5T1LB

Cetuximab fab in complex with cqa(ph)2dlstrrlkc peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
221
structure length
216
Chain Sequence
EVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CETUXIMAB FAB LIGHT CHAIN
publication title Natural and non-natural amino-acid side-chain substitutions: affinity and diffraction studies of meditope-Fab complexes.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 45
structure length 216
sequence length 221
ec nomenclature
pdb deposition date 2016-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t1lB02
3KYOB 3SE4A 3FRPA 5E9DB 4OZFG 5JLZB 3B5GA 4KI5D 1J0JA 3GIZL 4QRRE 2P5WE 4UAOB 4S1SL 3AY4C 3G08A 3FB6A 4U0RC 1JGUL 4Y5XB 1NGYB 2R0ZH 1XGPA 5B39A 5D7LA 5DJ0B 4GAGH 4XPTL 4JQVC 1NFIB 3MLXL 2EDTA 3VFVA 3ZT5A 1G6RB 2IPTH 4PLJD 3S36L 5C71A 4NO3A 1G0YR 4OLVH 3I2CH 4U1LA 3I3EA 2X4RA 4F2MB 4QTIL 1AR2A 3QBTB 4TSBH 3BDXA 4WHYG 1JPFA 5FA3B 5CEZH 3W9DB 5IV2B 1I7ZB 4K2UL 4KI5E 5F1OB 4G80B 4I2XE 4LKXA 2FATL 4POUB 1OTTC 3LEYH 2X4TB 4W4NA 5CINH 3I75B 2YKLH 5EBMA 5JUEH 2K9UA 2G2RA 4XB7A 3IVKA 1I1RA 4YFEA 1K2DB 2ERJB 1SMAA 2Y07L 1OPGL 1Y0LA 5EU4A 1Q9OB 4PRIB 5CSBA 1ZAGA 4PJ9C 2AJSL 1RZ7L 3D1MC 1CFVH 3DUSB 1F8TH 5A2FA 2Y06L 2OL3H 2OR9H 3QI9B 5GQBA 3T0EA 5DJZA 4G8IB 1WZKA 1JHTB 2DTMH 2FD6H 2PNDA 3MGOA 3C5ZB 3UTTD 5IMKA 3FB5B 1XF5B 2X10A 3RTQB 5D7JC 3IS1X 2B1HL 2YHGA 4NBZB 4NJ9H 4F7CA 3TWCH 4HWBH 1KTLA 1FG2A 1IAIL 2YRPA 4WNQB 2AXJA 5FKPA 2J3SA 2OCFD 3VGAB 4ODTL 4H1LA 2VAAB 4YHPA 5K59E 1JUFA 2HWZH 2VC2L 5I1KL 2ZKHL 4R96B 4ODHL 4EUPA 1MCKA 2XZCL 4Z7WA 1LP9E 4LVOB 2AQ3A 4NKMB 4E9LA 4PJCE 3EOYG 3V7AG 1NDMA 4X6CA 1S7RA 3GSNH 4OCXH 2BSTA 4KKCC 3KJ4B 3FHQA 5GGRY 3SE9H 2YN3A 2XWBB 1MRCL 4WY7L 2VL4A 4HD9A 4A2MA 2CMRL 3K2MC 1B0RB 1S7QA 4K3DL 4ZS7L 1ITBB 4NDMB 4OT1L 3QUXD 1I1AA 4MA3B 4GQ9H 3DO7B 5DZNA 5DMIH 5FYLD 4P3CH 2VQ1A 1CD1A 2JJUA 2BJML 3OAZK 3CLEH 8CGTA 4XXDA 2DMBA 3WN5C 3PGDA 3C6SA 1GZQB 2CSPA 2OTUB 4EDWL 2OSLA 4CAGA 3QUZA 3D87B 4HUMB 5TQ0H 4XRCB 5JPNA 1JE6A 1MCHA 2WBJB 4ZO8A 3G9VA 4O2FB 1J0HA 2D31A 5IB2A 3MGTB 2CKBH 3ESUF 2PTTA 4S2SA 3NIFE 3SDDB 1G6RL 5ANME 4DZBB 1LDSA 4OJFH 1QFPA 3E3QC 3KYKL 3HPJA 4XNMB 4JY6B 1GL4B 2QQKH 4NOFA 5B38A 3CFEB 4U3XA 5F9WC 5FYLE 2GSGB 4PTTB 2GJZA 2FIRT 2KPNA 2NXZD 1ES0B 4LRIA 2NTFA 5IMLA 1PFCA 2YPLA 3R1GL 4X7DC 2X9WA 2UWEE 3KPRA 3IJHA 1TJHL 5ICYA 1PZ5B 3IDGB 2NY2C 2EDRA 3B83A 3CCHA 2HKHH 1NBVL 2P48B 5D2LF 2XZAL 4ZYKB 2JTDA 4EI5D 4RX4D 5C0ND 2LAAA 3G5XB 4YHZL 4I8DA 3CFJB 1OSPH 5FYJU 4JY5L 1FFOB 2I60H 3QCTH 1MJUL 3AU1B 5D1XC 3I6LD 3HC4L 4HPYH 4ETQB 1LEIA 4WVRA 4OGXH 5HGBB 5C86A 1AXTL 5HHMB 1KCVL 4XCFL 2R0LH 4ZOAA 5E99H 5KAQF 2GTWA 3QG7H 3NFNB 3CSYB 3CXHK 3FONA 2FHBA 4J1UA 2CRYA 4JHWH 1DBBH 1C5DB 5T3ZE 1FE8H 5J8OA 5ICZA 2JELH 1CICA 5DDHA 4P2RB 3LPGA 4IDJH 4ODWA 1H8NA 4Y4HB 3VFMA 1MCWM 4LCCB 4IMKC 4RIRB 3B9KD 1RZJC 3FN9A 1OCWL 4QRSB 3FQUA 3I6LE 4LLDB 3DETD 3WE6B 3AFLA 4KUCF 3LAFA 5C6TH 1NBYB 4OCNC 2DM3A 3RAJH 3P9LA 1YUHB 2FL5A 2QEJA 2FLRT 3HI1A 2C3WA 1ZGLA 2OZ4L 5EUOE 3TCLB 1NMAL 5C9JA 1F45A 3REWB 5DTFA 4ZO6A 3DV4B 4MAUL 4G6FB 4AYFA 3P30H 3C5JA 4PJEB 3U0TA 4HBCL 4LHUA 3X11A 2NX5A 4LAQL 3TJHD 1Q9KA 5D1QB 1KNOA 3ARQA 15C8L 1FGVH 1S9KC 3WXVL 4OZ4A 3FHAA 2P8LB 3MRJB 4XP6L 3RDTA 3GBNL 2FX7L 5C0DB 1GIGH 1SEBB 2Y7QB 3IU4L 3NTCL 1UACH 3IDYB 3U46B 3HNSH 3MRPB 1WFNA 3NCFB 1CL7I 1UCTA 1K4CA 4X6EB 3QNZB 4FFYH 2Y5EA 1RULL 3OJDA 4K3HA 5D1ZC 4AG4H 4C83B 3HMXH 4NFCA 1G7QB 5BS0B 4QRPD 2JIXD 1U3HC 1N8ZB 2CDFA 1JHKH 3BP6A 3PWUB 1YMMD 3TPUB 4WRLA 2EH7L 2FZ3B 2RR3A 5J3HD 4ZUVA 4BZ1H 4ZAKA 4UOJA 5IHZB 3HE7C 2VXQL 3QFJA 1OP5K 3SCMB 1K8DA 2WIIA 3VI4E 2NY3C 2QR0A 4JPKL 5AEAA 3CC5A 5CBAB 4TOYH 1WAAA 5DUMH 4FQJH 4F37F 2A74A 4OQTH 5I1JL 1FGNL 1AR1D 2J4WH 5DK0B 3SO3B 1DSFL 4K7PH 4PLKC 3I3BA 4GMTH 5IB4B 4P2QA 3GRWA 2CDEB 4QRPE 3MRKB 1RVFH 3PWJB 4WCYL 1YMME 4P9HC 4O9HL 3QEGH 1DQMH 4LLQA 4GG8B 4FZ8L 4RNRB 3MRGB 3V0VA 2HH0L 1I1YA 1IT9H 3D69B 3SDAB 3U9UA 4K8RH 1AY1L 4JQIH 3CMOH 3UC0L 2DM7A 4JPWL 1D5XA 5L2JA 1IQDA 4NZUH 1X5AA 1S7TA 3U82B 1RU9H 4M62H 4U4BA 4ZTPL 1A64A 1HINL 1ETZB 4L8SB 5E8PB 3SJVB 1BQHG 2Z93B 2C9AA 5E7BA 5HVHB 1PVHA 2X5PA 2VQTA 4OZIB 2DLEA 3JTSB 4JVWA 4Y88A 1WSST 5TDNB 2YXFA 2BNQA 4ZPTB 2AK1H 2R15A 3IAQA 2H32B 3OKLA 1T2QL 3VFTB 4GXVL 1VGKB 4ZFOB 1MHHA 2MTPA 4F7MA 1QG3A 2X7LB 1I8MA 1FFNB 2FYYB 3INUH 5E1AA 1U8IB 2APXA 2G9HA 3U7YH 1IC7L 5JXEC 5C07B 3OAUH 1WICA 5D5MF 4NUGL 4R2GB 5F93C 2WNGA 5C08B 4R3SB 4L3EA 2IH1B 1A14H 3NFPB 1HQRA 3GSRB 1B6DA 5IB5B 5DVKA 4QYOB 1OGAA 4FQLH 1OOAA 3FQWA 1UJ3A 2AXGB 1A9EA 4Q9CA 4MVBD 5HGDB 5C0CA 4YHIA 2M26A 4N0YH 5D6CB 1QO3A 2GUOB 5T1MB 5C6WH 4KK9D 2X4SA 3VMNA 2ESVD 3SGEH 1LE9B 5IKCB 3WSQL 1MPAL 2D9CA 4N5EC 2D0GA 3KYMA 4ZUWB 4YX2L 3X3FH 1RZIB 1OM3H 3WNMA 3ZKQD 2XI9A 1YEHH 2YSSA 3TFKC 4NQSB 5I6XB 1NUNB 1FNLA 1QNZL 3OSKA 1IKNC 3ELAT 2XWJA 3UYRH 3WO4C 1OLLA 1PKQB 5F8QC 3PWLB 3K4ZA 5E4EB 4ZO9A 3RY6A 1JGVH 1H3VA 4LPVA 5FEBA 5HSFA 4D9LL 2E9BA 5JORB 3ZSTA 2Q6WA 4ZQKA 1NAMB 2ESVE 1JRHH 5H37G 1ACZA 1IGYA 1CR9H 2AV7B 3QA3A 1GYAA 5FUOL 2HTLC 4V1DA 1QBBA 1TZIB 4XVSL 4JLRB 3OGCB 5HTSA 1V05A 1JFQL 1LD9B 3DX9A 1YNLL 4WO4D 5DRWB 1YY9D 1I8LA 1OTUC 4K94C 1F4XL 1JI2A 3H9SE 1RZJL 1U8JB 3HUJB 5E1HB 4WI4A 4Y4FA 4JJ5A 3P0VL 3MJ7B 1G9MC 2DDQL 3KYNB 5FYJL 5B8CC 1YEIH 3C09B 1SY6H 1R5IA 3RY4A 2JJWA 4G3YL 4U3CA 3EYUL 3OKMA 3LKOA 4E42A 5MENB 4P59H 1KTDA 3PWPD 4PRHD 4U1HA 3VXQB 1AE6L 1NQBA 4H25B 1BVKB 2ATPB 2MWCA 1VFAA 2VLMD 4KK8C 1A6TA 1ZA6B 2FEDC 2A6DA 3T3MF 1MFDL 2XZQH 3WL9B 4NRYA 3KNBA 4IRZL 3IF1B 5HHOD 4EIGB 5TE4L 4NN7C 4PG9A 2DRUA 3HE6C 2GEEA 3LY6A 2VLLB 2NXYB 3BZEA 3NIGE 1MQKH 4X9FA 3Q6FB 4PJ8D 1KB5A 5IGXL 3NZ8A 5KSBF 3DVIA 1KCLA 4LSUH 1XGRA 1OTTD 1AGDA 1UWEL 4K23L 2D9QB 4C4KO 3FN0L 1HHIB 1TQCB 3A67L 5E94B 2AI0L 1QD0A 3PWPE 1U8LA 1UM4L 5D2NC 4JDTH 5DMJB 3AB0C 1PG7L 2Z4QB 4PJ9D 4Z5RB 2P8PB 2VLME 3O6LH 4X0KA 2R2HA 4MS8C 1I9JH 1IAII 2DM4A 4PJEF 1SJEB 1ODAA 3SQOL 4HIJA 5EOQL 3BAEH 3VRJB 3EYOA 4OZHA 3KLAA 3EDKA 1SYVB 1AGFA 2DQHH 3DYOA 4AQ1B 3C6LB 3NFSH 1UKQA 5IVNA 3BZ4A 5I8OH 3VRLF 4LOUC 3OXSA 2HFEA 1DUYA 5TH2B 4PBWD 1A8JH 5EZOL 5JHDA 1QR1B 2X4QB 2DD8H 4DAGH 1AGBB 1U8QB 3SPVB 5IB1B 3MRDA 3DYPA 1RY7B 1XIWC 5BV7H 1OF2A 1S5IH 4MD4A 3MZGB 2PTUA 2W0FA 3SY0A 1VEOA 3WDHA 2WLZA 4TNVK 3S5LB 5E2VL 1Y6NR 1TENA 4FQCL 3PIQB 5E8DH 4MZ2A 4K07A 1NAML 4XWOC 4MA1B 4URTB 4G7YH 4U6XB 2ED9A 4QRRB 1YYML 5GGUA 2P5WB 3FJTA 4KKCD 1U2HA 4U7MA 3TVMA 4RDQF 1PLGL 1IAOB 3E8UL 1A7RL 4H20L 3ULUH 1P7QB 3KPOA 3A6BH 4JFDD 4UV4H 3PV6B 3OHXB 4KY1L 2CQVA 1AD0A 5T5FL 2R56H 5IW1A 5KBNC 1EFXB 4BK4A 2QLVB 1QZ1A 4WTXA 1J8KA 1DANT 4NQEA 3MXVH 2ICWA 5DZLA 5KANI 5FGCE 4XCEB 4XZUA 1IVLA 1IC5H 4IJ3B 4I2XB 2OTWB 3RQ3A 5FDWB 4G8FB 3FMGL 4OFYA 4HCRA 5CJQL 1FQ9C 4LKCA 2D2OA 4KK5C 1UXSB 3U4BH 1CWVA 2G5RA 4LP5A 3L95B 4P0DA 5FHBL 4Q97A 4ODXA 3V52H 4GH7B 3RWIB 1FNAA 1ZT4A 5F70A 1TETL 2NZIA 5F9AC 1MF2H 1I85C 3O45A 4OZIF 1QBML 4JFDE 1X3DA 3PQYB 3RHWF 4L4TD 4CDHA 3IFNL 5KSUB 3BN9C 1N6VA 1QHOA 1H5BB 5E8EB 4XWGL 2VLKA 4G6MH 4TSCH 1I1CA 2R1WB 4M43H 4NRXA 5E8OA 2XA8H 5L2KE 5HHPB 4MCZB 3O3AA 5ALBL 2X2YA 2XY2A 1CXKA 5IWLA 3MTRA 1WBZA 4WHTB 5HGHA 4F80A 4GXUN 4KC3B 3CFDA 4RMVA 3H3PL 5L0QB 3QDGB 1CG9B 4QHNB 4CU6A 3TCXA 1UYWH 4JZOB 2NY2D 1IEAB 5E2UH 3DVGB 3V5KB 4J7RA 1SHMA 2DWEB 3QWRD 2QV2A 2A77H 2Q1EA 2GYSA 3DURA 5C6PB 4ONFH 1FLRL 3BMWA 3OKDA 1SJXA 4L4TE 4ELKA 5D1XD 1V3LA 2VN4A 3E3QE 4DVBB 1GHFL 1RHFA 4NN6C 4YHKH 2F15A 4XBGB 5CGTA 4P4KA 1KFAH 3WHXA 4H88H 1MHEB 3DGGA 4AENB 4J12A 1T20A 3QIWB 2QHRL 3HAEH 4KTYA 5KG9A 5EWIL 4HT1L 2DMCA 2XXCB 2F5AL 5I76B 1W72B 4G8GA 4KHXH 1UQSA 5LGKA 3F6LA 2G75A 4K94L 1B0GA 1CGTA 4ALAH 4IRJB 3RNKB 3W2DH 5EA0H 4HXAL 2AABL 4JFYB 3MBEB 3R06A 1BP3B 4F15C 5IHLB 1HIMH 4JQXC 1CLYL 4PG2A 2GJJA 4K71B 1OAQL 5HHNB 3BPOC 1G9ML 4BKLB 3UMTA 1T4KA 2X41A 3BUTA 5CP7A 1YEDB 3MYJA 3MLZH 3GSWB 2EDJA 2CLZB 1N6QH 2B4CL 5I66A 4NN5C 1EAPA 5KS9A 4NRZB 1YNKH 3T1FA 3M1BB 4HIHA 1RK0B 3OJ2C 3H9YA 4JREC 1PQZB 3NA4A 3VWJC 1VFUA 4IM8A 4YNYB 1BFOA 4YZFF 4JGJA 4O58L 1RJLA 4QXUL 1CZ8L 1F90L 1J5OL 1IBGH 1JMXA 1URLA 3MMEA 5GS2D 5CHNA 4HV8A 5HXMA 3O3UN 3X13B 5ANMB 1HYRC 4YXLH 5GRYA 3QUXB 1NL0H 3KLDA 4TUJA 3ZT7A 4DGVH 2XQBH 3BE1L 1SMOA 3HUJF 4J6RH 5F7KC 3RPKA 2JCCF 1CGSH 3RUGF 4RFEA 3CFKB 1ZA3A 3PHOB 2R39A 5D1ZD 4JZJA 4CJ0A 3V6FA 1S78C 1BECA 2UWEB 1NCBL 4DK3A 1BFTA 1ZTXH 3O3EA 3EDDA 1U3HD 5DD0H 2R0ZL 2I27N 3GO1H 1WVZA 5ISZD 4HWZA 2YWZA 1YN7B 4L8BB 4M7JH 1IFHH 5EO0A 2NY0C 4YDVB 2IPTL 1XF4A 5I1LA 3HE7D 3I2CL 4S0SD 4L9DA 5EG6C 2VLJA 5DS8A 2OYPA 3BEWA 1LO5B 4KWUA 3HC0A 5CAYB 5KSVA 4GBXA 1F3DJ 2NY3D 4TSBL 2LE9A 1IQWL 2NNAA 5CEZL 1WV7T 5DT1L 4X6DE 4DVRL 1UKSA 5DRZB 4Z76B 1QSFB 3TA3A 4OIBA 4QHUA 5DEFA 3VGHA 1HSAA 4PLKD 4JO3H 5DVNA 2YKLL 3U0PA 4OZFA 1WWBX 3MNWA 5ISZE 1DBKH 3S97C 3HFMH 5J7CC 3QXUA 3U6RB 3LS5H 5B3NA 4GG6B 2F74B 1WEJL 4Y5VB 1CFVL 2E5EA 1F8TL 3SDXE 1D9KD 5IVXF 2HN7A 2N7BA 4JFFA 4LDEB 4NKDA 3SDYL 4GKNA 5DQJB 2W0KA 2FO1A 2VKXA 2DTML 4BZYA 2ADGA 3LVEA 1QFUH 5ABDE 5GGRB 5DVOA 4WV1C 1R5WB 4XNYH 1OAKL 1HWHB 5JOEA 4HWNA 2E9IA 1V3MA 5EUOB 3TBWB 1Z9LA 4HWBL 4YHNA 2XWTA 4TNWF 1PY9A 5H94A 1GGYA 4PJ5D 5DXWA 3NGBC 5I8EB 1VACB 3QULB 4OBRA 1I3RB 4GKOA 4LU5L 3GGWB 4PJHA 1EHNA 1FSKC 3SE3A 5IROA 2HWZL 1DP0A 3QQ3B 4HAGA 3B9KB 2FIKA 1EFQA 3OR6A 4K8RC 2FJHB 3G5YB 4MAYC 3VXTB 3NA9H 5BO1H 2Q8AH 1LHZA 1Z3GH 4M7LT 3UTZA 3ZTNL 4Z7QE 5DJYA 3H6JA 3GSNL 4OCXL 3GMLB 1KPVB 5L8JB 5L6YH 2GFBA 3QJHB 3KPMA 5LBSH 3SE9L 1NSNH 4P46B 4PJ5E 4HFWB 1QVOB 3JZ7A 5FB8A 1IEBA 2E9WA 5ITBH 3TNNB 3RVVC 4HKXA 1ZEAH 1J8HB 4QKXB 4HEPG 4JPIB 4I9WD 5DMKB 3TO4B 4WU5B 4R6UA 5MEQA 3MJ9L 3HZKA 2L0DA 1FL3A 2IAMA 3CLEL 3N9GH 3W81A 3VU2A 1JL8A 1MHCB 3O2VH 5F88A 5I16B 5KTEH 1NANH 3CH1A 2J8UB 4XPFH 5D7IE 3ZE2F 5DJCB 1KXQE 1FNGB 3TFKD 5F89A 3VDAA 3B3IB 2G60H 1ZVSA 3PGCA 1IAIM 3H9ZA 4G5ZH 1L7TH 5EPMB 3RX8A 4LLUA 4M5ZH 1CFQB 2CKBL 1QQDA 3TH2T 2NW3B 1W0YT 5F1SA 5HYFA 4MJIA 1D5IH 3ZKSD 3MREB 4Z7VE 3DUHA 1YPZB 1IL1A 2COQA 4OJFL 5FA4B 1IILE 1JPST 5EORH 4AM0B 2QQKL 4I9WE 4LBEA 1V5JA 1J0KA 1BAFH 4M3KB 5E56A 1N59A 2J6EA 3PHSA 1FHGA 3ECBA 2PO6C 3MNVA 2HTLD 3TBTB 3ULSB 1DE4A 3LV3A 3OG4B 1X5LA 4Y2DB 4YDKH 3RZCC 2YZ1A 1QSED 2BVUA 2HKHL 1G7JA 2V2TA 1BHGA 4TUKH 4Q6IA 1H3UA 1ONQB 1OSPL 3H9HB 3ULVC 2IADA 3MRFB 5GRUH 5IHUH 4RISH 5KVGL 2IF7A 4HG4J 1T0MB 2I60L 3QCTL 2PYED 2YK1H 4X5WB 3GJFK 4OLZL 1BLNA 3AUVA 4PJGE 3ARGC 5E99L 3U1SH 1WCBB 4QHLB 5D7SH 3WNNA 3QG7L 4YO0B 4U6HB 4XCNB 4P5TD 1S7WB 3NH7L 1T22B 4LRNL 2ID5A 3WNPA 1FE8L 1LEGB 3OMZA 1QSEE 2JELL 1EJOL 1SJHA 2OTPA 1G7PA 5HHVH 4IDJL 2FEDD 1JK8B 4H26B 2A6JB 2YD7A 4D0CB 1FL6A 2W65A 4X8JA 3MSPA 1REIA 1KN4H 4PPTA 3HE6D 2ZWLT 2PYEE 4CN6A 3DMMC 4U6VL 3MV7D 4KXZI 5FUZL 1BEYH 3LKQA 4MA8H 4HUNB 1SBSH 4NZRL 4X4XA 5J06A 3V6BR 5C70A 2NY5H 4P23B 1JZ7A 4KROC 5CSZB 3FQTB 2VL5A 3P30L 1Q0XH 3OX8B 3KHQA 4MS8D 4PJDE 3I50H 4KAQL 2VUOA 1FGVL 4QXTB 3L6FB 2NCMA 2E3VA 4FZEL 3UEZA 2H8PB 4M5YH 1IGIH 2IGFH 1F4WH 1H15A 3MV7E 3KG5A 3BKJL 3HNSL 2ZCLH 2P7TA 4FFYL 5CEZD 4PYGA 1T1YA 1B2WH 1D3CA 3KXFD 4HLJA 4NCC1 5F7DB 1N5AB 2AJ3A 3HMXL 1NUGA 3T08A 4KJQD 1UJTA 4LLAA 3QISA 1LK2B 2DM2A 3MRRA 3AXLA 3IDUA 5D2NE 1JHKL 4XPGH 5CGYC 2FB4H 4EKXA 3HRZA 4NQVA 4U1GC 3S37X 3H9SB 1XIWD 1K4DB 2UZXB 3UPAA 4BZ1L 5A16A 5EC2B 4PJFF 2JE8A 1BIIA 4JFQA 4N0UB 2Z35B 4MMZC 3BPCB 5ITFB 4BSWB 3ARDA 4XWOD 4Y5YB 4OAWB 5HDQL 3L5IA 4TOYL 1BOYA 5DUML 3CMGA 3FFCA 4FQJL 2BVPB 3PF2A 3QIUC 1R3LA 4W81A 1WWAX 5CEZE 4OQTL 3KXFE 4NQXB 4X6FA 1CT8B 4K7PL 4LVNB 4GMTL 1JYXA 4NQCA 5KVMC 2C3GA 3BWUC 3QEGL 1DQML 4R26H 1CDYA 3ROLB 3VFUB 4LSVH 1FZJB 2Q76B 3OR7B 4U1IB 5FOBB 3T4YA 1B0WA 1I7UA 1IT9L 5FHAH 1R24A 5GGVH 4UQ3A 4K8RL 5BV7C 4I3RL 4JQIL 3CMOL 4KK6C 5E00A 4GW4A 4ODVH 2EXWC 3QAZC 4GG6F 3PJSA 4M62L 1KIRB 4YQXH 3DTXA 3M07A 2VDLL 2R29L 5FM5O 1A7QH 3QIBC 3MV8D 5DD1H 4KK5D 4Y4KA 5ID1A 1FNSL 3TBSB 4JB9H 4XBEL 4BSVA 5CKAA 2D03L 2MOVA 4MJ5B 3MLPA 4MQTB 1W0VA 4BFGA 4MD5A 1M4KA 2AK1L 1KC5H 3I9GL 3IXAA 2YRLA 3U0WH 3ULUC 1T04A 4ONGL 4HQQH 4R4BA 4WW2C 3PDOB 5DA0B 5IQ9B 4JR9L 3WFZA 2QSQA 1F6AA 1AHWC 1J88A 3INUL 4U3HA 1MCJA 4MDJA 5T1KD 3U7YL 4BFIB 3SQBA 1OSZA 3GB7B 2KL6A 3OAUL 4PJ8B 4PV8A 5I1EH 1A22B 1UB6B 1E28A 3QWOB 2EYRB 5DYOB 3MV8E 4Z95H 5JO5A 5J0BA 5J6HA 1S9VB 3T09A 2X05A 3QHTC 4FQLL 5DHVA 2C4XA 5SV4A 1BQHA 5E08L 2I07B 4OCYH 1OWWA 3KJ6L 1RIVH 2PR4H 4N0YL 2X1WL 5C0RL 3C60C 4Q0XH 1OQXA 3VCLA 2LABA 4WJ5B 2SEBA 3MLWL 4P4RB 5F7MC 5IFJA 4WEUD 1V7NH 3RBSA 2CLRB 2J8UF 2P46B 1IZKA 3BVNB 1G84A 1OP9A 3RGVB 5CEYA 1VB9A 4Y0GA 5I19H 2ZUQC 3QEHB 1S7SB 5BQ7B 3ULVL 3UYRL 3KR3L 4B53A 5JIIA 2C3VB 3Q5OA 3JV6B 1QBLH 5JLZA 5F1NB 1NCAH 2HT2C 3QUKB 5E2WH 2X40A 4ZFFA 3QWQB 3STLA 2CK2A 4BH8B 4RGMB 1P53A 5K9JL 3GSUB 4Y5XA 4GLRH 4APQB 1YPZF 5C09E 3BIKB 5FGCB 5AZ2H 1IGTA 2OX5A 4PRPD 4N90D 3RWFB 1CR9L 4B7IA 2W07A 5AG8A 1N7MH 1LNUB 3VWJD 3QEQA 4GJTB 1H3WM 5IBTH 4F2MA 5K9QI 4MZ3A 3U9PH 2YUZA 1FAIL 3W9DA 5BRZD 5JZ7C 3U4EA 3PWVB 3IYLW 3QXDA 2V2XB 3MRIB 5L2KB 2X4TA 3CK0L 3I75A 5IW6A 5H2BB 5I1AA 2MHAB 1KPUB 3ARFC 5ESVB 4HKBB 4CRPA 3PNWB 3QDJA 1YEIL 4KKLD 1K8IB 1SY6L 4PRPE 4N90E 4XVTL 3QPXH 4D9QE 1S78D 2X1QA 5E6IC 1Q9OA 4MNGB 1S8DA 3GIVA 4NNPH 1NFDF 4XTRC 3VXOB 3WEXB 4P59L 2GJ6D 2NZ9C 4Y19B 2A9MH 3WNOA 1J87A 1KB5H 3P4LA 1FVCB 3DUSA 3PP4H 1YEEL 1A47A 2P24A 4PP1D 5KSAA 3ZKXC 4G8IA 3VH8G 2NY0D 2EIZB 1JHTA 3MXWH 1EV2E 3C5ZA 3NMEA 5BRZE 4L4TB 3FB5A 3AGVA 1XF5A 2ZSWA 4ORGA 3RTQA 1I7TB 4Q2ZB 5FCUH 2YUXA 2FBJL 4OKVA 5SWSD 3LQAC 1UB5B 4TVPH 1MQKL 4OIAA 4QGYA 4Q58C 1FCCA 4Z7NE 5DJ6B 1BMGA 3BYYA 1MWAB 2VAAA 1EERB 3FKUS 4HIEB 1NCUA 3OKOB 3RVUC 1YEGH 3P11H 2GJ6E 4R96A 2IANB 3ABZA 4JDTL 3W5MA 3BW9B 4JN2B 3TJEL 2VH5L 3B9AA 2DQCL 4XPBH 5EZIL 3ZE1F 3VRIB 5IVZB 1CIUA 3I6GB 3MCLL 5JDSB 1I9JL 1OP3K 4NQUA 5I73C 3ZL4H 4ERSL 4TYUA 5MEOB 3BQUC 2FO4B 4RGNB 3BAEL 3L5JA 4JFXB 5SWSE 4G9DB 2BRRL 2XWBA 4MWFB 1KELL 4M3JA 1HQ4B 3W39B 1B0RA 4XC1L 1P4IL 2AEPL 3JWDH 4HAFA 5I8OL 3FCTA 1YEKL 1BWMA 3BT2H 5IJVA 4M61A 4HW6A 4ZO7A 1F2QA 1ZSDA 3O4LB 4MA3A 3DO7A 3T0EC 3SKJH 3V95A 2DD8L 25C8H 2WUBH 4FQ1L 4DAGL 1VFMA 1N64H 3N1GC 3LN5B 3U48A 4NKOB 2OTUA 3WYRA 5FM5M 2J2ZA 3D0VB 4JM2B 4PJXF 3O8XC 3ULVF 4QRQA 5JHLL 4XRCA 4K8RD 3UJJL 1WWCA 4LLMB 1R5VB 4G42B 4JRYB 4O2FA 4KTDH 2DKUA 3SDDA 3TBYB 3X3GH 2BDNL 4LCWD 4DZBA 1Z0MA 3IKCB 4XNMA 3WUWB 1T3FA 1CFTB 3CFEA 3QCVL 3BYTA 3ULUL 3A6BL 4UV4L 4HCRH 1DBML 4PTTA 5J12C 3RVVD 3G08B 4FTVD 3FB6B 3G6JE 3MLSL 1ES0A 2R56L 1T6WA 5B39B 2FRGP 4YR6A 5HBBA 4HK3N 1PZ5A 1MEXH 3MXVL 4GW5B 3VFVB 3CDYA 5ESQB 4QNPF 1IC5L 4X6DB 1S5HB 4M1DL 3G5XA 4WEBL 3TZVD 4ZD3H 3EOBA 3HA0A 4LCWE 4WFHD 3CPLA 3U4BL 3K4AA 2ARJB 1CTOA 3MCKA 1MF2L 4C4KT 1N4XH 3NABH 3ARVA 4YBLC 1VENA 5EULV 4HLZH 4I4WA 3L3DB 4O02H 3TIEA 4DUVA 3MUZ1 4FTVE 4PB0H 4N0FB 3CSYA 4TSCL 1BF8A 3L3GB 2JK5B 4M43L 3SGKC 2EDLA 2XA8L 4JRXA 4DEPC 1NLDL 1C5DA 3BPLC 3LS4L 3ZYIA 1EZVX 5KANG 4LARH 2PO6D 4AQOA 3D9AH 5GHWH 4X4YB 5JMRA 2Z31B 3T4AB 1MWAL 3VG0H 4Y4HA 4I0CC 3RZCD 4KDWA 4RIRA 5B21A 1C08A 2EECA 2UY7A 4WFHE 5E2UL 1RI8A 4QRSA 1U8KB 4XP1H 5C2BH 1MRFH 3UTQB 2BXZA 4F3FA 2A77L 3GNML 4KQ3H 4NZTH 4ONFL 43C9B 4WWID 5CILL 4F7CB 2C4FU 1KTLB 1XH3A 4KGJA 3C08H 3V5DA 5J56B 3TCLA 2EDKA 4NUJA 1KFAL 4FP8L 1TCRB 4H1LB 1D9KB 1DCLA 2IH3B 3PV7A 4H88L 4JN1L 5CKGA 3DV4A 4KVNH 5HYJD 3V7MA 5FM8A 4XHJC 5JW4M 5D1QA 4Z7WB 2AS5M 3CFBB 3LKNA 4PJ7A 4KHXL 3FO2B 3MRJA 1VSCA 1OW0C 1MJJB 4QEGA 2Y7QA 5IG7B 4ALAL 3UBXI 3U46A 4FS0A 5EA0L 1NDMB 1C5BH 3B9VA 2R1YB 3DX7A 2BSTB 4S0TD 2R0WL 1IGJB 4HEME 1GGIL 4BZ2H 3SOBH 4C83A 5EOCH 1UWXH 1YYLH 1OAXH 5K93A 3DMMD 1NCNA 1CICC 5BS0A 1Q9LA 2APBA 1EGJA 3JXAA 4R0LB 3MRQB 1GCFA 3PWUA 2EKSA 3UXFA 4ONOA 4OF0A 1P5VA 4OTXL 1FBIL 2FZ3A 4HH9A 1R3IL 2PXYC 1I1AB 2EDXA 3DXAE 5LKNA 5HYJE 5I74B 5D7IB 4M4PA 1U92B 1AQKL 4AIOA 4HIIB 5IHZA 4TUOA 3PGDB 3BZFA 4W6XB 3SCMA 4AEIL 2BNRD 1IBGL 1AC6A 2OSLB 3QUZB 2KH2B 4HG4K 1FPTH 1Q72H 2YPVH 3DLQR 2ZPKH 3JSSA 1ZLSH 4YXLL 2PUQT 4PGCB 4XXCC 3LQAL 1NL0L 2YD4A 2DQDL 2XQBL 5AAMA 4DGVL 4LAJH 2MCPH 4MXQC 1CGSL 2CDEA 1MCRA 3ARBD 4XP4H 1T7ZA 3MRKA 1R3HB 1ZXQA 2IPUG 3PWJA 3ZE0F 1KIUA 4L9LC 2W38A 5DLMH 3V5HB 4BYHA 1K6QH 4RNRA 3MRGA 1CGXA 3MPCA 1OARH 1A7BA 3D69A 5JIKA 3SDAA 1TJGH 3LIZH 3AM8A 5EB9A 4K3GA 4ZFGH 2ITDB 3MC0A 2NTFB 3VWKA 2BNRE 3WO4B 4M7JL 4DOHE 1QKZH 2CD0A 2E9JA 3LN9A 1L4IA 4P2CG 4OZFH 2M8XA 4UTAH 3C8KA 1ETZA 4L8SA 5E8PA 2FX9H 2Z93A 2B7DT 4LHQB 4RQQA 1I7RA 4PJGB 4QO1A 4BFBD 1T03L 3JTSA 4LGPB 3VG9B 5TDNA 3QUYA 3M17B 3QIUD 4ZPTA 4ZAKC 1X7QA 3V0WH 1P7KA 4JO3L 3D2UD 3VFTA 2VYRE 2VDRH 1UVQB 1VGKA 1ZHKB 4WUUD 5MP6H 5GGQH 2GTWB 2X7LA 3ROOA 3HFML 1TPXC 3QXTA 2MPAL 1GPOH 1U8IA 3FONB 4J1UB 1P69B 3LS5L 5C07A 3D85A 3BKYL 2EE3A 1K5NB 5ICZB 2DI7A 4KK6D 4KDVA 2PYEB 3X12B 1FO0H 3ZHKA 3RGHA 4R3SA 4ODUA 4R97C 1LO0H 2EXWD 3VFMB 3NFPA 3GSRA 1A9BA 4QYOA 4M1CC 1OVZA 2EE2A 3VMOA 2AXGA 4NKIH 1T7WA 3LEXB 4L4VD 1UFUA 4MXVE 4P5TB 1N26A 3BJ91 1AGCB 3ARWA 4P3WA 5SWZD 2GUOA 5T1MA 5JIPA 3ZT6A 4WUUE 1E4XL 1GOHA 4KRPB 1CK0L 1LE9A 3X14B 2MKWA 3ULUD 5IMOA 4HMDA 5F9DC 1UH2A 1RFDH 5CEXA 4YE4H 1RZIA 2A0LC 5HHXL 2Y6SC 4M7ZC 2WP3O 4NQSA 5IK3A 3U0TB 4XPHH 4YC2C 5I30H 4LHUB 3X11B 4AIZA 4JM2F 5BO1L 1KNOB 1X4ZA 1UM6L 2A2QT 5IEKA 2F53A 3PWLA 2VABB 4IRSA 5ILTH 1PDKA 5AYQA 3WFDH 3SGEI 4L4VE 3QXAA 3OTTA 4LEXH 5LBSL 1NSNL 5D2NB 2X89A 1K4CB 4PBVC 5SWZE 5JORA 3OJDB 5JQ6L 4BH7B 3TBVA 5LXGH 5J9PA 3NPSC 2AV7A 2YWYA 2EXYC 3FO1B 1TZIA 4LVHB 1HYSC 4PY8I 1MAML 3C60D 5D6DA 4U0QB 1SEQL 2CO7B 3R8BB 4ZUVB 2WUCL 4I0PC 4NP4H 5BJTA 1UJ3C 3AMKA 4BUHA 5KTEL 3MBXH 4P2OD 1DVFA 4XPFL 1U8JA 4P3DA 4O51A 4HS6B 1K8DB 2WIIB 2D7MA 2G60L 4LCIH 4X6DF 1BFVH 1JRHI 4G5ZL 4M5ZL 2FGZA 3MJ7A 5FYKU 4ZDHA 4OQ1A 1BGXL 1EEQA 3QUMH 5F9OH 1AO7D 2VDPL 1IGFL 3BMVA 1S7UA 4QRTB 1X5HA 2HT2D 3RIFF 1AD9B 1RUKH 4G6KH 4HDIB 2YC1B 4OM1H 5MENA 1X5IA 2AXHA 3FO9B 4PTUB 1WITA 2ATPA 2OL3B 4ZOBA 1I1YB 1B4JH 4GS7C 1BBJB 3LH2H 1RIHH 4LASH 2J5LC 4YDKL 2XV6B 3WL9A 3FOMB 2EE6A 2CRZA 3BI9X 3IF1A 5KN5A 4PJAA 2AEIT 3Q0HA 4RMTA 3NACH 2VLLA 4UINH 3STBA 4TUKL 1NKOA 4CGTA 1CVRA 5JW4Q 1AKJA 5JZ7D 3Q6FA 1AO7E 3T0DA 4AY0A 4RISL 2YK1L 1R3KA 4ELMA 3QZWG 1HHIA 5E94A 1G0XA 2W91A 1KPRB 2VOTA 3LD8C 3L3JB 3ARFD 2XY1A 2C26A 3FQXB 1ORSB 1V3KA 3U1SL 5D7SL 1PG7X 1F00I 3OKLB 5E6ID 4XTRD 2AV1B 3DSFH 1UA6H 2R23B 4Z5RA 4Y4FC 2P8PA 4ENEC 2V17H 1N5YH 2E8ZA 1NJ9A 4WUKH 1DJSA 3GSQB 3EO0B 5K9KB 1SJEA 2X4NA 5E1AB 2VXSH 4LLWA 4Z7WF 5EFIB 1H9VA 2ZG1A 1HE7A 1DFBL 3WUWG 2FECL 3T0XA 1CXHA 2Z92B 4YAQA 1KN4L 2P1YA 3U36B 1NMBL 3P3YA 4X6CF 1HEZA 3FQWB 3Q6GL 2VDOH 4HUXB 1A9EB 1BEYL 2ZG3A 4MA8L 1QR1A 1KEML 5C0CB 5T1KB 1AGBA 1U8QA 4RMRA 1SBSL 3SPVA 1QO3B 5EO1A 5IB1A 1V7MH 1Y6KR 4LQ1A 4ZSOA 2GY7B 5F7WC 2AK4E 3FRUB 1KB9J 4KDTA 5D7IF 5T1LD 1MCSA 1Q0XL 4S11A 1HSBB 3I50L 5ERWB 4S10A 3T0AA 4QRRA 1ZWIA 1GGUA 2P5WA 1CXLA 1A3LH 1SJVA 3BQUD 1AH1A 2M1KA 4OCLC 1Z2KA 2IGFL 4WI3A 4J23A 5C09B 5LG1A 1IAOA 2ZCLL 3GIZH 4Z0BH 2DIJA 3PV6A 3OHXA 4LLYA 1JHLH 2GK2A 3KAAA 3U2SA 5J11C 1A0QL 3IRZA 5DMYA 1EFXA 1NDGA 4LSSL 1IGYB 2FB4L 3NIDE 2VISA 3QA3B 2VZVA 3VDCA 1MREL 3S36H 5HDBE 1HH6B 3GRWL 3O8XD 4I2XA 2D4FA 1GOFA 1BD2D 2MQ0A 5C0AD 4G8FA 2DBLH 3DX9B 4QTIH 4Z18A 3TV3H 4E41D 2Z0BA 1UXSA 3MLUH 1F13A 2DQGL 2ED8A 3O2DA 3WBDA 3PQYA 5KSUA 1ZT1B 5FXCH 4OF3A 3JWDC 5E8EA 2A73A 1P9MA 4LSDA 5HHPA 4MCZA 2Y07H 4W4OC 1OPGH 3SBWA 1C12B 4OZGB 3RA7L 4R26L 3LKOB 4PGEA 1KTDB 2AJSH 2ZUTA 3T8XA 1RZ7H 2KQMA 4JG1H 5GGVL 2BX5A 4QHNA 1BD2E 3TVMC 2HJLA 5C0AE 4EZMA 3CFCL 3BRFA 1KSRA 3GZKA 3TN0C 1CGWA 4IDLA 4E41E 3P77B 1A6TB 3DVGA 2DL9A 2H9GB 3V5KA 3MLVL 3GI9H 2DWEA 3KNBB 4YQXL 5I0ZA 1Y6MR 1A7QL 1OLZA 4TULH 1PYWB 5DD1L 2GQHA 3SKOA 4F9PA 1RZKH 1J12A 3BZEB 4BSJA 3PP3H 4DVBA 1LO4L 2GJ6B 3OXRA 1LK3H 4DUWA 1LP9A 1J0ZA 4ODTH 1KC5L 1AGDB 5DI8A 5DR5H 4AEEA 1DEDA 4HQQL 5I1KH 2ZKHH 4PJCA 4ODHH 4E0RB 4NHCH 2XZCH 3ALWA 4A6YA 5I76A 4IEFB 1W72A 1CU4H 4F58L 4FMFA 3GSOB 3E2HB 1CLCA 2V5YA 1Q38A 1MFNA 1ZLVK 4KRNA 3RNKA 1BBDL 5ID0A 4JFYA 3MBEA 5IFHH 1J10A 3MV9D 4Z95L 1FAKT 3KLAB 4AEHL 5MI0C 2W9EH 2CMRH 2G5BA 1JNLL 4QRUB 5IWLC 1YEDA 4ZS7H 3BZ4B 3GSVA 2CLZA 3KPRD 4OCYL 5E4IA 1JYVA 5IOPB 2HFEB 1DUYB 1BJ1J 4UIKH 3RFZC 4NRZA 3M1BA 5E0QA 1Q0YH 1RK0A 5JHDB 1D5MA 2MJWA 1QFHA 1G1YA 1PQZA 1QTYT 3HZMB 4YNYA 1JNNH 4F9LA 2APTA 4EDWH 1U6AH 1OGTA 4GXUM 5ANMA 2F9BT 4AH2B 3IB4A 3R8QA 3MV9E 3QUXA 4P4KC 2OQJA 5KOVC 5I19L 3D3VD 2QSCL 2D7NA 1G6RH 3PWNA 1Z6JT 1QBLL 2E7CA 3CFKA 4DJMA 3PHOA 5E2WL 1SVCP 3BFOA 1ZANH 3KYKH 4WFGD 2LU4A 2UWEA 4M93B 1CICD 4FG6C 4GFTB 2QSTA 2KKQA 1CDCA 3KPSB 2PXYD 1F4HA 3VMPA 1WFUA 2DLGA 4L8BA 3UJTH 5DD6B 2Q7NA 3RWCB 3BD5A 3EYVA 3GBML 4YDVA 4NQEB 1KJVB 3MV01 3BEVB 2XZAH 1R3JB 1FORH 1KCUL 5IBTL 1LO5A 5LGHL 4Z7UE 3D3VE 2MQCA 4YHZH 3U9PL 4D2NA 4OV6F 4OCRL 3V4VH 4PGJA 1JNHB 2D7QA 4FTVB 5FECA 4XP9L 1QSFA 4JKLA 4WFGE 4OGYH 4K7FB 3PL6D 3TGXA 3STZB 1NCTA 2RJMA 3NCEB 1AXTH 1PSKH 3ZDZE 4CU7A 4WWKC 4DKFH 1KCVH 4XCFH 2NX5D 2DICA 4RX4A 4NNPL 2I9LA 4KRMB 3TZVB 2BC4B 3O3AB 2A9ML 3NZHH 1KB5L 2F74A 3QJFB 4PRNA 5K9QG 3F7YA 3CFDB 5DQJA 4AJ0A 4JZJC 2P43B 5GRWA 1MCLA 3MXWL 3MRMA 4X5XA 5GGRA 1OCWH 3FT2A 3PP3K 1R5WA 1XF2B 5FCUL 3MJ8B 4JO2H 1HNGA 3H2WA 3PE9A 1ACYL 5EUOA 4Y8AA 3VW3H 3IDNA 4ELKB 3OKDB 1CD8A 2NX5E 4ZAKD 1VACA 3QULA 1XGTA 1I3RA 3QFJD 2NLJB 4GW1B 4F7TB 1NMAH 1GH7A 3EAKA 3REVB 3QQ3A 5GPRA 3VD3A 1YEGL 3WXWL 1F3JB 3EJYC 1T1XA 3B9KA 5IM7B 4U49A 4DFIA 1T20B 5KG9B 4NSKB 4HC1A 5DJDB 4NO2A 2EDQA 2DS4A 3G5YA 3LN4B 3VXTA 2WQ8A 4LAQH 4QY8A 3UDWA 4PB9H 15C8H 4KUZL 1GXEA 3LCYA 5FK9B 1VFBA 3MR9A 3ZL4L 2FX7H 4P2QD 3GMLA 1KPVA 3IU4H 2F19H 3R4DA 2XTJC 4KH2A 3KPQB 5JOPD 1B0GB 1QACA 5DD3H 1VESA 4LNVA 3VH8A 3R06B 3QR2A 4N9OB 4PJBE 4M1CD 4PIRF 4HFWA 3VI3E 3DXAB 1QPXA 1TZHB 5HYJB 3WFHB 5BZWA 4XMLL 1ZLWK 4U2YA 3BT2L 3MYJB 5DMKA 1KJ2A 4WU5A 3SKJL 5CJOH 1RUML 2EH7H 5KS9B 2W9DH 1MHCA 2WIMA 3A6CH 1HCFX 5HI4C 3T1FB 4HIHB 4JGUA 5F6IB 2J8UA 1O0VA 2WV3A 1OL0A 1GAFH 2VXQH 1YN6B 5DJCA 1FNGA 3FTGB 1FC2D 1HCVA 1G7HB 4P2QE 3MMEB 5JOPE 2BNQD 3GI8H 4HV8B 3S3JA 5EPMA 3WIHA 1DBAH 2JIXA 4YHYB 1CFQA 1U91B 3HHRB 1CDUA 1YMMA 2NW3A 3SE3C 3X3GL 1MSPA 5I1JH 5C2UB 2CIKB 3MREA 4RWHA 4ZS6C 4CMMA 3OG6B 1P2CB 4GRLC 2FDBP 2Y5TB 1NANI 4AM0A 4RFEB 1OD9A 3OPZL 5CS7A 4HS3B 1GVIA 2DQUH 4O9HH 4ORZC 2BNRB 1VHPA 4DOHB 3VD9A 4HCRL 4FZ8H 1AQDA 3O3EB 2HH0H 1KLUB 3ULSA 3P9MA 1QP1A 3VA6A 4OZGF 1EVUA 4HWZB 3UC0H 1HYSD 4Y2DA 1E4WL 4NQDE 1OGAD 2ZP0T 4PLOB 2BNQE 4I0PD 5C0IB 2DWDB 2EIBA 3MZTA 1XF4B 3ARBB 4ZTPH 1NC4D 5AWNH 5F8RC 2EYSB 2HJKA 2VLJB 4ZD3L 1P5UA 3MRFA 5KSVB 4GBXB 2V9RA 1T0MA 4MA7H 5LWYH 1PY4A 5EU5A 4XB8A 4KFZC 4U1GB 3NABL 2VIRB 1OAUH 5DEFB 3ALXA 1IM9D 5HYEA 1WCBA 4O02L 4QHLA 4PB0L 1TJIH 1AJ7H 4GXVH 3IKKA 2GK0A 1S7WA 1LEGA 3LRHA 1OGAE 4OI9A 2EDNA 3IFPB 3MV11 5GHWL 4N0RA 3VXUD 1AI1H 1CBVH 1JK8A 4NUGH 2A6JA 3RBGA 4Z7OE 5CFHA 2FH6A 4GKNB 2H1PL 3MROB 1ZVYA 1RK1B 2KUTA 4XP1L 1MCWW 2ADGB 4DGYL 5C2BL 4WUUB 4JKKA 2X09A 4EXKA 3V8CA 2H6PB 1ZS8B 4NZTL 5CJXA 4V1DD 1MCEA 1E4JA 3VXSD 2H41A 2C4FT 4L8DA 4HZAA 2LVCA 4O2CB 4YHNB 2NY1C 2FH8A 5CSZA 5D8JL 2DQIH 5I8KL 4J3WA 1JIBA 1MPAH 2CGRH 4XGZA 4YX2H 2XTLA 2OI9C 3BXNB 3VXUE 1L6ZA 5E03A 5CP3A 4MNHA 2MCG1 3IU3A 2I26N 3LKPB 3OR6B 3CXHJ 4QXTA 3NCYS 3L6FA 4WI7A 2H8PA 3CUPB 1KT2B 4NNYA 2JJSC 2JB5H 3WLBB 2X9YA 5DJYB 3WNKA 1ZGLP 3BSZH 2ESVA 5BOZG 2GFBB 3VXSE 5F7DA 1YYLL 1OAXL 1T2JA 1BQLL 32C2B 2QBWA 2AVGA 1LK2A 4U33A 5FB8B 1VGEL 1A6AB 3H9SA 3S96B 3P4OA 1K4DA 3HZKB 1M71A 1FL3B 2IAMB 4YHLH 4NQTA 3KVQA 1T83C 1JFQH 2Z35A 2YD1A 3BPCA 1G0DA 2W9LA 4EQ2A 5ITFA 3CH1B 1EPFA 1HXYB 4Y5YA 3TNMA 2I24N 3UBXG 3SGJA 3ETBF 2XFXA 1GGCL 1Q72L 1OT1A 2YPVL 3TT1H 1EH9A 2ZPKL 4NQXA 4LLUB 3P0VH 4AK1A 2DKMA 2DDQH 4K7PX 4UV7H 4LPUA 4MJIB 5FYJH 4XP4L 3S3SA 2QADC 4TVPD 1KJ3L 4WO4A 3EYUH 1KCRL 3ROLA 3VFUA 4P2OB 1FZJA 1K6QL 2Q76A 5FOBA 4LBEB 2EYTB 4PR5B 1N0XH 1TJGL 3G5VA 3ARUA 3LIZL 4OB5H 4ZFGL 4RSVA 3N85L 4UDUB 3MNVB 1U8NB 1QRND 1INEH 1QKZL 5J13B 3LV3B 1AO7B 2H32H 4LGRB 1KIRA 5D96C 4KPHH 3EJZC 3TYFB 5TE4H 2AJXL 3IS0X 3ZYOA 2FX9L 2V2TB 5JA8B 3PWPA 4HK0B 3TBSA 4Q6IB 2D3VA 1SYSB 1EO8H 2DLFH 1ZT7B 2IADB 4UU9B 5IGXH 1IARB 4TVPE 5GSRA 1UWEH 4C57C 5EN2B 5IJKA 3WHE1 3FN0H 1BLNB 1KB9K 2XPGA 5HDOA 1UM4H 2W60A 3FQRA 5I71C 1IEHA 5MP6L 2E7LA 5GGQL 4OZHE 5GZND 2APWA 4NBXB 2EC8A 1U95B 1GPOL 1QRNE 3B8YA 4BFIA 1UEMA 2P5ED 1GSMA 3GB7A 4PJ8A 1I8KB 1Z5LB 1UB6A 4RA0C 3TVMD 3QWOA 3SQOH 5EOQH 1SJHB 3TN0D 2VLRD 5CZXC 1G7PB 2DJUA 2HFTA 1JWMB 1LO0L 1S9VA 2HP4A 4PS4L 2B5IC 2W65B 2L7UA 3BPNB 3GFUA 2YOCA 4U1MB 3GDBA 3ES6B 2I07A 4PJ9A 2W92A 1NKRA 2FCBA 3RNQA 5E24E 3GMMB 2AK4B 1M7IB 3LKQB 3ARXA 1UZ6E 3DHMA 4WI8A 2VMFA 4CVUA 2XA3A 2HRPH 3ZKXB 4WJ5A 3S34H 1RFDL 4N8VG 1CCZA 4YE4L 2AEQH 4P4RA 1YMHB 4ZXBC 5KS9F 4Y4KC 2P5EE 1C1EH 1INQB 5FCSH 3ZLQC 3DUUA 5LCVL 4FQCH 1DQDH 5AUMB 3BVNA 3RY5A 1NAMH 4XPHL 2VLRE 3RGVA 4ODSH 3B43A 1S7SA 5BQ7A 1YYMH 3QCUH 1J86A 1WIUA 2C3VA 5MHSD 4DKEH 2ZZUT 5ILTL 2VLKD 3KWWB 5F1NA 3PHQB 4XNZC 2CXGA 3WFDL 5J57B 4LEXL 4U1SB 5HGAB 1T0PB 1RZKC 4BH8A 2AJZA 2CUHA 2NY6D 1T1YB 4APQA 3KDMA 5T1LB 4KY1H 2NW2A 4XNQA 3RWFA 5T5FH 5E8NA 4HZLA 1LNUA 4ODBD 2AJYL 1WF5A 1JTPA 4NP4L 1NEZG 1MI5D 4FMKA 3MBXL 1HI6A 4JFQB 5KZCD 5MHSE 4CMHC 2HAZA 3ARDB 4GLRI 1HZHH 3TP4A 4LCIL 3OGOE 4P4KD 5FHBH 3PWVA 2J6EL 1BFVL 1MIEL 4JGMA 5L2KA 1TETH 5DO2C 2DMKA 5H2BA 3WN5A 3AS0A 4K3JH 1KPUA 3GJFB 4HKBA 5BVPH 3IFNH 3PNWA 5L8KB 1K8IA 3K8MA 4X6FB 1MVFA 1DQLH 4G8GD 3VXOA 4G6KL 3WEXA 4FFWC 3GMPA 5ALBH 5C0AB 5JXAL 3HRPA 3AREB 4E41B 1L7IH 3F12A 1YY8A 1I7UB 1EUUA 4XHQA 1MI5E 3LH2L 5BVJA 2W0PA 2EIZA 4UAOC 2BSRA 5INCB 4OFIA 4L4TA 2UYLA 3KHOA 1PW3A 1I7TA 3FB7B 4Q2ZA 5A2KH 1M7DB 4JFEB 1UC6A 5EOTA 1UKTA 1C16B 4UNVA 4MXVF 2PYFA 4H5SB 4P9ML 3RKDD 5ID1B 1NGXB 1FLRH 4JZNB 1JPTL 1GHFH 4TQEL 1IMHC 4G8GE 4EOWH 1W0VB 4Z9KB 1ADQA 3I6KB 4WWKD 3VGFA 4MD5B 3IXAB 3BW9A 1T04B 1JPGB 2QHRH 1MLBA 3DROA 2GI7A 3F7VA 4O5LH 4R4BB 4HT1H 5EWIH 5IVZA 3I6GA 3DSFL 1UA6L 2DKSA 3QWRA 5JDSA 2V17L 2WP3T 2VSDA 4WUKL 4ZFZB 5D1XA 2BOCA 4L29B 5MEOA 1OSZB 2FO4A 1JJUA 2WWMD 1TVHA 5B3JF 4G9DA 2ERJC 2XICA 4MWFA 1E28B 4YLQT 5DURD 1CLYH 3W39A 5J6HB 3IJYB 3QDMD 3F58L 1EIBA 4UQ2B 3RI5K 5DHVB 3QI9C 3RL1B 4EN3B 5CIPA 2B4CH 2XQYG 3O41B 2QQLL 3O6FD 1DR9A 3C5ZC 3LN5A 2MNUA 3TLRA 4NKOA 4BM7A 2EO9A 3QZWA 3S9DB 4FRWA 3RTQC 3EJYD 1OB1B 3D0VA 3MV9B 4JM2A 3TPKA 1CZ8H 4LLMA 4HJ0C 1R5VA 4G42A 4JRYA 3VGAC 2QTEA 4NFDA 4X98B 1A3LL 3QDME 2XTJD 1FVEA 1ZK9A 3IKCA 3UAJC 3O6ML 4EVNA 1X5XA 4JVUA 3WUWA 1CFTA 3OBAA 4XAKD 5HDLA 4Z0BL 4LVOC 2AERT 4ZFFB 1NCBH 2K3TA 3STLB 4EBQL 1JZ4A 1PKOA 1JHLL 1Z9OA 4YFDB 5I1DB 3KJ4C 1UXWA 4JFFD 1IGTB 1U3JA 5DGQA 3HLAB 4L3AA 1P4BL 5HI4D 4AT6B 5IVOA 2HT3C 3GEWB 4GW5A 5F3HB 2I5YH 5ESQA 5CD5C 3QEQB 4X6DA 1S5HA 3B2VH 2ZCKL 4RMQA 3ZDYF 2DBLL 3UTSD 1EEZB 3HMWH 5IQ7H 3TV3L 1GGBH 4I77H 2XTJE 3MLUL 4DFHA 1QUNA 1MAJA 1IQWH 3WDJA 4PY8J 2ARJA 5DT1H 5ISZA 4XAKE 5CLTA 4DVRH 4JG0H 3U4EB 4ZS6D 3QXDB 3L3KB 4OCMC 2EZ0D 2XN9D 3L3DA 4GRLD 5IW6B 5I1AB 4N0FA 2ADFL 2WBJC 2JK5A 3L3GA 4JJHA 3VXMD 3QDJB 4GAYB 3SDXA 1HHJA 1S8DB 2VE6A 3GIVB 3B5HA 5KVDH 4G9FD 4WHCA 1WBXA 3SDDC 1KLFA 4X4YA 3GUTA 4XI5D 2Z31A 3T4AA 4JG1L 1I3GL 1WEJH 4Z8FH 2ZOLB 1RZGB 3MRLA 2BCKB 1JGEA 3SDYH 5IBLC 3UTSE 2P24B 5DHYA 4V2CB 2HKFH 5KSAB 3PL6B 2N4IA 1U8KA 3GI9L 4POZC 3UTQA 3R0NA 4PJHE 2ZSWB 4ORGB 3WJLA 4TULL 1OAKH 2VZUA 43C9A 4OGAC 1RZKL 4OKVB 2XN9E 1AC0A 2BVEA 3GHBH 2UUDH 3Q48A 4JE4B 1LK3L 2FBOJ 3VXME 4RMSA 5IBUB 3RX7A 2HMIC 5IESL 3F62A 1TCRA 3EFFB 4LU5H 1D9KA 4YPGA 2IH3A 3D48R 5DR5L 3UO1H 4G9FE 1OAYH 4XC3L 1UG9A 4NHCL 4PJIE 5B22A 3SN6N 3CFBA 4ZODA 3FO2A 1CU4L 4M6MH 5T3XH 3IDJB 1MJJA 2O26U 1ND0A 4PJ5A 5IG7A 3ZTNH 4CW1A 3UTTE 4BK5A 4X4ZA 3JVGA 2R1YA 5IFHL 2VR5A 1IGJA 4YGAB 1UCBL 4YUEH 3CVHB 1WIPA 2W9EL 3L5WB 1T66C 5BZDA 3O11B 5DC0A 2PN5A 1P84K 2JLLA 2RHEA 4I5BB 4R0LA 3MRQA 3FCTB 6CGTA 2Y23A 5IJVB 4Y4HC 1RMFL 4LCCC 4M61B 2GT9B 4UIKL 1NMCB 1ZSDB 5E7FA 1JWUA 2X1PA 5D7IA 1Q0YL 4NO0D 1U92A 3MJ9H 3IXTA 2A9NH 4HIIA 4M6NL 1JNNL 2ILLA 1U6AL 2PW2B 4QRQB 2A38A 4V2BA 4NHUB 4Z7VA 3NCYP 2YA2A 4NPYB 4PGCA 1N3NA 5M95B 1JGDB 2UVFA 3HAEG 2YD9A 2F5BH 5DJAA 2P49B 1R3HA 4GRWF 1HHGB 5E2TH 3QXWA 4O2EB 5D1QC 1ZANL 3QO0A 1CGVA 1N2RA 1T3FB 2ENYA 3V5HA 1XZ0A 4NQDB 3O81A 3VJ6B 4U6YB 3EKCA 1MFCL 1HH9B 3HCVB 1A1OA 1RD6A 2NY4C 3IDYC 4ZUUB 4BQBA 1JF6A 1KGCD 2ITDA 5JW4N 3UJTL 1DZBA 4JHBA 4YR6B 2R8SL 1J1XH 5T3ZH 3HI5L 3DRQB 1CQKA 2ADJB 3V6OA 5DRXB 1FORL 3PABB 4PJGA 1GZPA 3EOBB 3V4VL 5KVGH 1MLCB 3M17A 1PEZA 3CPLB 4XVJH 4UOW0 4OLZH 4OGYL 3QQ9C 3SCMC 3MCKB 4FQPA 3RP1A 1PSKL 5TPWL 3VXPA 1UVQA 4DKFL 1ZHKA 4I4WB 3TIEB 1KGCE 1SM3H 1B3JA 4JRXB 3NH7H 2MFNA 4LRNH 2YD2A 1K5NA 1JNJA 1U2CA 3NZHL 1EJOH 2PYEA 3X12A 4IIQB 2CIIB 3EJZD 4Y16B 4MJ2A 1XF3B 4N8CH 1C08B 1IJ9A 3K3QA 3M8OL 3SDAC 4P5MA 4W68A 1YNTB 3LEXA 4JO2L 1N6UA 4OCSL 4U6VH 4C56D 5J4MA 4P5TA 4F3FB 5FUZH 4YK4B 3VW3L 1AGCA 1Q9WB 2D7OA 2RB8A 4NZRH 4ZTOH 1XH3B 3O9WD 3GKZA 4GS7B 3RZWA 3X14A 3D39D 2X44D 4PJDA 3V5DB 1ERNA 1I75A 4NUJB 5HVHC 1CLZH 2ZUWA 2GY5A 3EO1B 5TE6L 4MQ7B 3S98A 2AKRB 4WENB 1MJ8H 5CJ5A 1JN6B 4KAQH 4PB9L 4CKVX 3KS0H 4Y1AD 3ORJA 1MCIA 3LKNB 4PJ7B 1ZVHA 2VABA 1HILA 1NGWB 4FZEH 3BIAX 2F19L 1FV1A 5CZXD 3PXHA 5DD3L 4C56E 3BKJH 4LIQH 4FQQB 4LNRB 5D2NA 3DX7B 5ESAB 1P7HL 4IOFC 2BP3A 4KZEH 4JANB 5HYSG 2EIDA 4BH7A 4UT9L 1BQSA 4LQFH 2LTQB 4YFLF 1TZGH 5I8CB 3D39E 1NC2D 1T89A 3RL2B 1MCBA 4R2GC 1Q9LB 3WIHH 1WQVT 3FO1A 3FT3B 2EKSB 5HVGB 5CJOL 2AGJH 4HH9B 1EAJA 2W9DL 3A6CL 3F7RA 4ZXBD 4Y4KD 4TUOB 1GAFL 4Y1AE 3CSBA 5JDJA 3BZFB 2ZUVA 3KXFA 4HS6A 1AGEB 5E70A 1IRAY 1FYTD 3GI8L 1OTSC 3HTLX 5L88L 5HDQH 5CUSL 1DBAL 2CKNA 4HGWA 4DN4H 5EU6B 2H2PC 5BOPA 2QKIA 3W0WB 1I9EA 2DJ4A 5D2LE 4QRTA 1BJMA 4FQXB 3K1KC 4QLRA 35C8L 1CE6A 1AD9A 2APVA 4HDIA 2YC1A 5I6XC 3LKRB 3WIFB 3FL7A 2DQUL 3FO9A 4PTUA 2KDGA 5SWQB 2OL3A 2ENSA 5E4EC 4LPTA 1BBJA 1KIPB 4KUCD 2BY2A 4DKDC 4I3RH 3BDBA 3FOMA 3VWKB 3QRGL 1FYTE 5C0JB 3MNZA 4XMPL 2VDLH 3J8F7 5AWNL 3C8KB 2R29H 3GMOB 1KJMB 4RQQB 1FNSH 1I7RB 4MA7L 5LWYL 4KVCH 4XBEH 3L7FB 5D6DC 2D03H 5DO2D 3QUYB 3EO9L 4OLUL 1KPRA 2DYPD 3L3JA 4RAHA 4FXGB 3I9GH 2EC9U 1X7QB 3FQXA 1OAUL 1DQTA 1ORSA 1P7KB 4ONGH 4J2XA 2AV1A 1EZVY 1TJIL 2R23A 1AJ7L 1RZFH 3HR5A 3RWEB 4JR9H 1UENA 4RMWA 3SDCD 3MV8A 3GSQA 3ROOB 3EO0A 1WFOA 2E7BA 5K9KA 3BKCL 1F4AA 1CDHA 3GSNA 3DX6B 5E9DD 2VJXA 1CFNB 5EFIA 3D85B 3BISA 3C09C 1I85A 1AI1L 1CBVL 4RAVB 4ODUB 2Z92A 3U36A 4MD0B 1U8HB 1A9BB 4M7LL 3UZEA 8FABB 3U30C 3CXDL 4MNQD 1NGPH 5ECJE 4HUXA 5CP3H 5E08H 5D7KD 3D0LA 5EIVA 3KJ6H 4PGDA 5T1KA 5C0RH 3C5SA 1U8MB 5D93B 4QOKD 3FRUA 2NXYC 2VLRB 2DQIL 5IMOB 2CGRL 5CEXB 5E9DE 3MLWH 3MX0A 4I48A 3RKPA 2X6MA 2K1MA 2ZSVB 1QPPA 1HSBA 4PRDA 2CKBA 1S7XA 2CRMA 5ERWA 2VUYA 2KZ1B 5IK3B 1TQCC 4AIZB 4QWWC 1YZZA 4LCYB 4Z77A 1E6OH 1M1SA 3KGRA 1FFPB 1XR8B 3ULVH 3KR3H 5IEKB 1KIQB 1S3KL 2F53B 2JB5L 5C09A 2HFFA 4IRSB 4MNQE 3BSZL 4PRID 5D7KE 4ISVB 1FC1A 3QXAB 4HIXH 5K9JH 5KW9L 3QI9D 4QOKE 3TBVB 2HJFB 5J9PB 5I75B 3Q3GA 1G6VK 2V6HA 1JPSL 3WO3B 3C5ZD 2FLBT 5CWSB 2V2WA 1JBJA 1MJ7H 3RTQD 3C6LC 2Z9TA 1OT2A 4JFOA 4JQXA 1HH6A 4YHLL 5BJTB 3FT4A 5CZKA 4HJ0D 4RMUA 5IMMB 1T80A 1DVFB 3OB8A 1FAIH 2NY6B 2ORBH 2LU7A 4P3DB 1F6LL 4O51B 3TT1L 4PRIE 5IBUG 4BQ6A 3P0YH 2FEEL 4P49A 1ZT1A 1FVDB 2ZUUA 4RZCB 5E6ZA 3CK0H 4ZDHB 4WU7B 1R0AH 4UV7L 3VWJA 3F65A 2HFGL 1S7UB 3O3BA 5I15H 5EO9B 4XVTH 4MA1C 1C12A 3OF6D 4OZGA 2RQ8A 2B4CC 5F7EH 3WV0A 4UT7H 4U1JB 5KZCB 4IOIB 4OUOA 5HGGS 5BRZA 1N0XL 4KV5F 1II4E 3TYGH 4J3SA 4OB5L 5D4QA 1YEEH 4RFNB 2HT3D 4L8CA 3P77A 1INEL 2H9GA 1WGOA 2H3NA 4W6YB 5CD5D 1FZOB 4KPHL 5KN5B 4KI1A 4PJAB 4ZFOL 5L7XH 1PYWA 1VDGA 2FBJH 5HI5C 4NWTH 4OUUB 3UBXA 3ARTA 2GJ6A 1AKJB 1F97A 1QA9A 1EO8L 2DLFL 5DQDH 5D5ME 2X42A 1T7YA 4PP2B 2R4RL 5J89A 1NAKL 4IJ3C 1R3KB 5I9QB 4ELMB 1JP5A 2EEAA 4PRHE 2WBJD 4E0RA 1RJZB 3TJEH 5TE7H 2VH5H 2DQCH 3BRDA 1I9RH 4HKJB 5EZIH 3IDMB 3C2SA 2Y36L 3GSOA 5DEGA 3MCLH 1F58H 2PTVA 4X9HA 1NJ9B 3Q5TA 4NBYB 2X4NB 4NO5A 5HHOE 4ERSH 4Z0XB 1H5BC 4PLJC 3N1MC 4LLWB 5IBLD 1QFOA 3JV4A 1P9MC 4P57A 2CJUH 4PJ7F 4L3CB 2BRRH 3JTTB 1KELH 1XAUA 3GK8H 4POZD 4XH2B 4QRUA 4XC1H 1P4IH 2AEPH 4POYA 4YAQB 5D7JD 4FXKA 3RIAK 1YEKH 3LB6C 4OGAD 2CLVB 5L0QC 5IOPA 3K8KA 1HEZB 1VKXA 5F3BA 3ARPA 2E27L 4FQ1H 3BH9B 2VQUA 3HZMA 3QHFL 4LDLB 2HRPL 4WGVB 5EO1B 4ONHB 3S34L 2N7AA 4UB0L 3S35H 4ZSOB 2AEQL 2XIDA 4F9PC 1C1EL 4WV1A 1S9XB 2X4OB 5JHLH 4AH2A 2KQNA 3UJJH 1DQDL 5ADOL 3BJLA 2LU3A 4ODSL 5HHMD 2PCPA 1HXMA 4I1NB 3HI6L 3QCUL 5DA4A 1ZWIB 3QIWC 4DKEL 2BDNH 3O6FB 3RWDB 2M2DA 3OKKB 4L1HA 3KLHC 5DVMA 1T66D 3A6OA 3QCVH 5GRZA 3GMQB 1DBMH 4P2RD 4IRJC 4LLYB 4Y4HD 4WI9A 3KPSA 4ZOCA 3MBEC 3ZKNC 3OL2A 3MLSH 1KTKE 1GC1L 3U2SB 1OWRM 5DD6A 4OFPA 4K71C 3RWCA 3AS2A 1NDGB 4XPAH 2VISB 3DPBA 1KJVA 4N1HB 3BEVA 1YQ2A 1T0NA 1R3JA 1XEDA 2ADIA 5M94B 1XGQA 4L5FL 4N8VA 4X7FC 5HHME 3VE0A 5JNYA 3O2WH 4M1DH 4WEBH 1HNFA 5IB3B 1Q94A 5CCKH 1C7TA 3F7PC 1ZHLB 1JNHA 1HZHL 2XKNB 4FTVA 3JBG7 5DC4B 3SGDI 3ZKMC 4NJAH 3N1QC 4F9LC 4K7FA 5FUCC 3STZA 3T3ME 4CU8A 3BD3A 3LRGA 4K3JL 3C8HA 5I1GL 5BVPL 1FH5L 4P2RE 3C2AL 4OFVA 5D1QD 1DQLL 2A73B 1UGNA 2CUIA 3ZZ1A 1UH3A 4OLEA 3TZVA 2BC4A 3QUXC 1NLDH 3LS4H 4M6AA 5CMAB 1H3TA 2NY4D 5KSBE 1L7IL 3QJFA 1FO0B 4PGEB 3T8XB 2XQYK 5ETUA 1MWAH 1AIFB 2A1WL 1VEMA 2HJLB 1ADQH 4CBPA 2XN9B 2I9TB 3K81A 1BZ9B 2XXMB 3LPFA 4JFPB 1QFWH 1XF2A 2D0FA 3MJ8A 4HK3J 1WK0A 1NEZA 3VXMB 3GNMH 4JO4L 3RVWC 4WFFD 6FABL 4PJEE 5CILH 3SKOB 2VERN 1S9YB 2C1PA 2IG2L 3C9NA 1MFEL 3OXRB 2NLJA 3QQ9D 4PJIB 4GKZB 4GW1A 4F7TA 4EOWL 1LP9B 2YRZA 3REVA 4I18B 4FP8H 1F3JA 1FRGL 1TMCB 5IM7A 5DI8B 4OF6A 4JN1H 3VRLE 4NSKA 1U3YA 5DJDA 4O5LL 4PJCB 3LN4A 3UTTB 3P73B 1MHPH 4A6YB 3LZFH 3UCRA 3DNKA 5L8LB 3HKFA 5FK9A 1EO7A 5HJ3B 3K74B 2VZSA 2YA1A 1P6FA 3KPQA 2CXKA 2FJGB 5ID0B 2UVEA 4FNLH 1W0WB 1D5BB 2R0WH 4TPRH 4WFFE 1GGIH 1VA9A 1TZHA 3DXAA 1MNUH 3SDAD 1LO2H 5HYJA 3WFHA 3L3OA 3ET9F 2G5BB 5F7HA 1X9QA 4Y5VC 4NC2B 2E7HA 2Z91A 3T65A 3LRSA 3VFRA 3GSVB 5FYJD 4OTXH 1FBIH 1R3IH 3WLWC 1JZ5A 2Y72A 1D5MB 1AQKH 3SJVD 1IKFL 2AJVH 4RAUA 5F1KC 1FJ1A 1YN6A 4UIMB 3FTGA 1NCDL 1PBYA 1G7HA 1X5YA 4AEIH 3OKYA 1AXIB 4LP4A 3DVNA 2ICES 3NPZB 1OGTB 4CDGC 3KPNB 5I2IA 1CFSB 1U91A 2BNUA 5JPMB 3LQAH 4UNUA 2DQDH 2OQJB 2CIKA 1SY6A 3B9KC 1U8PB 1FNFA 3R0MA 1P2CA 5GISL 2WINB 3BGFB 3PWNB 4DZ8B 2Y5TA 4IOFD 4JAMA 4HS3A 4J4PA 4FFVC 3UDWC 3CJJA 3PG2A 5FYJE 2BNRA 2C7UA 5F44A 3DBXA 3SJVE 1BJ1H 1KLUA 5C08D 4EXPX 1PG7W 3LDBB 4OZIE 1F6FB 2ZCHH 3GKWH 4P46C 3WMSA 4TVSa 1CI5A 5EZJA 3EYVB 5C0IA 2DWDA 1H0DB 2I5YL 3ARBA 4HUUB 1Q8MA 4NNXA 3B2VL 2EYSA 1BFSA 3TJHC 3IJSB 5GRJL 3HMWL 5IQ7L 3TO4C 1GGBL 4I77L 1DQQA 3BH8B 2YMXH 1T03H 4PJAF 2H2PD 2N56A 3FO0H 1PAMA 3QPQC 5FECB 4JG0L 2NXZB 2BXYA 2VIRA 3IFOB 3OB0H 2C3XA 4B41A 5HHQB 5C08E 4TN9A 3MFFB 3SKNA 4EI5B 3T3PF 4ELMF 1O5DT 3IETA 2H45A 3RWGA 2MPAH 5KVDL 2I9LB 4U2ZA 3V4UL 1CLOL 3IFPA 3BKYH 1RZ8B 3T0BA 1JTTA 1CL7L 3DO3A 4Z8FL 4PRNB 3MGAA 4FOMA 2X89D 3F7YB 4H1LH 4JFZL 2HKFL 1OY3B 2RFXB 3MROA 3ZO0A 1RK1A 1K85A 3ZDXE 3MRMB 4X5XB 4WUUA 4EUPH 4Q9RL 3FT2B 4QTHA 1UZ8B 4BFEA 2H6PA 4YDLB 1ZS8A 3T2PA 4A6YL 5DD5L 5DQ9A 1W72L 1XGUA 4O2CA 4Y2DC 3GHBL 4NT6B 1QRKA 2BVQB 3I85A 3NCCB 3IDNB 1Y18A 3RJQB 1E4XH 3RWJB 1CK0H 1XGTB 1PKQE 3B9EA 3CFIC 4YDIH 3UO1L 9CGTA 1P4LA 5TJWK 1OAYL 5HHXH 1T1XB 3BXNA 1L9NA 4RRPG 4WW1B 3LKPA 4NO2B 4M6ML 4L4VA 5T3XL 5JXED 4QY8B 3CUPA 3I02B 4HLZG 4M00A 3CZJA 1KT2A 1UM6H 5SWZA 3WLBA 2YEZB 4CVZB 1VFBB 3MR9B 3NCMA 3O9WB 5IT2L 2O61B 4PGBB 4YUEL 3VH8B 1KEGL 4WW2A 1IGML 2ED7A 2IBZX 32C2A 5JQ6H 4D8PA 1KCSH 5BZWB 3RVTC 3KPPB 5KVEL 5EU3A 3CAFA 1A6AA 3HUJE 1A6ZB 1KJ2B 2JCCE 3S96A 3RUGE 2P42B 4OD1H 4QXWA 4LSRL 2XRAL 1MAMH 2MQ3A 2A9NL 5FYLL 4LSTH 1CTNA 1SEQH 3AAZB 1C5CL 1A7OL 2WUCH 4N5ED 4XBPB 2R2BB 1TQBB 1NCWH 5CJXC 1HXYA 2W0LA 1LDPH 5D2LB 3MA9H 3D6GA 4P23C 4KI5F 4QRPB 2LQRA 2JIXB 1A4JA 2YBRB 2OLDA 1BGXH 1YMMB 4X9BA 2VDPH 1IGFH 2F5BL 3C60A 4D0DA 2IMNA 3L3IB 4CMMB 2CR6A 4MXWH 4DGIH 5E2TL 2EEBA 2XACC 4P2OA 4MVBC 4Q7DA 5EUKA 5CZVH 2EYTA 4PR5A 5CD3B 2XYCA 5C0FB 1JZ2A 3E6HA 1AQDB 1VADB 5DC9B 4LCUB 4UDUA 4CADB 3GSXA 1U8NA 3P9MB 1G9NL 3C6LD 1J1XL 1AO7A 1ED3A 5T3ZL 4YEFA 3TYFA 2YUWA 1KBGH 4H0GA 1OTUD 1J0YA 1YA5A 4YGVA 4HK0A 2CH8A 2HJKB 4IOSD 1SYSA 3SKMA 3EBAA 1ZT7A 3OZ9H 4UU9A 3LKSB 4X7TA 4X7SH 1A1MB 4XVJL 1LE5B 5IVXE 5EN2A 5EU5B 3HAEA 3L1OH 5K59F 3TIDA 1P6AB 4IHOB 4Y5YC 3SGJC 4QRRD 4UMGA 1LP9F 4M6OH 2VB5A 1SM3L 1U95A 2F8XC 4R7NB 2GK0B 1J11A 1I8KA 1Z5LA 3O4OC 4PY7B 4PJCF 4XAWH 4LVNC 3MACH 4JY4B 1JVKA 4KK8D 4IMLA 1T1ZA 1P7QD 1JWMA 2DYPB 3FZUC 1DFBH 2IQAB 4LSQL 2VNCA 3OKNB 4N8CL 5FGBA 1INDL 3RWHB 4AIXA 1NMBH 4LSPH 4U1MA 5E6IA 5ALCH 3ES6A 5HI5D 4RFOL 1EFXD 1A6UH 4HKZA 3SDCB 3GMMA 2AK4A 1M7IA 3Q6GH 4PREB 1KXTB 3VGDA 1UWGH 2DJSA 3UYPA 1KEMH 4L8DB 4ZTOL 5I17B 3HNTL 1CLZL 1YMHA 3S7GA 1INQA 1CF8H 1WBYA 3HNVH 3VFGH 4XGZB 5AUMA 1ORQA 1MJ8L 4MNQB 4MNHB 3PQYD 1TNMA 3IU3B 5SX5H 5IJKC 5HPOA 1KJ2L 3NIFF 1LEKA 3KWWA 3PHQA 3BKML 1PD6A 4NNYB 4N1EA 4U1SA 4QOKB 4LIQL 5HGAA 4S1DC 5HD8C 2E7LC 3DSNA 3ZE2E 2ESVB 3EZJB 4KZEL 3EGSB 4LOUD 3LB6D 5T1LA 4PJ8C 4LQFL 2PETA 3QDGD 1TZGL 3MJGX 1SVZA 4KRLB 1A0QH 3WIHL 2UZIH 1S9WA 4LSSH 2UWEF 3ZTJH 2AGJL 1J0IA 2Z8RA 3BQUA 2VKWA 3UTPD 2X9XA 2F54D 2J12B 1E4KA 1MREH 3P4OB 1G7LB 1M71B 3H3BC 3GRWH 3PQYE 1X5FA 1DN0B 3LSOB 3TNMB 4YDJB 4KJPC 1JYWA 2XFXB 2D0HA 5KOMC 4DN4L 1XT5A 2DQGH 2DLHA 4OSUL 3QIWD 2ATKB 3GJFA 4LHJB 5EOCJ 4WHDA 1KV3A 3QDGE 3UYOD 1KTRL 3I84A 3KLHD 1V3JA 5LGJB 3WNLA 3VD4A 3O8XA 3IAGC 5EBGA 5GS1B 1BD2A 2Y9RT 3RGVC 5C0AA 3G9AB 5HYSA 2DL2A 1ITCA 3AREA 4WO4B 3RA7H 4E41A 4IRJD 3UTPE 2F54E 3CDGB 3MBED 3ZKND 3QT2A 2GTZB 3G5VB 4G7VH 1YQVH 5INCA 3CFCH 7FABH 4FQHB 5EC1A 4RGMC 3FB7A 3DIFB 1M7DA 3MLVH 2JB6A 4JFEA 4APQC 2GITB 1BVLB 2AXFB 4JDZA 4UTBL 5T3XD 5D5MB 2K7QA 3SEPA 1C16A 2WW8A 2P45B 4H5SA 5DUBB 1NGXA 4JZNA 2VXTL 1MCPL 2A83B 2XT1B 4KMQA 4U0RB 3PWPB 4KVCL 1LO4H 4PRHB 3MLYL 3ZKMD 1DEEA 4PYHA 5HVWA 5ADPL 3I6KA 1FN4A 3QH3B 2EC9T 5EUOF 5GSRB 5ACMA 3BN9D 3VXNB 1FNEB 2XPGB 1JPGA 2W60B 1DQJA 1RZFL 5HHOB 3FQRB 5D72L 4XVUC 4F58H 3B8SA 4F7EA 4ZFZA 2ZNXA 4L29A 5FF6B 1MCDA 1BBDH 3H3KA 5T3XE 2HVKA 2VWEC 1MY5A 2UV3A 4NIKB 4ZNEE 1FLTX 2NY7L 4P5KA 3IJYA 2B0SL 4AEHH 4M48L 2E6QA 3SGKA 4UQ2A 1JNLH 2VITA 1OP5H 1DLFH 1NGPL 5FUCE 3WKNA 3RVWD 1EVTC 2WWKO 2WSKA 4UI2A 2HRLA 3RL1A 4EN3A 3VFOB 5C7XL 4PJ9B 3O41A 3RNQB 4DCQA 4XCCH 3ZSSA 1OB1A 3MV9A 1I1FA 3T77B 5SX5K 4OF7A 1WISA 3CGTA 3VI4F 4XP5L 5D7JB 1QSFD 3WS6A 3DUUB 1CFBA 3L7EB 1M05B 3CDCA 4JVPA 1U58A 5T3ZD 4X98A 2ZJSL 2BMKB 4R90H 3QP3A 1CDIA 1E6OL 4PGZA 1WC7B 2QSCH 4LMQE 3MUJA 5IF0A 4PJFE 3W11C 43CAB 1WTGT 2MMXA 3MOBH 5FYKH 4HIXL 2P44B 3X17A 1KENH 2AJZB 1XF1A 5I1DA 3KDMB 4RGNC 2NW2B 3HG1D 3HLAA 4XNQB 1OW0A 3WLWD 2D7PA 5E8NB 4HZLB 4Z7UA 4QT5B 3D3VA 1E6JH 5ELIA 5F3HA 4AT6A 4E5XA 2AJUL 3GBMH 1MJ7L 5H35A 3P9WB 1D5ZB 4KJYB 3S36X 1QSFE 3MUGA 2H2SC 3OAYH 1KCUH 5JW3L 4PV9A 1EEZA 2AQ2A 5LGHH 1HI6B 4G6AC 2ORBL 1BQUA 4JFDB 4OCRH 2BVTA 4K7PY 4BUGA 3TH4T 1RQ5A 4XP9H 2PXYA 3P0YL 2FNBA 4C59B 3L3KA 1WCQA 4JM2C 4X80L 1A3RL 4GG6E 1R0AL 3WN5B 5C0BD 2R4SL 3LQZB 5KSBB 5F9JB 4YHOH 5I15L 4FFVD 3A0OA 3HG1E 4EQ3A 5B4MC 4C58B 1IGCL 3ALPA 4GAYA 5F7EL 4UT7L 3MRBB 3GMPB 3CIQA 1A6WL 3T0WA 3TYGL 3F12B 4XXCA 3AROA 2ZOLA 3SE4C 1RZGA 4P46D 1YY8B 2BCKA 4HXBH 3TESA 3IDXL 2B2XH 5BVJB 3PL6A 4UILH 2OM5A 3H7BA 2DQTL 3W9EB 2BSRB 2YN5A 1KF9B 1ZHBA 2UYLB 2QL1A 5L7XL 1J8HD 3P2TA 4L9LA 3TO4D 5EOTB 1ACYH 1TFHA 3FAWA 4NWTL 2O5ZL 5F9WB 1T21A 2PYFB 4MMXC 2ZUYA 3QPQD 5C0BE 1EBAA 2NY4B 5DQDL 3U7WL 4X8XA 2NQCA 3O6KH 3EFFA 5IFAH 1JF1A 4ESKA 4NZJA 4QHKI 3WXWH 2NY2B 4GMSL 2C3HA 1TTGA 5TE7L 1IC1A 1I9RL 1MLBB 3DROB 3F7VB 4UDTB 4OFKA 4HS8L 2LVEA 3IDJA 2NYYC 1IAKB 4D3CL 1F58L 4LDOB 4PJBA 4HSQA 4KGLA 1O7SA 4KUZH 2P8MA 2WAHA 2VZ1A 2H26B 5D1XB 2BOCB 1J8HE 2VDNH 1VPOH 1M6OA 3S3PA 3G04A 3UP1A 2CJUL 4GRMB 1NUDA 1TVHB 3CVHA 4NM4L 5GSVB 1D6EA 3GK8L 3L5WA 4KMTL 3O11A 4I5BA 4LIQE 5KAQG 2J8UE 3EJJX 4XMLH 2Z31C 5IR1B 3CZFA 4Y2DD 2GT9A 2CR3A 5CIPB 5DRNA 1RUMH 1RURL 5ACZA 3QG6A 2VN7A 5GRVL 3QZWB 3WJLC 3S35L 4FFZH 5HYQB 1FDLH 4EIZC 1DLHA 1YPZE 2PW2A 4NHUA 1DBJL 5CJ8A 4MAYD 4NPYA 1UM5H 5EBWB 1JGDA 3K2UL 2WLYA 4AL8H 3PUCA 1D9KC 1BX2B 2Q86A 1IM3B 1UH4A 4JEGB 3UROR 1F5WA 2L4OA 1FVEB 1HHGA 4O2EA 4WTWA 1J1OL 4EVNB 3OPZH 2BY3A 4NQDA 3VJ6A 2WBWB 4U6YA 3RVTD 1B88A 3MYZA 1HH9A 2VTFA 3HCVA 4ZUUA 5C92A 3OJVC 4LMQI 3JVGC 5A3IC 5TFSL 1UXWB 3OAYK 4J3UA 2YUVA 1E4WH 3EYFB 1G7IA 4XPAL 2MSPA 4GKSA 2B1AH 3DRQA 1CD9B 1JZ3A 3JWOH 2ADJA 1ZMYA 1H3PL 5DRXA 3NOIA 1NFDE 4R0LC 3PABA 3O2WL 5D1ZB 3WFCL 4TTGA 3NIGF 5CCKL 3LOWA 1I1AC 3CH8A 5I74C 1MLCA 1CQYA 1ROWA 4P23D 3CX5K 4F7PB 4U05A 5A43C 1U3HB 5D70H 4NJAL 5ISZB 5M7QA 1CYGA 4QF1A 3QUZC 4MJ6B 4I0PA 4BQCA 3IT8D 2DB8A 3WJJA 4KJWC 1NBQA 1NC4A 3HE7B 5IEHB 1XR9B 2HLFC 3MLRH 3SDXB 5BW7A 1HHJB 2VE6B 2NY3B 1WBXB 3TEUA 3GUTB 3BIBX 3WIIH 3B2UC 1RPQA 4NC1C 4IIQA 3UTOA 5F96H 3AS3A 3OJMB 3MO1A 4BJLA 3MOAL 2CIIA 3MRLB 4Y16A 3F5WA 1ADQL 1JGEB 1XF3A 1IM9A 3ZMRA 2VDQH 5DHYB 2Q8BH 2H1PH 4KKBC 3ZE1E 5BMFH 4FQIL 1QFWL 4LFHD 1YNTA 4YWGL 4NYLA 4MX7B 4DGYH 5F71A 2RAMA 3MLTA 4JHZA 1KN2H 4LRIC 3ULVD 1Q9WA 3H9SD