5T1LB

Cetuximab fab in complex with cqa(ph)2dlstrrlkc peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
221
structure length
216
Chain Sequence
EVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Natural and non-natural amino-acid side-chain substitutions: affinity and diffraction studies of meditope-Fab complexes.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
molecule keywords CETUXIMAB FAB LIGHT CHAIN
total genus 45
structure length 216
sequence length 221
ec nomenclature
pdb deposition date 2016-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t1lB02
4V1DB 3RWEB 2MKWA 4P57A 4WFGE 4I8DA 3FO9B 5GHWH 15C8H 4C56D 2RCSH 1CDJA 3UBXG 1I8MB 6CGTA 3WLBA 5ALCH 1DBJH 4ENEC 3GMOA 3MOAL 3TCLA 2CDFA 1BFSA 4HZLB 4NYLB 1J8HD 3FB8A 4JFFD 1EFXB 2ED7A 2HFGH 1QLRA 2OSLB 4P2QB 2NXYC 1HEZB 1NC2B 2FSEA 5CGMA 4Y4KA 1UJTA 5GRWA 5J57B 3U0PA 1JJUA 2R0WH 4FQ1L 2E8ZA 2PW2A 1MY5A 2XIDA 3MJ7B 4BZ1H 1KPUB 3EO1A 3EYOA 4QYOB 3V4VL 1TCRB 1R5WA 2V2XA 3GSXB 1CN4A 3IU3B 4CN4A 1QEWB 5GZOC 1ERNA 3BGMB 2CK2A 3L3OA 5E5MA 2WAHA 2IANE 1NBVH 1MVUB 4FQCH 4HV8A 1MFDH 1B0GB 2ZSWA 3EHBD 2IPUK 4YDVA 3NAAL 5E9DB 5D5MB 5GGVY 3FFCE 1HHJB 1IEAB 2FX9H 3TIEB 4LLMB 2OZ4L 2QADC 1TTFA 1LEKB 1ZV5A 2YA1A 1H3XA 4GW5B 5IROC 2YZ8A 4I3SH 2H2SC 4S2SB 3VFUA 4OBRA 4WJ5A 5IW1B 2DAVA 4NP4L 4GT7A 4AK1A 4DGVL 3C6SB 4NQUA 3LRGA 5IQ9B 3CSBA 3LKPB 4KMLB 4W4NA 4D3CH 1RQ5A 2V17L 3BX7C 4LMQE 4NDMA 1M7XA 2VO5A 4GW4A 4XMKH 5DVOA 4HC1A 2M2DA 2XTJC 3PL6B 1IKNA 3LMJL 4ZUUA 1VCAA 5IEKA 1MHHA 1UWGH 1YEGH 3C6LC 4NIKB 3ROLB 4D9LH 1GGBH 4NQEE 2LU3A 2EXYD 3OKLA 1I4FA 2HH0H 3QUYB 1FL5B 5MHSE 5IT2L 4HIXH 4K3DL 2XRAL 5C2UB 5LQBH 2NQCA 3HE7C 3QDGA 2R0WL 1GAFH 1R24B 1IAIL 3VXRB 1BHGA 1G7MA 1J0IA 1RZGA 4HEPG 5EU5A 3O3EA 5HGGS 4PJXF 2I9LA 1NDMB 2VB5A 4ZUSB 4JPWH 2F19L 1ES0A 5C71A 3QULB 1CDGA 1IFHH 4LIQL 4X4XB 2IANB 1CCZA 4LLQA 3KPLB 1BFOA 1U8IA 5FOBB 4JFEB 4Y1AE 5KG9A 2BMKA 4JFYB 2WIIA 2AXHA 1IT9H 4YUEL 1H5BA 5E8EA 1P4LA 3TH4T 5BVPL 4U2YA 1IM9A 5EBWA 3CVHL 1WQVT 1PY4A 3HMXL 3QA3A 5BVJA 1DBKH 4F7EA 2H8PB 4MNQB 2NY7L 2X70B 2IBGA 1Q9LB 1CLYL 1NH6A 2YXMA 4M48H 2IC2A 1WZKA 2UYLA 4WTZG 1L9MA 5BS0E 4M00A 4WUUA 1S5IH 1TETL 5K9JL 1B4JL 3HE6B 4D0CA 1CE1L 3VXUE 3TC9A 1A1NA 1A6UH 5GJTL 4HUVA 1DFBL 3QA3B 4WI2A 5EIQA 4LNVA 1CD1A 1BLNA 5HHMB 4OCXH 5GGRA 1Q9LA 3QT2A 2YXFA 4AG4H 4P5KA 5HYSA 3ZE2F 4NRXA 5L2KA 1AC6A 1NGQH 1FG2B 2XT1B 3MRNA 4OIAA 1T22A 5BXFA 1UGNA 1GAFL 1UWXH 5H35A 3D1MC 4QHNB 4XB7A 1FNEB 4NZRH 2BZDA 1OP3H 1MQ8A 5DWUH 5IFJB 5F7MC 1KLUB 1AGEA 4LCWB 2C7UB 1FVEB 4Y5YC 5J06A 4YC2B 1F6LL 3MODL 3QXDA 5DK2A 3V4PL 4X4XA 3EYQC 3BIAX 2IPUG 4JKPH 4HG4K 3CZJA 4KI5F 3CJJA 2NYYC 3PHQB 4PJBB 4MZ3A 4UQ2A 4XZUB 4YUEH 4OD2A 5DUBB 5JA8B 1G1CA 4JPVL 1AHWA 1VEPA 4YDLC 1XF5B 1WEJH 2Z8SA 4B7LA 4EI6B 3TCXA 3WN5A 1P6FA 2VXSL 3LRSB 3BKJL 1S7SB 2VL5B 1IKFL 1FBIH 4EQ3A 3T0BA 1G7HB 4JQVC 3ULVD 4XNUH 3RKDC 2AJXH 4ZDHB 1CU4L 5D7IE 1IAKA 3CSYB 3TT1L 3N1PC 2D4FA 4M03A 2Y5EA 4QXUL 1T89A 4KC3B 3RQ3A 3T0XA 5GJTH 4FZ8H 1TPXC 3BGAA 1MFNA 2YPVH 1GH7A 3SDXE 3G5VB 3GMPB 3PQYB 2PTUA 1P7QA 4R7NA 3ALPA 4FQIL 1UM4H 3PWLB 1UXSA 1IL1B 1E4KC 5C1MB 1UXWA 5L2KB 2NY3D 4C55A 5C8JB 1JZ7A 5GGVH 1CFBA 3BN9C 3GFUA 2VXVL 4IRJD 4QGYA 5EPMA 5JOEA 4QRRA 3HMXA 1NLDH 1MFBH 3RHWK 1DDHA 1XGYL 5HVWA 4MCZA 1TNMA 4L9DA 1UH4A 2AQ3A 4LCWD 4LSVL 5EWIL 4JGJA 3T0VA 3T2PA 5K93A 2MQ3A 4LL9A 3K74B 4JKPL 2EYRA 1KCUH 3I85A 3VG9B 5DEFB 5J3HD 1T21B 4MNGB 4JM2C 3VWJB 4DFIA 1IQWL 2BHUA 1ACYH 1YY8B 2MHAA 4LRIC 3VXOA 5MP6L 2BVQB 2YEZA 1F2XK 2EZ0C 1JGDB 4JCMA 4R0LA 3MCLL 2CMRH 3O6ML 1AY1H 3VGBA 5IB4B 4MB3A 3ZT7A 1WEJL 3CSPA 5DC4B 3HS0B 4OFPA 2C5DC 1ZLSL 4NRYB 1KCLA 3T0DA 3DX9B 4BYHA 3LKOA 3ULVC 3MRFB 2I60L 3D3VE 1Q94A 4EDWH 4D2NA 4D3CL 2R2BB 1CFVH 1SMAA 2F54B 1G84A 2AJXL 1F11B 4NBYB 3ULUL 1IGIL 5D7LD 3TT3H 1K4CB 4DEPC 1P5UA 3JXAA 4GAJH 3L7EA 3E6FA 1MLCB 1JUFA 2BSRA 4X6FB 2I24N 2B4CC 3VFMB 4OKVA 5KS9B 1MCLA 4D9LL 1CZ8L 5KSAA 3D2UA 3CFKA 3O6FC 5T1MB 5F9DC 4YFEA 4MMXC 3VMNA 4KJWC 5TE6L 3HI6L 4XCYA 2Q86A 1ZLVH 2QQNH 1NAMH 3TYGH 2X10A 4LGRB 1YNKL 1NLDL 5KTEH 2E9JA 1EEYB 4FQJL 4M93B 2K7PA 1U3ZA 4UILL 1NMBH 3HE7B 2F19H 1TVBA 3UXFA 2XZAL 4HPOL 1C5BH 3JTTA 2X1QA 4MD0B 5HHXH 2DIBA 3ARZA 2VSDA 3BH9B 1N2RA 1WFUA 4KI5D 3SKNA 4YFLI 5EIIA 5D71H 3QNZB 2X1WL 2GTZB 3QFDB 4OB5L 3HAEG 3W11D 5F96L 4X5XB 3KPQA 2XTJB 1JTPA 4Q9QH 3BMVA 4I48B 4KMQA 1DUYA 3BP5B 2EDNA 5C07B 5I8KH 3QUXB 4G43B 3TO2A 2JJVA 5ECJE 4OM1H 4JGMA 3IDGB 1E28A 3F7VA 4N0UE 2IAMB 1OL0A 2WM0A 3ULUH 5FECA 4LSPH 4I18A 4MA1C 3G6JA 3GSNB 3QIBB 4Y19B 3QNZA 1JE6A 3NCJL 3TIDA 3LEYL 4ZMAT 4N9GA 1I3RA 2P5WE 2FNBA 4KKAD 1YC7A 3DBXB 5IBLD 5ID1B 5FDWB 4G8GB 1ORQB 4ZPTB 3BKMH 5MEPA 3HR5B 4RGMB 4P23C 3BAEL 1XGPA 2EE3A 2IQ9L 4YDKH 4KDVA 3RWDB 3BPNC 4WGVB 1PGRB 5FDYA 5IVXE 1BD2A 3KS0J 5DS8A 3MUGA 5FHBL 4MJ6B 1CLCA 3BT2L 1C12B 2GI7A 4NUJA 4QRTA 3VXQB 5J6GA 1NDGB 2P49B 3HE7D 2DRUA 3NCBB 3WNMA 5DMKA 3ARXA 1HH9A 2AJ3B 3OTTA 4LASL 1C16B 1QNZH 5IB2B 1JGVL 2OTWB 1N59A 2F74A 4A2MA 4K7FA 2BXZA 3V0VA 5FYJL 5H2BA 1BREA 1VA9A 5J13B 4LEOB 3RVUC 2SEBB 3BW9B 4L4VA 3TH3T 4Q9QL 4I48A 3B9VA 4D0DB 1IZJA 3OGCB 2NW2B 4ZTPH 2X2YA 2V5RA 2HJFA 1X5YA 2AABH 5DEGA 2Q7YB 1RZKH 2FZ3A 4F80A 2E27L 3CUPA 4KUZH 3P9WB 1WFOA 3T2QA 1QFWM 4AQ1B 3L5XH 3TN0A 4U1GC 3Q5OA 2MMXA 2EDKA 2X9XA 3D9AL 4XCFH 5SWSD 1A1MA 2ORBH 3RWCB 3NH7H 3QHTC 1YMHA 1ZKAA 4KTEH 1Q38A 2BNQA 3P73A 3E0GA 1OCWL 3BKML 4P9ML 4LKXA 4YEFA 2NPLX 1MI5A 3BAEH 4X98B 5DTFB 1ZHLA 1ETZB 1A6WH 4G6KL 1LVEA 3E3QE 2ZCKL 4AIZA 2DQUH 3HHRB 3S3PA 2GTWA 1J88A 1X7QB 5D5ME 4NZDA 2BJML 2X6MA 5TH2A 4JPKH 3UTZA 5EO1B 2P7TB 3WIFB 4YDVB 5E9DA 1EJ6A 4P46A 2NXZD 3S5LA 3THML 4PP2B 3VD5A 4LCCA 4XBGA 4NQCE 3PG2A 2HWZH 1PG7L 4WUUD 3X12A 1Q8MA 2ATKA 5K9KA 3OKKB 1MRFH 1N5AA 2NY1C 2XV6B 2NZ9D 3LKSB 4GQ9L 3FO2A 2H45A 2W92A 3P9MB 1S5HB 4RWHA 5B38G 3IKCA 3UC0H 2BFVL 3K4AA 4ZFZB 3KPNB 4ZUUB 3NPSC 3LH2H 5TE4L 4ZUVA 1RZ8A 1TQCC 4PJBA 4GW4B 3DVIA 5D5MF 3T65A 4YHIA 1RZFH 1T89C 3L5XL 3I6GA 5JPNB 1NAKH 3PJSA 1KFAH 5JTWA 4TRPL 1U8QA 3HNVL 2OL3B 1LNUB 3QRGH 4P23A 5FGBA 2KUTA 1BBDL 4DCQB 1ONQA 5I71B 3OPZH 4Y4FB 1VKXA 2PO6C 4J4PA 1T0NB 2DIAA 2KQMA 5FYLE 4PRAA 3P30L 3Q0HA 4JZJC 3MYJA 5SX5H 1IM9D 4JVPA 4F33B 1IZKA 2BHYA 1PQZB 4DUXA 3QH3A 5ADOH 2R1XA 1U2HA 5C07A 1XF4B 4LF3A 5FFLA 1UKSA 2B2XL 4Y1AD 2AEIT 3SOBL 1DUZA 5SWZB 5IVXF 4CMHC 3RP1A 4U49A 4PJ8A 1N0XH 5HGAB 4Y4FA 1KPUA 1T2JA 1S9WB 3CMOH 3EO1B 4YHPB 1ZT4A 4OUUA 1NUNB 3BKCH 3QNYB 3TBVB 1EBPA 4HF5L 2XTJD 1XGQB 1MHCA 5EORH 2X7LA 2YSSA 2VLKE 4MYWB 1M05B 2WMPA 5CKAA 4D0DA 3UZEA 2RFXA 2WQRA 3BZEA 3GNMH 4M7LT 3OJMB 2HT2C 3G6DH 4BQCA 5T5NF 4NQED 1R3IL 5I1CH 1EXUB 3L3KA 1CD0A 1OAXH 4W6WB 3QEQB 4U2ZA 1K5NA 4S11A 1CDHA 5I66A 4RNRB 4QRUA 3M8OL 2R1WB 4TN9A 3W81A 4BELD 2FLBT 2HLAA 1ZHNA 3D87B 1KT2A 2R23A 1L7TL 3ZKMD 3DUUA 3IYLW 4G80B 1KC5L 4Y4KC 1CICA 3RFZC 5I8EB 2NTFB 5HGDA 1IRAY 1MJUH 4R4BA 3QEQA 4R7DB 3TBSB 5C0RH 2BNUA 3AB0B 5C08A 3OX8B 1BPVA 4P9HL 1KCSH 3VE0A 4LU5L 2IQ9H 3VA2C 5EOCJ 1KSRA 1R3LB 2DLIA 3RVXD 5I9QB 3L9RA 4X7SL 5J1SC 3T1FA 4G7YL 5ENWB 1LP9B 1RURL 5IQ7H 3MXWH 4GAFB 4MGXA 4LVNC 1RZJC 4X6BA 3CMOL 5HDBF 5JNYA 1I8IA 1YEHH 4Q74A 4XNYL 1JRHL 5D7LA 5F1NA 1FIGH 4HF5H 1GC1H 1KCRH 4LLUA 1FZKA 5DR5L 4I1NB 4RRPA 1GC1C 2DQDH 3MBEA 1DQLH 3EJZC 4EEEA 4Z7WB 1NCUA 1R3IH 4ZTPL 2WANA 5D1ZB 2DBLL 1D9KB 1NKRA 1LE5A 1LP9F 4E0RA 1E27A 1FZMB 1XF3B 4W81A 3ECBA 2FO4B 1U36A 1L7TH 2XFXB 1Z6JT 1U91B 1XCTA 3L3IA 3CCHA 5DJYA 4IS6B 4M43H 3C60A 3ESUF 4U05A 5HDQH 4U6VH 3TVMC 4KTEL 4H1LG 3MYZA 3EYSH 4P9MH 1MRCH 3SPVA 1O5DT 4F2MA 4I9WD 3DYOA 4GXUM 4HQQL 5I2IA 5IW3A 1IM3B 3L1OL 3SCMA 4OF6A 4RAHA 4WCYL 5EUOA 5T33L 1A1OA 3TVMA 1JPFB 1CVRA 2W91A 3SE3C 4PJIF 3QHFL 2W07A 2IADA 3HR5A 3RZCC 5C08E 1TDQA 2EIDA 4LFHD 1G7QA 3SDAA 1EUUA 1F3RB 2UY6A 3T77B 1T22B 1ZHBB 1XH3B 4O9HH 2D03H 1PX3A 4ODHH 1WCBB 2R56H 4BSWB 1YJDL 5E8PA 5HY9B 4NRYA 4NKIL 2C7UA 1P1ZB 1JF1A 3GMMB 3IDJA 2A6IB 1I8KB 4WFEE 1RIHH 3CC5A 3FOLA 2I27N 5CEZD 3AREA 2EH8L 3QDJE 3LH2L 5L88H 5BV7C 2R8SH 3LPWA 1DL7L 3PABB 3KNBB 5T1KD 1ZGLB 4G8EA 1QKZL 5CGTA 4Q6IB 4L4JA 4YPGB 2VDOH 2XTJE 4DOHE 1SYVB 4PJXE 1XF1A 1RZIA 4XXDB 4Z9KB 2HYMA 2CLZB 1TTUA 5FYLH 3HNVH 2R4RH 3OKMA 4M43L 5EN2A 1OAQL 1S9WA 4DK3A 4AEFA 2Q7YA 5DEGB 3OPZL 1U3HB 3VFVB 2NW2A 4M6NH 2X1XR 2Z92B 5DRNA 5MI0B 1UVQB 3GSUA 3OKEB 3V5HB 4MA3A 4K94H 1G0DA 2XYCA 4G6JH 2YD9A 1W72H 1K8IB 2PXYD 3P0GB 3PXJA 5CINL 1BFOB 1U8IB 5FOBA 5CBAB 2WIIB 4HKXB 1MJJA 3ISWA 4JRXB 2FCBA 3LIZL 3DVGA 3QCUL 3MRMB 4DVRL 5C6TH 2J8UA 2YR3A 4LAJH 5E8EB 1T04A 2HVJA 3L7EB 2EDWA 3LQAL 1WBXA 1KT2B 2R23B 3VFWA 7FABH 1DEDA 4MQXD 1LEIA 1NEZA 3VFPB 4O9HL 4XNQB 4ODHL 3OJDB 1T83C 4XI5D 2YMXL 1TJHL 2Z31C 5KSBF 1BIIB 3B8SA 1Z9MA 2AXFB 2A6KA 2EEBA 2P48B 4ZNCD 4NC1C 1KBGL 3MNWB 1VGEH 5E8OA 1OARH 1RUAL 1S5HA 1MWAL 3NIGF 3UJJH 5IFHH 3AGVA 2B1HH 4FQXC 5HGHB 3JUYA 1JNLH 4P59L 1JYVA 4XVSL 3UYOD 4HIHA 5MEPB 2DWEA 4ZS7L 1IGYA 1MCNA 2NNAA 3ES6B 3QUZA 4NKQB 4NN6C 5KN5A 4LCWA 5J3HC 1LEKA 2A38A 1CGSL 4MZ2A 3BXNA 2CRYA 1ZHKB 5M7QA 1N64H 4RISH 3MFFB 1QSFA 3G5YB 4MJ4A 1EHLL 1ITBB 3BMWA 1HXYA 5CINH 3CVHA 4P3WA 4X7SH 5EU7E 5GGUB 1MFEH 3OG4B 4X7FC 3SKOB 3RVVD 4NN5B 1X5AA 5D1ZA 4O51B 1C7SA 3MV8A 4K71C 2VXQL 1T83A 5GJSH 1CGVA 4YR6A 2JK5B 1WT5A 3NZ8A 4JDTH 5SWSE 4OFYA 3WIHL 3I2CH 1KN2H 3WUWG 1U0QA 3K4DA 2FH6A 1GC1L 4M02A 1UCTA 2R4SH 3E6HB 3SKUD 2R2HB 4P2OA 5GSVB 2ITCA 3HZKB 2NY0D 4HV8B 2VL5A 1KIUA 3BRGC 2VC2H 1YYLL 5DD0H 4QHLA 3GSNH 5D1ZD 3TN0C 35C8H 1QRKA 1YEJL 3QIWB 3JVGC 4JPIB 4U1IB 2Y1VA 3JBG7 1UWEL 3FFCB 4RAVA 4PJ7F 2VR4A 3BRDA 1BX2A 3LKQB 3RY6C 3QUKA 5T1LD 4ZXBD 5J7CC 1O7VA 3DYMA 1BJ1H 4YWGH 3R1GL 1IC4L 4KRLB 5DJDA 3V6OE 1FZJA 4LLQB 3UJTL 2GFBB 3I02A 5BZWB 3F6IA 3V6OC 5HPMB 4WW2F 4OZFG 4WEUD 3WJJC 1TIUA 4PGEB 3GMOB 4ORGB 4NOFA 3C2AH 1CXKA 4ZS7H 3IVKA 2ERJC 5F6IC 1J12A 1YN7A 3Q1SH 5D72H 5GIRB 2LVCA 1VDGA 5EO1A 2AGJL 1NUFA 4MNHA 4H88L 1AQKH 3HI1A 5DJDB 2HN7A 3STBA 3WKMH 2H32H 5ESVB 2MHAB 3NGBC 4MQSB 1I7TB 1A6TA 3DTXB 5IBUG 4C59B 3FQTA 1XGPB 1T21A 1RJZB 4BFEA 1DQQA 4BFIA 4FOMA 5EOCL 3W2DL 3FT2B 5T3ZL 2BP3A 2W9LA 1UA6H 3CFIC 1A5FL 3V6ZB 5KVEL 3QQ4A 3MA7A 2X4UB 5DRWB 1QBLH 3B9EA 3VWJD 4XC1H 3OR6B 3C08L 4NKMB 3UMTA 3T0ED 1KUMA 1JP5A 2XKNB 4YQXH 2GJ6E 1GHFH 1YEFL 3U46B 3MV8D 4CU6A 4PYGA 2X5PA 4G7VH 1T03L 5T1KB 4UNVA 2Z31D 2Z8VC 5E99L 2E7MA 5IESH 3ARDD 5IWLC 1H0DB 5C2BH 1NCWL 3VFUB 4TULH 5DMYA 4EUPB 1DL7H 2ERJB 3S6CA 1C8PA 3BW9A 2CLRA 5DVNA 2XZCL 1MI5D 3LEVH 4N8PA 1F6AA 4Y4HC 4H8WL 4OZIA 1FP5A 1BZ9A 2R4RL 3EDJA 2AS5M 1VADA 3BDYL 2OJEB 4DGYH 3HE7A 3BGMA 5J56B 2K1MA 2VZSA 4X4ZA 4PTTB 2PUQT 3BZDA 4WI9A 1MAJA 3WEXB 2CH8A 1AQKL 1FL5A 2N7BA 4RGNB 3QR2A 4XNZB 3JWNC 3K2MC 5I16A 4TNVF 2VN4A 1BVLA 1KIQB 4UV4L 4X5WB 4KMTL 3OKDB 4JM4H 4ZD3L 3C60B 1OGAD 4EN3B 3KPRE 1HI6B 1OP3K 1QRNE 4C54A 1WISA 3FQWB 2CDFB 3FHQA 3S4SA 1S7UB 4WO4D 4EQ2A 4R96A 4PTTA 1A64A 3NIDF 3DRTB 1HDMB 5GGTL 4NN5C 4QHUB 1UH2A 4GAGL 1LD9A 2ENYA 5EO0B 1LO4L 1DQTA 4YQXL 3GSNA 3QIBA 4OCWH 3MSPA 1XFPA 2A0LD 4I18C 2JCCF 1FFRA 3IFLH 1YPZF 2DBJA 5CWSB 1F02I 3S7GA 2IBZY 2FO1A 3QUXD 3HPJB 3BE1L 4QXGL 1JWSB 1YNTB 5IJVA 4PV8B 5C6PB 1XIWC 1P4BL 5E70A 2GT9A 2FL5A 4K23L 1MRDH 5E4EC 4P48A 4APQD 5FGCB 3WIIL 4MA7H 2OR9L 2DYPD 3PWUB 2DLEA 3LS5H 4ONFH 4XVSH 1Q72H 4JO2L 2O5YH 5DEFA 3NGBB 5JQHC 1NANI 4TNVK 3VFOA 3ZSSA 2AK4D 4NNYA 2C3GA 4OLVL 1R3LA 5E2UL 1ED3B 1KJ2H 4Q6IA 5D70H 3FMGL 3HFMH 4LDLB 1HEZA 1NC2A 1P4LB 1SYVA 4OI9A 1QSEB 1L7IL 4JFYA 1XR8A 4BH8A 4JRYA 3X3GH 4GG6B 3O8XA 1MCEA 2IMNA 1IM9B 4J3OC 4LQ1A 3RWHB 4JFFA 3AMKA 1AP2A 3ESVF 4B53A 4GRLA 2OXHA 3ZKXC 4NCC1 3TJHC 5HXMA 5CJQL 1WAAA 3ULUD 2Y4SA 4HWZA 1YMMA 5JW4R 2F15A 1LQSR 4ESKA 5I8CB 4P2RE 1F5WA 4AJ0A 2ADGA 4FQHA 3OG6B 3UCRA 2N4IA 4LQFH 5ISZB 3IFLL 1KEGH 1YN7B 4OFYD 5IFAL 3G5XA 1UWEH 2OCFD 5A2JH 4KKAC 4MLIA 4QNPE 1MFAL 2DIJA 4JFED 5K33A 4EOWL 1U8HA 4JRYD 1A7NH 4Z78B 4KRPC 3DGGA 4K7PL 3R06A 4NO3A 2WUCL 1K5NB 3MV9A 2E6JA 1GL4B 5IMKA 1YECL 3VA6A 1DE4A 2X4PB 5DMIH 1HZHH 2BSTB 3QEQE 1YUHA 1G6RH 4JANA 4R4NC 4HKJA 4PGDA 4PJGB 4OF5A 3Q1SL 3WS6A 3L3GA 2P5EA 5EC2B 1JBJA 3BEWB 4PJDA 2GHWB 2AK1H 4GKNA 4ETYA 5LXGH 1FL6B 3G5ZA 3TO2B 5TPWH 2XA8L 2L4OA 4BSVA 5AG8A 3U2SB 2IAMA 1CGYA 4WW1A 3WL9B 2GY7B 3OBAA 1QBAA 1B0GA 1A5FH 4JRXD 2X9WA 1ZHKA 2NLJA 3FN3A 3OB8A 4BZ2H 4A6YB 5CJQH 2E7LA 3LOWA 3O6FA 2Z31B 3HNSL 3UZQA 1FRGH 2GIYA 2V5TA 1F4YH 1MJ7H 5CLWA 3O2VH 3FN0L 3CD4A 3BH9A 4LQFL 4WNQB 4GRWB 3GSWB 3VWKD 4DOHB 1U8QB 2H26A 2BXYA 1IMHC 5JXAH 1JCKA 5C2BL 4DWHA 3U4AA 1Z5LB 4MA8L 5GISH 1FFOA 3QDMA 4HUKB 4PJHF 4LP5A 4C4KO 3UTTA 2WUCH 4NO3B 5L7XL 1R3KA 4HPYH 4JR9L 1T5WA 2BVYA 1G6RL 1GGYA 1P4IH 4HIIB 4Y8DC 4OKVB 1NBZA 4HX1A 1H5BC 5MI0C 1HHKA 3G04A 2EZ0D 4PGBA 5IW6B 5ESQA 4LGSB 3L3IB 3WLWD 4BUHA 1KJVA 2FJGA 3M45A 2G2RB 1QFPA 2OJZL 4UOW0 2Q8AL 4EZMA 4KVNL 3EYUH 3MRNB 1PAMA 1T20A 1CQYA 1CIDA 2C3VB 1J9CT 4KK6C 3CNKA 5CZKA 4KK5D 3ZE2E 1A14L 5L6YL 2VQ1A 1P7QD 1SBBA 2EKJA 4M5ZL 2AAVA 5DFWH 2VNCA 3CLFL 3X17A 3LHPL 3KPSE 3U1SL 4F15B 1EHNA 3GM0A 4S1SL 2VDKL 3NOIA 2NTSP 4HS3A 1FRGL 5A2IH 1LO4H 4IOIA 5BJTA 2BOCB 3GEWB 3GIVB 1BQLL 4XP5L 3PWPE 3AXLA 3FRPA 4U1NB 1DLFL 3V6ZA 1DZBA 4BJLA 1MF2H 3MJ9L 1VFUA 1HINL 3O9WC 4LRNL 1P4BH 4OGZA 1P1ZA 2BY3A 3JWDC 4K23H 4U6YA 4JEGB 2J4WL 3HZVB 2OR9H 4G9FB 1F13A 1ZWIB 4YJZL 2JB5L 1U2CA 1B4RA 2R1YB 3CC5B 3VE0B 1G6RA 5JW5A 1NDMA 4ALAH 3AREB 1IAMA 4Z8FH 4OCYH 4ODTH 2G75B 4KRPB 4ZS6C 2JJWA 4ZFGH 4MWFB 1U8KB 3P11L 5D2LA 4HWZB 3HRPA 5IHZA 1HHKB 3AUVA 5D70L 4LLYA 2Z8WC 5E2TH 1Q94B 2X42A 3MV7D 1A6VL 5SV3A 3V5KB 2J8UF 3NACL 2O5ZH 3SE4C 4JY6B 3BZ4B 3RPIA 1FAIL 1CDCA 2ZPKL 1NCCH 3V0WH 4PJ9C 3GSOB 1EEUA 3DMMB 4XMPH 4LMQI 5DJAB 1A7QL 5D2NB 3TPUA 4JRWA 4R6UA 3R4DA 2Z31A 1JHLH 3TYFA 1Y0LB 1MJ8L 3LHPH 2DLFH 5EC1B 3DYPA 4FMFA 1P53A 3ZL4H 2EYRB 4S10A 1KOAA 1INQB 2EDBA 4PP2A 4XHJC 3LS4L 3EDKA 2JELL 3X12B 1FZMA 2YRPA 1JPGB 4YHOH 4KUCF 4JZJB 1RUML 1U8PB 3QEUA 1MF2L 2LE9A 1HXYB 5C92A 2J8UE 2VLMD 3LQZB 1OPGH 4I0KA 5CGYD 3CPLB 2P44B 3DURB 3Q6GH 4K3EH 4W6YB 3D0VB 4BUGA 1N2RB 2H1PL 5GS3A 2X89A 1WSST 2GY5A 4WFFD 2JB5H 4V1DE 1ZANH 5ILTH 1XMWA 5DMIL 5CJ8A 2F58L 4OGAC 4PJ7E 2EDEA 3L3DB 2G60H 4I2XE 1DLHA 1FE8L 1LGVA 2EIBA 3MLTB 3HC0A 4YHLH 2PO6D 1I3GH 3NPSB 5FO8A 3STZB 5F88A 4HJJL 1Y6KR 5LXGL 3FO1B 5J1AA 5MEQA 2ZCHL 3MNVB 3JWOC 4XWGL 3W0WA 1N26A 3HNTL 4A2LA 4JAMB 3DX6A 4WY7L 3WV0A 5I1DB 2XA8H 1DBJL 3S3SA 5BW7C 1FAIH 3QDGD 4XCYB 1NCCL 3GSRB 3SO5A 4NO0D 5D7KE 1DN2A 1OAZH 4F7TB 4YBQC 3E8UL 3KLAB 4I3RH 5SWQA 1MJ8H 4BZ2L 4CADB 3CDGA 1UZ8A 4JG1H 2ATKB 4IBLT 5I19H 4EN3C 4HWBL 4X7CC 5FYJE 4R7DA 4PD4J 3CFJA 5AG9A 1BZ7B 3VI4F 3VW3L 3VD3A 5DD6B 1RIVH 1ZEAH 3BIBX 2ZJSL 4KKNA 5GRUH 3LKOB 5CGYC 3FZUD 1MFDL 5E7FA 5D7JB 1GOFA 5TDPA 3SE9L 1H8NA 3MLUL 4LOUD 5J11B 4C83B 3O0RL 4K3EL 4R4ND 3V5HA 4X98A 3U30B 4R2GD 5I73B 5L7XH 5MENA 1Q0XH 4JR9H 4Y4HB 1C5CL 4RAVB 3IB4A 4CU7A 3WUWB 3LN9A 2A6DB 3O6KL 4JFOA 3U9UA 2AJSH 3OHXA 2NMSA 3BUTA 5FO8B 5I71C 1UCBL 3HNTH 1OM3L 2B4CL 4MMZC 1WIPA 3UPRA 4I0PA 1KJ3H 3C8HA 3G08A 1JFQH 1YZZA 4ODBD 5JHDD 1XR9B 1ZA6A 3ZKND 4DAGH 1E27B 5HD8C 4NZTL 1UWGL 2JF1A 4L1HA 2ESVA 4O58H 5KVFH 4EI5A 1F4XH 2PR4H 2X4TB 4X6CA 5IT2H 4GKNB 3MUJA 5DMGC 2VDQL 4DKDC 4UU9A 1HH9B 3G5ZB 4HBQA 1SEQH 1UWXK 1PLGH 4B0MM 1AD0A 2P8LA 5IB3A 5LG1A 5I73C 4FQLL 4OD3L 1P7KA 2B1AH 4JPWL 4L8SC 3IDYC 2UUDK 3CVIH 3S37X 2ZG2A 3QFJE 1GGIH 2VDRL 1SEBB 4JQIL 3K1DA 1HIML 4WI7A 2YPLD 4OD2B 5HHQB 4X8JB 5IV2B 3B4NA 3QNXA 1D6EB 5IGXL 2BRRH 3ZLQC 4EI6A 4F7CA 4WNQA 4Z8FL 4R0LC 2B0SH 1QSFE 4L8DB 2DD8L 4KQ3L 2G5BA 2BK8A 2QQKL 4NFCA 4U6XB 1ZT7B 5K9JH 4YX2H 2EDTA 2B4CH 4KI5E 3NZ8B 5IVXA 5BMFH 1OLLA 2F5AL 1NGPH 1IJ9A 3TO4A 2L7UA 1DVFA 4X7TB 1A3LL 4U0QB 4S1RL 1UB6B 5F1KC 5DSCB 3BQUA 2DLFL 4G8FB 2CSPA 4ZPVB 5T5FH 3MX0A 3ZL4L 3VDBA 3B83A 3VFVA 1SEQL 1QFUL 1IAOA 1HKLH 3UPCA 4MLSA 3SCMC 1EGJL 2BY2A 5BQ7A 3HC0B 4CGTA 5FKAA 4RFOL 4FQCL 1S8DA 1WWAX 4NSKB 4O4YH 2ZUUA 5DT1H 3UO1L 3PWNA 3MR9B 4HUWB 5E2WL 3GI8H 3ZE0F 4YAQA 2MQCA 3Q6GL 2VISB 4RMWA 5EZJA 2UWEA 5B8CA 3QB7C 2NR6C 1J0JA 3W0WE 1BM3L 4HXAL 3MCG1 1UFUA 3KNBA 3LSOB 3ZHKA 1JGUH 5LKNA 3UAJD 4LCUA 3GRWH 3PP4H 1JV5B 3F12B 3JWOH 3OJDA 2XN9A 4PJAE 2WINB 3S9DB 4YHKH 1NEUA 4MAUL 3X3FH 4K7FB 4WFGD 3T3PF 2DJSA 1JMXA 3TF7C 3LMJH 3WJLA 4CMMB 4Z77B 3BFOA 4NZJA 1VB9A 5AZEH 5I76A 3KAAA 3ZTJH 3QXAB 3DSFH 1M71B 3FONB 4F3FA 5I18H 1T0MB 1V3KA 2P47B 3KYNA 4NO5A 1E0OB 1GGBL 3VG9C 3REWA 5D9SA 3DROA 5HYSG 2J88H 3RIAF 3PWPA 2EDQA 1JVKA 3QO1A 3S37H 4HT1L 4YXLL 5DJ2A 3TWCH 4WWKC 3MLPA 2VTFA 4YIQA 3PNWA 1OB1A 3F7PC 5CBEA 4PJ9D 3DO7B 2MCPH 2VDPL 1FIEA 1FVDB 5I75B 5JIPA 1N6QH 1FNAA 3EGSA 3NFPB 3MRHA 4PG9B 1QFHA 4HH9A 5GRZA 3EOAB 4YR6B 5JW4Q 2PW1A 3KYMA 4HGMA 4HXAH 1F3DH 3HB3D 1Z9SA 4WVRA 1KTDA 4PRNA 4FQQA 3BN9D 4IRJC 5D2LE 1PEWA 2A83A 3H9YA 4ODXA 3E1F1 3PP4L 3QUXA 2OM5A 5JMRA 5CBEB 5DFVC 4GXVL 1LO2L 4YHKL 5GPRA 4HIHB 2P46B 4NBZB 4KGJA 4WI4A 3IJHA 2Z35A 3WDIA 3KYOB 4RRPG 1KB5L 1KJ3L 1HDMA 1I9JH 2EXYC 1Z0NA 3BKYL 5IBTH 2OTUB 1LO5B 4PJ5A 4KKCD 3O3BB 2A73B 2YUXA 2VQUA 3FONA 2OL3H 3MNZA 4WUKL 5FUCC 3MRKA 3L9RB 4XCEA 5T3XL 3OXSA 1X5IA 3JV4B 3X13B 3KPNA 1XZ0A 5IB5A 1LP9E 4P5TB 4JO1H 1OGAA 5C86A 1BF8A 4QCIA 5EUKA 2CKBB 3SDDB 3LAFA 1YEKL 2HT3C 1QFWI 4ISVB 4IHOB 4HT1H 4YXLH 1FFPA 3Q6FA 2PKDA 4IEFB 3WS3A 3F58L 3KPPA 1WJ3A 3ZTNH 4LVOB 1IGCH 4RDQF 1SY6H 4RIRB 3S35L 5JOFA 3G6JF 1LEGB 5DRZB 1JZ8A 3QDME 5HHXL 3P77B 5B3JF 2XI9A 4HCRH 4Y16B 5FM4A 4DKFH 1URLA 2F54A 2VSCA 2OZ4H 1BZ7A 4R26L 4KROB 4X6EA 1LE5B 1XGUA 4X83A 1A4KA 2DYPB 4OF8A 3L3HA 3UTSE 3LKQA 3MRMA 1ED3A 3EOBB 3KXFA 4BH8B 1KNOA 5TDOB 2VDLL 3VFRA 4OM1L 3O8XB 2XKNA 2IPTH 1T1ZA 3RVXC 3RAJH 4U6HA 4P5TC 1MNUL 2BNQE 5HHNB 2DQIH 1U95B 3RUGA 3VXMA 4GBXA 3DGCR 3ROOB 2FZ3B 3D48R 3LRHA 4FFVD 3ZDYE 3IDXL 4Q9RL 4EIZC 2E7CA 2O61B 2FJFA 4FN0A 3VH8A 3WSQL 1KJ2B 1QSED 2DQFA 3RY5A 3WUWA 4FZ8L 4WO4A 1T7VA 4L8CA 4JQXC 3U82B 1WWWX 1F4WH 5C0EB 1KNOB 1UM4L 4L3AA 5TDOA 3WD5H 4WHYH 2D7PA 4NQVA 2FIKB 1A0QL 1SJHB 3MUY1 4IRSB 3RNKB 3FT4A 3HR6A 3T08A 1K3IA 5C0BE 1CXHA 2Q76B 5CMAB 4NM8H 4UMGA 1IGCL 3FJTA 1PJ9A 3GSQA 2OTPA 4PG2A 5JW4M 1FVDA 1CICB 4MQ7A 4CVXB 3D39A 3DV6B 3AS1A 4O4YL 4O2FA 5DT1L 5E94B 1ZLVK 2J6EH 4HCRL 3QEHA 4X9BA 3OKDA 2MOVA 3EUUA 3EYOB 4AIXA 3DI2B 1KB5A 4LP4A 1JGVH 3EYFB 1FO0L 4XHQA 5LGJB 4XPGL 3T4AB 1BM3H 4HLZH 5GRJL 4F9PA 1D9KD 1GGCH 3O6MH 4K3JL 5EB9A 2DQGL 3S4SG 1DBKL 1P7KB 3GRWL 3U9PL 4KQ4L 4ZPTA 1CLYH 1N3NB 4G9FD 5F3HA 2GQHA 1QO3B 3IJHB 1HQRB 1K6QL 1FLRH 4EJ1C 1JTOA 2BNRE 3A6OA 3WLBB 4OT1L 3SDCD 4Y7MA 4JCLA 1UKTA 3JVGA 5AZEL 3E6HA 3WSQH 4FFZH 5I1KL 2R15A 1MREH 4HIEA 5BOPA 2NR6D 3AY4C 4WV1C 4QY8A 2QADB 5IG7B 4ODSL 4PJHB 2WUBH 3QUML 1RUPH 3WHXA 1S9YB 3L7FB 5T3ZD 1X6NA 1A0QH 1SJHA 1SVCP 4MXVE 3MYJB 5F9JB 1OF2B 2J12B 4YHZL 5J0BA 5I1AB 3DETC 4RAUA 4JPKL 1MPAH 5DWUL 2AXGB 1U41A 5CP3H 2W38A 1DANU 1VACB 1KPVB 4XXCC 1U92A 1KYOK 5C0CE 3PWVB 3TFKC 5F7DA 4ELKB 4D9RE 4Y4HA 2VITA 1FO0H 5D71L 3ARRA 5ESAA 4PLNC 2E7LC 1CFQA 5AYUH 1DQQB 3MLYH 1T1ZB 1PYWA 4XPFH 5DDHA 4JFEA 1A6TB 4KQ4H 2BFVH 4XNMB 1NGWA 5CUSL 5E6IC 3MRJA 4OGYL 4HGKC 3P4LA 4HMDA 1XH3A 1EK3A 2NY6C 2VDNL 4R97C 4LHUA 1HILB 1JTTA 5KVGH 1LDSA 3IAQA 1KLFA 1VGKB 3L5JA 5JOFB 5IMOA 1TZHA 3VJ6B 1PYWB 3WIFA 1X5HA 1BJ8A 4G80A 4YGAB 3WNNA 5I1DA 4ORZC 1NEZG 4JO1L 5EULV 5EOQL 3QDGB 3HS0A 3P30H 4I5BA 4PLKC 3VG0H 2YUVA 4R0LB 5GGVL 5IB4A 4Y2DB 3IGAB 1OT1A 1QSFD 4LHUG 1QLFB 1PSKL 3ZTNL 1NGXA 3FQXB 1FDLH 5KSBB 3CH1A 2BRQA 2CUHA 3ARWA 4XAKE 3MROA 3PUCA 5FCSH 2ZP0T 4EBQL 5EU4B 3HRZA 5C0IA 3T04D 5L8JB 4LKCB 3CK0H 4LASH 3FOMA 3UBXI 3GMLB 1ACYL 5MP6H 5F89B 1G9ML 1AXTH 3V6FB 2X40A 1MH5A 3P4NB 4JFQA 1I1AD 5JZ7C 1WIUA 3NCCB 2A1WH 4P4KC 1U8JA 1VPOH 3ARED 4UNTA 2MSPA 5DQDL 1GSMA 1CDIA 4OGYH 4IM8A 2AABL 1A6AB 1JHKL 4J1UB 1ZT7A 1JPTH 4KUZL 5KS9F 3MRHB 3NMEA 3KYMB 2EYSA 4A6YL 3QIBD 3TYFB 1M6OA 1XEDA 2XICA 4PJGA 5DJAA 4LHUD 1T2XA 1A6UL 3LRSA 3NZHL 3OHXB 1OP5K 4PJDB 4N0UB 5IOPA 3EO0B 2VZOA 3FRUB 4M8QB 4XWOD 2ADIB 5IHUL 4OCXL 2FR4A 1ZA3A 3LZFL 1JGEB 1FZOB 5IV2A 3CU1A 4N5ED 3KR3H 4QT5B 4BFIB 3NTCH 3RGHA 2X9YA 2AJYH 4IDJH 2HJLA 4JFDE 4OF0A 4FTVB 3D0LB 1KTKE 3ARYA 2DS4A 1IGJA 1IM3A 4N0CD 4HULB 1AJ7L 4FXGA 1DBMH 4RGND 3CZFA 5GS1A 2EDRA 5JORB 1NAML 1EZVY 1EFXA 1YPZB 4KK8C 1DQML 1FC2D 1U58A 3AS0A 4LEXL 4P4RB 4YZFE 5D2NE 2BVOA 1MCCA 3U6RA 4TOYH 1FYTE 4PD4K 4QRRE 5B8CC 2P7TA 1CE6B 1E4KA 5I74C 3BPNB 2XWJA 5C7XH 1FC1A 2Z8RA 3EJYC 1GZQA 3QQ9C 3S5LB 2D31A 4LPVA 3VGAB 1JRHH 2EDHA 4JB9L 5HDBE 3RZCA 3L5IA 1I85A 2BOBB 2H3NA 3IFOB 1TVHB 4XWOC 2D7OA 2P5WA 5KVMC 4I2XA 3BPOB 5GRJH 3P3YA 4N8VB 1GGCL 3QUYA 3MTRA 3F5WA 1A22B 2AJZA 2D7TH 5T1LB 5C07E 2XN9B 2DM7A 4GUPB 1T1XA 5CJXA 3R8BB 4H26A 4WU7A 2IALA 4IOIB 2DBLH 1YY8A 2W1NA 4CAGA 5E95B 3AXLB 3D85A 1RZFL 4A6YH 4LVHB 3AREC 1S7WA 1OAKL 2PO6A 4J4PC 4YK4C 3N06B 5ICXB 3NCJH 5KSVB 3BWAA 4I3GA 3SDCA 3INUL 4TRPH 2IQAB 2CLVB 4RBPH 5I1KH 1P2CA 4DVBA 3DVFA 3QCTL 1I8IB 2VZTA 2VWEC 4UT7L 1ZLUH 2CLZA 4M7ZC 1JZ6A 2HFTA 3Q2CA 2H6PA 3DVNA 3K2UL 4M7KL 4YXKH 2DF3A 2FEDD 3IGAA 4XVTH 4NN6B 4UTAH 1S9VA 1KN4L 5JQ6H 3QH3B 1HSAB 3ZTJG 4Z0BH 4P5TD 2VXVH 3H0TA 4CL7A 2A6JB 1IAII 4X7TA 3CFCH 5D7JA 4L8BB 2JJTC 43CAA 1T5XB 1AH1A 3TO4B 3NFPA 4PG9A 3KJ4B 4ZOBA 1PVHA 5F9WB 5C08B 1HH6A 4XVUC 2VKWA 1NCAL 2DQTL 4MXWL 4NM4H 5DS8B 1QBMH 3CDCA 5I17A 4JB9H 4YDJB 1KPRA 3A6CH 2HKFH 2XKUA 4NUJB 4QRTB 5HI3D 2BOBA 1NGYA 2FHCA 4CW1A 5I1JL 1FFOB 5CZVH 3UYRH 3WN5C 1FNHA 4PGCB 4R90H 1T3FA 1FGVH 2W65B 4HKZB 1RZ7L 3H9HA 3ARGB 4E5XB 1FNGA 2PETA 1RIHL 4XPFL 4RNRA 2EXWC 2VL4A 2P1YA 4TVPH 1L0YA 2I60H 3EYFA 5LGJA 2EEDA 4DZ8A 5IEKB 2VDOL 1CD9B 1JPFA 3PDGA 1RPQA 1ODAA 25C8H 4AENA 2ARJQ 4NN7B 1BWWA 1FL3B 4BQBA 1AD0B 4GMSL 4P2YA 5DJZB 1PW3A 1CZ8H 1EBAA 4YXKL 1QYGH 1OTTC 4UI2A 5MENE 3PGDB 4PRNB 4UTAL 2KKQA 4G6JL 2M1KA 3MMEB 2Q8BH 4U7SA 5DK3A 4UZGA 1CFNB 3CFCL 2AEQL 5JMOC 2PN5A 1QFOA 3I75B 4ZOCA 4HUUB 2BJMH 4XTRC 5DTFA 3VDAA 1YN6B 3QJHB 4GG8A 4OCNC 3RWGB 2APVA 1U8NB 3WXVL 4K9EC 4Q6IC 3TNNB 3HCVB 5DJ2B 4GBXD 1CICD 5JPNA 3D85D 1FIGL 3U0PB 2NYYD 4WDIA 2FX8L 5KVDH 2AVGA 3SDXA 5DGQA 2OZ4A 4X0KA 5FIEA 2EDLA 3UX9B 3B9AA 4TQEH 4EXPX 3N85L 4JKWA 3UC0L 3QUYD 5DHVB 3PHSA 3C09C 3ARFA 1VPOL 2IBBA 3E6FB 1E4XL 4NQEA 4K94C 1KGCE 2OTWA 5GGQL 3GB7B 1BBJB 1KBGH 2FGWL 5CEYB 4W68A 4NWUL 3EYVA 2VIRA 3Q3GA 4GW1A 1DQJB 5DI8A 3CFKB 1CTNA 3MV7A 5AWNH 1X3DA 3RVTC 3W9EB 2V2WB 4C56A 3GZKA 25C8L 4Z18A 2XWJB 2P4AB 5EZOH 4GG6A 4OLZL 5EU5B 5ACZB 1ZE3C 1U8LA 1NGWB 4KJQC 1JGDA 4QHNA 2AKRA 3H0TB 3CFEB 1H15A 4CN1A 1A1OB 1PFCA 1I3VA 3TVMB 2WQ8A 1CDYA 4WEMB 4YC2C 4AH2A 1ZWIA 3WIHA 4U7MA 1XZ0B 3MRDA 1MLBA 2VISA 3ARVA 4YFLF 5EZJB 3BT2H 5B3JE 1PDKA 3VWKA 1MFEL 4UUJB 4TTGA 4Z5RA 3UAJC 2GJ6A 3GSUB 3OKEA 5BRZB 1P84K 5C3LD 4KUCD 4K2UL 4AEIH 2W9EH 2O61A 2YRLA 4B7IA 3VFTB 5GGRY 5C09A 3T3PE 2D9CA 5HHVH 5IF0B 3HG1B 3I3BA 4OFVA 5EFIB 4YH6A 2UYLB 5EORL 4J7RA 3DV4A 1QTYT 4JQVA 2LU7A 3D0VA 4XVJL 2D4DA 4PY7B 3CXHK 2CDGA 2IGFH 2J6EA 3GMMA 3IDJB 5I1IL 4B50A 1A7RL 2QSVA 4NJAL 2NY2C 1AD9A 3FO0H 3QWRA 2R8SL 1D5IH 4J3UA 4NWTL 2FGWH 5ADPL 2EO1A 1T66C 4N5UA 3O3UN 3BP4A 4G6ML 1RMFL 3MPCA 4PJ9A 3JTTB 5EBMA 4MNQE 3INUH 5EC1A 5HGBA 3F6LA 5LJYH 2Y7QB 3N50A 1WBZB 3RA7H 1RZ8B 3HAEH 4CVZA 1JNHA 1MAMH 3QEUB 3UTSA 1CFSA 3U0WL 3ZYJA 1AQDA 4HMEA 4ONHA 4K94L 1NC4B 4PGZA 4M7ZB 1KN4H 5JQ6L 2WBJB 5DRXA 2C26A 2DQUL 5JOPE 1CWVA 1NSNH 4Y4KB 3KPSB 4U1HB 1DVFD 4U1IA 5D96C 2FSEB 3RRQA 3HPLB 1T7WA 3STLB 1AHWB 4JY5L 4P5MA 4MXVF 4OJFH 2LQRA 1H3GA 2HWZL 4W4OC 5F7EL 2W60B 1LEIB 1S7TA 1BOGB 2VLJD 3UYRL 4NN7C 2FD6H 2FDBP 3K81A 4JHZA 1P9MA 2R69H 1TVDA 4PJIB 1FGVL 5DD3L 4HMCA 1KLUA 1TJHH 4WW1B 3WL9A 3MRJB 4U3CA 4MD5A 1IQDA 1KIPB 3SO3C 3B2UC 1AD9B 2QKIB 4HUNB 4PJ7A 1ZLWK 5B39B 4L8SA 1F90H 1M05A 5DMGD 2XZCH 1NBYA 1RMFH 1VEOA 2O5XH 5D6DC 4H8WH 1DBBL 4JN2B 3S34L 2NNAB 3LV3B 3K3QA 1MIEL 1MAML 3BDYH 1TCRA 2VQ1B 2RHEA 4AM0A 4FQ2H 4FA8A 2PO6B 1HHHA 1RVFL 4L4VB 5LCVL 2JJTA 4OTXL 1QRNB 1AR1C 5TF0A 5TDNB 1OTUD 2YS4A 4X6EB 5C0AD 3IXTB 4TUJB 4NZUL 4QY8B 3VRIB 5AEAA 4KMTH 2BVTA 1UB6A 5DSCA 1GRWA 4I9WE 5KW9H 4BK5A 1X5GA 4PRPD 3GBLA 2VXQH 4JY5H 3O3EB 3D2UD 3IXAB 3PXHA 1A4KB 4Q2ZB 1JIBA 4JDTL 3BEVB 4MNHB 2ED9A 4E41B 1PZUB 4ZO8A 2DDQH 5GZND 1OW0C 4P4KB 3H8NA 3BHBB 4HBCH 3NIDE 2BY0A 1BQHG 2FJGB 1N8ZA 2J1KA 3H3BC 2IANA 4JDZA 1K4CA 1AI1H 4JFDD 4JZNB 4OCWL 3JV5A 5DD0L 3FZUC 4JPIA 4MDJA 2XWBB 4XB8A 2KBGA 3TESA 4KAQL 4XT1C 3SDYL 2F9BT 1D5BA 3W39A 2VLKB 3O45B 1BVLB 3CAFA 3AVEA 4NT6A 1I4FB 3R1GH 1FZOA 3Q5TA 3UJTH 4PJAA 5HHOE 4M5YH 3C5SB 3GKZA 1JNHB 5JLZA 1TJIL 3HC4H 5TJWK 3RDTB 4Y4HD 2HKHL 4U1LB 4QT5A 1RULL 5FHAH 5FA3A 5CEXB 1E6OL 2PW1B 4NUGH 2FJHB 1WZ1L 4H0GA 5C0NC 4LAQH 3VGAC 1RVFH 1J87A 4H1LH 4NHCL 4TYUA 4AL8L 2NY1D 3GI9L 3EIFA 2ADFL 3D69B 5IMLB 1CK0L 5F7NC 2HVKB 4XC3H 3OAZH 4U1LA 2ZG1A 5IQ7L 4PV8A 4GW5A 4FFYL 1T1YB 4P2RB 5CEXA 5F3BB 5AAWA 2W9EL 4PB9L 4PJIE 4DCQA 5C0BB 3BDXA 3FQXA 4G6AD 4K71B 4GG6F 2K3TA 4HBCL 4XC1L 4L9LC 1K85A 1ZVSB 2YWYA 4CDHA 4TPRH 2DWEB 3CH1B 2R2CA 3PIQB 1DQLL 1QEWA 4Y1AA 3GSOA 5BV7L 3MRCB 5EU4A 2YD8A 5E99H 3VD9A 2YZ1A 2XQBL 5CIPA 3FO0L 4P2OC 4H1LB 3O2WL 4OZFB 4L9LA 3ZKSD 4NWTH 3MREA 3ZZ1A 5ADPH 3Q5YA 1R3HB 3C5JB 3MRLA 4RFEA 3VFSA 1HSBB 3JWDH 3QO0A 1J0YA 4Y16A 4KH2A 1NFDA 2I9LB 4P9HC 4FQXB 2HKHH 1OAUL 3RA7L 2HJKB 1F8TH 4AEEA 5E1AA 4G42A 5FGSA 4OLUH 1WLHA 5D93B 5C0DA 5E7BA 3CDGB 1D6VH 2V7HB 4HUXB 1AR2A 43C9B 3U4EA 3MR9A 1NSNL 4HUWA 3GI9H 3FFCA 1UACH 3X13A 1ZLUK 1CK0H 1W8NA 3RGVB 5D1QA 1JN6B 1NCNA 2DQEH 3RL2B 1UVQA 1J1XH 2VZ3A 2HTKD 5CJ5A 3KPRB 2IAMC 4UT6L 4FTVE 2YA0A 5C0AE 5DFVD 1T1WB 1FYTA 5HI4C 3BESR 2UY7A 3HTLX 3SO3B 2P8PB 5K59F 3DX6B 3HE6A 5ITBH 4MNGA 3VWJA 3TN0B 3RVWC 1KEMH 3WNKA 1RUKH 5JW3L 3FOLB 2B5IB 5EZIH 1I1YB 4OM0L 4JDVB 4UUJA 2XQBH 1R5IA 1EHXA 5IW1A 2J3SA 4R2GB 1RFDH 4LDEB 4RFNB 3RJQB 4OGXL 5L88L 5M94B 4L4TD 3G5VA 1YEIL 1RJZA 2O93L 3P40A 3HKFA 1C16A 4BSVB 5TQ0H 4XBPB 1TENA 1BIHA 3PWLA 1MCSA 4QRQB 3MLRL 2NXZB 5C8JA 2G5BB 4POZC 4Q58C 1JWMA 1NCBH 4QRPA 3ZDZF 4IIQA 3DUHA 2HT4C 2A9NL 2NY5H 1P4IL 1ZSDA 4PJDE 5F1OB 5FOJA 1I9RL 3VRJB 1UM5L 1UADC 3KYAA 5DJCA 4QWWC 5E2UH 5IMKB 1UEYA 1HOCB 5IP4A 1G7QB 4WEBH 5I0ZA 1N3NA 1QUNA 4YHYC 3OAYH 3D5OF 3PHQA 4UQ2B 4NPYB 1BD2E 4DZ8B 5KW9L 4S0TD 3TA3D 4EN3D 5T3ZH 5HVHC 3OB0K 3CH8A 4P2QE 5DJ0B 3D39E 2ICEA 3AY4A 3V95A 1H3PH 2YA2A 4RMQA 3ULUE 2QQLL 3FL7A 2E8YA 5CD5C 1I8MA 1YNLH 3BI9X 2GJZB 3MUZ1 2RR3A 2X4RA 2P42B 2DLGA 3TBWA 5DUPH 1RUQL 4PJXB 2GSGA 3U36B 4X5XA 1LO3H 5EBLB 3MLWL 1BJ1J 2DQHH 3IU4L 3KJ6H 3IJSB 3NCMA 5F7FA 4KV5E 4GBXC 4FZEH 4NKDB 3VXUD 4G5ZH 5TQ0L 1RUAH 2Z93B 1D5MB 2BNQD 3RUGB 3VXMB 1U9KA 4M1DL 4MA3B 3WHE0 3N1FC 1IGYB 2CDEA 1J11A 5SX5K 4KU1A 1MEXH 4UTBL 1MFCL 1SYSB 4IMKA 5AAMA 4PRHA 4R4FH 4PGDB 1MLBB 5FO7A 3IETB 2CPCA 4NQXB 3H9SA 3P11H 4XCNB 4G8FA 2Z91A 4QTHB 1NBYB 4OZGA 4N5EC 4CUCA 2XKSA 1SBSH 1KCKA 3PGCB 4G8EB 2EE2A 3QDMD 4KVCH 4P2QA 1NFDF 3TA3B 4R7NB 4CN6A 4IRSC 4HDIA 4PREA 4GUPA 5F9AC 3KXFB 4PJFE 3SJVA 4D0BB 4U1SB 1JHLL 3I2CL 4OIBA 2QEJA 5EU3A 4DW2L 1EZVX 5IIEA 3D18A 3RNQA 1YYLH 1G7LB 1MJ7L 4M1CC 3T77A 1ADQL 3MQIA 1CBVL 1XF2A 5DUPL 4GRLD 4JRXA 1A9EB 3AAZB 2XOTA 3BE1H 5ESAB 2J8UB 2JJSA 5I75C 1OD7A 4M7LH 3O4OC 3DVGB 1RZGB 4Z7VB 1XR8B 1I1AA 1BQUA 5KANI 3TBVA 2XWTB 1ORSB 4U3XA 3VXPB 4WWKB 3IRZA 4Q0XH 4CVZB 2FB4L 5IMMB 3QDAA 4DJMA 5DF0A 4UTBH 5IQ9A 2RFXB 2PTTA 1F3JB 3H7BB 4U1KB 2DQCH 4PRBB 3GMQB 4CJ1A 3W82A 2P8MB 3OKMB 3JSSA 4LSTH 4PJ8C 5FK9B 5TFSH 2PYED 5IJKA 3DRQA 1NJ9B 4H88H 4XGZA 1IL1A 1PZ5A 1UACL 2ZCLH 4HS8H 1I7ZA 3EJZD 4M1CD 2VAAB 2UWEE 1U8PA 4KRNA 1S7VB 1FJ1B 5F1SA 5HHME 5EOCH 2EC8A 1G0YR 4MCYA 4KPHH 3OKYA 1DUYB 4M5ZH 5KVEH 3BDBA 4PJFB 4PRPB 2PYEA 4X7EC 3CPLA 3TZVA 5IMLA 1E4WL 3V6BR 3QRFM 1BZQK 4WHYG 2BHZA 4X7DC 3QUZB 5KN5B 5ALBL 5KJRH 1T6VN 3F7QA 2GJ6B 1ADQH 1CG9B 4LKCA 5IHLB 3BN3B 1RIVL 1ZEAL 3SJVD 3WLWC 3IKCB 3C9NA 5GRUL 2YD7A 3F7YB 4OGXH 5GS2D 2V9QA 3AROA 1UH3A 3ILQC 4JHBA 4ZAKD 3HPLA 1XGTB 2VR9A 4FXKA 3N9GL 4G9DB 3VXUA 5HYQB 3QO1B 3BP7B 4WV1A 3EFFB 4CU8A 4IRJB 1Q9OA 1LDPH 3O4LE 1NCBL 1U8HB 4FP8H 3ZO0A 2BSRB 2HG5A 1G6RB 2YWZA 4DKAA 5JW5B 4AZ8A 3FAXA 3U7WH 1V3LA 3QXDB 1BQHB 3QUYC 5DK2B 1TQCB 3RDTD 2BNRA 1EVUA 2ICWJ 4ONOA 1X5KA 5TFSL 3MGOA 5F6HI 1X44A 1ADQA 1JWUA 4M6OH 4NO0A 3ECBB 1A02N 4XH2B 4LSRH 3RX8A 4JM4L 2FIRT 3VGDA 4D0BA 1REIA 2NY1B 5FKPB 1UT9A 4I0PC 4UOW1 4KHTH 1VFAA 2DICA 3SQBA 4K7PY 4XTRD 1K8DA 4AIOA 1J0HA 1QSEA 5FM5M 1E4WH 2VUYA 4ZO9A 4FHBD 2H6PB 3DVNB 3RWFB 1PLGL 3RI5F 5J6HA 1ZT1A 3QNYA 3RWCA 3BPOC 4X6DA 2FATL 3QG6A 1KG0A 1KULA 3SDAD 3VFRB 4PB0L 5E9DE 4NNPH 4ZAKC 5ESVA 3W11C 4YHNB 4MXQC 4OCRH 2XG4A 2C3VA 3O3AB 4ELME 1E6JH 5EPMB 5FGCE 5A3IC 3ARBB 1WBYB 4X99A 4AH2B 4ONGH 4XHJD 5L8KB 1Q72L 4JO2H 4JFEE 4RMVA 3P0VL 4I0CC 2HG5B 5E00B 4PJ7B 5ICYB 5GXBB 2YD1A 2OI9B 2VRAA 2RGSA 4HFUH 4KJPC 3EZJB 2XG5A 4KQ3H 4OV5A 1KJ2L 4RX4D 1X6LA 4KJYB 4Y5XB 4Z7WF 4FTVA 4XMLL 3SDXF 3VFGH 1R24A 5J13C 4YNYA 3EYUL 4HH8A 1SBSL 3B9KA 4R96B 3KLDA 3VXQA 3QQNA 4O00A 3EHBC 1NGPL 2EICA 2V9TA 2ZNWA 3OF6A 5C09E 4AT6A 1IE5A 1W2KT 4MJ6A 4ZFZA 2BERA 3GDBA 2X4OB 3ARUA 3QPXL 5FGBC 5C0AB 4R9HA 1QSEE 3EDEA 2EYSB 3PDDA 4KWUA 4R3SB 5EOTB 4LSUL 3A6BH 3CU7A 3NFNB 1AKJB 3RVUD 3BP4B 5BS0D 3EO0A 3VW3H 2CUIA 3UTZB 5I6XB 5IFJA 4MWFA 1CS6A 1RIUL 1A47A 5HGBB 4ZG1A 3O11B 2NY3B 5EO9A 1QR1B 5EBMB 4JKLA 2VXTL 3O9WD 1AGDA 4M7LL 5ICZA 2XZQH 3MLUH 2QTEA 3WFHB 2EIZA 4WTZA 1KENH 4NO2A 5CJOH 4RGOL 1MUJB 3BIKA 1OSZA 4LSSL 1NL0H 1P2CB 4JFOB 4PUBL 1VFOA 3DOSA 2HTLD 5BO1L 3C5SA 5EIIB 3O2DH 4KHXH 2DQCL 3LPFA 4YEEA 1JPGA 3QUXC 4AENB 2E6PA 3G08B 4I0PB 1AGFB 3PJSB 3VFGL 1J18A 3FFDA 4KK9C 3O3DA 5LAXA 3FB8B 4ZXBA 5T1LA 1YC8A 5GQBA 4PJCA 3ORJA 4N8VA 1TLKA 4O58L 4WU7B 3SQOH 1B6DA 1OGAE 2GCYB 3LKRA 1A2YB 1IARB 2Q7NA 2X4OA 2HFGL 5J9PA 4H20H 4WO4C 1QHOA 2EYTA 3W5MA 1P69B 4XZUA 4MVBC 5IVXB 1T66D 2ILLA 3FHAA 4NQTA 1X5XA 3DUUB 3FO2B 4G42B 3PL6D 4BZ1L 2EKSB 3TWCL 3OKKA 3O2VL 1D5XA 3CSGA 5DJ6B 1GJIA 1HYSC 2VE6A 4GRWE 3O2DA 4ZTOH 1GPOH 3VXRA 4XI5C 4UIKL 4PGEA 1UKQA 2VXTH 2QLVB 4RIRA 5CP7A 3RWDA 5F71A 4J3VA 1GGIL 3N9GH 4PV9B 5C0GB 2J5LC 4JFFB 4RGOH 3EDFA 2OBGA 3ZYOA 5ILTL 1PKOA 5HHOB 1BBJA 1G9NH 3U30C 5FGRA 4NP4H 1R5VA 2IAND 4DGVH 2XXCB 1RZIB 3FB5A 4RA0C 3O6FD 2ZKHL 3G6JB 4G8GE 5MERA 4YGVB 1I3GL 3QUMB 1LO2H 5D7JC 2VITB 4M6ML 5DXWA 4BSJA 5MEOA 3S36X 2BC4B 5J1TC 1EO8H 3LKNB 3OGCA 2NLJB 5BMFL 3SJVE 4MJIB 4FFVC 4EDXA 3SKMB 3T0EC 2J2ZA 2W0FA 3VWJC 5K59E 3SHSA 3IKKA 4PRIA 4PJ8B 1QOKA 4JLRB 1YY9C 1FGNL 3GK8H 5FUCE 2GKIA 5JO5A 4Y19D 3RTQB 3EOAA 4NHUA 4FABH 3O4LD 3NIFF 1GIGL 2A74B 3TBYB 1RHHA 4K3DH 3KPTA 3BEWA 5HHPB 1FL6A 2AK4A 3UPAA 5D96B 4G8GD 3S98A 1TVHA 2HRPL 3ZDYF 4Z7OE 3T0WA 4QTIH 1AO7B 2VLLA 1L9NA 1AXSA 3GHBL 5FAAA 1U3HD 4DK6A 4IIQC 2ZOLA 4EVNB 3IFPA 4DKFL 3PDOA 4LNRB 3MO1B 3OXRB 4PJGF 1CICC 2UUDH 3MACL 5E8OB 5KS9A 3VFNB 3HMXH 1G9NL 1IAIM 1JUFB 3ULUC 4HGWB 4F15C 1JI2A 1U8KA 3DUSA 1JGEA 3MBEC 3O6KH 2HFEB 2VDLH 1C08A 3IF1B 4PFEA 1FNGB 1A3RH 1MHPL 4LLYB 4UU9B 4ZODA 3VXSD 4S1QH 4N8CL 1XF3A 2V9RA 5D1XB 4Z77A 4JY6A 3RPIB 5E2TL 1WBXB 2XFXA 1B4JH 3D3VA 3RIAK 1FCGA 3RWHA 4TNWK 5ALCL 4X4YA 4OCMC 4ELMA 4FG6C 2Y23A 1AGBA 3ME0A 3FB7A 5EZLB 5F1IB 1EERB 3SKMA 3L6FB 1B6UA 43CAB 5E03A 4KTDL 3RWJB 5B38B 4I4WB 3CXHJ 3WD5L 2NX5B 3UPRB 2YK1L 4PYHA 2ARJB 3H42L 4NQDB 5JHLH 2QR0B 1Q9KA 1MCPH 2J88L 3DIFB 4JM2F 5DQJB 4Y5YB 1JYNA 3CX5J 5F1NB 3GIZL 3RVVC 4NZRL 2Y06H 3BD3A 5CKGA 5C0ND 4XRCA 3KLHC 5DHYA 1EPFA 4QTIL 3GSXA 2YN5A 3IU3A 1S7RB 3IDUA 3I6KB 1UYWH 3VI4E 4QYOA 5ID0B 3RWGA 3MV9B 4GBXB 3ROOA 3SGDI 2XWTA 5JDJA 1JNJA 1CXEA 3D85B 2QR0A 2X4PA 3EOYG 3B5TA 4FNLL 4QXTA 4FQPA 4F9LA 4N0FA 3QZWB 3V0VB 5MEND 4OZFH 5EH1A 4LVOC 1SVZA 1NL0L 3L5WB 4LBEA 3BQUB 4NKDA 3VXNA 1CD8A 5E2VH 1GZPB 1T7XA 3MV11 3IJSA 1X5FA 5TE7H 4G6AC 3BZFB 3UTSD 5JR1L 1G7MB 1CT8B 5BO1H 5IIEB 3WBDA 2GFBA 3UTQA 4ORGA 4XPHL 1MHPH 2OQJA 3MRQA 4DFHA 2DD8H 4XCCH 4N8CH 3M1BB 2QQKH 1J0KA 3VFWB 4UAOC 3KPLA 1A7PH 3EYVB 4FFZL 5CHNA 1Y0LA 1IC5L 5E08H 4U1JA 3U0TA 1N7ML 2EE9A 4RDQG 4DN4L 1MVFA 5K9QI 2OL3L 4WUKH 1OGTB 3SQOL 3PWJB 5D1XC 1NDGA 3JV4A 3NVQA 4ENED 5TDNA 1ZS8A 3QIWA 4OLXL 1NCDL 1AO7E 3BH8B 2F54D 2CKBA 2WLZA 3WO4B 1PX4A 5LQBL 3ULVE 1JYWA 4IDLA 5I19L 3F7YA 1IAIH 4LPYA 5L2JA 1HHGA 2ATPB 1AXSB 3D39D 3F58H 3IDNB 5C0FA 9CGTA 1MFBL 2Y7QA 4MJ5A 4GRMA 1NKOA 2YC1A 2ZOLB 5D6CA 2ITDB 4LLAA 1IFHL 3KWWB 1FN4B 5DJ8A 4QRQA 5E6YA 4UBDC 3OJVC 3PP3H 1JHTA 4O2EB 4QRPB 1K3ZA 4R2GC 2PYFB 4BH7B 4FNLH 1IQWH 3C6LB 3SGDH 4L4TA 3WS6C 1NUDA 2CRIA 5GSRB 2JJUA 5CP3A 5F3BA 5BVPH 4TTDD 4JO4H 3HAEA 3BPCA 5E8DH 1T4KA 5D6CB 3RTQA 4HZAA 3WHXB 3EZ8A 1AGDB 3IFNL 1WFTA 1V7NH 3JWOL 1FLTX 3HA0A 4CNIB 2AJUH 4PJAB 1FZKB 5J12B 1KB9K 4JQXA 4OCSH 4BH7A 1BOGA 3TT3L 3QIUB 15C8L 3X3FL 5BS0A 5KVGL 2VLJE 3DO7A 1F3JA 3H7BA 4GAJL 3T0EB 1CE1H 3QI9C 1K2DA 1K8DB 2XQYG 3DSFL 1OAYH 1TCMA 3R8QA 3RTQD 3W5NA 3NCFB 2RAMA 1QLRB 2OSLA 5C07D 4X5WA 3QXTA 2G5RA 2JB6B 3BZ4A 4V2BA 3KLHD 4EN3A 4FABL 2I25N 2CKBL 3E3QC 3AM8C 5K9KB 4E41A 1DEEA 3O9WA 4PRDB 1AO7D 1FNSH 2IG2H 4Z7UF 2VDML 3BSZL 4NM8L 3D39B 3DV6A 4FQJH 5GS1C 4ODWB 1FDLL 2C1PA 5FO9A 3O81A 1TZIA 4UILH 2B1AL 4TSAL 4Y5VC 5E4EB 5D7SL 4HPOH 4EBQH 4X99B 1FNEA 2NXYB 5A16B 4N0FB 5T5NG 5D8JH 3HUJF 6FABL 4TUOA 1VGKA 3BYTA 3MUGB 2EKSA 4LBEB 5I1LA 3BD4A 1DP0A 1AXTL 3NCEB 1SQ2N 2VKXA 3UP1A 4YLQT 2BNQB 3KLAA 5DGRA 5C0CD 3WFEL 4L9LB 1QVOA 3H9SE 2XTLA 3PWNB 3IXTA 4TUJA 3RBSA 1B0RB 3R0MA 2LU4A 3PE9A 1EXUA 1V7NL 3L3KB 1I75A 5TQ2L 2MCG1 3W0WD 4OCSL 1WFNA 4OLEA 1DDHB 1I9EA 4X6DB 1I1YA 2V17H 4NQSB 3RWIA 4PLKD 3QQ4B 3K46A 1F6FB 4E42A 1RD6A 4QXUH 3BKYH 5IBTL 2Z4QB 3SKOA 2W0LA 1I8KA 4ZSOA 4YHPA 3ZDXF 3PABA 5DEZA 5IHUH 4FQIH 3L3JB 3T4YA 2XACC 5TGBB 1EHAA 3H42H 4ZPVA 1LO0L 2CKBH 2HH0L 5FCUL 4L4VD 4YPGA 5IK3B 1S9XA 2XRAH 4XVUD 1DBML 4JVWA 5J8OA 1I7UA 5FM5O 4HX1B 2DMKA 2B20A 1X4XA 5FHBH 2GT9B 2ITDA 5ESQB 1Y18A 3O11A 4JM2A 1KELH 5A3ID 1JMZA 1NAMB 1SHMA 3B2VH 1TNNA 4PJEE 2ZSVB 4LPTA 4LSVH 4MAYD 5EWIH 2JTDA 2OP4H 4OQTA 3SY0A 5ACLA 3GJFA 5E2WH 5H37G 3HLAA 1ZMYA 4L5FH 4MX7A 4GKOA 2MWCA 3O41A 5I16B 1U93B 2A9ML 1OGTA 3WNOA 4XX1E 4E5XA 1J0ZA 3GBNH 3NABH 1NMAL 1CFSB 2YD5A 3BJLA 1ZA3B 4XP6L 2HLFC 1M7IA 2FX7L 2QSTA 3O3DB 5LAXB 5HHOD 3TH2T 1FNLA 2VLRE 1FCCA 1XIWB 1N5AB 4M48L 1AGFA 1XCQB 2ZUTA 3SBWA 1L4IA 2R0ZL 4BQ8A 4Z7NE 2PYEB 1CLZL 4L4VE 4NRXB 4DN4H 3MC0A 1DFBH 3NH7L 2DOCA 2R1YA 1F4WL 4O5LH 4HD9A 3L3JA 3ETBF 3K2UH 1MUJA 4L3EE 3FQUA 5I15H 12E8H 4IMKC 3SCMD 4B5EA 3VXTA 1NGQL 1OLZA 1JF6A 3BPCB 1I7RB 3KYKL 3SGEI 3S37L 1T0NA 4DUWA 3KPOA 1YNKH 1QFWL 4NBXB 1ONQB 3MROB 1PSKH 4F58H 5DVLA 1MHEA 4JFFE 1H0DA 3MODH 4N0CC 1B9ZA 5JA9A 3VGEA 2J6EL 4ZO6A 2VDPH 3VFOB 5E5MB 4MDIA 3CK0L 5GS0H 4ZAKB 5IROA 3ZHLA 1KB9J 2J7LA 2H32A 5CZVL 3MRIB 2A6DA 3HUJE 2A9MH 4YBLB 1B0RA 5D4QA 3CXDL 4GAYB 4PJHA 2NY6B 1QQDA 3S96B 4HIJB 2AJUL 5FKPA 1YEEL 1ES0B 4NYLA 4MJIE 1YYML 2W60A 2ADJA 4WIQA 2L7JA 2BNRD 5SWQB 5CIPH 1CLZH 2F8VA 1WV7T 4PGBB 2DN7A 3C5JA 1I1AC 1HQRA 5D1XD 2YPVL 4UB0L 4Y88A 1TFHA 1WZMA 4QRUB 3UTQB 4AMKH 5JXEC 4ELMF 1BD2D 4OZGB 2WUBL 5I15L 1HE7A 3LSOA 4HIXL 2IAMD 3FO1A 5J1AB 1UG9A 2IEPA 3Q6FB 1UENA 3FN9A 2GK2A 3CZFB 5GS1B 2AEQH 5KSAD 3MNVA 1QFWH 2OK0L 3IFPB 4JJ5A 2NXYD 1SY6L 4TOYL 5DZNA 1WTGT 3OL2A 1A6ZA 4LIQH 1A3QA 4IJ3C 4PJCF 4D8PB 2CXGA 5HD8D 1KCUL 5DK0A 4S0SD 3CCHB 2FL5B 8FABA 1JGLL 4TSBH 3GGWA 3QDJB 2MTPA 4FRWA 3MV9D 4Z7OF 5EBGA 1EV2E 1U6AH 3B9DA 3QI9B 2CMRL 3V8CA 3WFEH 3LKPA 4TQEL 4U1MA 2E3VA 5I1CL 5CUSH 3KWWA 2NY6D 5TQ2H 2ESVB 5H2BB 5HYEA 4GS7C 4L29B 3RAJL 3M8OH 3REVA 1NANH 2XY2A 2PYFA 4J3XA 1QR4A 1OAKH 3EDDA 3DMMC 5GSRA 5HGHA 2IBZX 1J05A 1HKFA 3QAZB 4LLMA 3KS0H 4O02L 2ZNXA 4M8VA 2KZWA 4OLZH 3ES6A 4J8RB 4F7MB 2ZUVA 4M7KH 5D1QB 2WWMC 4K8RL 1EEYA 5FCUH 2PF6A 4U6TA 2VUOA 3O45A 4LU5H 1A6WL 4IOSD 1RZJH 4M62H 3KHOA 3SPVB 2ZUYA 2OJEA 4H25A 3DROB 5TF1L 5ISZA 3MXWL 5I17B 5A2KH 5TH2B 5I8CA 4WHDA 2DQTH 4NQCB 4AEIL 2AK4B 3E2HB 4OLWL 2VJXA 4P46B 3O4OB 3NA9L 2HKFL 1KPRB 3K8KA 3VGHA 3L5WA 3MRGB 1DEEB 1CT8A 4PRDA 4LCCB 2VABA 4RQQA 4UINH 4XBGB 1U6AL 3WDJA 3ARFD 3BGFC 4P2QD 3QI9D 1RZ7H 5L2KD 3O4LA 2W0KA 1NMAH 2DQJL 2A0LC 4PRID 5FM8A 3E2HC 1DJSA 3DX8B 1CGXA 4LPWA 4HKXA 3G6JE 2R0ZH 5ITFA 1CU4H 4G6MH 4OZ4A 4PBXA 5T3XE 3MA9H 3TT1H 1KFAL 1FORH 2R0LL 5DUML 5T1DL 1YY9D 2RBLA 2A2QT 1MREL 2UV3A 4LLVA 2UZXB 3RL2A 3VXSB 4U31A 4GOSA 1V8HA 5EBWB 4XXDA 3EYSL 4QO1A 2ZZUT 2DYPA 3NTCL 1RUPL 3MJ9A 4HQQH 2AJZB 3ZMRA 4OIIH 3PGDA 3EO9H 1UXSB 1U3YA 1EEZA 3I9GH 4XPBL 3FFCD 4OCLC 4I4WA 2ZOKA 2LTQC 5C0GA 3SGKA 4QRPE 1T1XB 1QA9A 3QAZC 4QOKA 4WTXA 1F97A 4LEXH 1MPAL 2AJ3A 3C2SA 1Q1JL 3TNMB 2NX5A 5C08D 4Y8AA 3WXVH 1MVUA 3SDDC 3Q48A 1N0XL 1SJXA 4PTUB 4QHMA 5E1AB 4WWID 1A4JA 3CFJB 4CRPA 1I8LA 4PS4H 3BKCL 3QCVL 4NKOB 5IB2A 3BO8A 4X4MA 4M3JA 5KVDL 2YUWA 1QNZL 2PXYB 2D03L 3EOTL 4CKVX 5I30L 1Z5LA 2CQVA 2FD6L 2DJ4A 2DTSA 2R69L 2NY4C 1ND0B 4NKIH 3ARFB 3IJYB 3QXVA 1RJLA 2C9AA 1J8HE 3BVNA 2COQA 4Q97A 2IH3B 1OAXL 1PBYA 5HI4D 2XWBA 2V6HA 1F90L 2APBA 4Z76A 1INEH 4LVNB 2CXKA 1LO5A 1WUNT 1P84J 2LAAA 5F9WC 4NWUH 5IM7A 1OD9A 4MVBD 1ZOXA 3H9SB 4D9RD 1KC5H 3D9AH 5T1DH 5FYLL 2VZVA 3LN4B 2A74A 3JV0A 4UB0H 3TBYA 1G7PB 5HDOA 4Z7UA 1MCJA 1YEDB 4APQB 1Q9WB 4UDTA 3CGTA 1CR9H 1TMCB 3HMWL 2W59A 4P46C 4Z7WA 3DURA 4OIIL 5TE6H 3SN6N 5F72S 5CBAA 3B3IB 3EGSB 1MOEA 3LQZA 3GMQA 2QQNL 1AIFB 3WCYA 3WFBL 4HH9B 4ZNEA 4HXBL 3O6LL 3BPLB 1A8JH 1WWBX 3WMSA 4HIEB 2BOCA 2XZAH 3GHEH 3S35X 3THMH 4K2UH 4NM4L 2B39A 5L2JB 2H2PC 4P2OD 4PS4L 3RTQC 5EFIA 4J2XA 3GMLA 1OOAA 3OV6A 3A6CL 4MJ5B 1BAFL 1JGLH 5D7LB 3MRPA 3EOTH 5ETUB 5I30H 3TP4A 4X6BB 4JFPB 1BFVL 4XVJH 1NLBH 2D7MA 3MGTB 4FG6D 2Q6WA 5F96H 2YMXH 2F8OA 3QWOA 5D7IA 5HI5D 4G9FE 7CGTA 4ZYKB 4ZUVB 5L0QB 1I1FA 1FFQA 1OHQA 1PG7W 4K9EL 4ZQKB 5DQDH 3T4AA 4TVPL 2IPKA 2XA3A 1D9KC 5DJ6A 4TTDC 1OARL 5FV1L 4CMHB 2F8XC 3W9DB 5D2LB 1NAKL 5EU6D 2I9TB 2NY0B 3LEYH 5EA0L 4M5YL 1LMKA 3HB3C 1J10A 4O02H 3WHE1 1ZHBA 3VGFA 4FQXA 1QSZA 3QWQB 4GMSH 4N0YL 4PREB 3VWKC 3V5DB 4NUGL 4U0RC 1EEZB 2Q20A 4N1CA 4ZXBB 4ZO7A 3UTTB 4RISL 1WBYA 2JE8A 4LARH 4WCYH 1IBGH 3KJ4C 3SCMB 5ID0A 5T33H 3WFBH 1DQMH 3WNPA 4XP1H 1VESA 2A73A 4NQEB 2X4SB 4UIMB 3NBNA 5GJSL 4GFTB 4LCYB 1DN0A 4V1DD 1CL7H 5EN2B 3AB0C 3QJHA 4GG8B 3ARDC 1E28B 2D7NA 3F7VB 2Q3ZA 1FQ9C 3PQYD 4GG6E 1X4ZA 1FYTB 4QRRB 1YJDH 5CZXD 2VC2L 2VLME 5CJXC 5DD3H 4KZDH 5FYKE 2D7TL 2C1OB 1WVZA 3PGFL 1WK0A 4U4BA 1ZVHA 5DQ9B 5FYKD 3EW3B 1IQDB 1KIPA 1NC2D 1KTLA 3CFBA 3GGWB 3QDJA 5GGQH 3VCLA 3OF6D 4DTGH 1JF1B 4ZDHA 2CIIB 2YKLH 2P5ED 1V7ML 5LGKA 1YEDA 2R0LH 5DUMH 4G6FB 3MGOB 5FYKL 5EZOL 3QUMA 2ORBL 4M7JH 2BSTA 3S4SB 3IDNA 5C0FB 2ICCA 1AR1D 1UM6H 4JHAL 4NCC2 5EO9B 1C12A 1I3UA 1MJUL 3G6AA 1OCWH 5C0RL 4PG2C 3RJDA 4Q6YA 4QHUA 4FQ2L 4NT6B 3MRRA 4H5SA 3WFCL 2ICWB 5ISZD 2FYYB 5LCVH 4OTXH 3OKOA 3EO9L 2PTVA 1ND0A 3QIWD 3QEHB 1G9MC 4ERSH 1ORSA 5D2LF 3VXPA 5IEHA 2AXFA 4BM7A 5KS9E 1MCHA 5IKCB 3RDTC 1MQKL 2Q87A 3EJJX 1BECA 1H15B 4XAKD 5D9SB 1H8OA 1EJOH 3W2DH 5F8QC 5KSAB 1NCAH 3DJ9A 5HHPA 3LQAH 5DD6A 1FVEA 3BHBA 3DBXA 2WWMD 4XNYH 1PG7H 5I1EH 7FABL 1I7UB 5F93C 5IHZB 4QF1B 2VYRE 1MRFL 5AD0B 2VWEE 1T04B 1G9NC 4BQ9A 2DMCA 5SWSB 2DWDA 4KXZI 4OM0H 2IPKB 4Y5XC 4EUPA 1D9KA 4Z7NF 5I1IH 1A2YA 1BF2A 3DX9A 3CX2A 1A1NB 4NJAH 1T7YA 4QGTA 4PJCB 3H2WA 5TE4H 2YN3A 2VQTA 1GOGA 1MWAH 1LK3H 2GTZA 3QFDA 3I6KA 1XGQA 4MAYA 1DVFC 3DO3A 4WI6A 1HHIA 3SKNB 2G9HA 3ARBC 1B0WA 2FEEL 3FQNB 3RZCD 1JN6A 4PP1C 1T1WA 5HDQL 1ZGLP 4X9HA 4JHAH 3AFLA 5J11C 1MRCL 4OZGF 4RGMC 4M1GH 5ITFB 1QD0A 4LAQL 3WFCH 1CGSH 4NHCH 3L1OH 3N1QC 1BVKB 1N64L 4KKCC 3EBAA 1UQSB 2A77L 1G7IA 4PV9A 4UV4H 2BSSA 2FLRT 2B2XH 4ZD3H 2C3HA 3U4BH 1RK1B 3H9ZA 5IG7A 1BQHA 4MS8C 2EDOA 2YHGA 4X8XA 1FFPB 1OQXA 5I8EA 3DRTA 2FEDC 5F7EH 3U6RB 3V7AE 5KAQG 1VFMA 4V1DA 1KACB 4MB4A 4GRWH 3ZDXE 2P24B 1HILA 3UDWA 3QULA 4KXZH 5I0DA 4JHWH 5C0CB 3MXVL 4Y19E 3G6DL 1DBAL 1PY9A 2DQHL 1OW0A 4HGWA 2EH8H 5J6GB 1BWMA 3MRLB 4KJPD 4Q7DA 3WEXA 1AFVL 2H32B 1BEYH 2OLDA 2BDNH 4ELKA 2AEWA 5A40E 5HSFA 2GK0A 1DBBH 4YDJA 3JTSA 3V8OA 5L9DL 1P7HL 3ILPA 1MHHB 4GRWF 5DC0A 3C2AL 3RL1B 4G8GA 1ZK9A 3CFDA 2BCKA 1AO7A 1PQZA 3O6FB 3KVQA 1NPUA 4HJGB 4O2CA 4ZFOA 2NX5E 4U1MB 1D6VL 2AGJH 1LE9B 4E0RB 1H3WM 5C6WH 3HZMB 4G8IB 2M26A 1PZ5B 2OR8A 4LARL 2AI0L 2YPLB 4CNIA 3B43A 1BLNB 4APQA 3QUZC 3RVTD 4MSWB 3L3GB 3LKNA 4NC0B 1JF5A 1XGRA 3P73B 5GGRB 3QEQD 3I3DA 5C0BD 4P23B 5AD0A 3HG1A 3O8XC 3SE4A 1NBQA 4Y2OA 5D1XA 4KK9D 4UNUA 4IOFD 4HAGA 1KCRL 5JLZB 1QBLL 3MUHL 3RY6A 1INQA 3EKCA 1FN4A 5DJ8B 2A6KB 5LBSL 5ANMB 1YEFH 3QZWG 5JW3H 1FSKC 4JHWL 3DI3B 5C0CA 4KROC 1J8HB 3VU2A 2X70A 5KSUA 3DPBA 4Y16C 4PJBE 4PGCA 3R06B 1D5IL 5J12C 4JFXA 3SE8H 3ARGA 3FTGB 4OZIF 1U42A 1VGEL 2O26U 1BGXH 3OX8A 4JFZL 5T1MA 2F54E 2V5YA 5I1HH 4R4BB 3TBSA 2HVJB 1KXTB 3RPKA 3UBXB 2FB4H 3ZSTA 1TJIH 5FYKH 4N8VG 5L9DH 3QQ3B 3T0AA 1O0VA 3H9SD 1RULH 3B2UD 4U1SA 2CKNA 5CHNB 1BZ9B 1N0LA 5FHAL 4OQTL 1E6OH 3BISA 5CSBA 3U0WH 1OTTD 4D94A 1VADB 1WZ1H 3MLXL 4MD4B 1PKQB 3FTGA 3SGJA 4QXTB 2BSSB 3GB7A 1J1OL 5I66B 4QWWD 2Z0BA 5CIPB 3T2NH 2Y25A 5FYLD 1GZPA 3GRWA 3RGVD 2YD6A 1EJOL 2VLRA 3ALXA 5ACMA 2HT4D 1FH5H 4ETQB 3WO4C 3HZKA 3P4OB 4UT9H 3FRUA 1J1PL 1CYGA 4M8QA 5DD5L