5T1LD

Cetuximab fab in complex with cqa(ph)2dlstrrlkc peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
220
structure length
216
Chain Sequence
b'QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CETUXIMAB FAB LIGHT CHAIN
publication title Natural and non-natural amino-acid side-chain substitutions: affinity and diffraction studies of meditope-Fab complexes.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 45
structure length 216
sequence length 220
ec nomenclature
pdb deposition date 2016-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t1lD02
5IBTL 2IAND 2CXKA 2ZG3A 4ZS7H 3VH8G 1C8PA 1MCCA 4O5LH 1RUKL 5D2NE 5I1AB 3CU1A 3WXWH 3QEGL 4TOYL 1W2KT 3FO1A 2DM4A 4OCYH 2C7UA 4MMXC 3V6FA 1NCUA 4DQOL 2O5XH 3BDXA 3QA3B 1VB9A 2GJ6A 2NX5D 3KXFD 4OZIE 3FB7A 4E42B 2ORBL 1HILB 1RMFL 2CLVA 2DICA 3FJTA 3RHWK 5I66B 3WO3B 3V4UH 2NNAA 2UYLB 2EDNA 2H9GB 3NACL 2R4SH 3U1SH 1S5IL 1DQJB 3ZYJA 3L9RA 3WFDH 4LLYA 1TJGH 2OI9C 4L8BA 3K7UA 2DAVA 3ZKXC 3KPSA 4U2ZA 4XBEL 1N0XL 1W8OA 2IPKB 5E03A 1XGQA 3VGAC 4HKZA 4I2XB 2JIXA 1Y6NR 1FV1A 5CKGA 1YEGH 2EDWA 3EFFB 4XT1C 1ZS8A 5E99H 3IFLH 4LLDB 3LRGA 3UTQB 4QRRD 3GMRB 2ADJA 4D2NA 4PJ9A 4HS3B 1KULA 4OFDA 3D2UD 1JCKA 2P8LB 4LCCB 4P3DA 5AZ2H 1KLUB 4WTZA 4M6NH 4Q7DA 4XCNB 2G60H 3QUMB 2HYMA 1B0GA 4E5XB 3R0MA 3G5YA 5B3JF 2VXSL 3OHXA 1R24B 1FFNB 1ZEAH 4WU5A 4KRLB 5GZND 4HWEL 5DMYA 5FHBL 3RP1A 4YQXL 2B4CH 1ED3A 3Q48A 2FEDD 1UEYA 2XV6B 2DQCH 4ODSL 3S37H 5M7QA 3B5GA 4WHTB 2D7MA 1QNZH 2DLFH 1EHLL 5BQ7B 1F11B 1RURH 2DBJA 5F7WC 3MV7E 3S36H 2DQDL 4PJGB 4X0KB 4P0DA 4U1GB 2DJ4A 2DLEA 3DOSA 3GI8L 2XXCB 4Y1AA 3QULB 2A6IA 3MA7B 3Q2CA 4U31A 1AGDB 5TE7L 4KHTL 1MLBA 4PJXF 1JZ6A 3ULSB 1SEBA 5FO7A 3T77B 4G42B 2NQCA 5EA0H 5I71B 4P5KB 3JTSA 3B2VH 4ODVL 3PWNB 3SEPA 3X3GH 3VGGA 4M7ZC 1J1PL 1U3HB 4BH8B 1CDIA 3O0RL 2DQJH 2JCCA 5DGRA 1GGCH 2FATL 1JPSH 4I4WA 4P23D 4Y5VC 1BEYH 1D6VL 4MQTB 3QNYA 4PJGF 4LQFL 4TSCH 3VXNB 5C70A 4XMKL 4IOFD 4WHDA 3DI3B 3UTTB 1G7IB 1G9ML 3I6KA 1JPTH 4MHHI 1MCIA 1V3KA 4ZUVB 4GSDL 3L5WB 3SDAD 1R3HA 1MWAB 3GIVA 3WFEL 4ZO8A 1PSKL 1PX4A 1CF8H 5B3NA 5K93A 1YQVL 2DRUA 4JFXB 2R0WH 4X7TB 3HR5A 3ULVF 1FAIL 4Q6IC 1TJHH 3SBWC 5FA3B 4NO2A 4MNHB 4MXQC 4PJBB 1T21B 1BJ1H 1TZIB 4WI4A 3GSVA 3MZGB 2BVPA 4WGWB 1K2DB 4Z0XB 4APQD 2J7LA 3RIAF 3NIFE 5KANI 3WN5B 1G7PA 3LN5A 1U8LA 3L7EB 4J6RH 5CMAA 3ETBF 2DQHH 3F6IA 4QOKE 3T0XA 2EIDA 2VIRB 4LSQL 4Z77B 1IQDA 3UBXA 4K23L 4JE4B 2QQNH 4E41D 1MCFA 4F9LC 4YPGA 1MQKL 5TDPA 4GLRI 4YXHL 3MRGB 4MQ7B 5MI0C 2IBGA 3VI3E 2R9HC 4CU6A 1NDMA 1BQLH 1DR9A 1RVFL 3P9LA 3NIDF 3RBSA 4NO3A 4ZO9A 3OAZH 1T22A 4XP9L 5I6XB 2WINA 3IXTB 3C6LA 1G6VK 3RWFB 4MQXC 3IXAA 3FT2A 3ARFD 2UV3A 1T03L 3HFMH 3IU3A 1YMHA 5KSVB 5DYOB 5F89A 5EO9A 5EOCH 5JW3L 2PYFA 2FDBP 3TFKD 4KK5D 1EHXA 4RSVA 4XNXL 1UYWH 4GW5B 4K9EH 1YDPB 1B88A 1UH4A 3N9GH 2V2XB 4FXGA 1EAPB 1CD0A 1N59B 1OGAA 4W4OA 3QIBC 5SX5H 4GRLA 3U7AA 2F8VA 3QWRA 1VFBA 5DK0A 2APFA 2YPLE 4RA3A 3TBVB 1H9VA 3Q1SH 1ETZA 1JYVA 2ZUVA 4AJ0A 5FGBA 1C16A 4PY7A 3H9SE 1IEBA 4KTYA 1N64H 1UC6A 5K9KA 4PR5A 1SYSA 3HZMB 1UACH 4X98A 5TFSL 1J05B 5ICZA 1TXKA 5EUOF 4PRNA 1NFIA 2APTA 2GK0B 1X5XA 5DJ0B 4NC0B 3WKMH 4LCWD 2WIIA 4ZNCD 2PO6C 3CDCA 4YHYB 4HS6A 1YJDH 1QFUH 1UWEL 4G7VL 2HFGL 3HG1D 3QRGH 4JM4L 4PJ7A 1NBYB 2KUTA 5MEND 4KVNH 1S9VB 1U8KB 1T1ZB 3UTPE 3MLVH 1NCDH 4JM2F 4PJ8C 5IFAH 1M7DA 1CDHA 4U1MB 4PGJA 4NHUB 4AEHH 1XGYH 2C3VA 3H3BC 3QEQA 2VZVA 1SBBA 4QHLA 4J4PA 2GEEA 4ODTH 5J8OA 4L8DB 4UV7H 5EULV 1UQSB 3SGKC 1QBLH 4F7TA 4QYOB 1JPGB 5FDWA 5I1EL 5HD8D 1NUNB 4OCWL 3P0VL 2YA0A 3RY6C 4OZIF 1Z9SA 5HGAA 3IGAB 1GZQB 4JDTH 5KSBE 3UJTL 3AY4A 4KU1A 3WBDA 3MV7A 1YY9D 3B2UD 1I8LC 3D39D 5EN2B 3ULUF 5CHNA 1L6ZA 5DO2D 3H9YA 4S1QH 5C2UB 4MD5B 4Y8DC 2CSPA 2NR6D 3V7MA 2B1AH 2NZIA 3BGFC 4BELD 4N0YH 4Y4FC 4ZD3H 1EO5A 5ACMA 4NRXB 3EDKA 4HH9B 5DK2B 3I50L 5AG8A 5I75C 3LQZA 3ZHKA 1OLLA 2P24A 3OKMB 4MVBC 3P30L 3UTZB 4JDZB 4NJ9L 5C0BE 3D69B 3MOQA 3VFTA 2PCPB 2AJSH 4U1IA 3S9DB 1B2WH 4POYA 3P9MA 3ZKMD 2UWEA 3GFUA 4HDIB 1EGJL 4XPTH 3TCLB 1ZT4A 2L4OA 3HC4H 4PUBH 4QXTA 1S7QA 3FOLA 4Z7VB 1K85A 3ECBA 4JQVC 1YC7A 3WUWB 4MDJA 4YHOL 5FEBA 4OSUH 1N4XL 1GOFA 3EYUL 1XGUA 4DTGL 9CGTA 1KB5A 5DUBB 3E8UL 5I0ZA 4BZYA 1QQDA 5I74C 2Q6WA 3GMOA 3MODH 2C4XA 1GGUA 4PG9B 3D3VD 3CZFB 1MJUL 3X12B 1MF2L 3KPLA 3GNML 3MV9E 1U42A 1T2QH 2LAGB 4MJ4A 1RV6X 1JK8B 4ZPTA 5E6IB 3DGGB 2R23A 4LSRL 4HUKB 4ODXB 4XPFH 1J8HB 3C5ZC 3STLA 1J8KA 1HHHA 2D03L 1BD2B 3T0BA 3ZDXE 2IPUG 3R4DA 3MRQA 4LVNC 4L9LC 5IMOA 2R29L 4QOKA 1F4AA 2D31A 1IQWH 2YUVA 3WNNA 5JZ7D 3MQIA 3E2HB 5T1LB 3O41A 4NO0A 4RGOH 3GSRA 3DPBA 4LHUB 3MJ9H 4MSWB 3P73A 1QD0A 2R4RL 5D4QA 5GISH 3ARUA 3P40A 4Z7QE 1ONQA 4IHOB 2FB4H 2H3NB 3MRCB 3UX9B 4ZUWA 3NGBC 4N0CD 2DQGH 1U8PA 43C9A 3CFDB 4TUOA 4X80L 5J13B 1DE4B 4NQDE 1YA5A 2QSQA 5JW5B 1V8HA 1D5IL 3K2UH 4KH2A 1UCBH 2XWJA 2V7HA 3QIUA 1T04A 1S9XB 1E4XH 1DBBL 3M8OL 4QO1A 1KCVH 1S7UB 1FO0B 4KMTH 1BREA 2NY3D 4YHLH 2IPTL 2DLGA 2Z8VC 2IFGA 2XRAH 3U0PB 1W0WB 1DL7H 1FG2B 4MHHG 4DOHB 1IAKA 3VXUE 4LVOB 4UAOC 2XA3A 1IVLA 4YC2B 2Y6SD 3SE9L 5JIKA 4KI1A 4AIZB 4MWFA 3RZCD 4YGVB 4WU7A 2G5BA 1H3TA 1EMTL 5J0BA 4DZ8B 5GRUH 1H3XA 1PKQB 2DM3A 3VI4F 4GAJH 3WLBA 1FZJB 3TO4C 3OKEB 2W0KA 4KDVA 1DQDL 1GZPA 4GQ9L 2DQEL 1AE6H 3V5KB 4QCIA 3STZB 4GG6E 4Z7WE 4BQCA 5KANG 5JW4Q 4EXPX 3OJ2C 3H9SA 3T0WA 1DFBL 3C8KA 4WY7H 4AQ1B 3VDAA 1QRND 4Q9RL 3NFPA 5LAXB 4X7DC 1OARL 3FT3B 3UMTA 3QH3A 5TQ2H 3QZWA 4HIHB 3GSWB 4FQHA 3TWCL 3QAZC 5I1DB 4ONHA 4LVHC 3RWGB 4WWKB 3PWPD 4BH7B 3FB6A 1U2HA 4N1HB 3KPPB 1VA9A 3FQRA 2BVQB 3QUXA 1FRGH 4X83A 3DLQR 3FZUD 3FN0L 4O4YL 2COQA 3BH9A 5C0EA 4KZEH 2DYPA 3OGCA 5GS0H 1G7LA 1QO3A 2WIMA 3REVB 4R26L 4IRSD 4YXKH 1I7UB 3KPNA 3OL2A 4D9QE 1G6RA 1BJMA 1HYSC 1BIIB 4QRQA 2R9HD 1RZ7H 1NGPL 1MH5A 1YEEH 3JUYA 3VXME 4P49A 1XR9B 5I1CL 3D85B 3ULVH 1AI1H 4PRPA 4XWGL 3KPTA 3BEVA 3S3SA 2PR4L 3JZ7A 1CT8B 2P4AB 2AJYH 4GKOA 4R7NA 3V52L 3CSBA 4ONGL 2Z8RA 1A2YB 1NC4A 3QNZA 4ZS6C 3WIHA 1QVOB 4ZAKC 1CK0L 5I8EB 1Q0XH 5D96B 1WVZA 1A8JH 3RI5K 4URTB 4NP4H 1NCBH 3MRKA 1N7MH 2VR5A 2ZNXA 5IQ7H 3OKNB 3VCLA 4PS4H 1T7WA 4QRUB 5IOPA 4KAQL 1NCAL 3WIFB 2A1WL 2CO6B 3O4LE 5C0BA 5JHLH 5JW4R 3T4YB 4R0LC 2VLMD 3JVGC 4NZUH 5B38B 4X6FB 3RDTB 1CFQB 5IQ9A 4ORZC 3E6HA 1KYOJ 1TITA 43CAA 3HE7A 1U8OA 3NN8B 1ZXQA 3ARWA 1PG7X 3QI9B 3PHOA 3G9AB 5I1KL 3FN3A 4NPYB 4WW2C 4OF3A 2YS4A 4GT7A 4MD0A 3T2PA 2LVEA 2P5WE 3ARYA 4LBEA 4PTUB 5F9WC 5J9PB 1WFTA 1T5WB 3SCMD 5DD6B 1OSZB 4PP1C 3WNMA 5KS9B 1RU9H 1KTLA 1GC1L 5C08A 5KSBF 3V5HB 1FVDB 3MLWH 4BM7A 1Z6JT 4MXWL 1MFCH 3RHWF 5J3HD 5DS8B 1IGYA 3WUZA 4N90D 5BRZB 4BFIA 3MV9A 1OP5H 2R1WA 2VKWA 1NGQL 2UY6A 1VEOA 5IUSA 1DSFL 1TVBB 3DHMA 4JANA 5I8KH 1CE1L 1BOGA 5L6YH 1UZ8B 2CR6A 3KVQA 1FIEA 5ICYA 3FCTB 1JNNH 1DLFH 2IALA 2FIKA 2OR8A 1JUFB 2B5IB 2YXMA 5KS9F 1G1YA 1Q72L 4ZFOA 4LRIC 2R1YA 3DXAB 4ZXBA 1WIPA 5KSAC 5DD5H 3CU7A 5HHVL 1IGTB 4Q6IA 5EU7E 5C86A 3MMEB 1RUML 4Y5XB 3CFBA 5BS0B 3TA3A 5BXFB 5HYJD 4OLXL 3O6LH 3PV6A 5EBWA 4WCYL 4XC3L 5DJZB 4YGAB 1JNLL 1A3LH 1IGIL 2A83A 1CWVA 4OLWH 2HTLC 4BFEA 1HSBB 3FT4B 3B9KD 2EIZB 4RFOH 1KF9B 4Y16A 2WBJD 3IDMA 4MVBD 1DZBA 1QSEE 5I1HH 3BD4A 3PIQB 3BHBB 1LO3H 4AMKL 1EUUA 2IC2A 3O4OB 1RHFA 5ECJE 4JFOB 5J1AA 1YEHH 3V4VH 4F9LA 1YUHA 4NQEB 3LD8B 3HE6C 2BSSB 3UDWA 4AENA 3EJYC 1INDH 3CC5A 3E6FA 3W5MA 3C5JB 1EFXB 1JWMA 1PDKA 4OTXH 1JZ3A 4CVXA 3NA4A 4LLQA 4PJEB 5ELIA 3ZDXF 1NGWA 2ICCA 4KTDL 3RWCB 2CMRH 1N5YH 5E1AB 1A47A 4NGHL 1F6LL 4NUJA 4QNPF 4NZTH 2XQBL 3PWUA 4GG6A 3MREB 3ULUH 4Z7WA 4ETQA 5IEHA 2FHBA 3KYAA 4KK8D 2X6MA 2BJMH 4Z7QF 5FYLL 1H3PL 4K7FB 3BGMB 4JJ5A 1CXFA 5DD3H 4HPYL 2VITA 2Y36L 1I1FA 4F7MA 1I7RB 1JYXA 1TDQA 4MNQD 4FNLL 4RDQF 5DWUH 1NAMA 3KWWA 3PP4L 5MEQA 2EDQA 1QP1A 1KELL 2LVCA 1IGMH 3IFOA 1QSZA 1MJ7H 4JFDD 4Y5YB 3VE0A 5ITBH 1AD0A 1OD9A 4ELME 5JHDB 4FP8H 5J11C 1S9WB 1ZHNA 1JHTB 4RGNC 1F6FB 2FO4B 4L4JA 2IQ9H 3GMQB 2AEPH 2HJFB 1FVCA 3W0WB 2EEBA 5INDB 4JPVH 4OT1H 1Q0YL 3LKQB 4JO2L 3LS4L 3MOAH 4LIQE 4U0QB 4I3SH 3R06A 1KT2A 3SDYH 4EUPH 3P4MA 5T1KD 5I73B 5FM5O 3PDOA 3P0GB 4UNUA 4ZSOE 5CGMA 3MJ8B 2DQTH 2XQYG 4MCZB 4O2EA 5L7XH 2YWZA 4FFWD 3ZT6A 4JRYE 4U6VL 4KROB 4NZRH 1MCEA 1DTUA 1KJ2B 3B4NA 1PZ5A 4OF6A 3TJHC 1A3RH 4PJ8A 2PXYC 1F45A 5AZEL 5I76A 3FRPA 3FQNA 4NKMA 4N5EC 1Y6MR 4WV1B 5IB4A 3BMWA 2V5TA 1QLRA 4HPOL 1F02I 3D0VA 5I8OL 2Z31D 4PRHB 5CINH 3G6DH 5L2KB 3PWVA 5EUKA 3DX8B 4HKBA 4HJJL 3O4LA 4X5XA 2NY4D 4OD3L 5ICXA 3KYOB 5L9DH 5EU6B 3TO4D 2N1KA 1BMGA 2BNRB 2P5EB 3L3KB 1VGEH 4LGPB 5CBEA 4JHAH 1K8IB 15C8H 1A1MA 1NFDA 4XPBH 4OUOA 4XNZC 1ODAA 2X89A 4MJ5B 1XGRB 5E8NB 4U1KB 1HXMB 4L3EB 4ELKA 4FQ2H 3HC3H 4YLQT 3TCXA 4Y2DC 3VG0H 5I1GL 4LKCA 1BECA 4KZDH 4X9GA 4X7FC 2P5WA 5DJXA 1CL7I 2QEJA 1XF4B 3BP7A 3PQYB 4Y4FA 2ID5A 3JWNC 2FX8H 1I3RB 5C0AE 5HDQL 3VFNA 1M05B 1LEIA 2NXZD 3GBMH 4UT6H 3TIDB 1M7IA 5H35A 1HH9B 5T33L 2XG4A 3E3QE 1Q1JL 1J5OL 2V2TA 4TNVF 3QDJE 4ZFFB 4NYLA 1WZKA 3WJJA 3FO9B 4HGMA 1DJSA 1WWAX 5GGTL 4JQVA 2NY0D 5EC2A 5D7KD 2OL3B 4HIXH 1MUJA 3BFOA 4OLVL 3FQUB 4DGIH 5KVGH 2DBLH 4LNRA 4FQLL 4H25B 2A2QT 1KTRL 2BOBA 5IJKC 5FCUH 1HCFX 1QTYT 3O11B 1I8MA 1CGVA 2IGFL 1I8KB 4FQJH 1T20B 2AVGA 1JGEA 2ICWJ 3FB5A 1MRCL 1CDBA 2ATPA 3CMOL 3QJFB 4OF0A 2X4UB 4X6CF 2DN7A 2X4QA 5KVMC 5CJOL 1C7SA 4KQ3L 5A16A 3C5ZA 5DQJB 3WXVL 4Q9BA 4XAKE 5IIEA 3A67L 3IDGA 4ZNEE 4XVTH 4V1DB 3ZE1F 3V2AR 4U1LB 3PUCA 1I3GH 2J5LB 1UA6L 4M6ML 1CE6A 3MR9B 4R2GC 3TZVB 2ADIB 2ZOKB 3OXSA 5DC4B 4XNQB 5ACZA 5GGUA 4UUJB 1QFPA 2W0FB 1UH2A 4GUPB 5C6TH 2ZCHH 2VDPL 2D0FA 1YMME 3DRQA 5IMKB 4L4TE 1FYTD 1WUNT 3WS6C 3BVNA 1A14H 3BP4B 3PL6B 3T8XB 1PG7H 5IESL 3UPRA 3BKCH 1OPGL 2EYTB 4EEEA 3X14A 2AERT 1I1YA 1NMBH 5HI3D 4NFCA 2LTQC 2J6EA 3RL2B 5CZVL 1B90A 1ROWA 2B2XL 2V7NA 5EU5A 3MBEB 4JVWA 1S7SA 4HW6A 3NPSC 4DVBA 5E9DB 1TQCB 1AKJD 4HCRH 1RK0A 3ARGC 1BFOA 2V9TA 3CLEL 3HMWH 4QKXB 2X9XA 3I02B 5CJ8A 4JJHA 1A4KB 4NHCH 2X9YA 3QEUB 5DVOA 1RHHA 2Y5TA 4MNGB 2XYCA 3DVIA 1EIBA 3VGHA 3VJ6A 2Z9TA 5HPMB 1L7TH 1FORH 3K8LA 4K8RH 2X42A 2HN7A 1PD6A 4KI5E 4XCYA 5IB1A 2BFVH 2XPGA 3U7WL 2E9BA 2DI8A 1KB9K 1G6RH 2CIKA 1NMCB 5D2LB 2HFEB 2X4TB 4XX1G 5FKAB 5FYLD 5GGVY 3JBG7 1S9YB 1D9KD 1KLGB 4YO0B 4KXZI 2DQFA 4N68A 2VC2H 3G6AA 4P5TD 2H6PA 2C4FT 1NCCL 1T0MB 2G2RB 3VRLE 1OP3H 3V6BR 1IARB 5CZXC 5IT2L 1H0DA 4CVZB 4ZSOA 2EH8L 3HNSL 5IW1A 4UIKL 2AJVH 5T3XE 2CRYA 1JFQL 1WFNA 4OF8A 2R8SH 5DT1H 3HZYA 3GHBL 1VERA 1I75A 4Q2ZA 3FO2A 12E8L 4JRYA 4YBQC 2IANE 2WUBH 3SDCA 4NNPL 4KJWC 5D2LF 3LKNA 4OQTH 3VRIA 5LGHH 4XP4L 4MAUL 4DVRH 4JG0L 1LEGB 1TVHB 3EJYD 3LHPH 3TV3L 1LP9B 3KXFE 3DMMB 3LY6A 4CVUA 3ILQC 1E6JH 4AEIL 5JNYB 4M9PA 1T7VA 4OZHE 3QNXA 2F54B 2MPAL 2BNQD 3O2DL 4ELMF 2Z93A 1JMZA 3T65A 2F74B 3NFNA 2E6PA 2VLRD 5AUMA 3QG7H 2X4PA 4HIIB 5TF1H 4U7MA 4YDJA 3SKUD 2QQLL 1NUFA 4PRBB 4ZAKA 4X7SL 2VLJE 5FGRA 2YSSA 3K1DA 3BUYB 3CSGA 4EQ2A 5D93C 4R4FL 1P1ZA 5I16B 3EO9H 1N6UA 3DTXB 3O3AB 1S8DA 1HIMH 2CUMA 4QRRE 4BJLA 4LMQI 3W82A 2A38A 3QEHB 1XIWB 4KK9D 1LP9F 5C0AA 3T0EE 4PJIB 3VFPB 5HYSG 3QFJB 4F33A 3U83A 1J18A 1T5XA 1JHLL 2WMPA 4HWNA 2W9EH 5C09A 1WQVT 1A1NB 3I84A 4R0LA 1HH6B 3JVGA 4U7KA 3NCYS 4FQ1H 1E27B 1KCKA 5GGRB 3QDJA 3UJIH 4LSVL 5F71A 1YNTB 2X4OA 3A6BL 4GKSB 1N3NB 5A2JH 3REWB 2OQJB 3D9AH 3OJDB 3DBXB 4G8GB 4I3GA 1QR1A 2B1HL 4OLUH 3VFGL 5D72H 3FRUB 1CGWA 4A6YH 1H15A 1N2RA 1XGPB 4PJIF 3V95A 1Z5LB 4XI5D 1IT9L 1VESA 1BVLA 3MOBH 2H2SC 2NY5H 5B39G 2XZCL 3ES6A 4FHBD 3TJHD 4WJ5A 3V6FB 4XRCA 2GJ6B 1FDLL 1WBZA 2VH5L 1QKZL 3FB7B 1DQQA 3K80A 3QIWD 2CLVB 1LO2H 2Y06L 2NNAB 2R15A 4DN3L 5GJTH 4PRID 4ZNEA 4WHYG 4LLYB 3GHEH 4L8BB 5JR1H 3KPSB 1A7NL 4JN1H 4IMLA 4K3HA 1XGQB 4HJ0C 4KKBD 2JIXB 1HHGA 3SDDC 1FV1B 4LRIA 4M7KH 5DUPH 3T1WA 5KSAA 1ZSDA 2NY1B 4DUVA 4HWUA 2D0GA 3VFSA 3DARA 4NWUL 1ZS8B 3SOBL 3M17A 3T0DA 1ZLWK 3RI5F 1WITA 5T1DL 4RIRA 2ADJB 1YMMA 3O3BB 4L4TA 4DGVH 5I1JL 4RGMB 4P3DB 5ALBL 1FE8H 1MPAH 4H0HB 1WT5A 1RIUH 4X8XA 3G5YB 2AJUH 1T1WA 2LU7A 3OHXB 5FO9A 1QFWI 3BRGC 5C07D 4OJFL 4WU5B 4YWGL 3ILPA 2AAVA 3JV4A 1ED3B 4LP4A 4LEXL 3S4SG 2EO1A 3S34L 3CXHK 5F70A 4BSWA 1ZHBA 3HE6A 2X9WA 3RTQD 4YDKL 3IDXL 5I9QB 1UJTA 1F3DH 3GI9H 4ZPVA 1OAUL 5KBNC 2VLKD 4Y1AB 4E41E 1S7RA 2X4NA 5ESQA 4CKVX 1YQ2A 5BZWA 2WWKO 2DIAA 1UWXH 3BT2L 3BXNA 4QHKI 3RNKB 1SEBB 3ZTJH 5FO7B 4QXGH 4PRDB 2YKLL 4F37K 1WEJL 3SDXE 3JTSB 5IJVA 3BWUC 2HVJB 3RL1A 3SPVA 5HYEA 5C3LD 1YEKH 3BKML 5E5UB 4CVWA 2JCCB 2Y07L 4ISVA 1ZT1B 2BP3A 2LFGA 4I4WB 7CGTA 2DTMH 3QNYB 4MJID 3RWIA 1HZHL 2CD0A 5HHMB 3S96A 3SHSA 3IJYA 3RKDD 3MLUH 1QBAA 2PTUA 3UO1L 3I6KB 4P9MH 2DMBA 2IANA 4MA1B 4M7JL 4EN3C 2FX7H 1R3HB 4HIJA 4R2GD 4C56D 1F3RB 2GUOA 1F97A 1RQ5A 3OB0H 2X1PA 3C2AL 4NBYB 4UTBH 3HR5B 1RIVL 1MELA 2FWOA 1WCQA 4MGXA 5CEZL 1DUYA 4JFFD 1MAML 5B4MD 5KVDL 4NO2B 5JXAH 3QUML 5IFHH 4OZHA 3RVVD 3N1GC 1CFVL 4Y7MA 1AFVL 3ARPA 4F7EA 5CBAA 3GSVB 4O02H 5FGCB 4MYWB 5SWSD 1HXYA 5F21B 1G7PB 3LN5B 1E28B 2VLJA 5CMAB 4HMCA 4UILL 3RUGA 3WMSA 2I9LA 3EDJA 5E8DH 4AH2A 1IQDB 2PXYA 2XA8H 1RZKL 4LCWE 1UVQA 5MP6H 2O26U 1AR2A 4QRRA 4HBCL 4YPGB 3IKCA 5TDPB 5KVFL 3T0EA 2DMKA 3DHJA 4XAWH 4NN6B 4BQ8A 1QBML 5E94A 4H20L 2VDOH 3QR2A 1ZANL 3MBXL 4G5ZL 4MLIA 1NDMB 2BDNH 1U8MA 3N85H 3WN5C 4GKNA 4JY5L 2VUYA 1T7YA 4WUUD 3P9LB 1NFKA 4NO3B 5HGHA 4M3KB 1I7TB 1T22B 2WINB 4R90H 1F8TL 3C6LB 2ZJSH 3IXAB 3FT2B 4WUKH 1UH3A 4OCXH 3IU3B 1YMHB 2E8YA 5F89B 3WFHA 4Y2DA 4DZBA 3DSFL 2J3SA 5EO9B 3LV3A 4NQUA 2HH0H 2PYFB 4M62L 2MSPA 5ENWA 3RKPA 4EDXB 3HPJB 4FS0A 1AXSA 3QYCA 3PGFH 2M8XA 1HHKA 5CSZA 5D9SA 1A7QH 1RZ8A 4J7RA 1FNEA 2FJHA 2IAMC 4FXGB 4LHUG 4TPRH 1OGAB 1MRFL 4KDTC 1KYOK 2K3TA 4GRLB 3B5HA 3U36A 1MWAL 4KY1L 3OSKA 3MCG1 5I15L 1HSAA 5FKPA 1ADQH 3HRZB 4UBDC 1IFHL 1QEWA 4KTEL 3MGOA 5DK0B 4F2MA 1U93A 4F8QA 3RBGA 1ETZB 4J2XA 4I77L 1P7QA 4I18C 4PY7B 1IEBB 5K9KB 5ETUA 1HINL 4PR5B 4YBLB 1JZ7A 2DD8L 5C7XL 4P23A 5J6GA 5FYKL 1WZ1L 3FHAA 4X98B 5DHXB 4AL8L 5ICZB 4PRNB 4YHKH 1NFIB 5E5MA 2HJLA 4C54A 3VXOA 2WIIB 1A5FL 1TETH 3LQAL 3BQUC 4HS6B 1P84J 3TT3L 1DLHA 4PJ7B 1YYLL 2NY7H 2ED9A 1M7DB 1F3JA 5E08L 2C3VB 4H0IA 4NNYA 1BQSA 2PYEB 1YN6B 3QEQB 3HAEA 4FXLA 1CQYA 2VISA 4QHLB 2F5BH 2OJZH 4XP5L 5E2WL 5HDBE 3K4DA 5GS2H 4F7TB 1QLEH 5D70L 1M71A 2R2HA 1KCUL 3DJ9A 3FQWA 1Q38A 5TDOA 3W9DA 3VXRE 3MUHL 5HGAB 1A6ZA 1CD9B 2YD3A 5EH1A 1CL7L 1SJEA 3FFCE 3EYQD 1EJOL 2QADD 1JGLH 4JHZA 4GMTH 3PGCA 3M07A 5CHNB 1X4ZA 3R0NA 5A2FA 4PJCF 1J10A 1N6QH 4LIQH 1TJIH 2MWCA 4MA7L 3VA2C 1A1OA 5D7JC 2ESVE 2GCYB 1KXTB 1NMAL 1TNNA 1BJ8A 2BSTA 3OKLB 3LQZB 3SDXA 1OAQL 2P24B 4P2RD 1GAFH 3ARGA 4HKXA 5F7DB 1MI5D 3BH8A 4TN9A 3NCCB 1CDCA 2V2WA 4LEOA 3P9MB 2UWEB 4HUMB 3ZZ1A 1ZT4B 2ILLA 3P4OA 2QHLA 2Z92A 1T6VN 1P7KA 4P5MA 4QXTB 1S7QB 3FOLB 2HVKB 2BHYA 2VRAA 5FV1L 3ECBB 3QWQB 2DF3A 2XN9E 4MDJB 1KJ3L 1CDGA 3W11C 1IC7L 3GK8H 4UDTA 4HJ0D 1FH5L 1KB5B 1OAXL 1QFOA 3D25B 2YPVL 4V2BA 3BPLB 3VFMA 4FQXC 1NKRA 4MA3A 1QQDB 4I48A 2Q6WB 3GMOB 35C8L 3UYRH 1VCAA 4I8DA 4ZOAA 4JZOA 4PG2C 1XFPA 1ZA6A 1YECL 2ZSVA 4JRXB 3KPLB 4UIMA 3N50A 5B22A 2HFFA 3FL7A 5GGSY 1U58A 3RJDA 3LSOA 4N9OB 4ZPTB 1EH9A 5D7IE 2R23B 1LO4H 5KTEL 5ILTH 3O3EA 5DSCA 3STLB 4M43H 1PJ9A 3SKNA 2EIEA 3MRQB 4GW1A 5IMOB 1U41A 1RULH 4M9OA 1T89A 4QOKB 5EZJB 3MLXH 1RSFA 1Z3GH 1KN4L 2D31B 3EHBC 2C3HA 3O41B 2PF6A 2A9NH 1OB1A 4JREC 3GSRB 1HDMA 4NO0B 5CEZD 3P73B 4HMDA 1JZ5A 1ONQB 1NAKL 1EEQA 1SM3L 4ZUWB 3P77A 4M6OL 2JB5H 2WWMC 3ZTNH 4IRZL 1U8PB 43C9B 5J4MA 3MV8E 5D1ZC 4G9DA 4TUOB 4Y4KC 2Q8AL 1X5GA 3A6CH 5CP3A 4F58H 2XWJB 2UVFA 3QIUB 1T04B 3BI9X 3WCYA 1CXLA 2IBZX 3ARBB 1IRAY 6CGTA 5DJAB 3CVIL 1WF5A 3H7BA 3ZMRA 2DQIH 3KPOA 4Z5RA 2J88H 2WBWB 4C4KT 3K46A 4XMPL 1IAKB 3BISA 1GHFL 2BMKB 2HTKD 3G6JB 4Q0XL 1J0YA 4RRPG 3IU4L 1OD7A 5AD0A 3BZDA 5J13C 1CLCA 4MWFB 5F3HA 3ROOA 4M48H 3G9VA 4WU7B 4PLNC 2G5BB 1OWRM 5IGXH 1AIFB 5MHSD 3SJVE 2XZQL 2ZUXA 5DJ6A 2VABA 1VFAA 3IFNL 3QHFL 3F62A 2X4RB 4OD1H 1GZPB 4K3DH 2CPCA 2KZ1B 4QRPA 1XF1A 1U3HD 3KYKH 4QCIB 3U0WL 1KSRA 3GRWA 1WBXA 1OQXA 3MCLL 3VDCA 4YC2C 4AY0A 5CZKA 3H9SB 5HVWA 2Z4QA 5F7MC 4LSSH 3NCEB 3G6JF 4LSPL 1OAKL 2W0LA 4G9FA 4LGSB 3NFPB 1EBPA 4L4VA 2GW5A 3UTTD 2VDML 1FNFA 3I6LD 5DRZA 1RFDL 2APWA 3RWHA 4PJAA 1TZGH 3QZWB 3O6KH 3C08L 2AQ1A 5IMLA 4PLJD 4ZODA 4ONHB 1LE9B 3HS0A 1IEHA 1AGEA 2ZKHH 3FB6B 4P3CL 4RDQG 1ZGLP 2CKBA 3FQRB 1TCMA 3QUXB 2BC4A 3BH9B 5C0EB 2DYPB 3OGCB 1EBAA 3INUH 1S3KH 3RU8L 2DKUA 1G7LB 1QO3B 3AGVA 3MLZH 3T3PE 4N90E 1CGYA 5FYKD 2E27H 3KPNB 1MVUA 4P9HH 4LPXA 2ZCLL 4YDIL 2YBRA 3ARTA 2QQKL 3JV5A 1NL0H 1QPXA 4QRQB 3ZKXB 4GAGH 4LPUA 1MH5B 4QHNA 4DKAA 3EOBA 1ERNA 2A6JA 2CGRL 3LAFA 4P2QE 5ALCH 3SDDA 4OGYL 3DYOA 1AY1L 2EO9A 4PRPB 4MS8C 1FO0L 3VXRA 2E7BA 4K3EL 4TVPL 3BEVB 2LU4A 1OW0C 3GZKA 1MJJA 5LWYH 2VXTL 4R7NB 1NC4B 1RZJL 3FFCA 3JWOH 4ZO7A 1F00I 3UJJL 3BE1L 4XNUH 1OM3H 4EDWL 4I0PC 1RUAL 2YEZA 3MRKB 3OAYH 4KVCH 4O58L 3HZKA 2ESVA 4I5BA 4YFDB 4G7YH 1F6AB 3VCLB 3S88H 3ESUF 3T04D 3SGDH 1K4DA 5C0BB 5T3XH 3CVHH 4S0SD 5HHQA 5K59F 3QUKA 3SKOA 1Z9MA 3L5IA 5DFVD 4FRWA 1T3FB 2WNGA 5C71A 3RVXC 1QLFB 3QQ4A 5D96C 1ZVYA 2EECA 4JFZH 1MCNA 3QCUH 5IQ9B 2A0LD 1U95A 4FFZH 4LLAA 4XC1L 4OCLC 43CAB 4JY6A 4OUUA 2OLDA 2A77H 1U8OB 4HT1H 4XWOC 3GIZL 3PHOB 2XN9A 4ZFGL 4MD0B 2YMXH 4HQQL 5DEFA 3NABH 4YFLI 2EDRA 5HY9A 1KTLB 5C08B 1KIPA 4G8EB 4M7ZB 1IGYB 4BFIB 3DYMA 4RWYL 1OVZA 1JRHI 1S78C 2R1WB 4Z7OF 4Y5VB 4H88L 4Z8FH 1T83A 4JANB 5EWIH 4DKEL 5D7IA 1BOGB 4ZQKB 4FQCH 2EDOA 5EORH 1DBKL 5ICYB 1BF8A 4POZC 1PLGH 4JO3L 5IHUH 4G6KH 4MNQE 2IALB 2FIKB 3JWDC 1V5JA 3NMEA 3QQNA 4TTDC 2ATKB 4XP6L 1JWSB 1A6UL 4HFWA 4ZFOB 2R1YB 5I19H 4JFDE 5HHNA 4RISH 3QCTL 1U8IA 2QHRH 4Q6IB 3FN9A 4R4BA 5C0JA 4WEBL 2AGJL 3CFBB 5DMGC 5IR1A 4OM0L 3TA3B 3MV8A 5HHOA 1QFWL 2YK1L 3PV6B 4IRSA 4AYFA 1KCLA 3Q0HA 2A83B 2AV7A 4LFHG 5FYJL 2W91A 1X4XA 4U33A 5BW7A 2YWYA 3GMNA 4LASH 4Y16B 3IDMB 4H8WC 5C0RH 2H1PL 1KBGL 2YHGA 3VH8A 5J1AB 1OSPL 1YUHB 4YHPA 3WE6A 4AENB 5MI0B 3BKYH 3CC5B 3I2CL 4NC1C 3S98A 3E6FB 3NA9H 4WEUD 1FNAA 3SJVA 3VD3A 1Z0MA 1JWMB 2JJTA 4CVXB 4LLQB 4M1CC 3W11D 4MMZC 1NGWB 1YPZB 2YD4A 3QWOA 4YHNA 4PD4J 1AH1A 4CL7A 3NCBB 4XB7A 3ZL4H 3MRDA 2A6DA 1ZLVH 4HC1L 4NUJB 4XNYL 2HAZA 3PWUB 3JWDL 4GG6B 4Z7WB 4ETQB 5IEHB 4PJFF 5E4EC 3HPLA 4W70A 3BWAA 3LD8C 1J1XH 4JJ5B 4CJ0A 2EDHA 1I1AC 1FBIL 4O00A 3TH2T 1I1FB 4F7MB 1AXTL 3T0AA 4YJZL 3NCYP 4LQ1A 1NAMB 2W59A 3KWWB 2YPKA 5MEQB 3IFOB 3MRIB 1F90H 3LB6C 1MFAH 3QIBB 1YPZF 3VE0B 1MEXL 1BLNA 1AD0B 4F57L 5AYUH 1UXWA 3SCMA 5BMFH 3HAEH 1T7ZA 1P5VA 1ZHNB 3MRJA 3EYOA 4H8WL 7FABH 3MX0A 5I30L 1HQ4A 2Y23A 1FVCB 5ERWA 1J87A 3DO3A 4JR9H 1NBVH 4I18A 2P8MA 3WD5H 3I9GH 2B4CC 3R06B 5E6ID 1KT2B 2Q8BH 3P4MB 4WFHD 4NBZB 4FN0A 1J8HD 1MIML 3QPXL 4K94H 1BD2D 3PDOB 3ZT5A 4P2QA 1IGFH 3EGSA 1FYHB 3X13A 4O2EB 4UINL 2PO6B 5KW9L 2CKNA 3BQUA 4R8WL 5T1LD 4LHUD 5JQHC 2GTZB 3HMXH 3BRDA 3HNVL 4N8CL 4D9RD 2J4WH 4GKZA 3P0YH 4OLZL 1DN2A 1PZ5B 2MCPL 5C0CA 2D3VA 4PJ8B 2FSEA 4N0FA 5I76B 3FQNB 4NKMB 5I73C 5IB4B 4RZCA 4X4XA 1QLRB 4Q9QH 5GGQH 2Z35A 3D0VB 1R6VA 3J8F7 4M61A 5DQDL 4RFNB 3MZTA 1DVFA 3PWVB 5EUKB 4HKBB 4IM8A 4Q9CA 4H1LH 1EEZA 3DV6A 2ZG1A 4XCEA 3O4LB 4TVPD 4HWBL 4X5XB 1KFAL 5ICXB 3KDMA 3NTCL 5CBEB 5IG7A 3CXDH 1A1MB 4CN6A 1NFDB 4OB5L 1YEIH 4KRPB 3QCVH 5IVXE 1WWWX 1C1EL 4PJHE 3T3PF 2DB8A 3L1OH 1LK2A 3X3FL 4ELKB 3ELAT 4UV4L 3HA0A 3ZKND 3LH2L 4LKCB 4BA8A 2K7PA 4OGXL 5ITFA 2JELH 3WKNA 5DJXB 5HGDA 1MFDH 1DEEA 4X99A 3BP7B 4Y4FB 4YNYA 5DRXB 5F9DC 1FYTE 3GB7A 2EZ0D 2CLZA 5J7CC 2OZ4H 2HT4C 3KR3H 3JUZA 3VFNB 5I75B 1CN4A 3L5XH 5H35B 4RX4A 2VZTA 3P3YA 4OD2A 5IBTH 4ODUA 1ZV5A 4PJDE 5GS3A 1OY3B 3FTGA 5E1HB 4DW2L 4NJAL 1RUKH 1I1CA 1BWMA 3HI6L 3GMLA 4L3CA 3QEGH 4TOYH 3NAAL 3DVGA 2KH2B 1NGZA 1EVUA 2BSED 5EC2B 4DQOH 3MRLA 2IMNA 3W39A 4S1RL 2ORBH 4LNRB 3OGOE 1RMFH 4WWKD 3UXFA 5JTWA 2BOBB 4FQXA 2R0ZL 5I74B 4J23A 3NACH 4WO4A 1S5IH 1BEYL 2E7MA 1I8MB 4PG2A 1KJ2L 5CP3H 4XBEH 1N0XH 1W8NA 5HVHC 4L9DA 2GTWA 3H2WA 5FYLE 1JGEB 3CFJA 3FB5B 4KC3B 1IKFL 1K8DB 3BAEL 1UKTA 4PYHA 1YEFL 4RAHA 3GSNB 3OKDB 2HFTA 3CFKA 3DX6B 4G80A 2O5ZL 2X4QB 4TSAL 4XBGA 5A16B 3C5ZB 2CIIB 3D85D 3GBNL 5IIEB 2R0WL 4LVNB 4ESKA 4WNQA 3WNLA 1CQKA 1MFEL 4KJPC 5IB3A 3QHTC 3WJLC 4K9EC 1CE6B 3OXSB 2VXSH 3RVXD 2AJ3B 4QHKJ 5ACZB 5GGUB 3T3ME 1MOEA 4HWEH 1INEL 5EDXA 5FHBH 5IHZA 3NGBB 4YQXH 4MX7A 4XWOD 3NZ8A 3DRQB 3FQTA 5D1ZA 5GRWA 4Y4KA 4UNVA 4ODSH 3BVNB 5IW6A 5FYJD 5GGSA 4JFQA 1VGKA 3W5NA 3UPRB 1EHLH 5D5MB 3X14B 3CDYA 3GJFH 4KK6C 5D1XC 4YHZL 1IEAA 1T6WA 2DQDH 2XTLA 2V7NB 5EU5B 5ID0A 4GG8A 1QBBA 3TZVC 3DYPA 3GI8H 4DVBB 1HKFA 3Q5TA 1CR9L 3RDTD 1D7FA 1W72A 5ISZA 1RK0B 4AEFA 3HUJE 3B9DA 3O8XA 3MSPA 5TE7H 1S78D 4KHTH 3QI9D 1JF6A 4BSJA 2PW1B 3DV4A 3I6GA 5EO1A 3WNKA 3Q6GL 2V5MA 2Y5TB 1CVRA 1AGCA 4NRZA 4ODVH 2OL3L 1J1PH 4POZD 1DCLA 2FZ3A 3VJ6B 3O0RH 5D5MF 1CFSA 2HN7B 2FATH 4XCYB 5IB1B 1D6VH 2H2PC 2K9UA 2CIKB 4LQFH 4XMKH 5BRZD 4K55A 1PBYA 2DQFB 4K7PY 1G9MH 4QHMA 5HPOA 3G6AB 1F13A 2H6PB 4C55A 5DMGD 4GSDH 3RGHA 3WFEH 4TNWF 2P48B 5CJBA 1FHGA 1PSKH 4ZSOB 5IW1B 1JNHA 4D3CL 1YQVH 4M5YL 2Y25A 4U1SA 1FAIH 2P8PA 3HZYB 1C12A 4HGWA 4Q2ZB 1CI5A 3FO2B 5DR5L 4J8RA 4W6WB 4LVHB 3ARQA 3DXAD 4NQXA 3SDCB 4FTVA 4AK1A 3H42L 3LKNB 3VRIB 1GSMA 1GL4B 5BS0D 5CWSA 3TO2B 5BV7B 2GAZA 3HNTL 2R56H 5HGBA 1T4KA 5M94B 4X7CC 4JVPA 1N26A 1U8NA 5DA0B 4LSQH 1P84K 4K23H 4KKLC 3ZE2E 4MAYA 3QNXB 3LS5L 4Z0BL 3BUTA 5TE4L 3MLYL 2Z93B 4NNXA 4PRIE 2J8UE 3T65B 3C09C 1MQKH 3NFNB 4CDHA 5D8JL 5AUMB 4AEHL 2X4PB 4NT6B 4YXHH 4YDJB 5IVXA 4ZAKB 3MLRL 4NQED 2ADFL 1JGVL 2YSSB 3AMLA 4JO4L 5T1MA 1RVFH 3AU1A 4TUKL 3O6FA 1A6WL 1QBLL 3DMMC 4PLKC 5GJSL 1EFXD 4I0PA 1S8DB 4XP9H 1UM6L 2HT2D 4PBWD 3VWKC 4JY4A 1VEMA 5DZLA 3MRMA 1NLDL 1T03H 4F33B 1WWCA 2YD5A 1T5XB 4IDLA 2F19L 5JW3H 3FOMB 5C09B 3AS1A 4EI5C 2OBGA 3P4NA 4R0LB 3EYSL 2OR9L 4HUUA 4XNXH 3QPQD 3CZJA 2AEQL 5L88L 2X4OB 5F7FA 5E2TL 5F9AC 2P43B 4WW2B 2EE2A 3PDDA 4K7PL 1FCGA 2M26A 1QR1B 5F9WB 4X8JA 4YDVA 1N2RB 1MCRA 1HYRC 5JHDD 2VLKE 3F7YA 3CFIC 4M1DL 3DETD 4KPHL 1BVLB 3QFDA 5LKNA 1PFCA 5IVXF 4PJHF 3W0WD 5SWZE 3UZEA 1MCWM 3ES6B 5TFSH 4WJ5B 4I0CC 4XRCB 3GMPA 8CGTA 3B9VA 1WBZB 2IJ0C 3HI1A 1DQQB 2BSRA 3D6GA 1UWEH 4G7VH 2HFGH 4JN2A 1AHWA 3MXWL 4JM4H 3BD5A 1EEUA 1BJ1J 4IMLB 4MJIE 5IHBA 2DL9A 3RVWD 1HHGB 4KROD 3RPKA 1CXIA 2VE6A 4PJDF 5KSAB 3VFSB 2FX9L 1LDSA 2H45A 4OCMC 4S1SL 3M17B 3BEWA 2XACC 2FLBT 4C56E 5I1EH 1ZA3A 1MRDL 2CRIA 4L4TB 2AW2A 4OCWH 1UXSA 2VQ1B 4MJ6A 4PRHD 2VERN 3P0VH 4LNVA 5L2KD 3UJTH 1SJHA 2BERA 4JFFE 1T1WB 1MJ8L 2DQUL 5EU6D 5CD5C 3W9EB 5FO9B 2P5ED 1GGTA 2BNRD 1FFOA 1YYML 1HEZA 4ZUUA 4R7DA 1FJ1A 3ILPB 3OR7A 5KAQF 3S35L 3V0VA 4HAFA 3QO1A 4L3ED 3HUJA 3PXHA 4XCFL 1A21A 4MCYA 4TTGA 1FNGB 4PJ9C 4BSWB 3HE6B 4RGMC 4ZG1A 3I50H 5IKCA 3P30H 3DVNA 4OZGF 4NJ9H 1J0KA 3PQYD 5SX4H 4ZPVB 3W2DH 4QHUA 4GW4A 1S7RB 4YPJA 5GS0C 2NYYD 5BZWB 1QSVA 2F58L 1EGJH 4J1UA 4UT7L 1BAFL 1WAAF 3Q3GB 2VAAA 4LFHD 1JZ4A 3BXNB 2FJFA 1A0QL 1JRHL 3U46A 4QRSB 3T3MF 4WUUE 4YHOH 1G9EA 1N4XH 3EYUH 4JKLA 3C9NB 4DTGH 5IJVB 3RL1B 5I9QC 4WI9A 3SPVB 3RNQA 3UAJC 3E8UH 2V17L 1O0VA 3BN9C 3MRBA 4QTHA 2EYRA 2KQMA 4QLRA 3CFCL 3S96B 4I0KA 1F4WL 3IFPA 1MCKA 1MJUH 5ABDE 1MF2H 3GNMH 5TGBA 1FFPA 2NW2A 2AXFA 4RGNB 5EPMA 4HIJB 4B0MM 2GHWB 4LSRH 3AAZA 2GUOB 2D03H 1MLCA 4X6DE 1ES0A 4WTXA 4PB9L 5F97E 5DVLA 1QHOA 2FWOB 2R29H 2FD6L 1DUYB 4RNRA 1MCOL 3QDMA 4MDIA 1Q9LA 4V1DD 2R4RH 1LD9A 4F7EB 5CBAB 4MA1C 1EZVX 3IT8D 2AK1L 5LBSL 3WDJA 1OT2A 1HXYB 3TZVD 3FONB 3VRJA 4IDJL 2VLJB 4QGTA 4X80H 1RJYA 4NQSA 4MB3A 3RUGB 4AH2B 2I9LB 5F1SA 1IMHC 1D5IH 2PXYB 2FL5B 1QZ1A 1YEEL 1UVQB 5LQBL 3QUYC 1DBBH 1RUQL 3M8OH 5GHWL 2IPTH 3PL6D 4R4ND 3IKCB 3T0EB 3OR6A 2AEIT 1ND0A 5E94B 5TDNA 2AJYL 2HKHL 4KRMB 2NW3A 1FNHA 1TZHA 5J6HB 4GKNB 3MBED 4H1LG 3HRPA 2OR7A 3SE9H 5HI5C 5E9DD 2QKIB 4P4KC 2F53E 3MA9L 4XNZB 5HGHB 5M95B 1EMTH 4S11A 4Z7UA 3DURA 5F1KC 1G0XA 1QRKA 3KPRA 3DUHA 3WFHB 4Y2DB 4DZBB 4RMQA 3LV3B 4XCCL 3RTQA 1DQDH 1UB6A 4GQ9H 2BHZA 2DQEH 2P42B 2VR4A 5IB5A 1AXSB 1OCWL 5CUSL 4RA0C 5CSZB 2J8UF 2VLKA 1RZ8B 5FDYA 1DFBH 2FJHB 3RVUC 1GGIL 1T66C 5SWZA 4Q9RH 3U36B 3C6LC 5CGYD 4IOIA 1OARH 4IS6A 1H3WM 1HSAB 5FKPB 1QEWB 2VDLL 1UM4L 3EAKA 3MGOB 2JK5A 3TWCH 4RFEA 1U93B 1LEKA 2RR3A 1MI5E 1P7QB 2A6KB 3KHQA 5D2NC 5A2LH 4GRMB 1FLTX 3FN0H 2AJZA 4O4YH 3UEZA 1OTUC 3IDUA 2C1PA 4MJIA 5E5MB 4R26H 4QWWD 4FQPA 1K9TA 1R5IA 2HJLB 3VXOB 5I8KL 3S36X 3OG6B 2G75A 1NGPH 1NBZA 1Q9KA 1DLHB 1RPQA 2OTWA 5SX4I 5I1CH 5FGBC 1TCRA 4OGAD 3DMMD 1F3JB 4XWGH 1D5ZA 4NNYB 2PR4H 3V52H 1GVIA 4JFFA 4ONGH 1J1OL 1W72H 2F54D 4N9GB 2VISB 2DKSA 1CK0H 4B41A 4P59L 1QR4A 1C7TA 3U79A 1T2JA 4I2XE 1M71B 2R2HB 3HKFA 2EEDA 3FQWB 5TDOB 1AR1C 1KC5L 2RCSL 1H8SA 3HI5L 4TULL 3BKJL 1KG0A 5F7LB 3KLHC 1SJEB 3ZYOA 1FSKC 4BYHA 4RWHA 4KAQH 1NCAH 1OF2A 1L0YA 2A1WH 3GKWL 3JTTA 4KQ4L 4L8SA 1XIWD 3PGCB 3QZWG 4XX1E 2M2DA 5CEZE 3HB3C 1SY6A 2EDLA 2H32H 1C5DA 2FCBA 4KUZL 3O2DA 4O2FA 1A1OB 4PJXE 2YZ1A 3PHSA 1FPTL 2XG5A 4D0BB 1PZUB 3NPSB 1NC2A 5I1KH 2BSTB 1CFTA 3SDXB 4LL9A 4F15B 1W0YT 3U4EA 3ARGB 4HKXB 4P2OA 1ZAGA 3IJHB 5E8EA 1SQ2N 5DURB 1CLOL 1KNOA 4LEOB 4EKXA 1RK1A 4G8GD 1GC1H 1CXKA 4PD4K 2LV4A 5DHVH 3P4OB 2Z92B 1P7KB 4P5MB 4PJGE 1IAII 4JHWL 3I3BA 4MXWH 3ZO0A 4ACPA 2MQ3A 1CG9A 4FQIL 3VXQA 3D0LA 3JXAA 4UDTB 1NGQH 2DJSA 1DSFH 1CE1H 2PNDA 1MHHA 2P47B 3LDBC 4FMFA 5GZOD 5A3IC 3VFMB 3VFRB 2GJ6D 2GK2A 4MA3B 4I48B 1MSPA 5K9OA 5BO1L 3ULVE 4JZOB 5ADPL 1T1XA 1ZA6B 4B50A 1ZMYA 4UIMB 1I4FA 1Q72H 2HFFB 4N1CA 5FCSH 4XVJL 3KPSD 5HHVH 3JV0A 2FH6A 2IQ9L 4UU9A 2JIXD 4LGRB 1II4E 3O3EB 4MZ2A 5DSCB 1RUMH 3SKNB 4XNMA 1LO0L 4OLXH 3UTTE 4EVNB 1IC5L 2NY1D 3JV6A 4GW1B 1D5XA 3I6LE 3WHE0 4WCYH 4XC3H 5CAYB 1JNLH 3FKUS 4PGDA 2V9RA 1IGIH 3L5HA 3QBTB 4OZFH 1JN6A 3GSQA 4N5UA 1XCQA 3P77B 1TTFA 4L1HA 3EW3B 4AMKH 3U30C 2DI7A 4PJBE 2VXUH 1FGNH 1RIHL 2F53A 5D7SL 4JB9L 3CMGA 4J3XA 3H7BB 4X6DF 3KPOB 4Z5RB 4KTDH 5D93B 5DLML 5FECB 5FB8A 5F1IA 5KSUA 4UNTA 3HZVB 2WV3A 4NGHH 4LLWA 3UTSE 2XQBH 4Y1AD 5AD0B 1WFUA 5EC1B 3U0TA 1B3JA 2XTJE 2UZIL 3ROOB 2DJUA 2V5SA 5FYLH 1H3PH 3VFWA 5KJRL 1EO7A 5DJ6B 4HPYH 2VABB 1VFAB 1KB5L 4LLUA 1I8IA 2YD9A 4FNLH 2C5DC 5D71L 4QRPB 3PP4H 1KELH 4AZ8A 1MI5A 4P57A 2LU3A 3L3JA 4ZOCA 1CCZA 4GS7C 2Z4QB 1OTTC 5LGJB 2CDEA 5HHMD 3MJ9A 5E24E 1BBDL 4G9FB 4L4VB 3NIGE 2KBGA 1G7JB 1Q0YH 4JO2H 5DRZB 3RWHB 3LS4H 4PJAB 4NQCB 1PEZA 1YNKL 1OP9A 5IMLB 2IADA 3HS0B 2ZPKL 1AGEB 5CJXA 5JOPD 2CKBB 4RQQA 2BC4B 4E42A 3GSOA 3KJ4B 1HILA 2EE3A 4CMHC 1A7PL 1TTUA 2AK4E 4YE4L 4U0RB 4U6VH 5CIPH 1MCWW 4JZNA 3ZDYE 4ZUSA 2H9GA 2YBRB 2CDGB 4GLRH 2XI9A 4D8PB 4G3YL 3MJ6A 5AWNL 4N8VG 5C0GA 3X17A 5AZEH 1GXEA 3EOBB 2A6JB 4FA8A 3SDDB 1MCJA 4HPOH 3SKJL 3VXRB 5I8OH 2V9QA 4HGKC 3QUXC 1KUMA 2KL6A 1MJJB 1A7OL 1OOAA 1IM9A 1DBAL 3FFCB 4HJJH 4NCC2 5EU3A 4NM8L 3WO4C 4OD3H 4LCCA 3ULUE 1JF5A 3CK0L 5F3BA 2MKWA 4E5XA 1ACYL 2YEZB 5F72S 1T1YA 1R24A 3BMVA 4PB0H 2X7LA 3HZKB 4JCLA 4PJXA 2ESVB 4HJGB 4I5BB 1E4KA 3RA7L 1I9IL 3I85A 5I1GH 3QJHA 1K4DB 1P4IL 3C6LD 2Z91B 5HHQB 3QUKB 2XZAL 1LNUA 3SKOB 3L7FA 4WHTA 3QQ4B 1PG7L 5HDQH 1IZKA 5BQ7A 1RZGA 1AGFB 2ICES 3M45A 3L3DA 4CBPA 1U95B 4M4PA 3C60C 4PJGA 4WDIA 4JY6B 3LZFL 1RD6A 4OUUB 3OZ9L 1VADA 2XN9B 5T33H 3I3EA 1Q1JH 1J5OH 1OTUD 5E2VL 5DEFB 1OGAD 1E6OL 4GRLD 1JL8A 1SMOA 1WISA 2ICWI 5D7LA 4ZOBA 3S5LG 3SY0B 5GGTH 3QWRD 2XWBA 3VXSE 3ZHLA 1NDGA 3MRPA 5JPNA 1ZK9A 4FQLH 3HE7C 5F9OL 2BVUA 4Z78B 1KCRL 1MFBL 4P3WA 4CMMB 5CSGA 2IGFH 2F5AL 5INCA 3VXNA 4Z7VE 5D6DC 1G7IA 5JO5A 1MRCH 4OZ4A 4LCYA 4EN3B 1V3LA 3CMOH 1MWAA 5HYSA 5F6IC 4POUB 5CJOH 3V7AG 5I1LB 4KQ3H 4I9WD 4HFWB 1EJ6A 3WXVH 5HHNB 3A67H 4NUGL 1U8IB 5FK9A 3WIHL 4AIOA 2VDNH 3ZDZE 2RFXA 4NQTA 3KLHD 4XGZA 4XBPA 2PYED 4DEPC 3QEQD 5IR1B 1UA6H 3MV8B 4J4PD 3CDGA 4M6MH 5HHOB 2MFNA 4MNHA 5E6YA 1T21A 1U36A 3RRQA 4GQPH 4GRWB 4U05A 2AV7B 2X5PA 5T5FL 1K2DA 5F7YC 1JV5B 4WFHE 3V0WL 2VDPH 3GMNB 1BD2E 4DVRL 5CLTA 2ITDB 4ZXBC 3V4PL 5HYIA 4N0UA 4CU8A 5IESH 5H8DA 4ZTOL 4OI8A 1OPGH 3VH8B 4CGTA 1IGCL 4C4KO 1CICA 2EXWC 2H26A 5E0QA 4YXLH 1U6AL 3QUYA 5CZVH 3FO0L 4RAVA 3UTSA 3L3IA 3WHE1 2B2XH 4JKPL 4BKLA 2BOCA 3TA3C 5B39A 1KPUB 4WI2A 2CH8A 4YHPB 4O9HL 1RJLA 4KKNA 3MRGA 3WHXA 3SJVB 4NWTL 3CLEH 4Y16C 3VI4E 3MGTA 4GRWF 4OFIA 3IAPA 3H6JA 1PQZA 4P4KA 3UPAA 4P2CG 2QTEA 2UZYB 2A6DB 4S2SA 1LE5A 3DIFA 3HPLB 3PNWA 1KTDA 5DD0L 4DK3A 3D18B 1S7VA 3IETA 4IRJA 3UDWC 4LMQE 4DOHE 2HWZL 4IIQC 3U7WH 2Q3ZA 4HK0A 2Y9RT 1DQTA 4HLZH 4PJBF 1NCTA 2GY5A 2IG2L 5EUOA 3T1FA 2YD6A 2YPKB 3T08A 2IAMB 1NCCH 1MQ8A 1PKQE 1Z9LA 5EIVA 4FQQA 5E4IA 3A6OA 1A6PA 5C1MB 5IT2H 1BLNB 3BX7C 1UXWB 5DFTA 3OAUL 2EH8H 2HT3C 3HNSH 3O2VH 4MB4A 4P4RB 4UIKH 5B8CC 4ZFOL 1JFQH 5FHAL 4IEFB 1EK3A 4JM2A 3GHBH 1HQ4B 1KB9J 4JRXD 1INQA 3VU2A 4CJ1A 2AK4A 5ERWB 3BPOC 4WI6A 12E8H 1MCHA 1OWWA 3PF2A 4I18B 3S4SA 3B3IA 2FHFA 2KPNA 4KJQC 1V05A 4NNPH 5D2NA 3LCYA 2X05A 5A2IH 4P2QB 3EGSB 5TPWL 3TC9A 3IDYB 1KIQA 3C6SA 1JIBA 4MAUH 4QOKD 4JG0H 4Q74A 4XP4H 3X13B 3TV3H 1B4RA 4OZIA 1ZVSB 3BQUB 4X4ME 4OFVA 4NO0D 4AEIH 1SY6H 3BP5A 5E5RB 3AS3A 3WYRA 2MPAH 3O2DH 2AABL 2RJMA 1U8KA 5C0CB 2FSEB 3K8MA 4NHUA 2K1MA 1QG3A 1HK6A 3V6OE 3NIGF 3LRHA 4RZCB 4X4XB 2QQLH 4NZJA 4X7SH 1BQHB 1I7ZA 2Z35B 4M61B 3QO0A 4U49A 4P46A 3EOAA 1SJXA 3QIUD 1V3MA 1DVFB 4JCMA 2FR4B 4R4FH 4F7PA 3RGVA 1EEZB 3ARBD 2ADGA 4QYOA 4XCEB 1UADC 1BBJB 3AVEA 3KDMB 4OM1L 4YZFF 5IG7B 3IGAA 1I1RA 1QSFE 1JHLH 1K3IA 2HLAB 3IDJA 3ZDYF 1LK2B 1OTSC 1Y0LB 5MEPB 3KJ6L 4UQ3A 1X5KA 4RFNC 5ITFB 4LSVH 1FZOA 4MD5A 2JE8A 1NAML 5HGDB 4HH8A 3A6BH 1DEEB 3MJ7A 4X99B 4AEEA 3OAZK 3AB0C 4YNYB 4NRYA 2EDTA 1A7RL 1O5DT 3GB7B 5D7JB 4BFGA 4EUPA 2P46B 5FYJE 3B43A 4R3SA 1R3IL 2EEAA 5DK2A 3VFUA 3VXSA 5DEGA 3OKMA 3TNNA 4KRPC 2B1HH 3VFGH 4LLMA 4OD2B 3KPMA 2WSKA 5GXBB 3H9SD 3H3PL 4ODUB 3FTGB 1IT9H 2CDFB 1E4WL 4M5ZL 3GMLB 4L3CB 3GJEA 3S6CA 4Z7VA 4XPHL 2XZCH 3SE8L 4FZ8L 2EDKA 1FDLH 2VH5H 3MRLB 1QKZH 3W39B 1X5YA 2Y06H 1KJMA 2HRPL 4FQXB 4DN3H 5KS9E 3QUXD 2E9WA 4WO4B 2DYPD 1A7NH 3WJJC 4AQOA 5FO8A 2GTWB 4KMQA 2NTSP 5DMKA 3DO7A 5BRZE 2F9BT 5D6CA 2XWTA 1AC6A 1LMKA 1BPVA 2XQYK 3CFKB 3TJEL 4G80B 4NWUH 5E6IA 3SOBH 1QUNA 4XBGB 4OFYA 5J57B 5T1DH 1V7NL 1BVKA 4PRPD 3PJSA 5I1JH 4CN4A 3ALXA 5ALBH 4EBQL 4JKWA 4WNQB 2IBBA 2Y72A 5TF0A 5IB3B 1NC4D 5ANME 5EU7C 5BZDA 4JREB 4PY8J 5FUCC 5T1LA 4OZFG 4LHUA 4WTWA 3DXAE 4O02L 2D9CA 2B0SL 1ZGLA 4OJFH 4YWGH 5IHZB 5FOBB 5E95B 3RY4A 4Z7VF 3NZ8B 5IHLB 3FQTB 5D1ZB 5BS0E 4Y4KB 4LEXH 3SKMB 1DBML 3S34H 5IW6B 5GGSB 2VXQL 1VGKB 2CRZA 4YDKH 1G7QA 3IDXH 5C0BD 2OYPA 1JWUA 4M6AA 5DDHA 5ID0B 4QNPE 1Q94A 3QDAA 1OAUH 3O3DA 3ZDZF 4XHJC 3U0PA 3MXVH 4L8CB 5ISZB 1IAIL 3O8XB 1R5VB 3THML 3BT2H 3F12A 1U91A 1TPXC 2IH1A 4JPWL 2NY6C 3CXHJ 3DV4B 3I6GB 5EO1B 4NQEE 3TPUA 3QG6A 1XF5A 2YKLH 5KAQG 1WEJH 4JFEE 4NRZB 1AGCB 1Q9OA 4FFYL 3QXWA 2DWEA 2FZ3B 3IJSA 4PJEE 3K74B 3BKMH 5C08D 2O5YL 2Y07H 1CFSB 4AIXA 4UOJA 4W81A 1KCSL 5C0FA 2D4FA 1HZHH 2V5RA 2CLRA 3RWDB 4J12A 3UO1H 5F7EL 4QHMB 3OQ3B 4HHAA 4M7JH 1BM3L 2E6QA 8FABA 3GSNL 4ZYKA 4WFFD 3B9AA 2LABA 5DGQA 5LAXA 3AXLA 2OTPA 4PLOB 1JNHB 3IF1A 2WM0A 2NXYC 4U1SB 3C2AH 4DAGL 1CD1B 1FG9C 2HKFL 1RIVH 2VLLA 1C12B 1PEWA 2EC9U 5CEZH 4X4MA 2YPLA 4J8RB 1MAMH 5KVDH 3QUMH 1GH7A 5JPMB 4NQXB 5TQ0L 4JLRA 1CFVH 1AFVH 5JHDE 4FTVB 3SE3A 2EDJA 1VACA 2E5EA 4OIBA 3TA3D 5CWSB 4MXQD 3O45A 3V6OA 3VA6A 2VO5A 2GAZB 3REVA 2GJZA 5HGBB 1T4KB 4HCRA 1FIGL 2FYYB 4KJYA 2PW2A 4UILH 1CLYL 3B5TA 1U8NB 2JLLA 3TBSA 1RZKH 1HCVA 5IROA 2HLFC 4Y16D 4MAYB 4HXBL 3H0TB 4DJMA 2J6EL 3D85A 3BD3A 3OPZL 4NNXB 4HBCH 3SDCC 5KVFH 1EUTA 4G43A 1J86A 4JFPB 1QSFA 1QBMH 4H20H 4D94A 2VMFA 1ZANH 4G5ZH 4HSQA 4V2CB 1PYWA 4WVRA 2DIJA 4JY5H 5BV7C 3PE9A 5EIIB 5T1MB 4JKKA 3O6FB 1OAZL 1QLEL 4I0PB 4GBXA 5K9QI 1F8TH 4DKDC 4JY4B 1PAMA 3R8QA 3MRMB 5J12C 4LPWA 1PVHA 2WP3T 3DSFH 5L2KE 1GIGL 5KSBA 4M62H 4CNIA 4MQXD 5KN5A 1F4YH 3CSYA 3P4NB 2I60L 5EU6E 3OKKA 2BNRE 4HUUB 4HAGA 4XVUC 2AJXL 4FG6C 3K2MC 5DF0A 1FZMA 3C60A 2BVTA 2OXHA 4HF5L 3T09A 4WHCA 1MRFH 2Q7YA 2NLJB 1MWAH 4KY1H 4F3FA 3QI9A 5I15H 4OQTA 5B21A 3VWJC 1K6QL 4Q97A 3CCHA 3NZHL 1IFHH 4KTEH 2G9HA 3QIBD 4QEGA 3PGDA 3F7VB 4X8JB 4YDVB 1T5WA 2C3XA 5DD6A 1OSZA 1FL5A 1G9NC 3F7YB 4I77H 1ZWIB 5KS9A 2VZ3A 3E3QC 3QFDB 4HC1A 1HINH 1VENA 4LRNL 2DD8H 3K0WA 4ERSL 1KIUA 5C7XH 2VDRL 5FYKH 5IV2A 1WZ1H 4XMLL 4JQIL 4KFZC 1BZ9A 4AL8H 2ZUWA 3QUZC 3GMPB 3G08A 3G5VA 4HFUL 3HI1B 5BV7L 1BVZA 2BSRB 5EFIA 5A40E 1A5FH 3LQAH 1MIEL 1DQLL 2YR3A 4FFVC 4X6CE 4JAMB 4JN2B 5D6DA 4D0DA 4RMRA 1AHWB 1YYLH 1U2CA 4RRPA 2PO6D 4HX1A 3ZE1E 2C3WA 5E08H 1A6VL 2EXYC 1JUFA 4Y8AA 5ANMA 3WEXB 5LXGL 1R3KA 4GXVL 1QACA 2VE6B 5IBUG 2APXA 4PJ8D 2FRGP 4XP5H 5EOQL 5E2WH 1QA9A 3VGDA 5F9JB 3BEWB 2AS5M 1OTSD 1ZA3B 4Y5XA 5D70H 1WICA 5BS0A 4WHYH 1KCUH 1FGVL 1UXSB 4MJ6B 4M02A 2AEWA 3F6LA 1Z3GL 3AREA 3GBLA 2CK0L 1UWGL 5IF0A 1SJHB 4WFED 1IL1B 3O4LD 1M7XA 2XKNA 1CL7H 5HI4C 2MHAB 1EJOH 1FFOB 4Y19E 1AJ7L 4B7IA 4BFBD 4ZUUB 4BQ9A 4RAUB 4R7DB 1FJ1B 1G9NL 2JB6B 2X89D 1UENA 4W68A 4KRPD 3OR7B 1L7IL 3V0VB 4A6YA 1EO8L 3QO1B 2QR0A 4J3UA 3RIAK 5I8CA 3HUJB 5FUCE 4OKVA 1BGXL 1YNLL 4YHML 4MCYB 4MA7H 4OCRL 3VXTA 1CGSH 4NQDA 4D9LL 1NMAH 1R3LA 1WT5C 1HI6B 2HMIC 1HKLL 1RY7B 5IKCB 4JFEA 1OAQH 5F96L 4UTAL 3DVNB 4Y4FD 4QHUB 2VR9A 4GW4B 1WZMA 1KPRA 4NSKA 4JG1L 3LOWA 4J1UB 4ZFZA 2VAAB 1BF2A 5FOJA 5FV2A 4P9HC 1MHCA 3VXUA 4HK3N 2FJFB 5E4EB 3U46B 3TP4A 1WJ3A 1KJ3H 5E9DE 1IC7H 1RZFL 1FH5H 4IIQA 1OAXH 1I1AB 1NANI 2ED8A 4CADA 2YPVH 3RNQB 1HNFA 4M3JA 5C6PB 4M8QB 3U9PL 4HLZG 2BY3A 2E8ZA 3EZ8A 3MFFA 3MRBB 4QTHB 35C8H 2FLRT 1MAKA 4KI5C 5D1QC 4MNGE 5IEKA 2DMCA 2RB8A 3IFPB 3TYFA 1YECH 1UEMA 2BHUA 1S7TA 5TGBB 5B8CA 3WFBL 1FFPB 2NW2B 5JHDA 2AXFB 4S0TD 2VXVL 1OP5K 1WTGT 3O9WA 5D2LE 2MMXA 5FM8A 3GMQA 1SHMA 3CDFA 5KTEH 4YAQA 1LDPL 3TF7C 2O61A 1MLCB 2W60A 1MCPL 4NDMA 1ES0B 1TZGL 1KTKE 2HG5A 3C5ZD 4RNRB 1KN4H 5C2BL 3IDNA 4OLEA 1X6NA 3QDMB 4PJEF 5HJ3A 4HS8L 3OKOA 4LAJH 4MDIB 2ARJA 1Q9LB 3MJ8A 1LD9B 2VB5A 3GUTA 1NAKH 1SM3H 4M6OH 1GJIA 3V0AC 3VRJB 1B9ZA 4IRZH 3BDYL 4XHJD 2Q8AH 2A73B 1RJYB 3MGAA 4LAQL 4NQSB 3QISA 3GMMA 1IC4L 3UC0L 3GKZA 4H5SA 4NKOA 2AV1A 4TQEL 4WV1A 1XGTA 3U6RA 3VXMA 3CVIH 3OR6B 1LP9E 3ARXA 1ND0B 4Z7NE 1AO7E 2GSIA 3TLRA 2NW3B 4XMPH 5DXWA 1GHFH 4Q0XH 2OS7A 1G7HB 5LCVL 2F54E 3IU4H 3KYOA 2BNRA 3EDFA 4TUJA 5EZOL 1P6FA 4LSUH 4X9FA 4WW1A 2X70A 4Z7UB 3DURB 2XZQH 3KPRB 1U9KA 3IFNH 3QHFH 4DCQA 4KXZH 3G5ZA 1KEGL 3T0EC 5BVPL 1UJ3A 5JQ6L 1UB6B 4N8PA 1JE6A 2LE9A 3U0WH 1C5BL 5IB5B 2DS4A 3CX5J 1U8QA 2APBA 2QSTA 3MCLH 1I3RA 4PJIE 3QFJE 2EDDA 3UPCA 2BY2A 5GZNC 1BZ7A 4LSPH 2VL5B 1FNLA 1UZ6F 1OAKH 5SWZB 1FL6A 2XNAB 1H3GA 2YC1A 4IOIB 2VDMH 4IS6B 1HH9A 4KDWA 1J11A 1RFDH 3MYZA 2JK5B 4QXWA 1UT9A 3C08H 2DL2A 4RFEB 4HG4J 3MFGB 3SGEH 1RJZA 4X6CA 1LEKB 3ZE0F 2W9DL 5GSRA 3EKCA 5GSVA 1M6OA 2W92A 4P3CH 3DX7A 4O51A 1JYNA 4G8GE 4LP5A 5DJYA 2AJZB 4AT6A 2C1PB 2Q1EA 3RU8H 1CZ8L 1WZLA 5L0QB 5K9QG 1A64A 2YD1A 3SDCD 3LMJL 2Q3AA 4HV8A 3EYFB 1R5IB 1A7BA 2ZCLH 4YDIH 3FB8A 5IW3A 2QQKH 1ZHKA 2G75B 4YDLC 1NBZB 1Q9KB 2OTWB 5HVHB 2GITA 2CGRH 2QSVA 4OGYH 1AY1H 1HYSD 2UVEA 1TCRB 2GJ6E 5DUML 1FO0H 4U7SA 3TBTA 4F9PC 2D9QB 4K3EH 4TVPH 2MNUA 1D5ZB 3QJFA 1T0NA 4FZEL 4P23C 1MHPL 3V9FA 2VXTH 3FFDA 1RZJH 1X44A 2DWDA 4IOFC 3ARDA 4Y19A 1X5IA 4OIIL 3BE1H 1NSNH 2GYSA 4XPAL 5BOZG 4QXUL 3KPSE 3C8DA 5SV3A 4ZS6D 1DEDA 4ZAKD 2Z8SA 4QY8B 5K9JL 1RUAH 1ZGLM 4O58H 4FG6D 4PYGA 2VN4A 1XEDA 4UUJA 3TVMA 5JIHA 4IJ3C 5HYQB 1KG0B 2YD2A 3TN0A 2IBZY 5LGKA 1OF2B 3JTTB 1H5BA 4L8SB 5IMKA 3P9WB 4LASL 1ADQA 1L0XA 2PTTB 1URLA 1WCBA 5DC9B 5FYJU 2GT9A 3V79C 1TQBC 3VGBA 3N06B 4S1DC 2EYTA 5D1XB 5EOTA 1QSEA 5C09D 3CLFL 1NEZG 4XC1H 1SBSH 4O2FB 5DMJB 3GIZH 1NC2B 4ZFGH 4K94C 1CFTB 1HHIA 3U4EB 3BJLA 1FFRA 4PPTA 4P2OB 4LOUC 5E8EB 3MRHA 2YUXA 2VDQL 1KNOB 5I1IL 2EDYA 2QBWA 3BO8A 1RK1B 3BZ4B 4M7LT 4LVEA 2D7TL 2VAJA 4PJ5B 4Y4HA 1XF3B 4MNGA 4PP1D 3WIIL 4Y1AE 1CG9B 2BNUA 3EOTH 4NZDA 4JO1L 5JIIA 3VXQB 3D0LB 2EXYD 4H88H 4GO6B 4DKEH 4F15C 3EJJX 5D2LA 2HFEA 1IAOA 3K4AA 1DBKH 1UCTA 3U7YL 2K7QA 4DFHA 4JPKL 5K9OB 4JO3H 4LU5L 4FABL 4LPYA 3ARFC 3HTLX 5HVFB 1YEJL 4RBPH 4FXKB 1T1XB 4XP6H 4DKFH 1MCQA 4XAKD 1A6UH 1I4FB 2JCCE 4KK5C 3QCTH 1BWWA 4ELMA 2DLTA 1NJ9A 4UU9B 2JJVA 2AGJH 4WEBH 5A1AA 5TJWK 4PGZA 2FBJL 4NOBA 3QDGE 4OM0H 1DBJL 1WLHA 5KSAD 4W6XB 4BK5A 1QFWH 3JV6B 2P1YA 1D5XB 3DROB 1MFNA 2J2ZA 4PGDB 3WFCL 5MEOA 1JN6B 3LEVH 4L4TD 5FYJH 3TPKA 1JZ8A 4JZJC 2BXYA 3R1GL 2HMID 3M1BA 3GSQB 4KV5E 1LP9A 1J0HA 2R0KL 2H1PH 2HTLD 1KBGH 1XCQB 1A6TA 1AO7A 4YX2L 4U6TA 5HHPA 4GFTB 3CGTA 3QP3A 2ED7A 1GOHA 2XIDA 3SQOL 2I9TA 1X7QA 5CCKL 3OJMB 1T80A 1OSPH 3C09B 4R97C 2F74A 3DUSA 1T89C 3DVFA 5FGCE 3LKPA 2F53B 3I2CH 2FEEL 3SGEI 4PRBA 3HE6D 1QFWM 4ZUTA 2NX5E 1OL0A 5F1IB 1KENL 1K3ZA 1RZIA 3SE4A 1WIUA 4LLWB 2YUWA 4HC1H 4XNYH 4GAYA 3JWDH 3VWKB 3VW3L 4XB8A 3U0TB 4GJTB 1XIWA 1SEQL 5KVEH 4KI5D 4PJIA 1P2CA 3QFJA 1OGTA 3VFWB 1ITBB 4ZO6A 4EI5B 1FBIH 4KKCC 3O2WL 1D5MA 1AXTH 1I8IB 1TLKA 1I85C 1E27A 4ZDHA 5JXEA 2SEBB 2VQTA 5DRWB 1U92A 4PV8A 1Y6KR 4W6YB 1N3NA 3REWA 1ZE3C 1XCTA 2OQJA 3B2UC 4P57B 1MEXH 4K07A 4F57H 3VWJA 4Z7NF 2CDEB 1KN2L 4JFYA 4H8WH 5DZNA 1VKXA 5I30H 2NR6C 1XGPA 5E8PA 1Z5LA 3WNPA 4K7PX 4RGND 3ZYIA 1WC7A 4XXCA 1KV3A 2IADB 1OGAE 5DTFB 3O81A 3QPXH 1MIMH 2N56A 5GGVL 3QUZA 1OP3K 4RQQB 5CILL 3GSOB 4UINH 4QRTA 3TIEA 3S97C 3UCRA 3ZKMC 5KW9H 2Y4SA 4R8WH 3WV0A 4JZNB 3C8HA 4WI8A 4XPGL 3MACL 4ZUSB 3HNVH 1CBVL 4N8CH 5FUZL 3MROA 3LPFA 1BFTA 4ETYA 4OLZH 1MNUL 2MCPH 2Y7QA 3AC0A 5C0GB 1CIDA 5FM4A 3FO1B 2VLJD 3WL9A 2EKSA 3Q5OA 2C7UB 1NH6A 2OJEA 2PXYD 3C5SA 5DQDH 1WIOA 3BYYA 3KJ4C 4N5ED 1ZT7A 1IM9B 4Y0GA 3PV7A 3W81A 4PP2A 3P11L 5EU3B 4U0RC 4HWBH 3O3BA 4I9WE 3TYGL 1KFAH 4PJ7E 3T0ED 2VZOA 3NTCH 4CW1A 3L9RB 5F3BB 2R1XA 4YFLF 1NCWL 4OB5H 5JOFA 2PYEE 3QEQE 4PJCE 4HKZB 4NO5A 1G9MC 1C1EH 1NKOA 1T1YB 3G04A 2X7LB 4PJXB 3RFZC 3X3FH 4UV4H 3LQMA 4LPCA 3LH2H 1LVEA 3QJHB 4OGXH 2ARJQ 1UM5L 4M93B 1JPST 1F5WA 1LNUB 4MA8L 4PJ9B 3L7FB 5JZ7C 3IVKA 3GRWL 4Y2DD 3PABA 1RZGB 2R69L 3LEYL 3DI2B 4LARL 3S35X 1B0GB 3L3DB 1BOYA 5HGGS 3FQXA 4ODHL 1MY7A 4U6YA 4WDIB 1HE7A 1A4JA 4N0CC 1VADB 5FXCH 3L6FA 3GSUA 4HXAL 2YN3A 4DW2H 4NJAH 3HI6H 2RIKA 3TH3T 5D7LB 1AQDA 3NAAH 3RNKA 1WTLA 3AFLA 2NY3C 2XWBB 4PRDA 3AS0A 2CKBL 2EH7L 4S1RH 4TSBL 5ADOL 1NDGB 3TNMA 3MRPB 2HVJA 2MOVA 5JPNB 1BQHG 5GIRA 1LHZA 1P7QD 3L3GA 2QSCL 2R0ZH 2GJJA 1ZT1A 2UWEE 2A6IB 2Y6SC 3MTRA 4QGYA 1ZHLA 4QTIL 5D1QA 3RZCC 3ZHDA 5INCB 1KJ2H 2PKDA 2XICA 1MLBB 3QDGA 5JO5B 1IKFH 1FLRL 3BAEH 4OZ4B 1YEFH 4LCYB 1JGUL 5TH2A 3ME0A 5E2UL 1WSST 4GXUM 2O5ZH 2E7LA 3U4BL 5HYSB 2OK0L 4TSAH 3OF6D 4U1HA 4YEEA 5F7UA 3FHQA 3GBNH 1FC1A 3PWLA 3KNBA 4BZ2L 5FK9B 2FGZA 1P69B 2RFXB 3CVHA 4XBPB 4XGZB 1T83C 1MFEH 4JRXE 3CDGB 4MLSA 2AI0L 4S1DD 1A9BA 4JVUA 5ESVA 1INEH 5LVEA 1BZQK 2E9IA 3GIVB 3LEXA 1IJ9A 4NKIL 4LCIL 1AQKL 5DMIL 3H9ZA 2R56L 1E28A 4KGLA 3NFSL 4D0CA 4N0UB 1CGTA 4LOUD 5EB9A 2NX5A 1CICB 3KXFA 2H26B 3QUYB 3FZUC 4YHZH 4RAVB 3UTSB 3L3IB 4BKLB 2BOCB 2JCCF 1FFQA 5B39B 1VPOL 2R0LL 2XTJB 4IRSC 1RJLB 2BVPB 1CR9H 4KRNA 4L5FL 3WHXB 3MUY1 5BW7C 1U8LB 1KEML 3MGTB 1P9MA 3VFOA 1JHKL 1PQZB 3Q6GH 4P4KB 4EOWL 2NY2B 3ARGD 3UBXB 4S2SB 3ESVF 3KLDA 1I7TA 1FL3A 2OL3H 1LE5B 3DIFB 3WUWG 2JJSA 1M4KA 1O7VA 3PDGA 5DURD 3PNWB 5SWQA 1KTDB 1XZ0A 3D2UA 3HG1E 4KV5F 1S7VB 3P2TA 4JEGB 5MENE 2N4IA 1S5HA 3IETB 4IRJB 4HK0B 3G6JE 5H37G 4EDXA 2JJTC 3HPJA 1UWXK 1CU4L 2X2YA 5EUOB 4G6ML 3T1FB 3CH1A 1F58L 4GMSL 4FQQB 1NCNA 1FZKA 1A9EA 3N0PB 2ZCKL 1AXIB 4D3CH 4M5YH 4YUEL 3HRZA 2VWEE 3EOYG 5CEXA 4JM2B 5CZXD 3LRSA 1INQB 5DR5H 2AK4B 3EDEA 5TE6L 1ZLUK 1GPOL 1PGRB 1R3JA 4TNVK 3S4SB 3B3IB 3D39E 2GSGA 5JUEL 5D2NB 3H42H 1MAJA 4YBQD 5HTSA 4OF5A 1KIQB 3HNTH 1GGBL 3C6SB 3O6ML 1BFVL 4RMUA 3RAJL 3QXVA 4KJWD 3FAXA 4UT9L 3SCMC 2WZPD 3EO0A 4Q58C 1VFBB 3OB0K 4OZIB 2OP4L 1FP5A 1RUPL 5DFWH 3BP5B 4PRAA 1D6EA 3LS5H 4Z0BH 5J3HC 5TE4H 3BIKA 1ZLSL 3MLYH 1C16B 5GRVK 3ILQD 2V5YA 4F9PA 2EE9A 3KHOA 4Z9KB 1U8JA 1XMWA 3F58L 4HZAA 3ARZA 5D8JH 3EBAA 1SYSB 1HNGA 2PYEA 1YN6A 5HDLA 4PJCA 2UY7A 5GQBA 5H2BA 4LSTL 4DUWA 5LJYH 1I7ZB 3MLRH 4R96A 4RMSA 2ADFH 3QO0B 3IDYC 1JGVH 2BVOA 4P46B 3EOAB 4JO4H 4TUKH 4F7PB 3RGVB 1A6WH 4KKCD 2ADGB 5GJSH 3SDAA 5K59E 1UM6H 4PRPE 3HCVA 4OFPA 1MREL 2OMNA 1NLDH 5GS1C 2KZWA 3FMGL 2F19H 3ZLQC 1FSKB 3VD5A 1XR8A 3D3VE 3IDJB 1HN1A 3EYSH 2OR9H 2GY7B 4XTRC 4UQ3B 1I9RL 5CJQL 4G6JL 3CX2A 1DVFC 1FZOB 2AEQH 5FDWB 4APQA 5L88H 3MJ7B 5E2TH 2DLHA 4NRYB 4JQXA 3B9KC 4EUPB 2P44B 2GCYA 1L9MA 1G0DA 4QRPD 4R3SB 2WBJC 3OKLA 4S10A 3VFUB 3VXSB 4K7PH 5DEGB 3TNNB 3MV7B 4K2UL 5I17A 5F7DA 3W2DL 4LLMB 3CD4A 3NH7H 4PJ7F 3KPMB 3VMNA 4E41A 1BHGA 4Z7OE 4M1DH 4JGJA 4NN5C 4KPHH 3KPQA 3HMXA 2D7PA 4G9FD 4L4VD 3GJEB 2HVKA 1PKOA 2NMSA 5JIPA 2FBOJ 4NQCD 4ZTPL 2H2SD 4K3JH 1B4JL 4LK4A 4U1NA 3LDBB 1KJMB 3D25A 3VFTB 5C0IA 4U1IB 1QYGL 3AM8A 3MXWH 4KK8C 2FHCA 1XAUA 4H1LA 5EU4A 5C08E 3ARFA 4J3OC 3D5OF 5FAAA 5FO8B 4C58B 4UQ2A 5DMKB 4JRXA 3DO7B 5D6CB 2XWTB 4Z95L 3CUPA 3T2NL 2FX9H 4OIAA 1XGUB 4S1SH 2BZDA 5EO0A 1FNSL 3SDDD 4PBVC 3WSQL 1BVKB 1C5CL 4WFFE 1MRDH 3PJSB 1SVCP 1ZTXH 3VXRD 1I3VA 2MJWA 4WO4C 4ONFL 4J3TA 1UFUA 4TRPL 5EZJA 3BPNB 3FFCD 2LQRA 4ZMAT 3T2OA 5BZDB 3HC0A 2OZ4A 5JMOC 1MJ8H 3MRNA 2DQUH 4JZJA 5K33A 3RVTC 4BSVA 1YYMH 2UWEF 3WNOA 1ZGLB 1X6LA 1DP0A 3S35H 1F4HA 3U30B 1JMXA 1HHHB