5T1VA

Crystal structure of zika virus ns2b-ns3 protease in apo-form.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
217
structure length
158
Chain Sequence
b'VDMYIERAGDITWEKDAETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERARNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS2B-NS3 protease,NS2B-NS3 protease
publication title Crystal structure of Zika virus NS2B-NS3 protease in apo-form.
rcsb
source organism Zika virus
molecule tags Hydrolase
total genus 27
structure length 158
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5t1vA00
3SV8A 3SZEA 1RTLA 5GNDA 5H4IB 1NS3A 2OBOA 3SU3A 1RGQA 2A4QA 4NWKA 3L6PA 3RC5A 3SUFA 2OINA 1CU1A 3M5MA 3KF2A 2GVFA 4I31A 3LOXA 2OC8A 5IDKA 3OYPA 4JMYA 4A1VA 1A1RA 2P59A 4B6EA 3SU5A 5ETXA 4WH8A 2A4RA 5FPTA 5T1VA 3KEEA 1N1LA 2F4LA 3RC6A 2GGVB 1DY9A 2OC1A 1JXPA 4A1XA 2A4GA 3SV7A 4B73A 3U1JB 3RC4A 3KN2A 3SUDA 5EQRA 3OTPA 2FOMB 5FPYA 3LKWA 3H09A 5EQSA 4RI0A 3P8NA 3AK5A 3SUEA 4B6FA 3M5OA 4OM9A 3O8CA 3M5LA 1DY8A 5ESBA 4B75A 3PV5A 4A1TA 2O8MA 5GJ4B 4B76A 4KTCA 3SU0A 3SUGA 3SU6A 4I33A 2XNIA 3SV6A 2VBCA 5GPIB 4A92A 1W3CA 5EPYA 2IJD1 4R8TB 2QV1A 3LONA 2OBQA 1BT7A 2WV9A 4WH6A 2YOLA 2XCFA 3O8DA 5EQQA 2OC7A 4B74A 4I32A 3SV9A 1DXWA 3SU2A 2IJOB 4TYDA 2FP7B 3KNXA 2K1QA 5EPNA 3P8OA 5FPSA 4K8BA 2XCNA 4WF8A 2OK5A 4NWLA 3SU1A 3EYDA 3O8RA 3E90B 3SYJA 5B6LA 3O8BA 4U01A 2OC0A 2WHXA 3PV2A 3SU4A 2WZQA 1WXRA 2FM2A 1DXPA 2F9VA 3U1IB 4B71A 2F9UA 4M9FA 3M5NA
chains in the Genus database with same CATH superfamily
2B0FA 3HK6B 3SZEA 1J14A 2I6SA 2ZDNA 1BB0B 1O5AB 4MDSA 4CR5A 5LPFA 2WV5A 2ZF0H 1F7ZA 4WVPE 1V2ST 4KTUA 4AG1A 1GCDA 3LC5A 3UTUH 1PPFE 3L6PA 4ZKOU 3GCHB 1BHXF 1NRPH 1LVMA 3P95A 5SGAE 1F92A 3SI3H 1RIWC 1HBTH 2ZFQH 4X6OA 1AZZA 4YZUA 3MWIU 2VIPA 1HDTH 3ZVAA 1NO9H 1KXDA 1C4Y2 2BVRH 3A88A 3GDUA 5JDUB 1TPSA 2YNAA 1E1QD 3S9AA 3LJOA 9LPRA 4Y8XA 4B73A 1L2EA 2G5VA 1IHSH 1E79D 2CJIA 3PMHB 3VB3A 1KXCA 1Y3YA 2C93B 1GHXH 5L6NH 4Q4LA 4MNYA 4H6TA 1ELCA 5A8YA 1HAVA 4OS5A 4DGJA 1D9IA 4MQAA 1HGTH 1BTUA 4SGBE 2ZTXA 5I46H 1AUJA 1G32B 3PRDA 1FPCH 2PKAB 1LKAA 3ZVDA 2G51A 1SGFA 2JH5D 3V12A 1K28D 4F48B 4K1EA 2BX3A 3A7TA 4A92A 1VGCB 1O2JA 4YT6H 1OWDA 1YGCH 2BVSH 4A5TS 5CHBA 4IC5A 3BG8A 2FI5E 3LIWA 2OXSA 1QB9A 1FAKH 1TLDA 3IG6B 1K1LA 1SKYE 1WDIA 3FANA 3ZV9A 1AD8H 1LVOA 2FOEA 1GHVH 2ZGBH 3BG4B 3OY6U 4MNXA 2J2UA 4J1YA 1XKAC 4BXWA 2I6QA 3CENA 3UOPA 1GBAA 4FU8A 1ELTA 2HALA 1YPLH 1L4DA 3O8RA 1TA2A 4AB9A 4X6PA 1H9IE 2V6NA 2F9BH 1E38B 7GCHF 1HXEH 3NKKA 3LU9B 3RXCA 3OFND 4KP0A 4CH8B 2UUKB 3ENSB 5DG6A 1HAHH 1XX9A 3SV8A 1KXEA 1SPJA 2XW9A 2ZHDA 2OBOA 3NPSA 3B9FH 5L2YH 1CQQA 5C67A 1EJAA 2G4UA 2A4QA 3FZDA 2FX6A 3I29A 1EZSC 2PGBB 3ATIA 1O3MA 2VIQA 1Z8RA 2VJ1A 3Q00A 5JBBS 5DP5A 2G55A 2W3IA 3GISB 3DUXH 1C5LH 3MTYA 2WPDD 1INCA 3SNBA 5IDKA 1P2OA 4FXGH 2GV7A 1O3LA 1RIWB 1C1UH 3T2NA 2W3KA 4XE4A 5T1VA 1NTPA 1VCPA 5LPEA 1YPGH 3RXAA 1TBQH 2KCYA 3FKSD 3U1JB 2QF4A 1LKBA 5GCHG 1YLCA 2IN2A 4Q7YA 1K1JA 1G37A 1N6XA 2GMTB 3DT0H 4ZMAH 2KX4A 2P16A 1KYNA 2V7QD 4UFEH 3SOSA 1QIXB 2QAAA 3O8CA 1OSSA 3V13A 1ZTJA 2JDID 3FFGA 4NIXA 1P2IA 1XXFA 3PYHA 1S5SA 1GVKB 2QF5A 3SU0A 5I25A 3A81A 4Y0YE 1T31A 2W7SA 3RM0H 2J98A 3KYFA 5JYIA 1PQ5A 1LHEH 1OWEA 1WSSH 1ELEE 2KAIB 1SHYA 4GVUA 1FIWA 1TGSZ 2R0LA 4JZEH 2PW8H 1HIAB 1YCPM 4U32A 1FY3A 3F9EA 3LPRA 4D7GA 2SFAA 5G4BA 3RXIA 2OBQA 4JCNA 2BD5A 2CGAA 3SJKA 1W0YH 2TPIZ 4JZFH 5IYTA 1NU9A 3F3BA 1ARCA 2K8IA 3TJVA 3JZ2B 1H1BA 2VWNA 1WAYB 1BMLA 4AG2A 1VJAU 4GHTA 2VH0A 1GJAB 1SGPE 4HI3A 3SO3A 3BIVH 1TB6H 4IW4E 4XOJA 3T25A 3T62A 4D9QA 5A0CA 3A8AA 4NG9H 2BQ6B 2Y80A 3CNRA 1KSNA 4OS6A 2ZDLA 3GY6A 1AB9B 5J4QA 2XRCA 2ANKH 1BMNH 1C5NH 3VB7A 2Z3CA 2AGGX 1MTNB 2AMDA 1CVWH 1UW7A 3DHKH 1FZZA 3MH6A 4H42U 2PLXA 1P3CA 1DPOA 4O9VA 1GWAA 4FUBA 4WMFA 1MBQA 2QXIA 3BTHE 3SI4H 1KXFA 4ABGA 1DANH 2NU1E 3RXFA 4FUGA 1TMTH 2J94A 4DY7B 2GV6A 1ELDE 1O2KA 1BTYA 1SL3A 2AGEX 1TAWA 1TOCB 4JYUH 1ZYOA 4MNVA 3ATWA 4XFQA 3BN9A 2P59A 5KECA 4IBLH 1DUEA 2ZU4A 1FY5A 1ZHRA 4TPYA 2VIDA 3RU4D 3L33A 4KTSA 3ELAH 1QRXA 1O2QA 2FWWA 1Y59T 3A80A 4DVAU 2SNVA 3E0PB 2Y7ZA 4D9RA 2VVUA 1KY9A 4NIYA 2A31A 1BRUP 1MKXH 4IC6A 7GCHG 1SGRE 1V2QT 2XBYA 3SORA 1W13U 3K6ZA 4ZKSU 1ELFA 1GBHA 4B6FA 1DWBH 1G36A 1O3OA 3M5LA 3OTJE 1BOQA 2JJ2D 3C1KA 4NZQA 1AFEH 3GS9A 1THSH 2XC5A 5HIZA 3MYWA 1MCVA 4D7FA 4MVNA 5FXLA 1GJDB 4Z0KA 1O2ZA 1F0UA 2OTVA 3TJOA 4FUCA 2Z9KA 2QIQA 1D3PB 1DE7H 2HLCA 2VBCA 5TCCA 4K1TA 3GY3A 1GBBA 1GPZA 2SGAA 2GJGA 1A5HA 6GCHG 3QTOH 2ZO3H 2Z3EA 3BTGE 2TRMA 1B0FA 2G52A 2XCFA 2UUYA 1HAZB 1YBWA 1JIMA 1MMJN 1FV9A 4X8UH 1SI5H 5E0GA 4LK4A 3Q3XA 3U69H 1Y3VA 3NUMA 3UB0A 2FP7B 2C8ZB 3P8OA 1X7AC 2KCPA 4IN1A 4UE7H 4NWLA 3SU1A 4FU7A 3PWCA 2OUAA 3N7EA 1IQJA 2IPHA 1LCYA 2J9NA 3BTEE 9ESTA 2FM2A 2AMQA 1BBRE 2ZU1A 1ACBE 1AGJA 1C1TA 1O2NA 3RXJA 4NSYA 1PPGE 5EXLA 2DUCA 3AAUA 2JH0D 2BY5X 2ZTZA 3R3GB 1NRRH 4TSFD 2FOCA 1ABJH 5AVDA 2TGTA 3FZZA 1C5YB 2ILNA 3OEED 4GCHF 1YF4A 2OINA 1TBZH 3MU1A 2Z9LA 4D76A 2ZU2A 1ANDA 1OX1A 2GVFA 4I31A 2RCEA 1THPB 4D8NA 1GI3A 3P8FA 3FN8A 3SU5A 5DGJA 1NRSH 1O3JA 2A4RA 2YMSD 2F4LA 2H5CA 1IQMA 4ZKRU 5EGMA 3UAIC 3BTWE 3PTBA 4X2XA 2EQNA 1C5PA 2R3YA 2WV4A 2ZWLH 2VB0A 2JETC 1XMNB 2VVVA 1W2KH 3T29A 1Y5UT 5A0BA 1KLTA 2G5NA 1JWTA 2WYJA 2JIZD 5ESTE 2WPMS 4LXBH 2H6MA 2KCAA 3BSQA 2KR7A 4SGAE 1TWXB 3MH7A 3MOCA 1C1VH 4X1NU 4NA7A 1WOFA 1C2FA 1MZAA 1K0HA 1V2RT 1GMDG 1K2I1 2PTCE 4AC9A 1CHOG 5BPEA 2P3FH 2RG3A 4GLYA 2V0BA 2ZFFH 3UNRA 1O2TA 1UTKA 3LDXH 1ZR0A 3EA8A 5TCAA 4ACAA 1P11E 4AZ2B 1GI0A 4YESB 1EB1H 2AIPA 1AFQB 3A85A 2O9QA 4TYDA 1NC6A 2BXTH 5EPNA 4FUIA 1C1WH 1SGFG 4K8BA 5EXMA 2HVYB 2LP6A 2PTNA 4NCYA 1O2RA 2BB4A 2AYWA 4K60A 5AFZH 4GUXA 2WZQA 1F0RA 1XUHA 2XC4A 2RDLA 1GDNA 4WMEA 2H5DA 3RXMA 1GHZA 1CBWB 3QGNB 1H8DH 3LH1A 1A3BH 4XBDA 3U28C 1W11U 1P8VC 1CA0C 1BMMH 1C2DA 2W5EA 4MPWA 4K1SA 4NWKA 3RU4T 1ZPCA 2LELA 3SUFA 1SVPA 2BLOA 1KXAA 2EEKA 1TRNA 3A82A 4XBBA 1TQ7B 3NWUA 1WBGB 1EXFA 4VGCC 1V2UT 1B7XB 3N7OA 1ZGVA 4Y7BA 4ABJA 4X2WA 4OS2A 3RXRA 2QF3A 1QY6A 1XUKA 1Y3WA 3L3TA 2QGRA 2W7UA 2TBSA 1GI4A 1JIRA 2FOFA 1GBIA 1XXDA 2ZFPH 1ZLRA 1O3PB 1N1LA 2ZIQH 2ODPA 4M7GA 5DN6D 1DY9A 1VR1H 3RXEA 1ZTKA 1ORFA 1C2IA 4MTBA 3EE0B 3TITA 1CA8B 3RXTA 3QX5H 4UDWH 3RM2H 3K2UA 3OX7U 1BJVA 1C5UA 1Z71A 3SUEA 2H2ZA 2CXVA 3P70B 4WJG2 3MNBA 2PSXA 3S9BA 3S7KB 4ABHA 1NY22 1C1QA 3PMAB 1T32A 5HGGA 2FOAA 1G30B 1JRSA 4GCHG 1ELBA 3UR9A 1W14U 2F83A 4IS5A 2FIRH 1GBEA 2HPQH 4Q7ZA 1PPEE 1Y8TA 3GY5A 4FUJA 4OGXA 4R8TB 3DD2H 1QL8A 2GDEH 1C5SA 2G81E 1O30A 1V3XA 1W0ZU 3CS0A 5DPAA 4NSVA 2YOLA 1SQAA 3VB6A 1P2JA 1QL9A 2ZU5A 3ZZAA 2FEQH 1GI7B 3RXVA 1P2MA 2ANMH 1DWCH 1XKBC 1YP9A 5FAHA 3M3SA 2BHGA 4ABDA 3A7WA 3BTDE 3RU4E 4DG4A 4BAHB 2GT8A 3AAVA 3U98H 2WPKS 1UVTH 3SNDA 1IQNA 4XBCA 4U01A 2GD4B 4I8LA 3PV2A 2STBE 1QFKH 1EAXA 3OY5U 1J8AA 2UWPA 1Q3XA 1HAVB 3KQ5A 1S6FA 1GHAF 3SNEA 1FAXA 1LHFH 3OSYA 1XVOA 1QR3E 3E1XB 1BITA 1SQRA 8GCHF 4Y0ZE 3M61U 3RXQA 1TMBH 1GBMA 5J4SA 1A5IA 1ZRBA 3P17H 3EAJA 2GCTC 3MH4A 1TX7A 1AWHB 1NPMA 2O8LA 4AFSA 4Y6DA 4PROA 1CA0B 3BEFB 3M5MA 2BQWB 4H6SB 3U9AH 4NFFA 1CHGA 1F5LA 3SN8A 2QXHA 1CT4E 1EPTA 2VVCA 3LGTA 3VB4A 2RDEA 2BY8X 1TX6A 2C3SA 1ESTA 1KLJH 4JZIA 1A46H 1JBUH 3AASA 2D2DA 5CHAC 1RJXB 3KN2A 1FMGA 3SJIA 1O5GH 2NU4E 4THNH 1MU6B 4NIVA 2BVXH 3MU5A 1QB6A 1O3HA 2Q6GA 1EFRD 4B2AA 1E37B 2KFWA 5DKMA 4TY6A 1MKXK 1RFNA 4XD7D 1UCYH 2VWOA 3DCLA 1E34B 2O8MA 2A32A 5FCRA 3TNTA 2FX4A 1AKSB 5FL7D 3ODDA 2OP9A 4AFUA 2A2XH 4LZ4B 3SHCH 3VEQB 5DP7A 3ZZ5A 4DIIH 1O31A 4YOIA 5GPIB 4ZUHA 2BTCE 3UIRA 1QRZA 3WY8A 1O3NA 3ZZ3A 2VIOA 4ISOA 1OHHD 1UTLM 2D1JA 4R0IA 1ZMJA 1IOEA 1IQGA 2BY7X 4IN2A 3SNCA 4YO9A 2BLQA 5HM9A 5CDFE 3PV4A 1T8OA 1S0QA 3PB1E 1HCGA 1QA7A 3RXOA 1YLDA 3ITIA 3S7HB 2A5KA 4BAMB 4WMDA 4H4FA 5HKKD 3EYDA 5C5OA 4A6LA 3UUZA 3TK6A 1C2EA 1SLWB 1HJAC 3FAOA 2ZC9H 1LQEA 2UUJB 1KTSB 3ATMA 1FY1A 2A7JA 4ABIA 4CH2B 3WW7A 5FX5A 2F9NA 2R3UA 2VU8E 3TK5A 3T27A 4B2CA 3F68H 2M5TA 4TY7A 4YTAA 4X8TH 2ZDMA 3S69A 1UVOA 1O2MA 4O03A 1ANEA 2CN0H 1EQ9A 1G3DA 1GHWH 2HLDD 1D6WA 3KF2A 1O5EH 3N7DA 1BDAA 2ALPA 1ZSLA 2Y7XA 5GXPA 3SJ8A 5DP4A 4ZAEA 4F4OC 1TABE 3QLPH 1S6HA 4O3TA 2YMSC 5ETXA 1O3GA 2ODQA 4ASUD 1HAPH 4F49A 4P00A 5DO4H 4X1PU 1JXPA 3SV7A 1UK4A 4WXIA 3RC4A 1DWEH 2ZU3A 1P2QA 1T8NA 1BZXE 3SUDA 2GZ9A 5JB8S 1BTWA 2BY6X 4I86A 1A0HB 5EQRA 1C5OH 1SR5C 1GBJA 4AYYB 2BDBA 1HFDA 3M37A 1BMFD 1W7XH 3FO8D 3TPIZ 2AMPA 1GHAG 1KLIH 4FETA 1TONA 1O3DA 1BUIA 1F0TA 2RA3A 1OYQA 4RKJB 4A1TA 1C1PA 8GCHG 3PLKA 1TPOA 5C3NA 3ZZCA 1AVWA 1H8IH 2A5AA 1MBMA 1G3BA 1MTVA 4I33A 1FIZA 2G4TA 1EX3A 3SJ9A 2GZ7A 4WWYA 1MAXA 1O3KA 1T4VH 3K65B 4HFPB 1HYLA 1UK2A 3T5FH 3BTQE 5HMAA 1BT7A 2NWNA 3A7YA 4WH6A 2ALVA 1PQ7A 3KGPA 4NA9H 1FLEE 1KIGH 3BIUH 1COWD 4X8VH 5DP3A 2PKAA 4ABAA 5T3HA 3SV9A 1WUNH 5F8ZA 5EODA 3N99A 3JZ1B 3EA7A 3MH5A 4UFFH 2Y5GA 1DLKB 2V3HH 1GHYH 3A84A 3CP7A 2J38A 4JYTA 1CO7E 1P04A 4ISHH 1O2LA 1NN6A 2VGCC 3PTNA 2FLBH 1K22H 1SGTA 1L0ZA 1O38A 1ZPZA 3W94A 2ZFRH 1FXYA 1K1IA 3ZVGA 1VJ9U 3UNQA 1VKYA 2Y6TA 3GDVA 4DIHH 1BRAA 1TALA 2ASUB 5PTPA 1MU8B 1D3QB 2OD3B 1T7CA 3OYPA 3SGBE 1WV7H 2Q6DA 4JMYA 1NU7B 1LHCH 2EI6A 4CHAC 2BOKA 1GG6C 1KDQB 1YLNA 3ZV8A 5C17A 2ZNKH 2ZPRA 5LH8A 3AW0A 4RKOB 3A87A 2YMSB 1QQUA 2ZA5A 2XBVA 1BQYA 1FNIA 2AGIX 3MMGA 5L30H 1UTQA 4FOUC 1P05A 1AY6H 3TGJE 1UJ1A 2FODA 4RI0A 1VCQA 4OS1A 1OWJA 2B5TB 1P01A 3SQEE 1TGBA 4UFGH 3BF6H 4FVBA 1EP6A 7ESTE 1FI8A 4AFZA 1HLTH 4ISNA 1QBVH 5GJ4B 1MCTA 4KTCA 2TGDA 1AU8A 3M35A 2ZEBA 1LPZB 1QB1A 4TT3D 2OQ5A 5F53A 3T28A 1BTXA 1IQKA 2GX4A 3WWBA 1AN1E 2WYGA 2FO9A 1W3CA 5A8XA 1LHDH 1TNGA 1SGNE 1VITF 2IJD1 2R0KA 5A2MH 3LGWA 2Y81A 5T6FA 3M7TA 2HNTF 2XBWA 3UQVA 5KEDA 3SW2B 1MD7A 1F5KU 2BD4A 1BTZA 2OLGA 4E05H 5HXFA 2FMJA 1LVBA 1XM1A 1CT0E 2F91A 1GMHF 1O2HA 3SU2A 1OOKB 2KAIA 4K69A 1YCPK 2PHBA 2Y5HA 2P94A 2XNDD 4Z1MD 4NA8A 2ZDKA 2OC0A 1C2MA 1WXRA 2J92A 1GJCB 4AGJA 4B71A 3KL6A 5FCKA 1GBCA 3A7XA 3M5NA 1C1MA 3RXBA 1P06A 3I77A 4CRAA 1RD3B 5H4IB 1MTWA 3TGKE 3MU0A 1O5DH 4KGAA 1GHBF 1TBRH 3RXHA 4X6MA 1BHXB 2UUFB 2NU0E 3TNSA 5EJLA 1P0SH 4X2YA 2BLVA 2FS8A 4ZHMU 1SGDE 1UTMA 1MQ6A 1O2SA 4YLQH 4AYVB 1H4WA 1EUFA 4CRBA 4I7YH 1AVGH 2FDAA 3KQBA 4X1SU 1GDQA 3HK3B 2UWLA 3H5CB 4B6EA 2B8OH 2STAE 1AZ8A 4X8SH 1XUFA 4AN7A 3DSPA 2LPRA 3RXPA 1WQSA 1SC8U 1LO6A 1T4UH 3D65E 3RC6A 4E7RG 2A4GA 4K8YA 4CHAB 1VZQH 1BTHH 3DSGA 2BLWA 5A8ZA 1ABIH 4ZXXH 2VIWA 3LKWA 3UPEA 1HXFH 1BTPA 3M7UA 1DWDH 1GL0E 4K2YA 1CGJE 2P95A 2BDHA 1H9HE 1O5BB 1UCYK 4JZDH 2ZP0H 2FI4E 5E0JA 2DE9A 1D3TB 1MZDA 3EGKH 1GVLA 1PPBH 3SNAA 1CGIE 2GT7A 1GBTA 1DDJA 2W26A 2H9HA 1O2GH 2BD8A 1ZMLA 3SV6A 5C20A 1O3EA 4Y7AA 6ESTA 3NXPA 2HRVA 2P93A 3F6UH 1OWHA 1EPTC 3MQKC 1JOUB 4DJZB 2FOHA 2P8OC 2Z9IA 3S9CA 2PUXB 2BY9X 1ZZZA 1SQOA 3GDSA 1PQAA 3K9XB 4WXVA 1EKBB 1ELGA 3E6PH 4Q63A 2IOTA 1O3CA 1OPHB 1LVYA 6CHAC 5BRRE 5FHTA 3BV9B 4ZHAA 1A3EH 2VWLA 3LC3A 5DP8A 2IJOB 2ZKSA 4I8JA 2A4OA 1ETSH 1EZXC 5A09A 8KME2 1O39A 5JBCS 4JK5A 1GBKA 2HNTE 3SYJA 2BM2A 4ZH8A 1C1OA 3O8BA 1DT2A 1LHGH 1GI6A 1ARBA 1S6LA 2BD2A 1J15A 2SGEE 5EJ1A 3FP6E 4BTUB 2ZHWH 2WPJS 3HKJB 4UONA 1S84A 4JYVH 4P02A 1G2MA 1MKWK 1MH0A 1S85A 1UHBA 1ZPBA 4OGYA 2BDYA 1KTTB 5IK2D 1TPAE 1YPEH 1O35A 3R0FA 1YKTA 1VITG 1IQFA 3E0NB 3NZIA 1V6DA 1YPJH 1S82A 1QQ4A 5C5NA 4ABFA 2Y82A 1Y5AT 1TRYA 3AVZA 3KQDA 3LOXA 3MU4A 2P3UB 4ISIH 1V2KT 1P9SA 1E35B 1OP8A 2A2QH 2DE8A 4YOJA 1PQ8A 2CHAC 1GMHG 2HNTC 3GCTF 3W1EA 2XWBI 2Z9JA 3TVJB 1BBRH 1Y3UA 2FOMB 5FPYA 1HNEE 3GCOA 2QA9E 3PO1C 3WWFA 2F43B 3AK5A 4AGKA 3ZVCA 1DS2E 2A7HA 2TGPZ 3M3VA 1YPHE 1UTPA 1L1GA 3FP7E 3U8TH 2ZHEH 4A7IB 1FPHH 1O5FH 1FDPA 1UTNA 5E8EH 1GHBG 1P12E 1TQ0B 1T8MA 1A0JA 2Z9GA 4Y76A 3RDZA 4JZ1A 1BRCE 2PGQB 3Q77A 4Y10E 3SHAH 2LNCA 3HPTB 1E36B 3DSOA 1C2KA 2ZDAH 1AI8H 2J5UA 1SMFE 3KCGH 2XYAA 2PFEA 3LONA 1B0EA 2THFB 3M7QA 1AE8H 4INKA 1W12U 2HVXA 3F2FA 4RSPA 1ZRKA 2JETB 1FN8A 1AVXA 3GCHC 2O8UA 1TNLA 2ZCHP 1UCYE 4UEHH 1QTFA 1TOMH 1DLEA 4LZ1H 3DA9B 3KNXA 3MNXA 4Q7XA 1QL7A 3B23B 2XCNA 1LDTT 4UFDH 1YPKH 1NBMD 3RXGA 5B6LA 1CT2E 7LPRA 1C4V2 1GJ9B 1ZGIA 2F9VA 1UVSH 2ZCKP 4INHA 1FQ3A 1ZHPA 1N6YA 1Z8IB 1ZSJA 2ZGXH 1PYTD 3E16B 2CK3D 1IQLA 3H7TA 2JKHA 2BOHB 4Q2KA 1GMCF 2VH6A 1BRBE 4MNWA 1C2HA 3A83A 4CRFA 5EG4A 1YCPH 2PSYA 1O34A 1QJ1B 1VCWA 2WPLS 3HKIB 1O2WA 1A61H 2VWMA 4MPUA 1NRQH 1RXPA 3TU7H 2J34A 2ZCLP 1PPCE 2IPQX 3PLBA 2BQ7B 1H8ED 1O33A 2BYAX 2FESH 4NGAH 1O2OA 2FI3E 4BTIB 2OC8A 1SGEE 2Z6BD 3EDXB 1E1RD 3DFLA 3LH3A 3VG8A 4FU9A 1A1RA 1RS0A 3C27B 2CV3A 1C1NA 1JMOH 2QYIA 3UOUA 2PKSC 3U8RH 4ABBA 1K1MA 1WQVH 1VGCC 2V3OH 4MPVA 3QUMP 4CRDA 1GJ6A 4A1XA 4ZCNA 1DM4B 5ABWA 1FY4A 3ZVFA 3ZVEA 3A8CA 3VXFH 5AFYH 5DP9A 3ATLA 2XOKD 1DVAH 2O8WA 4Q80A 2YNBA 4CREA 3A86A 4RN6A 4OS4A 3BG4C 1O0DH 1OWKA 3URCA 4BAQB 5FBEA 1TFXA 2Y5FA 3U8OH 4VGCB 1NFYA 2L74A 3RMLH 2ESTE 2NU2E 1O2YA 1DSTA 4ACBA 1C9TA 3MFJA 2FZZA 1C4U2 1AO5A 1K1OA 2SNWA 1TNHA 2V3MA 5GCHF 1D6RA 2ZTYA 4XDEA 1HJ8A 3MO3A 2PR3A 2FOGA 4OS7A 2FPZA 3BTFE 3ZZBA 5C94A 2AIQA 3O8DA 5T6GA 2WINI 3QGJA 2PV9B 2B9LA 3B8JA 1D3DB 4X0WU 5GIBA 3GCTG 4B74A 3S0NA 1EZUC 1QGFA 2A0QB 4B1TA 1FUJA 1C9PA 5F8XA 3GCNA 1IHTH 1TNKA 1GI5A 3V3MA 2ZZUH 2R2WU 3GYMA 2AFQB 3TLOA 1SGYE 3RMNH 3IITA 3RXSA 3A89A 1YPMH 2ZECA 3LGVA 4ESTE 2KZ4A 1YWUA 2ANWA 3E3TA 3M3TA 1TE0A 4I8HA 2R9PA 4JK6A 1DSUA 1MAYA 1IQIA 1P9UA 1U6QA 1QHRB 1EAIA 3UREA 5DSFA 4FUEA 2GMTC 1H9LB 3MI4A 3I78A 1J9CH 1HJ9A 5LPRA 4AX9H 2WSSD 3ZZ9A 5JB9S 1CU1A 3TK9A 3TH3H 4E7NA 4TWWA 2D26C 1W7GH 1M9UA 4HTCH 1C2JA 1SSXA 5L2ZH 2JH6D 1C5WB 1EAWA 1G3CA 1O32A 1F5RA 4E06H 1OKXA 1FY8E 1MKWH 1QBOA 3KEEA 1ZJDA 2A45B 2CF9H 3LJJA 1UVUH 2J98B 3UQOA 4Y79A 2PKSB 1EASA 1RTFB 1XUIA 3KQCA 1C5QA 1O2XA 4O97A 1XVMA 2ZHFH 5EQSA 2FS9A 2BDCA 1BMAA 3DFJA 3HGNA 3SV2H 3NCLA 1P57B 4J2YB 2GCTB 4X2VA 2AHME 1V2MT 4XSKU 4YXWD 1GMCG 1DY8A 1O37A 1O3BA 5ESBA 4B75A 2ZHQH 3RUOA 2H9TH 2EA3A 4FUHA 5FBIA 1C5XB 3F2GA 3VXEH 4CBOA 1NZQH 1EJNA 2GTBA 3PM3A 1SGQE 1AB9C 3EE7A 1QCPA 3G01A 3PMJA 2H9EH 3BTME 1MTNC 3GYLB 5A0AE 3RXUA 2QF0A 5LGOA 4O3UA 1NT1A 3KHVA 5C1XA 3VPKA 1ESAA 3E91A 5CHAB 3VFEA 2ULLA 1AKSA 2JJ1D 1JRTA 3F1SB 1Z8GA 1EATA 2HPPH 2BMGB 1BJUA 4HG6A 2K1QA 5TJXA 1DICA 3UFAA 2OK5A 3V0XA 2BZ6H 1TGTA 2XBXA 2TGAA 2A5IA 1K9OE 1KXBA 6GCHF 1Z6EA 1HRTH 3VB5A 1GI8B 1GJBB 4YOGA 4B2BA 4K3JA 5GNDA 1P02A 1BIOA 1W0KD 3SJOA 4DW2U 3ZZDA 3KIDU 2J95A 1DFPA 3SU3A 2O8TA 1DITH 3SBKA 3F0OA 4NZLA 1TIOA 5KGOA 1C5TA 4I8KA 4CBNA 3RC5A 1EAUA 3A7ZA 1C2GA 3PLPA 3URDA 4Z6AH 3A8DA 3RLYH 1QURH 4DOQA 3ZVBA 4DT4A 3A7VA 2Q1JA 2ZQ1A 3F2HA 1W0JD 1LPGB 3BTTE 4WH8A 1ELVA 1YYY1 5C2ZA 1HJAB 3HGPA 2SGQE 2ZQ2A 1T8LA 2F9PA 3KQEA 4FUFA 4ISLA 2AERH 1PPZA 4ZROA 1BBRK 1SFQB 5C0TA 2PP6A 3H09A 1GCTC 4BXSA 2HGTH 1LPKB 3MNCA 1NBME 1S83A 2BDAA 3RLWH 5EW1H 4INLA 3RMMH 1Q2WA 4X6NA 4IMQA 3HATH 1TMUH 1AWFH 4B76A 1MD8A 1OYTH 2W6ID 3F9GA 1EP5A 1RTKA 1TNJA 3MNSA 4HZHA 1ELAA 5E2PA 1TGCA 2HOBA 4FUDA 3SU6A 1LQDB 2V35A 1MUEB 1AQ7A 3UR6A 4TPIZ 2K0QA 2EI8A 1P09A 1WCZA 4MPXA 4IGDA 1V2JT 2EY4C 1O2IA 1SGCA 1N8OC 2QY0B 1D4PB 3OEHD 5F8TA 2W6JD 2ZDVH 1UMAH 3TH2H 2UWOA 3UWIA 1FN6A 3MU8A 5GDSH 3W95A 1C1RA 1SB1H 1B5GH 1HAYB 2GKVE 2VNTA 3QZRA 4YM9A 1Z8JB 1DXWA 2BDGA 2ZFTA 3D49H 1E0FD 4DCDA 3Q3KA 1TYNA 2ZPQA 5FPSA 4MG3A 4WF8A 1V2PT 2ZGCA 1GI9B 3E90B 1GMDF 4YLUA 1SFIA 2G8TA 1FJSA 1QRWA 1CHOF 2FYRA 2OCVB 4RT0A 3SU4A 3UY9A 1O5CB 1L1NA 1PYTC 3UWJH 2C90B 1PPHE 4BAOB 3AW1A 1O2PA 3OE7D 1YC0A 1OP0A 4GSOA 1NS3A 2Z94A 1W8BH 1O2VA 2XTTB 1RGQA 1SQTA 3GICB 3PWBA 4CRGA 2VIVA 4CR9A 2R2MB 3ATKA 5F6MA 1HIAA 3V7TA 1Y3XA 4NIWA 2TIOA 2ZI2H 1P2NA 3ZZ7A 3ODFA 3K6YA 1P03A 1V2TT 2C8XB 1ANCA 1V2NT 4ABEA 1O3AA 4ASHA 2GDDA 1S81A 1V2LT 5FPTA 2G00A 1OS8A 2BD3A 1G9IE 1C5RA 2OC1A 2VGCB 3ZYEA 1WTGH 3P6ZB 2GP9B 3F0PA 1SLXB 2J4IA 1MABB 3GY7A 1NROH 4ZXYH 1TA6A 5C0UA 1HAXB 2GCHF 1KMHB 4X1RU 4FVDA 1AFQC 1O3FA 1SBWA 4Y8ZA 1GCTB 1KDQA 1ZSKA 4AFQA 1C5MD 3SGQE 2QXJA 2L6OA 1A7SA 1BA8B 1LMWB 3MO9A 3SUGA 3RMOH 1UHBB 1SHHB 1G2LA 1TPPA 2B7DH 1A4WH 3TGIE 1GG6B 5C1YA 3T26A 5EPYA 1SGIB 3Q76A 1MTSA 3F9HA 3F9FA 3FVFB 1NRNH 1J17T 1ID5H 2Q6FA 2ODYB 3EQ0H 3LGIA 3QZQA 1UTJA 3MHWU 1CBWC 1CE5A 4MLFB 4DT7B 3Q3YA 2AEIH 2XXLA 1HV7A 2WV9A 1J16A 2QXGA 5CMXH 3ZIAD 1C5ZB 1HPGA 5K7RA 7KMEH 1UO6A 2CF8H 2F3CE 1N8OB 4RT1A 4GAWA 2OC7A 5JBAS 1NFWA 2FTLE 1GJ4H 3ZYDA 1HB0B 1PFXC 2ZG0H 4UD9H 4F55A 1OP2A 3SGAE 1EJMA 3RP2A 1P10A 5CE1A 1EOLA 2WPIS 3UNSA 1XUGA 5EJZA 1DXPA 4YT7H 5FX6A 1QBNA 5AF9H 1WU1A 3U1IB 4AORA 2QE7D 2SGPE 2QN5T 3FOAA 4M9FA 2XWAA 1IAUA 2A7CA 2SGDE 2ZGHA 1NM6A 4GHQA 4NFEA 2GZ8A 1GBLA 1SG8B 3SQHE 1UVPA 2M2AA 1GVZA 4ZHLU 2F9OA 3QK1A 1WTHD 1QJ6B 3P92A 5JPMH 4A1VA 1IQEA 1EZQA 1LTOA 1GGDC 3PMBB 2FLRH 1CGHA 4WY3A 4AOQA 2GGVB 1H8HD 1OXGA 3PROA 1ZJKA 1ZHMA 1S0RA 1P3EA 1V2WT 3QTVH 4BANB 5DK1A 5HYOA 1ESBA 2FOBA 1NFUA 2XC0A 1HAGE 3D23A 3IWMA 2BX4A 2QC2A 4LOYH 1WYKA 1EOJA 4OM9A 2AH4X 1G3EA 1GJ8B 4DURA 5AHGH 2WPHS 3RXLA 1QA0A 1GBDA 1L1JA 1O2UA 1HUTH 2D8WA 1RRKA 1THRH 4Y8YA 3GOVB 2XNIA 1ZMNA 2BDIA 5HIYA 4KKDA 5EU8A 1DUAA 3NK8A 3NRLA 1F0SA 1AMHA 2QV1A 3VGCC 5EOKA 2C8WB 1C2LA 1ZOMA 2BD7A 4TWYA 3STJA 4AB8A 4BAKB 3LGYA 2KM0A 1GBFA 3LT3A 1EB2A 4I32A 2ANYA 1BCUH 2CMYA 2FYQA 2RA0A 1TRMA 2SGFE 4BNRA 6LPRA 2EC9H 1QNJA 1TX8A 1ANBA 2A1DB 2GCHG 2FXRA 3BEIB 1O3IA 8LPRA 1A2CH 2WHXA 1FX0B 4Y11E 5JBTA 3OAAD 1A5GH 1K1PA 2P3TB 3QO6A 5DP6A 2Z3DA 3ZZ8A 1YM0A 2F9UA 1QJ7B 1Y5BT 4Y71A 1AIXH 5T6DA 1RTLA 2ZPSA 8ESTE 5GWZA 1EPTB 1NFXA 2BD9A 2P8OB 1MQ5A 1TGNA 2BXUH 1GJ5H 3LGUA 4BOHA 1C1SA 3ZZ6A 1HAOH 2PUQH 1K1NA 3QWCH 1Z1IA 1Z1JA 4IMZA 3GY2A 4CRCA 5EIYA 2RFKC 6CHAB 1QZ8A 3GY4A 2J97A 1YPHC 4HGCA 2QCYA 1SLVB 5F03A 1FONA 1HAIH 2BZAA 3EA9A 1W10U 4XRNA 1UTOA 1V2VT 3A8BA 3TJNA 1GI1A 3MO6A 1IQHA 2VINA 5K0HA 1VITH 3QDZB 4KELA 3TIUA 1DX5M 1P2KA 2OQUA 3OU0A 3BTKE 1Q31A 1F2SE 4U2WA 5HM2A 3ZZ4A 2EI7A 3D62A 1GGDB 1PJPA 4I8GA 1DOJA 2ZFSA 3OTPA 1L4ZA 1Z7KA 1A0LA 1ZTLA 1O36A 2FTMA 1XUJA 2NU3E 3P8GA 2Z7FE 2C4FH 3P8NA 2KCOA 4QT8C 3M5OA 3SZNA 2C8YB 5E0HA 3CS7A 3ESTA 5C1UA 3E8LA 3PV5A 1YY3A 3RXKA 1ETTH 3M36A 4K5ZA 3TJUA 1MTUA 1Z6JH 5DJ7A 1UK3A 5EXNA 4BTTB 2AS9A 3GY8A 2CHAB 1GDUA 1ETRH 1SLUB 5EW2H 4U30A 2WUCA 1TNIA 3QN7A 3RXDA 3KYGA 2PWXA 1C5VA 4GPGA 4ZKNU 3VGCB 5E2OA 1OWIA 5EQQA 4X1QU 3H7OA 2WUBA 3PO1B 1GL1A 3TH4H 3BEUA 1GI2A 1GJ7B 1AUTC 1V2OT 1CSOE 1NESE 1K21H 2H1UA 3STIA 5B6OA 1AHTH 3PRBA 1AE5A 2ZGJA 1SOTA 1SOZA 3FP8E 2HWLB
chains in the Genus database with same CATH topology
3SV8A 3SZEA 1RTLA 3OE7D 5GNDA 1W0KD 5H4IB 1NS3A 2OBOA 3WW7A 3SU3A 5DSFA 1RGQA 3F0OA 4TSFD 2A4QA 5IK2D 4NWKA 3OEED 3L6PA 2M2AA 3RC5A 2LELA 3SUFA 2WSSD 2OINA 1H8ED 1CU1A 2HLDD 3M5MA 3KF2A 2WPDD 2GVFA 4I31A 4DT4A 3LOXA 3N7DA 2OC8A 5IDKA 3OYPA 1E1RD 4JMYA 3M5NA 3VG8A 4A1VA 1A1RA 2P59A 3F2HA 3FN8A 4B6EA 3SU5A 2YMSC 1W0JD 5ETXA 4WH8A 2A4RA 4ASUD 2YMSD 5FPTA 3DSPA 5T1VA 3KEEA 1E1QD 1N1LA 2F4LA 3RC6A 2GGVB 5DN6D 1DY9A 2OC1A 1H8HD 5C17A 1JXPA 3W1EA 4A1XA 2A4GA 3SV7A 4B73A 2KCYA 4ZCNA 3FKSD 3U1JB 3RC4A 2YMSB 2QF4A 3KN2A 3SUDA 3F0PA 1MABB 5EQRA 3OTPA 2FOMB 5FPYA 1E79D 2XOKD 3LKWA 4M9FA 5C0TA 5C0UA 3H09A 5EQSA 1EFRD 1KMHB 2KFWA 4Q4LA 4RI0A 3P8NA 1BMFD 2F43B 1NBME 2KCOA 2V7QD 2JIZD 3FO8D 4XD7D 3SUEA 4B6FA 3AK5A 4FETA 2AHME 3M5OA 4YXWD 4OM9A 3O8CA 3M5LA 1DY8A 5ESBA 4B75A 3DCLA 2JJ2D 2JDID 2O8MA 3PV5A 4A1TA 3GS9A 2KCAA 3WWFA 5FL7D 2QF5A 5GJ4B 4B76A 4KTCA 2L6OA 2W6ID 3SU0A 2KR7A 3PRDA 3F2GA 3SUGA 3SU6A 4TT3D 5F53A 4I33A 2XNIA 3WWBA 3SV6A 2VBCA 5GPIB 3DSOA 2K0QA 4A92A 1W3CA 5EPYA 3NRLA 2IJD1 2J5UA 4R8TB 2QV1A 5CHBA 3LONA 2OBQA 1OHHD 1BT7A 3OEHD 2WV9A 4WH6A 2YOLA 2KM0A 2W6JD 3F2FA 3ZIAD 3F3BA 2XCFA 3O8DA 5EQQA 1COWD 1SKYE 2JJ1D 2K8IA 4Q63A 5CDFE 2OC7A 4B74A 4I32A 3SV9A 1DXWA 3SU2A 2IJOB 4TYDA 3UB0A 2FP7B 3KNXA 2K1QA 5EPNA 3P8OA 5FPSA 4K8BA 2KCPA 2XCNA 4WF8A 2OK5A 4NWLA 3SU1A 3EYDA 4F55A 3N99A 5HKKD 2XNDD 1NBMD 4Z1MD 3O8RA 3E90B 3SYJA 3N7EA 5B6LA 3O8BA 4U01A 2OC0A 2WHXA 1FX0B 3PRBA 3PV2A 3OAAD 3SU4A 2WZQA 1WXRA 2FM2A 1DXPA 1S6LA 2F9VA 3U1IB 2KZ4A 3OFND 4B71A 2QE7D 2F9UA 3FOAA 2CK3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SV8 A;  3SZE A;  1RTL A;  5GND A;  5H4I B;  1NS3 A;  2OBO A;  3SU3 A;  1RGQ A;  2A4Q A;  4NWK A;  3L6P A;  3RC5 A;  3SUF A;  2OIN A;  1CU1 A;  3M5M A;  3KF2 A;  2GVF A;  4I31 A;  3LOX A;  2OC8 A;  5IDK A;  3OYP A;  4JMY A;  4A1V A;  1A1R A;  2P59 A;  4B6E A;  3SU5 A;  5ETX A;  4WH8 A;  2A4R A;  5FPT A;  5T1V A;  3KEE A;  1N1L A;  2F4L A;  3RC6 A;  2GGV B;  1DY9 A;  2OC1 A;  1JXP A;  4A1X A;  2A4G A;  3SV7 A;  4B73 A;  3U1J B;  3RC4 A;  3KN2 A;  3SUD A;  5EQR A;  3OTP A;  2FOM B;  5FPY A;  3LKW A;  3H09 A;  5EQS A;  4RI0 A;  3P8N A;  3AK5 A;  3SUE A;  4B6F A;  3M5O A;  4OM9 A;  3O8C A;  3M5L A;  1DY8 A;  5ESB A;  4B75 A;  3PV5 A;  4A1T A;  2O8M A;  5GJ4 B;  4B76 A;  4KTC A;  3SU0 A;  3SUG A;  3SU6 A;  4I33 A;  2XNI A;  3SV6 A;  2VBC A;  5GPI B;  4A92 A;  1W3C A;  5EPY A;  2IJD 1;  4R8T B;  2QV1 A;  3LON A;  2OBQ A;  1BT7 A;  2WV9 A;  4WH6 A;  2YOL A;  2XCF A;  3O8D A;  5EQQ A;  2OC7 A;  4B74 A;  4I32 A;  3SV9 A;  1DXW A;  3SU2 A;  2IJO B;  4TYD A;  2FP7 B;  3KNX A;  2K1Q A;  5EPN A;  3P8O A;  5FPS A;  4K8B A;  2XCN A;  4WF8 A;  2OK5 A;  4NWL A;  3SU1 A;  3EYD A;  3O8R A;  3E90 B;  3SYJ A;  5B6L A;  3O8B A;  4U01 A;  2OC0 A;  2WHX A;  3PV2 A;  3SU4 A;  2WZQ A;  1WXR A;  2FM2 A;  1DXP A;  2F9V A;  3U1I B;  4B71 A;  2F9U A;  4M9F A;  3M5N A; 
#chains in the Genus database with same CATH topology
 2B0F A;  3HK6 B;  3SZE A;  1J14 A;  2I6S A;  2ZDN A;  1BB0 B;  1O5A B;  4MDS A;  4CR5 A;  5LPF A;  2WV5 A;  2ZF0 H;  1F7Z A;  4WVP E;  1V2S T;  4KTU A;  4AG1 A;  1GCD A;  3LC5 A;  3UTU H;  1PPF E;  3L6P A;  4ZKO U;  3GCH B;  1BHX F;  1NRP H;  1LVM A;  3P95 A;  5SGA E;  1F92 A;  3SI3 H;  1RIW C;  1HBT H;  2ZFQ H;  4X6O A;  1AZZ A;  4YZU A;  3MWI U;  2VIP A;  1HDT H;  3ZVA A;  1NO9 H;  1KXD A;  1C4Y 2;  2BVR H;  3A88 A;  3GDU A;  5JDU B;  1TPS A;  2YNA A;  1E1Q D;  3S9A A;  3LJO A;  9LPR A;  4Y8X A;  4B73 A;  1L2E A;  2G5V A;  1IHS H;  1E79 D;  2CJI A;  3PMH B;  3VB3 A;  1KXC A;  1Y3Y A;  2C93 B;  1GHX H;  5L6N H;  4Q4L A;  4MNY A;  4H6T A;  1ELC A;  5A8Y A;  1HAV A;  4OS5 A;  4DGJ A;  1D9I A;  4MQA A;  1HGT H;  1BTU A;  4SGB E;  2ZTX A;  5I46 H;  1AUJ A;  1G32 B;  3PRD A;  1FPC H;  2PKA B;  1LKA A;  3ZVD A;  2G51 A;  1SGF A;  2JH5 D;  3V12 A;  1K28 D;  4F48 B;  4K1E A;  2BX3 A;  3A7T A;  4A92 A;  1VGC B;  1O2J A;  4YT6 H;  1OWD A;  1YGC H;  2BVS H;  4A5T S;  5CHB A;  4IC5 A;  3BG8 A;  2FI5 E;  3LIW A;  2OXS A;  1QB9 A;  1FAK H;  1TLD A;  3IG6 B;  1K1L A;  1SKY E;  1WDI A;  3FAN A;  3ZV9 A;  1AD8 H;  1LVO A;  2FOE A;  1GHV H;  2ZGB H;  3BG4 B;  3OY6 U;  4MNX A;  2J2U A;  4J1Y A;  1XKA C;  4BXW A;  2I6Q A;  3CEN A;  3UOP A;  1GBA A;  4FU8 A;  1ELT A;  2HAL A;  1YPL H;  1L4D A;  3O8R A;  1TA2 A;  4AB9 A;  4X6P A;  1H9I E;  2V6N A;  2F9B H;  1E38 B;  7GCH F;  1HXE H;  3NKK A;  3LU9 B;  3RXC A;  3OFN D;  4KP0 A;  4CH8 B;  2UUK B;  3ENS B;  5DG6 A;  1HAH H;  1XX9 A;  3SV8 A;  1KXE A;  1SPJ A;  2XW9 A;  2ZHD A;  2OBO A;  3NPS A;  3B9F H;  5L2Y H;  1CQQ A;  5C67 A;  1EJA A;  2G4U A;  2A4Q A;  3FZD A;  2FX6 A;  3I29 A;  1EZS C;  2PGB B;  3ATI A;  1O3M A;  2VIQ A;  1Z8R A;  2VJ1 A;  3Q00 A;  5JBB S;  5DP5 A;  2G55 A;  2W3I A;  3GIS B;  3DUX H;  1C5L H;  3MTY A;  2WPD D;  1INC A;  3SNB A;  5IDK A;  1P2O A;  4FXG H;  2GV7 A;  1O3L A;  1RIW B;  1C1U H;  3T2N A;  2W3K A;  4XE4 A;  5T1V A;  1NTP A;  1VCP A;  5LPE A;  1YPG H;  3RXA A;  1TBQ H;  2KCY A;  3FKS D;  3U1J B;  2QF4 A;  1LKB A;  5GCH G;  1YLC A;  2IN2 A;  4Q7Y A;  1K1J A;  1G37 A;  1N6X A;  2GMT B;  3DT0 H;  4ZMA H;  2KX4 A;  2P16 A;  1KYN A;  2V7Q D;  4UFE H;  3SOS A;  1QIX B;  2QAA A;  3O8C A;  1OSS A;  3V13 A;  1ZTJ A;  2JDI D;  3FFG A;  4NIX A;  1P2I A;  1XXF A;  3PYH A;  1S5S A;  1GVK B;  2QF5 A;  3SU0 A;  5I25 A;  3A81 A;  4Y0Y E;  1T31 A;  2W7S A;  3RM0 H;  2J98 A;  3KYF A;  5JYI A;  1PQ5 A;  1LHE H;  1OWE A;  1WSS H;  1ELE E;  2KAI B;  1SHY A;  4GVU A;  1FIW A;  1TGS Z;  2R0L A;  4JZE H;  2PW8 H;  1HIA B;  1YCP M;  4U32 A;  1FY3 A;  3F9E A;  3LPR A;  4D7G A;  2SFA A;  5G4B A;  3RXI A;  2OBQ A;  4JCN A;  2BD5 A;  2CGA A;  3SJK A;  1W0Y H;  2TPI Z;  4JZF H;  5IYT A;  1NU9 A;  3F3B A;  1ARC A;  2K8I A;  3TJV A;  3JZ2 B;  1H1B A;  2VWN A;  1WAY B;  1BML A;  4AG2 A;  1VJA U;  4GHT A;  2VH0 A;  1GJA B;  1SGP E;  4HI3 A;  3SO3 A;  3BIV H;  1TB6 H;  4IW4 E;  4XOJ A;  3T25 A;  3T62 A;  4D9Q A;  5A0C A;  3A8A A;  4NG9 H;  2BQ6 B;  2Y80 A;  3CNR A;  1KSN A;  4OS6 A;  2ZDL A;  3GY6 A;  1AB9 B;  5J4Q A;  2XRC A;  2ANK H;  1BMN H;  1C5N H;  3VB7 A;  2Z3C A;  2AGG X;  1MTN B;  2AMD A;  1CVW H;  1UW7 A;  3DHK H;  1FZZ A;  3MH6 A;  4H42 U;  2PLX A;  1P3C A;  1DPO A;  4O9V A;  1GWA A;  4FUB A;  4WMF A;  1MBQ A;  2QXI A;  3BTH E;  3SI4 H;  1KXF A;  4ABG A;  1DAN H;  2NU1 E;  3RXF A;  4FUG A;  1TMT H;  2J94 A;  4DY7 B;  2GV6 A;  1ELD E;  1O2K A;  1BTY A;  1SL3 A;  2AGE X;  1TAW A;  1TOC B;  4JYU H;  1ZYO A;  4MNV A;  3ATW A;  4XFQ A;  3BN9 A;  2P59 A;  5KEC A;  4IBL H;  1DUE A;  2ZU4 A;  1FY5 A;  1ZHR A;  4TPY A;  2VID A;  3RU4 D;  3L33 A;  4KTS A;  3ELA H;  1QRX A;  1O2Q A;  2FWW A;  1Y59 T;  3A80 A;  4DVA U;  2SNV A;  3E0P B;  2Y7Z A;  4D9R A;  2VVU A;  1KY9 A;  4NIY A;  2A31 A;  1BRU P;  1MKX H;  4IC6 A;  7GCH G;  1SGR E;  1V2Q T;  2XBY A;  3SOR A;  1W13 U;  3K6Z A;  4ZKS U;  1ELF A;  1GBH A;  4B6F A;  1DWB H;  1G36 A;  1O3O A;  3M5L A;  3OTJ E;  1BOQ A;  2JJ2 D;  3C1K A;  4NZQ A;  1AFE H;  3GS9 A;  1THS H;  2XC5 A;  5HIZ A;  3MYW A;  1MCV A;  4D7F A;  4MVN A;  5FXL A;  1GJD B;  4Z0K A;  1O2Z A;  1F0U A;  2OTV A;  3TJO A;  4FUC A;  2Z9K A;  2QIQ A;  1D3P B;  1DE7 H;  2HLC A;  2VBC A;  5TCC A;  4K1T A;  3GY3 A;  1GBB A;  1GPZ A;  2SGA A;  2GJG A;  1A5H A;  6GCH G;  3QTO H;  2ZO3 H;  2Z3E A;  3BTG E;  2TRM A;  1B0F A;  2G52 A;  2XCF A;  2UUY A;  1HAZ B;  1YBW A;  1JIM A;  1MMJ N;  1FV9 A;  4X8U H;  1SI5 H;  5E0G A;  4LK4 A;  3Q3X A;  3U69 H;  1Y3V A;  3NUM A;  3UB0 A;  2FP7 B;  2C8Z B;  3P8O A;  1X7A C;  2KCP A;  4IN1 A;  4UE7 H;  4NWL A;  3SU1 A;  4FU7 A;  3PWC A;  2OUA A;  3N7E A;  1IQJ A;  2IPH A;  1LCY A;  2J9N A;  3BTE E;  9EST A;  2FM2 A;  2AMQ A;  1BBR E;  2ZU1 A;  1ACB E;  1AGJ A;  1C1T A;  1O2N A;  3RXJ A;  4NSY A;  1PPG E;  5EXL A;  2DUC A;  3AAU A;  2JH0 D;  2BY5 X;  2ZTZ A;  3R3G B;  1NRR H;  4TSF D;  2FOC A;  1ABJ H;  5AVD A;  2TGT A;  3FZZ A;  1C5Y B;  2ILN A;  3OEE D;  4GCH F;  1YF4 A;  2OIN A;  1TBZ H;  3MU1 A;  2Z9L A;  4D76 A;  2ZU2 A;  1AND A;  1OX1 A;  2GVF A;  4I31 A;  2RCE A;  1THP B;  4D8N A;  1GI3 A;  3P8F A;  3FN8 A;  3SU5 A;  5DGJ A;  1NRS H;  1O3J A;  2A4R A;  2YMS D;  2F4L A;  2H5C A;  1IQM A;  4ZKR U;  5EGM A;  3UAI C;  3BTW E;  3PTB A;  4X2X A;  2EQN A;  1C5P A;  2R3Y A;  2WV4 A;  2ZWL H;  2VB0 A;  2JET C;  1XMN B;  2VVV A;  1W2K H;  3T29 A;  1Y5U T;  5A0B A;  1KLT A;  2G5N A;  1JWT A;  2WYJ A;  2JIZ D;  5EST E;  2WPM S;  4LXB H;  2H6M A;  2KCA A;  3BSQ A;  2KR7 A;  4SGA E;  1TWX B;  3MH7 A;  3MOC A;  1C1V H;  4X1N U;  4NA7 A;  1WOF A;  1C2F A;  1MZA A;  1K0H A;  1V2R T;  1GMD G;  1K2I 1;  2PTC E;  4AC9 A;  1CHO G;  5BPE A;  2P3F H;  2RG3 A;  4GLY A;  2V0B A;  2ZFF H;  3UNR A;  1O2T A;  1UTK A;  3LDX H;  1ZR0 A;  3EA8 A;  5TCA A;  4ACA A;  1P11 E;  4AZ2 B;  1GI0 A;  4YES B;  1EB1 H;  2AIP A;  1AFQ B;  3A85 A;  2O9Q A;  4TYD A;  1NC6 A;  2BXT H;  5EPN A;  4FUI A;  1C1W H;  1SGF G;  4K8B A;  5EXM A;  2HVY B;  2LP6 A;  2PTN A;  4NCY A;  1O2R A;  2BB4 A;  2AYW A;  4K60 A;  5AFZ H;  4GUX A;  2WZQ A;  1F0R A;  1XUH A;  2XC4 A;  2RDL A;  1GDN A;  4WME A;  2H5D A;  3RXM A;  1GHZ A;  1CBW B;  3QGN B;  1H8D H;  3LH1 A;  1A3B H;  4XBD A;  3U28 C;  1W11 U;  1P8V C;  1CA0 C;  1BMM H;  1C2D A;  2W5E A;  4MPW A;  4K1S A;  4NWK A;  3RU4 T;  1ZPC A;  2LEL A;  3SUF A;  1SVP A;  2BLO A;  1KXA A;  2EEK A;  1TRN A;  3A82 A;  4XBB A;  1TQ7 B;  3NWU A;  1WBG B;  1EXF A;  4VGC C;  1V2U T;  1B7X B;  3N7O A;  1ZGV A;  4Y7B A;  4ABJ A;  4X2W A;  4OS2 A;  3RXR A;  2QF3 A;  1QY6 A;  1XUK A;  1Y3W A;  3L3T A;  2QGR A;  2W7U A;  2TBS A;  1GI4 A;  1JIR A;  2FOF A;  1GBI A;  1XXD A;  2ZFP H;  1ZLR A;  1O3P B;  1N1L A;  2ZIQ H;  2ODP A;  4M7G A;  5DN6 D;  1DY9 A;  1VR1 H;  3RXE A;  1ZTK A;  1ORF A;  1C2I A;  4MTB A;  3EE0 B;  3TIT A;  1CA8 B;  3RXT A;  3QX5 H;  4UDW H;  3RM2 H;  3K2U A;  3OX7 U;  1BJV A;  1C5U A;  1Z71 A;  3SUE A;  2H2Z A;  2CXV A;  3P70 B;  4WJG 2;  3MNB A;  2PSX A;  3S9B A;  3S7K B;  4ABH A;  1NY2 2;  1C1Q A;  3PMA B;  1T32 A;  5HGG A;  2FOA A;  1G30 B;  1JRS A;  4GCH G;  1ELB A;  3UR9 A;  1W14 U;  2F83 A;  4IS5 A;  2FIR H;  1GBE A;  2HPQ H;  4Q7Z A;  1PPE E;  1Y8T A;  3GY5 A;  4FUJ A;  4OGX A;  4R8T B;  3DD2 H;  1QL8 A;  2GDE H;  1C5S A;  2G81 E;  1O30 A;  1V3X A;  1W0Z U;  3CS0 A;  5DPA A;  4NSV A;  2YOL A;  1SQA A;  3VB6 A;  1P2J A;  1QL9 A;  2ZU5 A;  3ZZA A;  2FEQ H;  1GI7 B;  3RXV A;  1P2M A;  2ANM H;  1DWC H;  1XKB C;  1YP9 A;  5FAH A;  3M3S A;  2BHG A;  4ABD A;  3A7W A;  3BTD E;  3RU4 E;  4DG4 A;  4BAH B;  2GT8 A;  3AAV A;  3U98 H;  2WPK S;  1UVT H;  3SND A;  1IQN A;  4XBC A;  4U01 A;  2GD4 B;  4I8L A;  3PV2 A;  2STB E;  1QFK H;  1EAX A;  3OY5 U;  1J8A A;  2UWP A;  1Q3X A;  1HAV B;  3KQ5 A;  1S6F A;  1GHA F;  3SNE A;  1FAX A;  1LHF H;  3OSY A;  1XVO A;  1QR3 E;  3E1X B;  1BIT A;  1SQR A;  8GCH F;  4Y0Z E;  3M61 U;  3RXQ A;  1TMB H;  1GBM A;  5J4S A;  1A5I A;  1ZRB A;  3P17 H;  3EAJ A;  2GCT C;  3MH4 A;  1TX7 A;  1AWH B;  1NPM A;  2O8L A;  4AFS A;  4Y6D A;  4PRO A;  1CA0 B;  3BEF B;  3M5M A;  2BQW B;  4H6S B;  3U9A H;  4NFF A;  1CHG A;  1F5L A;  3SN8 A;  2QXH A;  1CT4 E;  1EPT A;  2VVC A;  3LGT A;  3VB4 A;  2RDE A;  2BY8 X;  1TX6 A;  2C3S A;  1EST A;  1KLJ H;  4JZI A;  1A46 H;  1JBU H;  3AAS A;  2D2D A;  5CHA C;  1RJX B;  3KN2 A;  1FMG A;  3SJI A;  1O5G H;  2NU4 E;  4THN H;  1MU6 B;  4NIV A;  2BVX H;  3MU5 A;  1QB6 A;  1O3H A;  2Q6G A;  1EFR D;  4B2A A;  1E37 B;  2KFW A;  5DKM A;  4TY6 A;  1MKX K;  1RFN A;  4XD7 D;  1UCY H;  2VWO A;  3DCL A;  1E34 B;  2O8M A;  2A32 A;  5FCR A;  3TNT A;  2FX4 A;  1AKS B;  5FL7 D;  3ODD A;  2OP9 A;  4AFU A;  2A2X H;  4LZ4 B;  3SHC H;  3VEQ B;  5DP7 A;  3ZZ5 A;  4DII H;  1O31 A;  4YOI A;  5GPI B;  4ZUH A;  2BTC E;  3UIR A;  1QRZ A;  3WY8 A;  1O3N A;  3ZZ3 A;  2VIO A;  4ISO A;  1OHH D;  1UTL M;  2D1J A;  4R0I A;  1ZMJ A;  1IOE A;  1IQG A;  2BY7 X;  4IN2 A;  3SNC A;  4YO9 A;  2BLQ A;  5HM9 A;  5CDF E;  3PV4 A;  1T8O A;  1S0Q A;  3PB1 E;  1HCG A;  1QA7 A;  3RXO A;  1YLD A;  3ITI A;  3S7H B;  2A5K A;  4BAM B;  4WMD A;  4H4F A;  5HKK D;  3EYD A;  5C5O A;  4A6L A;  3UUZ A;  3TK6 A;  1C2E A;  1SLW B;  1HJA C;  3FAO A;  2ZC9 H;  1LQE A;  2UUJ B;  1KTS B;  3ATM A;  1FY1 A;  2A7J A;  4ABI A;  4CH2 B;  3WW7 A;  5FX5 A;  2F9N A;  2R3U A;  2VU8 E;  3TK5 A;  3T27 A;  4B2C A;  3F68 H;  2M5T A;  4TY7 A;  4YTA A;  4X8T H;  2ZDM A;  3S69 A;  1UVO A;  1O2M A;  4O03 A;  1ANE A;  2CN0 H;  1EQ9 A;  1G3D A;  1GHW H;  2HLD D;  1D6W A;  3KF2 A;  1O5E H;  3N7D A;  1BDA A;  2ALP A;  1ZSL A;  2Y7X A;  5GXP A;  3SJ8 A;  5DP4 A;  4ZAE A;  4F4O C;  1TAB E;  3QLP H;  1S6H A;  4O3T A;  2YMS C;  5ETX A;  1O3G A;  2ODQ A;  4ASU D;  1HAP H;  4F49 A;  4P00 A;  5DO4 H;  4X1P U;  1JXP A;  3SV7 A;  1UK4 A;  4WXI A;  3RC4 A;  1DWE H;  2ZU3 A;  1P2Q A;  1T8N A;  1BZX E;  3SUD A;  2GZ9 A;  5JB8 S;  1BTW A;  2BY6 X;  4I86 A;  1A0H B;  5EQR A;  1C5O H;  1SR5 C;  1GBJ A;  4AYY B;  2BDB A;  1HFD A;  3M37 A;  1BMF D;  1W7X H;  3FO8 D;  3TPI Z;  2AMP A;  1GHA G;  1KLI H;  4FET A;  1TON A;  1O3D A;  1BUI A;  1F0T A;  2RA3 A;  1OYQ A;  4RKJ B;  4A1T A;  1C1P A;  8GCH G;  3PLK A;  1TPO A;  5C3N A;  3ZZC A;  1AVW A;  1H8I H;  2A5A A;  1MBM A;  1G3B A;  1MTV A;  4I33 A;  1FIZ A;  2G4T A;  1EX3 A;  3SJ9 A;  2GZ7 A;  4WWY A;  1MAX A;  1O3K A;  1T4V H;  3K65 B;  4HFP B;  1HYL A;  1UK2 A;  3T5F H;  3BTQ E;  5HMA A;  1BT7 A;  2NWN A;  3A7Y A;  4WH6 A;  2ALV A;  1PQ7 A;  3KGP A;  4NA9 H;  1FLE E;  1KIG H;  3BIU H;  1COW D;  4X8V H;  5DP3 A;  2PKA A;  4ABA A;  5T3H A;  3SV9 A;  1WUN H;  5F8Z A;  5EOD A;  3N99 A;  3JZ1 B;  3EA7 A;  3MH5 A;  4UFF H;  2Y5G A;  1DLK B;  2V3H H;  1GHY H;  3A84 A;  3CP7 A;  2J38 A;  4JYT A;  1CO7 E;  1P04 A;  4ISH H;  1O2L A;  1NN6 A;  2VGC C;  3PTN A;  2FLB H;  1K22 H;  1SGT A;  1L0Z A;  1O38 A;  1ZPZ A;  3W94 A;  2ZFR H;  1FXY A;  1K1I A;  3ZVG A;  1VJ9 U;  3UNQ A;  1VKY A;  2Y6T A;  3GDV A;  4DIH H;  1BRA A;  1TAL A;  2ASU B;  5PTP A;  1MU8 B;  1D3Q B;  2OD3 B;  1T7C A;  3OYP A;  3SGB E;  1WV7 H;  2Q6D A;  4JMY A;  1NU7 B;  1LHC H;  2EI6 A;  4CHA C;  2BOK A;  1GG6 C;  1KDQ B;  1YLN A;  3ZV8 A;  5C17 A;  2ZNK H;  2ZPR A;  5LH8 A;  3AW0 A;  4RKO B;  3A87 A;  2YMS B;  1QQU A;  2ZA5 A;  2XBV A;  1BQY A;  1FNI A;  2AGI X;  3MMG A;  5L30 H;  1UTQ A;  4FOU C;  1P05 A;  1AY6 H;  3TGJ E;  1UJ1 A;  2FOD A;  4RI0 A;  1VCQ A;  4OS1 A;  1OWJ A;  2B5T B;  1P01 A;  3SQE E;  1TGB A;  4UFG H;  3BF6 H;  4FVB A;  1EP6 A;  7EST E;  1FI8 A;  4AFZ A;  1HLT H;  4ISN A;  1QBV H;  5GJ4 B;  1MCT A;  4KTC A;  2TGD A;  1AU8 A;  3M35 A;  2ZEB A;  1LPZ B;  1QB1 A;  4TT3 D;  2OQ5 A;  5F53 A;  3T28 A;  1BTX A;  1IQK A;  2GX4 A;  3WWB A;  1AN1 E;  2WYG A;  2FO9 A;  1W3C A;  5A8X A;  1LHD H;  1TNG A;  1SGN E;  1VIT F;  2IJD 1;  2R0K A;  5A2M H;  3LGW A;  2Y81 A;  5T6F A;  3M7T A;  2HNT F;  2XBW A;  3UQV A;  5KED A;  3SW2 B;  1MD7 A;  1F5K U;  2BD4 A;  1BTZ A;  2OLG A;  4E05 H;  5HXF A;  2FMJ A;  1LVB A;  1XM1 A;  1CT0 E;  2F91 A;  1GMH F;  1O2H A;  3SU2 A;  1OOK B;  2KAI A;  4K69 A;  1YCP K;  2PHB A;  2Y5H A;  2P94 A;  2XND D;  4Z1M D;  4NA8 A;  2ZDK A;  2OC0 A;  1C2M A;  1WXR A;  2J92 A;  1GJC B;  4AGJ A;  4B71 A;  3KL6 A;  5FCK A;  1GBC A;  3A7X A;  3M5N A;  1C1M A;  3RXB A;  1P06 A;  3I77 A;  4CRA A;  1RD3 B;  5H4I B;  1MTW A;  3TGK E;  3MU0 A;  1O5D H;  4KGA A;  1GHB F;  1TBR H;  3RXH A;  4X6M A;  1BHX B;  2UUF B;  2NU0 E;  3TNS A;  5EJL A;  1P0S H;  4X2Y A;  2BLV A;  2FS8 A;  4ZHM U;  1SGD E;  1UTM A;  1MQ6 A;  1O2S A;  4YLQ H;  4AYV B;  1H4W A;  1EUF A;  4CRB A;  4I7Y H;  1AVG H;  2FDA A;  3KQB A;  4X1S U;  1GDQ A;  3HK3 B;  2UWL A;  3H5C B;  4B6E A;  2B8O H;  2STA E;  1AZ8 A;  4X8S H;  1XUF A;  4AN7 A;  3DSP A;  2LPR A;  3RXP A;  1WQS A;  1SC8 U;  1LO6 A;  1T4U H;  3D65 E;  3RC6 A;  4E7R G;  2A4G A;  4K8Y A;  4CHA B;  1VZQ H;  1BTH H;  3DSG A;  2BLW A;  5A8Z A;  1ABI H;  4ZXX H;  2VIW A;  3LKW A;  3UPE A;  1HXF H;  1BTP A;  3M7U A;  1DWD H;  1GL0 E;  4K2Y A;  1CGJ E;  2P95 A;  2BDH A;  1H9H E;  1O5B B;  1UCY K;  4JZD H;  2ZP0 H;  2FI4 E;  5E0J A;  2DE9 A;  1D3T B;  1MZD A;  3EGK H;  1GVL A;  1PPB H;  3SNA A;  1CGI E;  2GT7 A;  1GBT A;  1DDJ A;  2W26 A;  2H9H A;  1O2G H;  2BD8 A;  1ZML A;  3SV6 A;  5C20 A;  1O3E A;  4Y7A A;  6EST A;  3NXP A;  2HRV A;  2P93 A;  3F6U H;  1OWH A;  1EPT C;  3MQK C;  1JOU B;  4DJZ B;  2FOH A;  2P8O C;  2Z9I A;  3S9C A;  2PUX B;  2BY9 X;  1ZZZ A;  1SQO A;  3GDS A;  1PQA A;  3K9X B;  4WXV A;  1EKB B;  1ELG A;  3E6P H;  4Q63 A;  2IOT A;  1O3C A;  1OPH B;  1LVY A;  6CHA C;  5BRR E;  5FHT A;  3BV9 B;  4ZHA A;  1A3E H;  2VWL A;  3LC3 A;  5DP8 A;  2IJO B;  2ZKS A;  4I8J A;  2A4O A;  1ETS H;  1EZX C;  5A09 A;  8KME 2;  1O39 A;  5JBC S;  4JK5 A;  1GBK A;  2HNT E;  3SYJ A;  2BM2 A;  4ZH8 A;  1C1O A;  3O8B A;  1DT2 A;  1LHG H;  1GI6 A;  1ARB A;  1S6L A;  2BD2 A;  1J15 A;  2SGE E;  5EJ1 A;  3FP6 E;  4BTU B;  2ZHW H;  2WPJ S;  3HKJ B;  4UON A;  1S84 A;  4JYV H;  4P02 A;  1G2M A;  1MKW K;  1MH0 A;  1S85 A;  1UHB A;  1ZPB A;  4OGY A;  2BDY A;  1KTT B;  5IK2 D;  1TPA E;  1YPE H;  1O35 A;  3R0F A;  1YKT A;  1VIT G;  1IQF A;  3E0N B;  3NZI A;  1V6D A;  1YPJ H;  1S82 A;  1QQ4 A;  5C5N A;  4ABF A;  2Y82 A;  1Y5A T;  1TRY A;  3AVZ A;  3KQD A;  3LOX A;  3MU4 A;  2P3U B;  4ISI H;  1V2K T;  1P9S A;  1E35 B;  1OP8 A;  2A2Q H;  2DE8 A;  4YOJ A;  1PQ8 A;  2CHA C;  1GMH G;  2HNT C;  3GCT F;  3W1E A;  2XWB I;  2Z9J A;  3TVJ B;  1BBR H;  1Y3U A;  2FOM B;  5FPY A;  1HNE E;  3GCO A;  2QA9 E;  3PO1 C;  3WWF A;  2F43 B;  3AK5 A;  4AGK A;  3ZVC A;  1DS2 E;  2A7H A;  2TGP Z;  3M3V A;  1YPH E;  1UTP A;  1L1G A;  3FP7 E;  3U8T H;  2ZHE H;  4A7I B;  1FPH H;  1O5F H;  1FDP A;  1UTN A;  5E8E H;  1GHB G;  1P12 E;  1TQ0 B;  1T8M A;  1A0J A;  2Z9G A;  4Y76 A;  3RDZ A;  4JZ1 A;  1BRC E;  2PGQ B;  3Q77 A;  4Y10 E;  3SHA H;  2LNC A;  3HPT B;  1E36 B;  3DSO A;  1C2K A;  2ZDA H;  1AI8 H;  2J5U A;  1SMF E;  3KCG H;  2XYA A;  2PFE A;  3LON A;  1B0E A;  2THF B;  3M7Q A;  1AE8 H;  4INK A;  1W12 U;  2HVX A;  3F2F A;  4RSP A;  1ZRK A;  2JET B;  1FN8 A;  1AVX A;  3GCH C;  2O8U A;  1TNL A;  2ZCH P;  1UCY E;  4UEH H;  1QTF A;  1TOM H;  1DLE A;  4LZ1 H;  3DA9 B;  3KNX A;  3MNX A;  4Q7X A;  1QL7 A;  3B23 B;  2XCN A;  1LDT T;  4UFD H;  1YPK H;  1NBM D;  3RXG A;  5B6L A;  1CT2 E;  7LPR A;  1C4V 2;  1GJ9 B;  1ZGI A;  2F9V A;  1UVS H;  2ZCK P;  4INH A;  1FQ3 A;  1ZHP A;  1N6Y A;  1Z8I B;  1ZSJ A;  2ZGX H;  1PYT D;  3E16 B;  2CK3 D;  1IQL A;  3H7T A;  2JKH A;  2BOH B;  4Q2K A;  1GMC F;  2VH6 A;  1BRB E;  4MNW A;  1C2H A;  3A83 A;  4CRF A;  5EG4 A;  1YCP H;  2PSY A;  1O34 A;  1QJ1 B;  1VCW A;  2WPL S;  3HKI B;  1O2W A;  1A61 H;  2VWM A;  4MPU A;  1NRQ H;  1RXP A;  3TU7 H;  2J34 A;  2ZCL P;  1PPC E;  2IPQ X;  3PLB A;  2BQ7 B;  1H8E D;  1O33 A;  2BYA X;  2FES H;  4NGA H;  1O2O A;  2FI3 E;  4BTI B;  2OC8 A;  1SGE E;  2Z6B D;  3EDX B;  1E1R D;  3DFL A;  3LH3 A;  3VG8 A;  4FU9 A;  1A1R A;  1RS0 A;  3C27 B;  2CV3 A;  1C1N A;  1JMO H;  2QYI A;  3UOU A;  2PKS C;  3U8R H;  4ABB A;  1K1M A;  1WQV H;  1VGC C;  2V3O H;  4MPV A;  3QUM P;  4CRD A;  1GJ6 A;  4A1X A;  4ZCN A;  1DM4 B;  5ABW A;  1FY4 A;  3ZVF A;  3ZVE A;  3A8C A;  3VXF H;  5AFY H;  5DP9 A;  3ATL A;  2XOK D;  1DVA H;  2O8W A;  4Q80 A;  2YNB A;  4CRE A;  3A86 A;  4RN6 A;  4OS4 A;  3BG4 C;  1O0D H;  1OWK A;  3URC A;  4BAQ B;  5FBE A;  1TFX A;  2Y5F A;  3U8O H;  4VGC B;  1NFY A;  2L74 A;  3RML H;  2EST E;  2NU2 E;  1O2Y A;  1DST A;  4ACB A;  1C9T A;  3MFJ A;  2FZZ A;  1C4U 2;  1AO5 A;  1K1O A;  2SNW A;  1TNH A;  2V3M A;  5GCH F;  1D6R A;  2ZTY A;  4XDE A;  1HJ8 A;  3MO3 A;  2PR3 A;  2FOG A;  4OS7 A;  2FPZ A;  3BTF E;  3ZZB A;  5C94 A;  2AIQ A;  3O8D A;  5T6G A;  2WIN I;  3QGJ A;  2PV9 B;  2B9L A;  3B8J A;  1D3D B;  4X0W U;  5GIB A;  3GCT G;  4B74 A;  3S0N A;  1EZU C;  1QGF A;  2A0Q B;  4B1T A;  1FUJ A;  1C9P A;  5F8X A;  3GCN A;  1IHT H;  1TNK A;  1GI5 A;  3V3M A;  2ZZU H;  2R2W U;  3GYM A;  2AFQ B;  3TLO A;  1SGY E;  3RMN H;  3IIT A;  3RXS A;  3A89 A;  1YPM H;  2ZEC A;  3LGV A;  4EST E;  2KZ4 A;  1YWU A;  2ANW A;  3E3T A;  3M3T A;  1TE0 A;  4I8H A;  2R9P A;  4JK6 A;  1DSU A;  1MAY A;  1IQI A;  1P9U A;  1U6Q A;  1QHR B;  1EAI A;  3URE A;  5DSF A;  4FUE A;  2GMT C;  1H9L B;  3MI4 A;  3I78 A;  1J9C H;  1HJ9 A;  5LPR A;  4AX9 H;  2WSS D;  3ZZ9 A;  5JB9 S;  1CU1 A;  3TK9 A;  3TH3 H;  4E7N A;  4TWW A;  2D26 C;  1W7G H;  1M9U A;  4HTC H;  1C2J A;  1SSX A;  5L2Z H;  2JH6 D;  1C5W B;  1EAW A;  1G3C A;  1O32 A;  1F5R A;  4E06 H;  1OKX A;  1FY8 E;  1MKW H;  1QBO A;  3KEE A;  1ZJD A;  2A45 B;  2CF9 H;  3LJJ A;  1UVU H;  2J98 B;  3UQO A;  4Y79 A;  2PKS B;  1EAS A;  1RTF B;  1XUI A;  3KQC A;  1C5Q A;  1O2X A;  4O97 A;  1XVM A;  2ZHF H;  5EQS A;  2FS9 A;  2BDC A;  1BMA A;  3DFJ A;  3HGN A;  3SV2 H;  3NCL A;  1P57 B;  4J2Y B;  2GCT B;  4X2V A;  2AHM E;  1V2M T;  4XSK U;  4YXW D;  1GMC G;  1DY8 A;  1O37 A;  1O3B A;  5ESB A;  4B75 A;  2ZHQ H;  3RUO A;  2H9T H;  2EA3 A;  4FUH A;  5FBI A;  1C5X B;  3F2G A;  3VXE H;  4CBO A;  1NZQ H;  1EJN A;  2GTB A;  3PM3 A;  1SGQ E;  1AB9 C;  3EE7 A;  1QCP A;  3G01 A;  3PMJ A;  2H9E H;  3BTM E;  1MTN C;  3GYL B;  5A0A E;  3RXU A;  2QF0 A;  5LGO A;  4O3U A;  1NT1 A;  3KHV A;  5C1X A;  3VPK A;  1ESA A;  3E91 A;  5CHA B;  3VFE A;  2ULL A;  1AKS A;  2JJ1 D;  1JRT A;  3F1S B;  1Z8G A;  1EAT A;  2HPP H;  2BMG B;  1BJU A;  4HG6 A;  2K1Q A;  5TJX A;  1DIC A;  3UFA A;  2OK5 A;  3V0X A;  2BZ6 H;  1TGT A;  2XBX A;  2TGA A;  2A5I A;  1K9O E;  1KXB A;  6GCH F;  1Z6E A;  1HRT H;  3VB5 A;  1GI8 B;  1GJB B;  4YOG A;  4B2B A;  4K3J A;  5GND A;  1P02 A;  1BIO A;  1W0K D;  3SJO A;  4DW2 U;  3ZZD A;  3KID U;  2J95 A;  1DFP A;  3SU3 A;  2O8T A;  1DIT H;  3SBK A;  3F0O A;  4NZL A;  1TIO A;  5KGO A;  1C5T A;  4I8K A;  4CBN A;  3RC5 A;  1EAU A;  3A7Z A;  1C2G A;  3PLP A;  3URD A;  4Z6A H;  3A8D A;  3RLY H;  1QUR H;  4DOQ A;  3ZVB A;  4DT4 A;  3A7V A;  2Q1J A;  2ZQ1 A;  3F2H A;  1W0J D;  1LPG B;  3BTT E;  4WH8 A;  1ELV A;  1YYY 1;  5C2Z A;  1HJA B;  3HGP A;  2SGQ E;  2ZQ2 A;  1T8L A;  2F9P A;  3KQE A;  4FUF A;  4ISL A;  2AER H;  1PPZ A;  4ZRO A;  1BBR K;  1SFQ B;  5C0T A;  2PP6 A;  3H09 A;  1GCT C;  4BXS A;  2HGT H;  1LPK B;  3MNC A;  1NBM E;  1S83 A;  2BDA A;  3RLW H;  5EW1 H;  4INL A;  3RMM H;  1Q2W A;  4X6N A;  4IMQ A;  3HAT H;  1TMU H;  1AWF H;  4B76 A;  1MD8 A;  1OYT H;  2W6I D;  3F9G A;  1EP5 A;  1RTK A;  1TNJ A;  3MNS A;  4HZH A;  1ELA A;  5E2P A;  1TGC A;  2HOB A;  4FUD A;  3SU6 A;  1LQD B;  2V35 A;  1MUE B;  1AQ7 A;  3UR6 A;  4TPI Z;  2K0Q A;  2EI8 A;  1P09 A;  1WCZ A;  4MPX A;  4IGD A;  1V2J T;  2EY4 C;  1O2I A;  1SGC A;  1N8O C;  2QY0 B;  1D4P B;  3OEH D;  5F8T A;  2W6J D;  2ZDV H;  1UMA H;  3TH2 H;  2UWO A;  3UWI A;  1FN6 A;  3MU8 A;  5GDS H;  3W95 A;  1C1R A;  1SB1 H;  1B5G H;  1HAY B;  2GKV E;  2VNT A;  3QZR A;  4YM9 A;  1Z8J B;  1DXW A;  2BDG A;  2ZFT A;  3D49 H;  1E0F D;  4DCD A;  3Q3K A;  1TYN A;  2ZPQ A;  5FPS A;  4MG3 A;  4WF8 A;  1V2P T;  2ZGC A;  1GI9 B;  3E90 B;  1GMD F;  4YLU A;  1SFI A;  2G8T A;  1FJS A;  1QRW A;  1CHO F;  2FYR A;  2OCV B;  4RT0 A;  3SU4 A;  3UY9 A;  1O5C B;  1L1N A;  1PYT C;  3UWJ H;  2C90 B;  1PPH E;  4BAO B;  3AW1 A;  1O2P A;  3OE7 D;  1YC0 A;  1OP0 A;  4GSO A;  1NS3 A;  2Z94 A;  1W8B H;  1O2V A;  2XTT B;  1RGQ A;  1SQT A;  3GIC B;  3PWB A;  4CRG A;  2VIV A;  4CR9 A;  2R2M B;  3ATK A;  5F6M A;  1HIA A;  3V7T A;  1Y3X A;  4NIW A;  2TIO A;  2ZI2 H;  1P2N A;  3ZZ7 A;  3ODF A;  3K6Y A;  1P03 A;  1V2T T;  2C8X B;  1ANC A;  1V2N T;  4ABE A;  1O3A A;  4ASH A;  2GDD A;  1S81 A;  1V2L T;  5FPT A;  2G00 A;  1OS8 A;  2BD3 A;  1G9I E;  1C5R A;  2OC1 A;  2VGC B;  3ZYE A;  1WTG H;  3P6Z B;  2GP9 B;  3F0P A;  1SLX B;  2J4I A;  1MAB B;  3GY7 A;  1NRO H;  4ZXY H;  1TA6 A;  5C0U A;  1HAX B;  2GCH F;  1KMH B;  4X1R U;  4FVD A;  1AFQ C;  1O3F A;  1SBW A;  4Y8Z A;  1GCT B;  1KDQ A;  1ZSK A;  4AFQ A;  1C5M D;  3SGQ E;  2QXJ A;  2L6O A;  1A7S A;  1BA8 B;  1LMW B;  3MO9 A;  3SUG A;  3RMO H;  1UHB B;  1SHH B;  1G2L A;  1TPP A;  2B7D H;  1A4W H;  3TGI E;  1GG6 B;  5C1Y A;  3T26 A;  5EPY A;  1SGI B;  3Q76 A;  1MTS A;  3F9H A;  3F9F A;  3FVF B;  1NRN H;  1J17 T;  1ID5 H;  2Q6F A;  2ODY B;  3EQ0 H;  3LGI A;  3QZQ A;  1UTJ A;  3MHW U;  1CBW C;  1CE5 A;  4MLF B;  4DT7 B;  3Q3Y A;  2AEI H;  2XXL A;  1HV7 A;  2WV9 A;  1J16 A;  2QXG A;  5CMX H;  3ZIA D;  1C5Z B;  1HPG A;  5K7R A;  7KME H;  1UO6 A;  2CF8 H;  2F3C E;  1N8O B;  4RT1 A;  4GAW A;  2OC7 A;  5JBA S;  1NFW A;  2FTL E;  1GJ4 H;  3ZYD A;  1HB0 B;  1PFX C;  2ZG0 H;  4UD9 H;  4F55 A;  1OP2 A;  3SGA E;  1EJM A;  3RP2 A;  1P10 A;  5CE1 A;  1EOL A;  2WPI S;  3UNS A;  1XUG A;  5EJZ A;  1DXP A;  4YT7 H;  5FX6 A;  1QBN A;  5AF9 H;  1WU1 A;  3U1I B;  4AOR A;  2QE7 D;  2SGP E;  2QN5 T;  3FOA A;  4M9F A;  2XWA A;  1IAU A;  2A7C A;  2SGD E;  2ZGH A;  1NM6 A;  4GHQ A;  4NFE A;  2GZ8 A;  1GBL A;  1SG8 B;  3SQH E;  1UVP A;  2M2A A;  1GVZ A;  4ZHL U;  2F9O A;  3QK1 A;  1WTH D;  1QJ6 B;  3P92 A;  5JPM H;  4A1V A;  1IQE A;  1EZQ A;  1LTO A;  1GGD C;  3PMB B;  2FLR H;  1CGH A;  4WY3 A;  4AOQ A;  2GGV B;  1H8H D;  1OXG A;  3PRO A;  1ZJK A;  1ZHM A;  1S0R A;  1P3E A;  1V2W T;  3QTV H;  4BAN B;  5DK1 A;  5HYO A;  1ESB A;  2FOB A;  1NFU A;  2XC0 A;  1HAG E;  3D23 A;  3IWM A;  2BX4 A;  2QC2 A;  4LOY H;  1WYK A;  1EOJ A;  4OM9 A;  2AH4 X;  1G3E A;  1GJ8 B;  4DUR A;  5AHG H;  2WPH S;  3RXL A;  1QA0 A;  1GBD A;  1L1J A;  1O2U A;  1HUT H;  2D8W A;  1RRK A;  1THR H;  4Y8Y A;  3GOV B;  2XNI A;  1ZMN A;  2BDI A;  5HIY A;  4KKD A;  5EU8 A;  1DUA A;  3NK8 A;  3NRL A;  1F0S A;  1AMH A;  2QV1 A;  3VGC C;  5EOK A;  2C8W B;  1C2L A;  1ZOM A;  2BD7 A;  4TWY A;  3STJ A;  4AB8 A;  4BAK B;  3LGY A;  2KM0 A;  1GBF A;  3LT3 A;  1EB2 A;  4I32 A;  2ANY A;  1BCU H;  2CMY A;  2FYQ A;  2RA0 A;  1TRM A;  2SGF E;  4BNR A;  6LPR A;  2EC9 H;  1QNJ A;  1TX8 A;  1ANB A;  2A1D B;  2GCH G;  2FXR A;  3BEI B;  1O3I A;  8LPR A;  1A2C H;  2WHX A;  1FX0 B;  4Y11 E;  5JBT A;  3OAA D;  1A5G H;  1K1P A;  2P3T B;  3QO6 A;  5DP6 A;  2Z3D A;  3ZZ8 A;  1YM0 A;  2F9U A;  1QJ7 B;  1Y5B T;  4Y71 A;  1AIX H;  5T6D A;  1RTL A;  2ZPS A;  8EST E;  5GWZ A;  1EPT B;  1NFX A;  2BD9 A;  2P8O B;  1MQ5 A;  1TGN A;  2BXU H;  1GJ5 H;  3LGU A;  4BOH A;  1C1S A;  3ZZ6 A;  1HAO H;  2PUQ H;  1K1N A;  3QWC H;  1Z1I A;  1Z1J A;  4IMZ A;  3GY2 A;  4CRC A;  5EIY A;  2RFK C;  6CHA B;  1QZ8 A;  3GY4 A;  2J97 A;  1YPH C;  4HGC A;  2QCY A;  1SLV B;  5F03 A;  1FON A;  1HAI H;  2BZA A;  3EA9 A;  1W10 U;  4XRN A;  1UTO A;  1V2V T;  3A8B A;  3TJN A;  1GI1 A;  3MO6 A;  1IQH A;  2VIN A;  5K0H A;  1VIT H;  3QDZ B;  4KEL A;  3TIU A;  1DX5 M;  1P2K A;  2OQU A;  3OU0 A;  3BTK E;  1Q31 A;  1F2S E;  4U2W A;  5HM2 A;  3ZZ4 A;  2EI7 A;  3D62 A;  1GGD B;  1PJP A;  4I8G A;  1DOJ A;  2ZFS A;  3OTP A;  1L4Z A;  1Z7K A;  1A0L A;  1ZTL A;  1O36 A;  2FTM A;  1XUJ A;  2NU3 E;  3P8G A;  2Z7F E;  2C4F H;  3P8N A;  2KCO A;  4QT8 C;  3M5O A;  3SZN A;  2C8Y B;  5E0H A;  3CS7 A;  3EST A;  5C1U A;  3E8L A;  3PV5 A;  1YY3 A;  3RXK A;  1ETT H;  3M36 A;  4K5Z A;  3TJU A;  1MTU A;  1Z6J H;  5DJ7 A;  1UK3 A;  5EXN A;  4BTT B;  2AS9 A;  3GY8 A;  2CHA B;  1GDU A;  1ETR H;  1SLU B;  5EW2 H;  4U30 A;  2WUC A;  1TNI A;  3QN7 A;  3RXD A;  3KYG A;  2PWX A;  1C5V A;  4GPG A;  4ZKN U;  3VGC B;  5E2O A;  1OWI A;  5EQQ A;  4X1Q U;  3H7O A;  2WUB A;  3PO1 B;  1GL1 A;  3TH4 H;  3BEU A;  1GI2 A;  1GJ7 B;  1AUT C;  1V2O T;  1CSO E;  1NES E;  1K21 H;  2H1U A;  3STI A;  5B6O A;  1AHT H;  3PRB A;  1AE5 A;  2ZGJ A;  1SOT A;  1SOZ A;  3FP8 E;  2HWL B; 
#chains in the Genus database with same CATH homology
 3SV8 A;  3SZE A;  1RTL A;  3OE7 D;  5GND A;  1W0K D;  5H4I B;  1NS3 A;  2OBO A;  3WW7 A;  3SU3 A;  5DSF A;  1RGQ A;  3F0O A;  4TSF D;  2A4Q A;  5IK2 D;  4NWK A;  3OEE D;  3L6P A;  2M2A A;  3RC5 A;  2LEL A;  3SUF A;  2WSS D;  2OIN A;  1H8E D;  1CU1 A;  2HLD D;  3M5M A;  3KF2 A;  2WPD D;  2GVF A;  4I31 A;  4DT4 A;  3LOX A;  3N7D A;  2OC8 A;  5IDK A;  3OYP A;  1E1R D;  4JMY A;  3M5N A;  3VG8 A;  4A1V A;  1A1R A;  2P59 A;  3F2H A;  3FN8 A;  4B6E A;  3SU5 A;  2YMS C;  1W0J D;  5ETX A;  4WH8 A;  2A4R A;  4ASU D;  2YMS D;  5FPT A;  3DSP A;  5T1V A;  3KEE A;  1E1Q D;  1N1L A;  2F4L A;  3RC6 A;  2GGV B;  5DN6 D;  1DY9 A;  2OC1 A;  1H8H D;  5C17 A;  1JXP A;  3W1E A;  4A1X A;  2A4G A;  3SV7 A;  4B73 A;  2KCY A;  4ZCN A;  3FKS D;  3U1J B;  3RC4 A;  2YMS B;  2QF4 A;  3KN2 A;  3SUD A;  3F0P A;  1MAB B;  5EQR A;  3OTP A;  2FOM B;  5FPY A;  1E79 D;  2XOK D;  3LKW A;  4M9F A;  5C0T A;  5C0U A;  3H09 A;  5EQS A;  1EFR D;  1KMH B;  2KFW A;  4Q4L A;  4RI0 A;  3P8N A;  1BMF D;  2F43 B;  1NBM E;  2KCO A;  2V7Q D;  2JIZ D;  3FO8 D;  4XD7 D;  3SUE A;  4B6F A;  3AK5 A;  4FET A;  2AHM E;  3M5O A;  4YXW D;  4OM9 A;  3O8C A;  3M5L A;  1DY8 A;  5ESB A;  4B75 A;  3DCL A;  2JJ2 D;  2JDI D;  2O8M A;  3PV5 A;  4A1T A;  3GS9 A;  2KCA A;  3WWF A;  5FL7 D;  2QF5 A;  5GJ4 B;  4B76 A;  4KTC A;  2L6O A;  2W6I D;  3SU0 A;  2KR7 A;  3PRD A;  3F2G A;  3SUG A;  3SU6 A;  4TT3 D;  5F53 A;  4I33 A;  2XNI A;  3WWB A;  3SV6 A;  2VBC A;  5GPI B;  3DSO A;  2K0Q A;  4A92 A;  1W3C A;  5EPY A;  3NRL A;  2IJD 1;  2J5U A;  4R8T B;  2QV1 A;  5CHB A;  3LON A;  2OBQ A;  1OHH D;  1BT7 A;  3OEH D;  2WV9 A;  4WH6 A;  2YOL A;  2KM0 A;  2W6J D;  3F2F A;  3ZIA D;  3F3B A;  2XCF A;  3O8D A;  5EQQ A;  1COW D;  1SKY E;  2JJ1 D;  2K8I A;  4Q63 A;  5CDF E;  2OC7 A;  4B74 A;  4I32 A;  3SV9 A;  1DXW A;  3SU2 A;  2IJO B;  4TYD A;  3UB0 A;  2FP7 B;  3KNX A;  2K1Q A;  5EPN A;  3P8O A;  5FPS A;  4K8B A;  2KCP A;  2XCN A;  4WF8 A;  2OK5 A;  4NWL A;  3SU1 A;  3EYD A;  4F55 A;  3N99 A;  5HKK D;  2XND D;  1NBM D;  4Z1M D;  3O8R A;  3E90 B;  3SYJ A;  3N7E A;  5B6L A;  3O8B A;  4U01 A;  2OC0 A;  2WHX A;  1FX0 B;  3PRB A;  3PV2 A;  3OAA D;  3SU4 A;  2WZQ A;  1WXR A;  2FM2 A;  1DXP A;  1S6L A;  2F9V A;  3U1I B;  2KZ4 A;  3OFN D;  4B71 A;  2QE7 D;  2F9U A;  3FOA A;  2CK3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...