HYJA 1NBYA 2AV7A 1XIWA 1LDPH 2WBJC 5IW3A 5DO2C 2JIXA 2BNUA 1JIBA 1AFVH 2AEPH 2EYTA 1T03L 1KB5B 5D1QB 1PZ5B 2OR7A 4FFVD 1HOCA 1LEGA 4PJ9D 4I48B 5E94A 5F96H 4BSVA 5FB8A 4JFFD 2Z4QA 3B9KB 3ARGC 4NKDB 1CZ8H 5KS9F 3N1FC 4HWBH 3O9WD 3EUUA 5E4EC 3TBTB 2OL3L 4DZBB 5KSUB 2DI7A 5C0FA 1BP3B 4B53A 3L5XH 1FVDA 3C87A 2FSEB 1AP2B 2YBRA 2EDFA 3BSZH 2NXYC 4O2FA 5K9OB 5F70A 1OQOA 1BAFL 3GMMA 3IDXL 4KHTL 4YE4H 4PJIF 3SKMA 4WWKB 4MVBD 4YX2H 3PWPD 4G6ML 2XKSA 1XGQB 4U1KA 3S88H 5FFLA 4KVNH 3SDYH 1XF1A 2X4RB 3BDBA 1Z9SA 1HDMA 3TZVC 4E41E 5FHBH 5J56B 5JUEL 5BXFA 3GHEH 4ELMF 4E5XB 5JOPE 4PJAF 4XVSL 3X3GL 3NIFE 3GI8L 4ZAKA 2VISB 2EIZA 2CKBB 4G6AD 4R0LB 2D31B 1KC5H 4U1JA 5CJOH 3VI3E 1OOAA 5DHVA 4TSBH 4JVPA 3C5ZC 3CFDB 1L7IL 1RJZA 4ONGH 1UWXH 1S3KH 4KTEL 4I13B 4CNIB 5ICYA 5A3IC 2XFXB 2X09A 4J1UA 5IB2B 3I75A 2HT3C 2HVKA 1BQHA 2DQCL 4FQXA 1OB1B 3LS4H 1ONQB 2IG2L 2Z9TA 1INQB 2Z35A 3SGKA 4XMKH 4JFHD 4JGJA 4FFVC 3BKJH 4LL9A 2R29H 5MERB 2O5XL 5IMOB 1AGDA 2JK5B 4KMLB 4L9LC 3B9VA 5EN2B 3M17B 5KW9L 4ZS6C 3O9WC 1T20A 1A2YB 2D7NA 4LCWA 3AREA 2V7NB 2EE6A 4P2QE 5DJ2A 3FMGL 3GI9H 2ICWB 1N64H 3P4MA 4J6RL 4JM4L 1SJEB 4TSCL 3OKMA 4PJ9B 3UJJH 5JPNB 3ARBC 1JPST 1MAML 1U3HB 5L2KB 4PY7B 3QXDB 1PKQA 3VWKD 1D5IL 5CAYB 3ULVE 1X5HA 1DLHA 3GSNA 3BWAB 5GIRA 4S1SL 1J8HA 5E1AA 2AXJA 5C6PB 5GS0L 5IEHB 1SVZA 5D1ZA 5FA3A 1JCKA 3GMRB 2QADC 1O0VA 5FK9B 1RHHB 2VDML 4TQEL 2FR4B 4EXPX 2WWKT 2CIIB 5K9KA 3WFHB 1CU4L 1QKZL 1W0YT 1JTTA 1QSEA 4Y1AE 1U95A 4EEEA 2NY3C 1MNUH 1AQDA 3VMOA 3PWPB 1S7SB 2M1KA 3HI5H 3I2CL 3O3BB 4G5ZL 4BH7B 1LO2H 5I8KH 2VRAA 4ZTOH 2FIKB 3ARRA 1CFNB 1DBAL 3RY4A 3TYFA 4M6MH 4DKDC 4FQHB 4WTWA 5IBLD 3MBEC 1LDPL 1RULH 3QDME 5GGRY 2CPCA 1H3PH 4JHWH 2AEPL 4N8PA 3S3SA 3K46A 4ETQA 1MH5A 3AS2A 1XCQA 4PV9B 4QXTB 5ESVA 5F96L 4PLKD 5C0AE 4Z76A 2VZTA 4JRXD 2CXKA 5A2LH 2P44B 3LEYL 4PJXE 1CZ8L 1GOGA 2V2WB 5C3TA 4HWBL 3PUCA 5HHOD 3HI1A 3OR7B 4AIXA 2VQTA 4YHNA 5E56A 1G7MB 3UTSE 4PY8I 4ZFOA 5J8OA 4F2MA 1HXMB 5TE4H 4L4TA 3UTPD 2VZ3A 4L29B 4Q9RH 1A6AB 1MFNA 3ARQA 3NAAH 4FRWA 3LEVH 3KPRD 1YYMH 5D2LF 3L5XL 5F88B 3VWKC 4HJ0D 4MNQA 3BSZL 3S9DB 4GRLC 1NC4A 2PW1A 5IM7B 4H5SB 4P9HC 4H25B 5LXGH 1FC2D 3BQUD 4PJDE 4YE4L 5DR5H 1F8TH 4MA7L 2KL6A 4YX2L 5A2JH 2HYMA 3B5TA 1JNHA 5DK2A 1N8ZB 5DQ9A 4KVNL 3SDYL 4GXVH 3S88L 2D4DA 3RWJA 1M7DB 4L8CA 2YD4A 5FHBL 2AK4A 3GHEL 3BKCH 2ZNXA 4X9FA 1YN7B 5DYOB 4JANA 4WI5A 1N26A 3V2AR 4M1DH 5KG9A 4LKCB 5AUMB 2YN5A 1KC5L 5CJOL 1MJJB 1WZKA 1NCNA 1P9MC 5C2UB 4TSBL 3GSNH 3MGOA 1CDYA 1T89A 2BNQB 2WUCH 5DGRA 4ONGL 3RWHA 3S3PA 4N0UE 4X99B 1S3KL 4OZHE 3HR5A 1OLZA 1VEPA 3ZYJA 2H2PC 1GRWA 3BH8B 4HEME 5J13B 2VZUA 3BDXA 4Y19D 5H94B 3LS4L 5M94B 5IJKA 2EE2A 2GSIA 3Q48A 3QIBC 1CG9B 4X7DC 1JK8B 4XMKL 3EGSB 3BKJL 1A1MA 4PLKC 2R29L 2RFXB 5MEND 1YNTB 4GBXD 4U6YB 2GJ6D 3CH1A 2K9UA 3BN9D 1L0QA 1V3KA 3DETD 3IKCA 2XWTB 1OPGH 4BZ2H 3O4LD 1G0YR 5KTEH 3DUHA 4B7IA 1P6AB 3WKNA 4CVZB 4YH6A 3GI9L 3MYJA 1G6RB 5F7WC 4KJWD 4Z8FH 4QRTA 1QO3A 1N64L 4Z7VB 2G9HB 4NKMA 3O11B 5HGBA 3UJJL 1FFRA 2VR4A 4XCYA 4PRPD 2V2TA 2BNRD 4JRXB 2XN9B 2QSCH 3TJEH 3IJSB 1JGEA 3HC0A 4LLWA 4YBLB 3BQUC 1WT5A 1XR9A 1S5HB 3MRIA 2A83A 1JUFB 1CL7H 4NZDA 4RNRA 5DC4B 3KPRB 1PY9A 1ZSDA 2IMNA 3D1MC 5GGUA 5GPRA 1UKQA 4LGSB 3BP4A 5FCUH 5ISZA 4ELKA 4C4KT 1I1YA 1MNUL 1QQDB 4JFDB 5GSVB 3V0AC 4OCWH 4F80A 3OWEA 5CD5D 3VFPB 4QYOA 2BMKB 2JF1A 3HI5L 3MCKA 1CWVA 2C3VB 1LO2L 5ICZA 5I8KL 3OJMB 4I18C 4ZTOL 3F8UB 2CLZB 4NRXB 3BUYB 1ORQA 1U8LA 4GW5B 1RULL 3KWWA 3OKDA 5FYKE 2M8XA 3KHOA 2OJEB 2OBGA 4JHWL 2I60H 1YPZE 4ZOEA 4GBXC 4YHKH 3W9EA 1TCRA 3SE3C 4ZFGH 1HSBA 4XC3H 3QRFM 2Y5TA 1MLBA 1TZGH 4HFWA 4Y5VB 1L7TH 3SKUD 3REVB 4P5TD 1PX3A 5JZ7D 4DUXA 5TE4L 3FQXB 4KJWC 1UJTA 4HDIB 1TTGA 4Q9RL 3C5JB 3G5VB 5DD1H 4DGVH 1UA6H 3QHZL 3G6AA 2OM5A 4PJFB 1MHEB 3LEVL 1YYML 2DLGA 3NN8B 5MENB 3L7EB 3UPRA 2VLLB 4UV4H 4XVUD 1T1ZA 3W11C 3D39D 3O4LB 1XF2B 5IIEA 5LXGL 1LNUA 3ESUF 1H3UA 3INUH 4L3CB 1F8TL 1ZHNA 5E5UB 12E8H 1IAKB 2PR4H 4OZGE 5ITFA 3S5LG 4GXVL 4MB4A 3QUZD 2EC9T 5DUPL 4J12A 3LB6C 4PRPB 3BKCL 5FYLE 3U1SH 3WS3A 5BJTB 2VLMD 4OLZH 3TFKC 4M1DL 3LQZB 3V6ZA 4P4KA 2Q6WB 2ITDA 3VCLA 4LPTA 4OFYD 1ZWIB 4ONFL 2NX5A 1SJXA 5F8QC 4P59L 4B41A 3GSNL 4LCCC 4LLQB 1FNEA 4HFUH 2WUCL 1IL1B 2JCCA 3VDCA 5EUKB 3HCVB 3K1DA 1TXKA 3TIEB 2XTLA 4OSUH 4JQIH 1H0DA 5F9JA 1YNKH 2GCYA 2J6EL 3VMNA 1AXSB 3LN4A 3B9AA 1BJ8A 4UI2A 1QFPA 3C5SA 4QHMA 1BFVH 4Q9BA 2PNDA 2EDWA 3BXNA 2BNQE 3RNKB 2F15A 4TYUA 1I3VA 4WI7A 5EC1A 5C0RH 4LNRB 3T0WA 3OX8A 1IGJB 5ICXB 5JZ7C 4BZ2L 4TSAH 4LQFH 5KTEL 1CD1B 3QISA 4Z8FL 2WIIB 1JYNA 3K4AA 2AXGA 4K94C 4OBSA 4X4ZA 3IDYC 5HDOA 5HDLA 1TZIB 5AD0A 4GRMA 3JUYA 2QSCL 3TJEL 2W0KA 1IE5A 1NFIB 3FQTB 1CGSH 4CMMB 4O02H 1R3JB 4U6XA 5FHAH 1CTNA 4P5TB 3VDBA 2F58L 1CL7L 2R23B 3BVNB 4WHYH 4R7NB 4TUJA 5IB5B 4OQ1A 4BQBA 3E6HB 2CR3A 4WU5B 1Q0XH 3G04A 5IK3A 5ANME 4P57B 4U7SA 2ED9A 3L3GB 5SWSD 4J8RB 4U1GC 3D39B 1ZT7B 2X40A 4PRID 3KDMB 3EYVB 3GSRB 5DI8B 5HI4D 4C56B 4XNQA 4OCWL 3GMLB 3MLZH 1HQRA 2APWA 5E1HB 3QUZB 2FZ3A 5I71B 4M9OA 2YPVH 5F7UA 2FD6L 3V4VL 1K6QH 4K3JH 2C5DC 4K3DH 2YPLE 2F8OA 4Y0GA 4X7TA 3STZA 3OXRB 4G9FE 3F65A 1U8IB 2Y5EA 5EO9A 3DYOA 2CDEA 2OSLA 3HG1D 1QR1A 1DUZA 2YA0A 2I60L 1V3LA 5FO8B 3LQMA 4RAVA 3ZE0F 4YHKL 3DX9B 3G5YA 4ZFGL 3KPSE 4XC3L 1NCTA 4M8QA 2DQUH 1V7MH 2VABA 4GRWH 3QQ9C 1HHGA 1P2CA 3LRSB 2PETA 1TZGL 5I17B 5KSVB 3OXSA 3GDBA 1L7TL 3HE6D 4X98A 1MCQA 4CDGC 5GZOC 1K8IA 5DD1L 4J4PA 4DGVL 1UA6L 2EYRA 4LHUG 2Z92B 1I7TA 4UV4L 1JL8A 3V8OA 4UMGA 1Y0LA 2F74B 4E42B 3WJJC 3ETBF 5EH1A 5I1IH 1WCBB 5LG1A 3IDNB 2ED7A 3INUL 4WTZG 2D7PA 3DMMA 4P3WA 12E8L 3PJSA 2PR4L 4LCIL 4Y89A 2W9LA 1IRAY 4J23A 5T1LD 1FNGA 4TNVK 4XP6L 2RGSA 3NFNA 1NCUA 3MLVH 1S7RB 4CVUA 3R06A 3IF1A 1LO5B 3C2SA 1CLYH 3UBXB 1FG2A 5IB4A 3U1SL 3MLTB 5L88H 3TBYB 2JCCF 4LVOB 4OLZL 3WIIL 4BQ8A 4EDWH 4YAQA 3O6LH 1OQXA 2NW2A 4PRDA 1JF5A 3MREA 4KJQD 2FJGB 5JHDE 1MI5D 4HFUL 4OZIE 5DJCA 3N50A 2FJHB 3QUYA 5SWSB 3VFOA 4OSUL 1PEWA 3TA3C 1BBDH 4WW2A 3SDAD 2JJVA 1AGEB 5H35B 2NTFA 3WIFA 2OYPA 4M4PA 1BFVL 2XIDA 4K7FA 2I07A 4GKNA 4L8DB 2A6DB 2DAVA 3RWGB 4W6XB 3QIUB 2OR9H 2OK0H 5C0RL 4P3DB 5C9JB 3S96B 3EO1B 5E8DH 5I8EB 1XGRB 5IROA 2AJ3B 4TSAL 3QDJD 4LQFL 2ZG2A 4XNZC 4QKXB 5D6CB 3HG1B 4S2SB 1NPUA 4GKZA 1Q1JL 1T5WA 3WE6B 3N1QC 4YFLF 5H8DA 1B0RA 3BFOA 5D8JH 1CGSL 4O02L 5FHAL 2IJ0C 2UWEA 2Z8SA 4XBGA 3HE6B 1OGAD 4GG6B 4IRJA 5I76A 3LPWA 4HXBH 1CLCA 3V5KA 2P8MB 3EW3B 2HT2D 2MHAB 1Q0XL 1EEYB 5HVWA 2VLKD 4GMSH 5FOBB 1HIMH 2H8PA 4MD0A 5HPOA 5T3XE 2E7LA 4R2GD 5GZND 1WITA 3EYQC 4Y2DA 1FL6B 4NPYB 2RAMA 4WV1B 2NY1C 1KIRA 2APBA 1QEWA 4FTVE 4EVNA 1BM3H 1CXHA 1UQSA 2YPVL 5DA0B 1K6QL 4R7DA 1HH9A 1S7TA 4K3JL 4I9WE 4K3DL 2DKUA 4P4RA 3B2UD 2XYCA 4MA8H 1FP5A 1H5BB 1P7QD 4M48H 3ILQD 4TUOA 3M1BA 5I1JH 1MI5B 3CDGB 1IKFH 4KK5D 4BJLA 3QZWA 3W0WA 2Z31D 3NZHL 1L9MA 1DEDA 1UG9A 2DQUL 3FB6A 3MJ9H 4JG0L 1V7ML 1BOGA 1BJMA 1RZGA 4TVSa 3JTTA 5BOZG 4UNUA 2BOBB 2DIJA 5C0BA 3SDAB 4YBHA 2D9QB 1IM3B 1QACA 4LPWA 2RBLA 1A9BB 1IBGH 4LLDA 1L6XA 4PRAB 1RFDH 3EOTH 2GW5A 5C6WH 1GIGH 5BV7H 5KSBA 1IGYB 1BVLB 5I1IL 5IHZA 4FQQA 2ERJC 2EXWC 4QRUB 2HT2C 4RGMB 1S9WA 3QDGD 2XQYK 2CLVA 1OM3H 4FFWD 1H15B 1U8QA 3RL1B 3D25A 2X4NB 3MLVL 3QDAA 1WIOA 3VRLF 2GFBB 2P7TA 4OFDA 4EI5B 1CLYL 1CXLA 3O6KH 2V7HB 4JN2A 4YDJA 5L88L 1OGAB 1LP9E 3I6KA 1FIGH 4EDWL 3O6LL 4PIRF 3IETA 1FSKC 3T0BA 2F54B 1NGPH 4WRLA 1FHGA 4WW2F 3U30B 2EIDA 3LAFA 2HLAA 5CP7B 2VLKB 4XVJH 5TE6H 1NMCB 2P8PA 3P30H 4GKSA 1OW0A 3B2UC 4ZUTA 3RWCA