5T1VA

Crystal structure of zika virus ns2b-ns3 protease in apo-form.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
217
structure length
158
Chain Sequence
VDMYIERAGDITWEKDAETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERARNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS2B-NS3 protease,NS2B-NS3 protease
publication title Crystal structure of Zika virus NS2B-NS3 protease in apo-form.
rcsb
source organism Zika virus
molecule tags Hydrolase
total genus 27
structure length 158
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5t1vA00
5EQRA 3U1JB 3SU6A 2OK5A 3M5MA 3KNXA 4A1VA 4A92A 5FPYA 2WZQA 4OM9A 5B6LA 3O8BA 2GGVB 3SUEA 3O8RA 1DY9A 1W3CA 5H4IB 4WF8A 2O8MA 3M5LA 3LKWA 3PV5A 2OC8A 1A1RA 3O8DA 2XNIA 5EPNA 2IJOB 5GPIB 4A1TA 4K8BA 5ESBA 2WHXA 5EQSA 2OC0A 4JMYA 1JXPA 2XCNA 5EPYA 3SU2A 1DXWA 4RI0A 3SV8A 3O8CA 3SV6A 2FOMB 1RGQA 4WH8A 3RC5A 3SU4A 3SYJA 2IJD1 3U1IB 3SU1A 3M5NA 4NWKA 4M9FA 3SUFA 4WH6A 2F4LA 3SUDA 4KTCA 2K1QA 2QV1A 4B6EA 4A1XA 3SU5A 2OC1A 2FP7B 4U01A 2OBOA 3KEEA 2VBCA 3P8OA 1WXRA 2OBQA 5GNDA 2F9UA 3E90B 1DY8A 2A4GA 1N1LA 2A4QA 5IDKA 2WV9A 1DXPA 3SU3A 3LONA 5GJ4B 3SU0A 3EYDA 4R8TB 4B75A 1BT7A 2A4RA 1RTLA 3KN2A 4B71A 4NWLA 5FPSA 3M5OA 2P59A 4I31A 3SV7A 2XCFA 2F9VA 3LOXA 3KF2A 5EQQA 4I33A 3P8NA 4B6FA 4TYDA 5ETXA 3SV9A 3L6PA 2FM2A 2GVFA 4B73A 2OC7A 3RC6A 3SUGA 2YOLA 3H09A 3RC4A 3AK5A 1CU1A 5FPTA 4B76A 3PV2A 4B74A 4I32A 5T1VA 3SZEA 2OINA 3OTPA 3OYPA 1NS3A
chains in the Genus database with same CATH superfamily
2Y7ZA 4X2XA 3M5MA 1J9CH 4DVAU 2ZFRH 1DFPA 1K1MA 1XUKA 4NIYA 4MPUA 2QCYA 3WY8A 2GTBA 2BMGB 1SG8B 1C5TA 1HAVA 2LPRA 3Q00A 5GPIB 2YMSB 5EQSA 1Z1IA 2OUAA 2XCNA 1ABIH 1CGIE 2G4TA 2AGIX 2J34A 1RTFB 2XWBI 4OGYA 1UTQA 1ELBA 1C1OA 2FOGA 1BRBE 1RD3B 4WXIA 2ZTYA 2XBYA 1LQDB 1C1MA 1KXBA 5DG6A 2EI7A 2XWAA 2L6OA 1Z8IB 2PV9B 1O3JA 2FS9A 3A7XA 5ABWA 9LPRA 3SU5A 2KM0A 1W0YH 1C1SA 1P3EA 1JWTA 2RG3A 1WCZA 2BOHB 1RIWB 1IQNA 1OWDA 3RXEA 3FP8E 4INLA 4AYYB 1AFEH 1SOZA 5EU8A 3MI4A 4FUEA 5FX6A 1Y5UT 1EAIA 2NU2E 1JRSA 1BMNH 2J95A 3VB7A 4I86A 1O3PB 4MVNA 2KZ4A 1P57B 3K2UA 3RXUA 1GI0A 3K65B 1P2MA 1WTGH 1ZMJA 1XXFA 1AI8H 2BDBA 1KXAA 4BANB 4FU9A 1EPTC 4Q2KA 1SC8U 4JK6A 1A5HA 2RDEA 4AYVB 1BBRK 3P8NA 7ESTE 3A7YA 3T62A 1P8VC 4BNRA 2PKSB 1SGDE 4K1SA 2WPJS 1MKXK 4X6PA 3SHAH 1MKWH 3HGNA 2ZFFH 2ZGJA 1SFQB 3D49H 1ESAA 1MTNC 3NXPA 1QIXB 2ZKSA 4H6TA 1BTXA 2W6JD 1QA7A 2TGDA 1YCPK 4Z0KA 3OYPA 2VIPA 3A7WA 1CHOF 1P05A 2WPMS 1SGRE 1TABE 3C1KA 2SFAA 5JBBS 2GGVB 2QF5A 3ZIAD 1O5FH 1CE5A 2CF9H 1TPOA 3OX7U 1GI3A 5T3HA 3RXIA 1G2LA 4ABBA 1UJ1A 3LKWA 5JB8S 1AGJA 2YNBA 4U30A 1DWCH 4XD7D 5JDUB 1WBGB 1XKAC 1EASA 1GI7B 4A7IB 4B1TA 1LPGB 3V3MA 3EQ0H 3M7QA 1O2RA 5T6GA 1S82A 3TJUA 3F68H 1TONA 1FQ3A 1QR3E 2FOHA 2FODA 3F9GA 4GCHG 5GXPA 5C5NA 1HGTH 1GI5A 1O2JA 5GDSH 1S5SA 3BTQE 4SGBE 1ZRKA 1N6XA 1SGYE 1L1JA 1GCTB 2TGAA 2A2QH 2TBSA 1FJSA 1SQRA 2BX3A 4X1QU 3SYJA 2ZDMA 3KL6A 4A5TS 1AQ7A 1ELDE 2R3YA 1GI8B 1EPTB 3ITIA 1VZQH 2QXGA 4P02A 2C93B 1IQMA 5C1XA 1GHBG 3KEEA 3PMJA 1HJ8A 3M3SA 4Y8ZA 1Y3VA 2ZDAH 1ZHPA 2HPPH 2QA9E 2HPQH 1B5GH 4UFGH 1O5GH 1ZSJA 5KEDA 1FN6A 1MTNB 2AIPA 1YPMH 2QGRA 2PWXA 1GMDG 1O3MA 2ZCLP 5IDKA 1OYQA 4MNXA 2AERH 1MUEB 4MNVA 3KQCA 3TVJB 3DSGA 1GBBA 4JCNA 5LPEA 2ZGCA 2W7SA 2GV7A 3TJNA 1NRSH 1YPLH 2ZHDA 1ZHMA 2A5KA 7GCHG 1NBME 3VEQB 2F9VA 1QTFA 5T6FA 1L1NA 4OS7A 1DVAH 1Y8TA 3RP2A 3FKSD 1DPOA 5T6DA 2ZC9H 2WPDD 2CF8H 3H5CB 3RC6A 2EQNA 3TNTA 4D8NA 1H9IE 1UK2A 4ABAA 4AX9H 1OP2A 1CU1A 5GWZA 4OS6A 1U6QA 1FAXA 3SZEA 2W6ID 4JYVH 2CK3D 1TPSA 1G9IE 3A82A 4FU8A 2JH5D 1CA0B 1HBTH 2H5DA 3VG8A 1P09A 2Y5HA 1HUTH 1ZPBA 2J97A 1AN1E 3SGBE 2ASUB 2GZ9A 1GBTA 2GX4A 3NWUA 4Q63A 4H6SB 5DP7A 1YCPM 3GY6A 2F83A 1BA8B 3OE7D 1CBWB 1AUJA 1HDTH 1TX6A 1F2SE 3PV5A 2ZECA 2XNIA 2WUBA 4CHAC 1W14U 3LGTA 4A1TA 1DOJA 2C4FH 2IPQX 1NRNH 2C3SA 1EB1H 1GGDC 1GBDA 1YPJH 2OLGA 1BB0B 2H6MA 1KLTA 3ZZ4A 1QL9A 3F9FA 5DP8A 2Z3DA 4B2AA 3UNQA 1MMJN 2WPIS 4ISLA 2P94A 4DGJA 4ZHAA 1ESBA 1O39A 2R2MB 3RXSA 3VXEH 1W12U 2BY9X 2UUKB 5DO4H 1ZR0A 1QCPA 5A0BA 1D4PB 3Q3XA 3P8OA 5JYIA 5A0AE 3GDSA 1HCGA 1GBMA 1UTJA 5CDFE 5C3NA 1EUFA 1O2MA 2FX4A 1E1QD 1E1RD 4D76A 5DN6D 1F7ZA 2ANWA 1V2OT 2R2WU 1KYNA 3LGUA 1OWIA 4ISIH 3MYWA 6CHAB 4DT4A 3N7DA 1X7AC 3RXAA 1AB9B 1GJCB 5FCKA 1Z6JH 1C2GA 1KXFA 1XX9A 3GISB 2OQ5A 4X8VH 3SJ9A 2BX4A 1AWHB 2J9NA 4FUFA 3M5OA 3VPKA 1Q31A 5CHBA 1WSSH 4F4OC 3HATH 3ZVFA 2FTMA 3U8OH 3Q76A 1V2ST 1DSTA 1FUJA 1ELFA 1BMMH 5AFZH 2Y81A 1NT1A 4B2CA 1HV7A 1Z8JB 2GCTC 1GMCG 1OXGA 1HXEH 1T31A 3NRLA 1B7XB 1A0JA 3SI4H 4ABDA 1GJ7B 3SN8A 1QA0A 2F9NA 2FM2A 3R0FA 5L6NH 5EGMA 2V6NA 3GICB 3RXRA 2ZDLA 3EDXB 3KCGH 3K9XB 2ODPA 1OP8A 3GOVB 1S0RA 5TJXA 2WV4A 3UQVA 4VGCB 5HXFA 1C2FA 3OU0A 3BG4C 1NS3A 2CMYA 2K8IA 3P92A 4X1RU 2CHAC 5IK2D 5DP3A 3TGJE 2D1JA 1CA8B 1FY5A 1XUIA 4A92A 3OTJE 2PGBB 2BLOA 1KLIH 5B6LA 1IOEA 3SUEA 1FAKH 2B5TB 4GAWA 4WF8A 5DK1A 1BOQA 2BZ6H 3SJIA 3S69A 5BPEA 1TNKA 1E38B 4O9VA 5C17A 2PGQB 1J16A 3RXKA 3WWFA 3PRDA 2QF4A 2RFKC 2STBE 4I8KA 1BHXF 5JPMH 1NFWA 1W7GH 3PRBA 2ZHQH 1MZAA 1C4U2 1FY8E 1VGCC 3SU2A 4JZIA 1DXWA 1QY6A 3F9HA 2DE9A 3U28C 1SGNE 3UUZA 2BY5X 1JIMA 1NFYA 2A2XH 4I8LA 2EY4C 4WH8A 3OSYA 2ZU1A 1UTPA 1GJ8B 1E79D 1AY6H 3SUDA 4CR9A 1ELGA 1MQ6A 2FEQH 2VIVA 1FMGA 1THSH 1CHOG 1UTKA 3VB5A 1K0HA 1O2XA 1WXRA 5GNDA 3QLPH 4Y7AA 1B0EA 3A8AA 1ZTLA 1HJ9A 1YPHE 1IHTH 1HAVB 4O03A 1C2HA 4CBNA 3SU3A 5GJ4B 2J98A 3H7OA 2I6SA 3EYDA 4B75A 4DURA 1BT7A 1GBIA 4BXWA 1ELVA 1RTLA 4AFQA 1UCYE 1A4WH 1O5CB 1OWHA 1C5MD 4ASUD 1YYY1 3A8DA 3ZZAA 2FIRH 1MD8A 1NBMD 2ZF0H 1LO6A 2A0QB 1TFXA 4YOJA 2PKAA 4K8YA 2BVRH 3MO9A 1UVTH 3SNCA 2Q1JA 4FUDA 4I33A 5A09A 4B6FA 3STJA 5FBIA 1DWDH 3UR6A 1N8OC 1RRKA 3DFJA 1CGHA 1HPGA 4R0IA 2G5VA 1T8LA 1MKXH 2D2DA 2H1UA 1VCWA 4YT7H 1SHHB 1CSOE 1P01A 1K2I1 3AW0A 4UEHH 1FPHH 1BZXE 1EZSC 3PMBB 1YCPH 2HNTC 3QX5H 1EQ9A 2JJ1D 1FIZA 1AUTC 2ZPSA 1AD8H 2O8WA 1T8OA 5A0CA 1EFRD 1GJDB 1GMHF 3QZRA 4FXGH 2VVUA 2J2UA 1TQ7B 3VGCC 1MTVA 3RXMA 2BD7A 1FLEE 4GPGA 1A1RA 1ETRH 1INCA 2XBXA 2ZWLH 4Q7ZA 5DP6A 5DP5A 4AFZA 1E0FD 1K21H 2VVCA 2KCYA 3RU4T 1TYNA 2FZZA 1TNLA 3LGWA 1Y5AT 3GDVA 5EIYA 1DE7H 1LHCH 1GHBF 1HRTH 1BUIA 4BXSA 2Z7FE 4RKJB 1HAPH 3ZVAA 2CN0H 2FX6A 2ZDNA 4JZ1A 5CE1A 1TA6A 2J38A 2TGPZ 3ATLA 1GI1A 3U8RH 1BJUA 1RGQA 3SU4A 4ZCNA 3NKKA 1XM1A 2FYRA 1ABJH 3UWIA 1L4ZA 4KTCA 1VKYA 4K3JA 2PLXA 3RXHA 4Z6AH 2HVXA 4YO9A 1A0HB 4ABFA 3PROA 2TRMA 5EJZA 1ELEE 1EJAA 1GBEA 5HMAA 7GCHF 2KR7A 3PM3A 2A4GA 2A4QA 3ZZCA 1Q2WA 1SBWA 3H7TA 3AAVA 4CR5A 1CO7E 2HGTH 4X6MA 4ZXYH 3FN8A 1PQAA 3FP7E 3ESTA 4DW2U 1YLDA 2HLCA 3AAUA 1O3HA 4O3UA 2FTLE 5E2PA 1K1LA 1UTNA 3ZVEA 2W5EA 2H9EH 4NZLA 5E2OA 5EQQA 4FUJA 2G55A 4TYDA 2PFEA 5ETXA 1P12E 4K5ZA 3SJKA 1C4V2 1BBRE 1D3TB 3CS0A 1C2MA 1BJVA 4K1TA 2YOLA 5L2ZH 5FCRA 1ZMNA 3RXJA 5EW2H 1RS0A 3CP7A 3F3BA 1FI8A 2P16A 4FETA 2Z3CA 4NG9H 4X8TH 4BAHB 2R9PA 5EQRA 1HJAC 1S6FA 4A1VA 1NU9A 1D3QB 1C1QA 1VITH 1Z6EA 1HAYB 3SNAA 1TMBH 1LCYA 1S85A 4ACAA 3PV4A 1TPPA 1K1OA 1VCQA 1PYTD 4X1NU 1GHAG 1Q3XA 2UWPA 4JZEH 1CQQA 2HRVA 3SORA 2DUCA 3OFND 3RDZA 5EPNA 1HXFH 3VB6A 2IJOB 3T2NA 2ZIQH 2D26C 1GDUA 3SQEE 5F8ZA 5K7RA 1F0UA 2ZU2A 3DA9B 2M2AA 3GY8A 2BM2A 1TGBA 3I78A 2Z9KA 3G01A 3QZQA 1C2JA 4Q80A 1IQHA 5JBCS 3PWCA 3SV6A 5G4BA 3PTNA 3KIDU 2ZTZA 4K60A 1SQTA 1COWD 4BAMB 3MH5A 1AFQC 1P11E 3SU1A 3KQEA 1O2WA 1H4WA 1QURH 1UMAH 3GCTF 4NWKA 2JH6D 1Y3YA 3SJOA 1PQ5A 2BXTH 1WDIA 1ZLRA 4TPYA 4FVDA 1SKYE 1P9SA 5JB9S 1H9LB 1O32A 3U9AH 3MNXA 4KELA 5I46H 1CT2E 2JH0D 1O0DH 1C9PA 2A7JA 3LU9B 3BTWE 4Y0YE 1NO9H 4MQAA 1GMCF 1S6HA 2WV9A 1C5SA 1DXPA 1KDQA 3TJVA 4FUIA 5HGGA 1O2ZA 2BDCA 1MU8B 4WMEA 5DPAA 3E0NB 2LP6A 1PYTC 2V35A 1AIXH 1O2LA 1C5WB 3BSQA 1BRUP 3RXQA 1P2OA 2ZGHA 3OY6U 2P59A 2SGQE 2PTNA 4PROA 1EJNA 2FOAA 1NRPH 3KYFA 2V7QD 1H1BA 4X6NA 1GBAA 5L2YH 1ZTKA 1AVXA 1N6YA 2GVFA 3A88A 1BIOA 4RT0A 2VIWA 1O3OA 5C1YA 4JK5A 4Q7YA 1UO6A 3M36A 2Z9LA 1QQUA 4B74A 2A7HA 1C1PA 1O2IA 2VIOA 1GDNA 2OXSA 3QTOH 1PJPA 2TIOA 3SO3A 4XRNA 3PMHB 2AHME 3UOPA 5JBTA 1Y3XA 3F2FA 3LGIA 2GP9B 1VJAU 4X1SU 1XUJA 1YLCA 1TGTA 1P10A 3UTUH 1D6RA 1TNGA 4XBCA 4ZHLU 3MO6A 4IMQA 1DS2E 1V2KT 3O8DA 5I25A 1XMNB 2BD3A 1IHSH 3ZZ3A 3T5FH 1TA2A 1P2KA 5ESBA 3NPSA 1V2UT 3PLKA 2UWLA 1HAIH 2ZNKH 3S9CA 2UWOA 8ESTE 1MCTA 4OGXA 1ANDA 1T8MA 3LGYA 1GJ9B 4Y0ZE 1C1UH 3HK6B 4H4FA 1O2VA 1BTZA 4FUGA 1ARBA 1C9TA 3EE7A 4O3TA 3RU4E 3URDA 3GY5A 3BIVH 3EA7A 1O30A 3PTBA 3W1EA 4CRCA 2FESH 1YBWA 3M5NA 3ENSB 1G32B 5CHAC 2FLBH 3Q3KA 2HNTF 1LQEA 3FP6E 4GVUA 1KXDA 2GJGA 1G36A 2NU3E 2OC1A 4ABGA 2Z9IA 1OWJA 1TNJA 3BG8A 3NZIA 1AHTH 3P8GA 1JIRA 1GMHG 3GCNA 1DY8A 3GY2A 4JYUH 1AKSA 3BN9A 4CREA 3PLBA 3V12A 1ZPCA 1P2NA 1O2KA 2GDDA 1QBOA 1RTKA 2AS9A 3ATKA 2EEKA 1BHXB 5A8XA 4E05H 3A84A 1QRZA 1FY3A 8KME2 1KMHB 3JZ2B 1MBQA 3W94A 1TLDA 1O3AA 1GBFA 1WU1A 1ZYOA 2Z9GA 2F91A 1OYTH 1SLVB 3ATMA 4LXBH 2JDID 4Q7XA 1ANEA 1QBVH 3ZZ6A 2BQ6B 3MH6A 2P3TB 4YTAA 5A8ZA 2BYAX 1O3FA 1Y59T 2BDGA 3ELAH 5FPTA 2ZU4A 3EE0B 2VIDA 2VVVA 3ZYDA 1DX5M 3GCOA 2TPIZ 2L74A 2VWNA 1C5OH 3BF6H 3PO1C 1K28D 5F03A 3V7TA 1QJ6B 3ODFA 1BTHH 1GBLA 5CHAB 3DSOA 4NA8A 2O8MA 1F0TA 1T4VH 2Y5GA 3QDZB 1BTWA 1C2EA 1H8DH 2AYWA 2QXJA 1H8ED 4UFDH 4GHTA 1C2DA 4K8BA 4YOIA 1CHGA 2VGCC 2PKAB 4CBOA 4UONA 5EW1H 2ULLA 1YY3A 5EXMA 2LELA 4GHQA 4U32A 1UK3A 5HKKD 2ALVA 4RI0A 1C5UA 4MLFB 4Y7BA 3TH2H 4BAKB 6ESTA 2ZEBA 3HK3B 3UY9A 1T8NA 2A4OA 2P3FH 1UHBB 2XNDD 4AC9A 1YPEH 3UWJH 4ABIA 2ZPQA 1T7CA 1TNIA 4YXWD 3BEIB 4THNH 1ZSLA 4YESB 2WPKS 1H8HD 3BTGE 1ARCA 1F92A 2QV1A 3MMGA 4TPIZ 5F6MA 1ZZZA 2QIQA 5EOKA 4ACBA 4XBBA 3F1SB 2JETC 3BTHE 3K6ZA 4XFQA 1XUFA 3OAAD 5C5OA 1AO5A 1W0KD 7KMEH 2C90B 1HAZB 2G8TA 1DUEA 1Z8RA 1Z7KA 1P9UA 2OTVA 2WSSD 1PFXC 2BY7X 5TCCA 3HGPA 4HI3A 2P8OC 2GCHF 1AMHA 1THPB 2VJ1A 1GDQA 4NA9H 1G3DA 2F9BH 1KTSB 1NN6A 2WYGA 4I31A 3DUXH 3SNDA 2GV6A 3SW2B 3M61U 3RLYH 2XC5A 4M7GA 1EKBB 1NU7B 1XXDA 1ZGVA 2KCPA 1D3PB 1IQJA 1GHAF 1D6WA 1L1GA 3GCHC 1O34A 1NESE 2ZGXH 1EB2A 4A6LA 1V2MT 3GCTG 3KQ5A 3RXPA 5FL7D 1UCYH 1GPZA 3K6YA 3SHCH 4KKDA 3TGKE 4I32A 4K1EA 3V0XA 4OS1A 3DD2H 2R3UA 1PPEE 4RSPA 4IC6A 5J4SA 1EAXA 1YC0A 4BOHA 2BQWB 2XC0A 4ZHMU 4FVBA 4WMFA 4CHAB 1G3EA 1BTPA 1SSXA 2ZDVH 8GCHF 2SNWA 3SGAE 4F49A 1T4UH 1IAUA 1SGQE 2OC8A 4K2YA 3OEED 2H9HA 4ZH8A 4RKOB 1GBCA 2OCVB 3TJOA 1GGDB 2BZAA 1TGCA 3TK5A 2WHXA 3TITA 3BTEE 3P95A 1GI6A 1C5LH 2O8UA 4XOJA 1F0RA 3RMLH 1MABB 1C5RA 3MOCA 1OWEA 3IITA 1L0ZA 1TOCB 3BEFB 3HPTB 3KQBA 1BTYA 4WVPE 2FOEA 2JKHA 2ZCHP 5DP4A 3FO8D 2C8XB 2XBVA 2WV5A 3UQOA 1DLKB 4NCYA 1GHXH 1O5DH 1MQ5A 1WQVH 2GZ8A 1EZUC 1AZ8A 4U01A 2W3IA 5AFYH 1GVZA 2VBCA 4IS5A 1UVUH 1NZQH 5C0TA 2ZFSA 3ZZ5A 2A1DB 2B7DH 3VXFH 5F8XA 1NROH 4MPVA 2QYIA 1QL7A 1MKWK 1SHYA 3RM0H 2AGEX 4OS2A 2A31A 1C5QA 2BHGA 1EOLA 1DSUA 3MH7A 3BTKE 4X2YA 1E37B 5C2ZA 2A4RA 2ZFQH 2F9PA 1PQ8A 2Y7XA 3A85A 2VWMA 1KXCA 2R0LA 1G2MA 2QXIA 1GG6C 2GCTB 3ZZ8A 5AVDA 3RMOH 3TGIE 4IC5A 3GY7A 3GDUA 2AMPA 2ZP0H 4FUCA 1FZZA 4WMDA 1QJ7B 1PQ7A 1SPJA 1SMFE 3MNSA 1UVOA 4FUBA 2FI3E 4FUHA 4B73A 3QO6A 2BDAA 1PPBH 1UW7A 2OC7A 1MCVA 5GIBA 3BG4B 3AK5A 1W2KH 2GDEH 1C4Y2 4DCDA 2CHAB 3TH4H 1LHEH 2OINA 3SJ8A 4CH2B 2P93A 4TT3D 1A3EH 1QL8A 5GCHG 4CRDA 2IN2A 2ZFPH 3DT0H 3KNXA 3M35A 1V2TT 1TRMA 2RDLA 2WPLS 1KDQB 2A5AA 5FPYA 4ZKSU 3ODDA 1AE8H 2ZU5A 3FFGA 3RXFA 4F55A 1BBRH 3E3TA 3P70B 1C2LA 3M3TA 1QRXA 1DDJA 2NWNA 1VGCB 1QBNA 4ABJA 4AG2A 4Z1MD 3UPEA 1K9OE 4ZMAH 4ABEA 2PSXA 2ALPA 1A0LA 2CV3A 2J94A 2YNAA 2PW8H 4UE7H 4BTTB 3E0PB 3WW7A 1T32A 2KCOA 4DIHH 5EXNA 1G3CA 3QUMP 1QRWA 3EA8A 3RMNH 2XOKD 1HAHH 1SLWB 5EG4A 2D8WA 1A5GH 3C27B 4AB9A 4FOUC 4OS4A 3MU8A 1PPGE 2V3OH 1Y5BT 2B9LA 2FP7B 3E16B 2OBOA 2PP6A 1FNIA 2ANYA 3BTDE 4Q4LA 1TIOA 1QQ4A 1EAUA 4CRFA 2AFQB 1BMAA 1W0JD 3E90B 3LIWA 2IPHA 4NIXA 1O2NA 3A83A 1H8IH 1EOJA 4INKA 2VU8E 1V2WT 4ABHA 1GL0E 1MTWA 2YMSD 4NWLA 3RXLA 1HAXB 4UDWH 1HAOH 2FDAA 3A7TA 4E06H 1ZJKA 2XYAA 2PR3A 3KF2A 2ZTXA 5SGAE 1N8OB 2ANMH 2ZHEH 1C5NH 2OQUA 3SV9A 3L3TA 1SGTA 2VH6A 3MH4A 1S84A 4AFSA 1TRYA 4X8SH 1FY1A 1NY22 5FXLA 4E7NA 4BAQB 3U69H 1EATA 5T1VA 3LT3A 5A8YA 4ESTE 1GVKB 3DSPA 5HIZA 3SU6A 1DUAA 1F5RA 5E0JA 3TNSA 5KECA 4Y8YA 4YZUA 1DM4B 3ZZ9A 3ZZDA 3VGCB 3MWIU 2Y82A 1FONA 4OM9A 5C1UA 3O8RA 1DANH 3E1XB 4OS5A 1QJ1B 4KGAA 4IW4E 4YOGA 4CRGA 5FAHA 4ZUHA 3A86A 1BMFD 2GCHG 1C2KA 4ZKRU 3EA9A 1S83A 4D7FA 1C5VA 1FPCH 2CXVA 1ACBE 4Y11E 4GLYA 6LPRA 3URCA 1TGNA 3E8LA 3AW1A 2P95A 1O35A 3LGVA 4NSVA 5DKMA 1GJAB 5TCAA 2VNTA 1KLJH 4O97A 1LDTT 3ZVCA 5AF9H 3RXTA 2GKVE 2B0FA 4MNYA 1TWXB 2VIQA 3RXCA 1K1NA 4AG1A 1EP6A 1ID5H 5ESTE 2HLDD 1TALA 4WWYA 2AH4X 3LH1A 3Q3YA 1LHDH 3QN7A 2TGTA 1P06A 2KFWA 3RUOA 5LPRA 3KGPA 4FU7A 1FV9A 1L4DA 4IGDA 4KP0A 2XTTB 4Y8XA 3TH3H 2QE7D 4KTSA 3PB1E 3M7TA 1YLNA 1MBMA 1RIWC 2SGAA 8GCHG 1C1RA 1UTOA 2XC4A 1OPHB 1IQFA 3IG6B 2BXUH 1W7XH 3BV9B 2PTCE 4CRBA 1LVYA 1ESTA 4ZXXH 1TX8A 4DIIH 3AASA 3E91A 3D23A 2EC9H 2R0KA 1UK4A 3SV7A 3ATIA 2EA3A 3PMAB 4NFEA 1HFDA 1SGFA 2J92A 3DFLA 4MDSA 3TK9A 5K0HA 2W7UA 2FI4E 1H9HE 2KAIA 1TOMH 1HB0B 2BDIA 1LMWB 1W10U 1NPMA 3R3GB 2BD5A 4XSKU 1Z8GA 1GL1A 1YGCH 3LJOA 2PKSC 2ILNA 4BTUB 5B6OA 1HJAB 2Q6GA 2K0QA 4NGAH 1KY9A 1AWFH 2FOFA 2ZI2H 1TQ0B 2OK5A 3RXOA 3ZZBA 1CT0E 3QWCH 4AN7A 3F2HA 1NM6A 1ELAA 1M9UA 1VITF 1EJMA 3O8BA 1DY9A 1W3CA 3N99A 2AIQA 1E36B 3UOUA 1QHRB 2A45B 4ISNA 3LPRA 3D62A 1SR5C 1XVMA 2ZPRA 1O2HA 3PYHA 3UFAA 3NUMA 2VWOA 1E35B 3F9EA 4INHA 4K69A 1V2QT 5J4QA 2OC0A 4SGAE 3SNEA 4YLQH 2AEIH 1ELTA 1J17T 4ZKOU 3M37A 3UB0A 1XVOA 1WQSA 2AMQA 4X8UH 1AFQB 3TLOA 1O5BB 1SLXB 1IQLA 1ZGIA 4BTIB 1LVMA 4X2WA 1WUNH 2F3CE 1ZTJA 1O2TA 1P0SH 1YPKH 1TX7A 1YPHC 3W95A 1GCTC 1V2JT 4P00A 2WYJA 2CJIA 1TB6H 4ISOA 4B6EA 3S9BA 1W0ZU 2RCEA 3A8CA 2QN5T 3FAOA 4Y79A 1O2UA 1DLEA 4YT6H 4I8GA 3TU7H 3RXBA 2JIZD 1O31A 1AVGH 1TBRH 1DWBH 1HLTH 1P2JA 1C1WH 1V2RT 1GBKA 3UNRA 2BDHA 4J2YB 1TE0A 2Q6DA 1EP5A 4LZ4B 1NRRH 2V3HH 1Y3WA 4B71A 3UR9A 1UVSH 2Z3EA 4BAOB 1P03A 5GCHF 3BEUA 1CT4E 1XUHA 9ESTA 1AZZA 2ZDKA 1KTTB 1RXPA 3KYGA 1THRH 1HAGE 3TPIZ 3MQKC 1A2CH 3EGKH 1CVWH 1OWKA 8LPRA 1DT2A 4TWYA 3H09A 1O36A 3RC4A 2CGAA 1GCDA 1QB6A 4B76A 3A89A 5EJLA 2G81E 1LHFH 3RXVA 3P8FA 4CRAA 2UUFB 2V0BA 3OTPA 4HZHA 3KQDA 4UD9H 2ODYB 1KSNA 1Z1JA 3T25A 3F2GA 1VR1H 3GY4A 1UTLM 3TIUA 2BLQA 5H4IB 4H42U 1CA0C 3KHVA 1OOKB 2UUJB 3M5LA 3MNBA 2J5UA 3NK8A 1GI9B 1LVOA 1GHYH 3JZ1B 1TGSZ 2PSYA 2HNTE 1CBWC 1DWEH 3F6UH 3N7EA 1SGCA 2W3KA 1J14A 3GY3A 1HIAA 2Z94A 1NRQH 2XRCA 3FZZA 2BD8A 3S0NA 2BY6X 2M5TA 4YLUA 2J98B 4AFUA 4Y6DA 1S6LA 3MFJA 5E0HA 1P04A 1GHZA 1V2PT 1SGPE 1JOUB 3STIA 3SNBA 1IQKA 1C1TA 3SGQE 2G5NA 4Y76A 2A5IA 2P3UB 1TMTH 3SUFA 2F4LA 3HKIB 1ZPZA 1O2GH 3A87A 1TNHA 2HALA 2FPZA 3P6ZB 4TY7A 4NA7A 5EODA 1SB1H 3PLPA 3T29A 2FLRH 1NC6A 1GI2A 3ZVGA 3FOAA 2VB0A 1BCUH 1WV7H 3B8JA 2ZG0H 1KIGH 3HKJB 3ZVBA 1KXEA 2KX4A 1GJ5H 1IQEA 1BRCE 1W11U 1YP9A 1YWUA 1C1NA 2BQ7B 1O3LA 3I77A 1O3KA 4TY6A 4D9RA 1IQGA 3V13A 2ZO3H 3DCLA 3QGJA 3T28A 2VINA 6CHAC 2AMDA 1D9IA 1AB9C 1JRTA 2BB4A 5BRRE 1O5EH 2Y6TA 1IQIA 1EAWA 4MPXA 4UFFH 1QZ8A 4IN1A 4DJZB 2ZQ2A 2BVXH 1VCPA 2OD3B 6GCHF 1FIWA 1OS8A 3RMMH 1HNEE 3L6PA 5HM2A 2AGGX 4AB8A 5C20A 3U98H 1WYKA 2BD9A 3WWBA 2C8YB 2JJ2D 1MAYA 1O3EA 3PV2A 1ZMLA 3PO1B 1SI5H 3A81A 4D9QA 3ZV9A 3S7KB 1FY4A 2FI5E 4Y71A 5HIYA 5PTPA 1W8BH 2KCAA 4Y10E 2GT8A 4LK4A 5C94A 4ZKNU 3L33A 2WPHS 2SGEE 2Z9JA 4VGCC 1QFKH 2ZGBH 3SI3H 4ZROA 2OP9A 1K1IA 2VGCB 1RJXB 2BTCE 5IYTA 2ZQ1A 1MH0A 1JBUH 1O3IA 1SGFG 2FS8A 2Z6BD 1YKTA 2ZHWH 3OEHD 3CENA 4JMYA 1JXPA 2SGDE 2QC2A 1F5KU 2QXHA 3ATWA 1P2IA 3UNSA 1NFXA 4HTCH 1P02A 3ZV8A 5HM9A 3BTFE 1HYLA 4CH8B 3A8BA 3T26A 1OKXA 1DICA 2C8ZB 2FOMB 3IWMA 1C1VH 1ZOMA 2WUCA 3SQHE 2IJD1 3U1IB 3VB3A 1V2VT 3MU0A 2VH0A 4F48B 3MU5A 1V2NT 2JETB 1TMUH 3VFEA 4A1XA 1J8AA 3FANA 1W13U 2XW9A 2WINI 1O38A 1V6DA 3FZDA 2F9OA 3N7OA 3LC5A 5C67A 2OBQA 1VITG 2F9UA 1PPHE 4D7GA 2V3MA 2Y80A 1SL3A 4XE4A 4DT7B 1QGFA 3RU4D 1GWAA 2P8OB 5LH8A 3SOSA 1OSSA 1BMLA 1O37A 3I29A 2ZZUH 2O8TA 4LOYH 5F8TA 2BDYA 3UAIC 3VB4A 4HFPB 3AVZA 3U8TH 2GMTC 1PPCE 1BITA 4DY7B 5JBAS 1QB1A 3Q77A 4X6OA 1SFIA 4GUXA 1TPAE 2XCFA 1WAYB 3RXDA 4AGJA 5EJ1A 1O3GA 3QGNB 2B8OH 3GCHB 3LOXA 2J4IA 3NCLA 4MG3A 2BD4A 1Z71A 1LPKB 4NFFA 1G37A 1O2OA 1O3DA 3S7HB 1O3BA 1BQYA 1LVBA 1B0FA 4I8HA 2ODQA 1ETSH 3MO3A 4HG6A 3SV2H 2GT7A 3DHKH 2QF3A 1GJ6A 1BDAA 3M7UA 3LC3A 4WJG2 2Q6FA 5AHGH 1F5LA 1ANBA 1S81A 4ZAEA 1FN8A 1EPTA 5DJ7A 1LHGH 3LDXH 4IN2A 1A5IA 1YPGH 1PPZA 3M3VA 4JZDH 5CMXH 1ANCA 1ELCA 5HYOA 3OY5U 1D3DB 1SOTA 4IBLH 1A46H 2SGPE 2GZ7A 4NSYA 1GJBB 1OHHD 2ZFTA 3UREA 2KAIB 3TK6A 1S0QA 2G4UA 1MAXA 1GI4A 4TSFD 2STAE 2HVYB 3P17H 1C5PA 2PHBA 1GJ4H 3EAJA 3GYMA 1PPFE 4I7YH 2G51A 1OP0A 1ZHRA 3LH3A 2GMTB 3MTYA 3B9FH 1G30B 4MPWA 4QT8C 4UFEH 2RA0A 4DG4A 4DOQA 2NU1E 1OX1A 1EZXC 1Y3UA 4M9FA 1K1JA 1SVPA 1ZRBA 2BD2A 2K1QA 4NIWA 1V2LT 2ZCKP 1AE5A 3RM2H 5DP9A 4X1PU 1LKAA 2G00A 2BLVA 4WXVA 1SQOA 1DITH 1GHVH 1O3CA 1A7SA 1TBQH 4JYTA 5LPFA 3E6PH 5DGJA 1ORFA 1UHBA 1SGIB 3MHWU 1O2PA 1GG6B 3LJJA 4IMZA 2NU4E 3QTVH 1FDPA 3ZZ7A 3ZVDA 4AORA 2NU0E 2QAAA 3GS9A 1EZQA 2UUYA 2H5CA 1EX3A 1G3BA 2QY0B 4GCHF 4AOQA 1UTMA 5L30H 5F53A 2HWLB 2I6QA 3ZYEA 2HOBA 1FX0B 2FXRA 1ZJDA 4XDEA 2XBWA 2Y5FA 1NFUA 1SLUB 3SUGA 2ZU3A 1C5YB 1O2QA 2BOKA 2O9QA 1SQAA 1RFNA 2BVSH 1GVLA 2GD4B 1CGJE 4X2VA 1JMOH 3BTTE 1XUGA 1AU8A 2BLWA 3BIUH 1MZDA 1V3XA 2A7CA 4KTUA 2H9TH 3U1JB 2FWWA 1O5AB 3RXGA 3UIRA 2FOCA 2WZQA 5DSFA 2EI8A 2XXLA 5EXLA 1GMDF 1GHWH 1LTOA 3F0OA 5KGOA 2EI6A 2ESTE 5E0GA 4RN6A 2SGFE 3QK1A 4I8JA 1BTUA 2BY8X 2FOBA 1ETTH 4NIVA 3MNCA 4NZQA 1O3NA 3RLWH 1F0SA 1WOFA 2ANKH 1LKBA 3T27A 1C2IA 4JZFH 1MU6B 5EPYA 1J15A 1P3CA 3F0PA 4YM9A 5FHTA 3SV8A 1AKSB 1O2SA 3CS7A 1TBZH 3O8CA 4X0WU 1ZSKA 4WY3A 6GCHG 4J1YA 2PUXB 1K1PA 1FXYA 1K22H 3RC5A 1P2QA 1O2YA 1YM0A 4HGCA 4MNWA 1MD7A 4RT1A 3FVFB 1TRNA 1E34B 1QB9A 4WH6A 1YF4A 7LPRA 2FMJA 3A7ZA 3D65E 1GBHA 1NTPA 2FYQA 3A7VA 1C5ZB 1QNJA 2A32A 1XKBC 2G52A 3MU1A 4U2WA 2YMSC 1LPZB 3BTME 4ISHH 3CNRA 1L2EA 3PWBA 4TWWA 2F43B 2O8LA 1GBJA 1N1LA 1EXFA 1A61H 1UCYK 5FX5A 3LONA 1O33A 3SU0A 2ZA5A 4R8TB 1HIAB 3KN2A 1MTSA 2FO9A 5E8EH 2PUQH 5LGOA 2ZHFH 2C8WB 2W26A 5FBEA 3GYLB 5FPSA 4B2BA 1MTUA 4E7RG 1UVPA 4ASHA 2RA3A 3B23B 3SBKA 3S9AA 1A3BH 3MU4A 1SGEE 1VJ9U 2VWLA 3SZNA 1AVWA 2H2ZA 5A2MH 3A80A 1BRAA 4AZ2B 2DE8A 4AGKA 5C0UA 4LZ1H 1TAWA 2THFB 4XBDA 2IOTA 2SNVA 1C5XB 4MTBA 1WTHD 2QF0A 2LNCA 4GSOA
chains in the Genus database with same CATH topology
5EQRA 2KCAA 3SU6A 2K8IA 2OK5A 3M5MA 3KNXA 3U1JB 3VG8A 2AHME 4A1VA 5IK2D 2JJ1D 4A92A 5FPYA 3F2HA 3F2FA 1NS3A 2WZQA 3F2GA 4OM9A 5B6LA 1EFRD 2GGVB 2QF5A 3O8BA 4Q63A 3SUEA 3ZIAD 1DY9A 1W3CA 3DSOA 3N99A 4WF8A 5DSFA 5H4IB 2O8MA 4F55A 3OE7D 3M5LA 3F0OA 2J5UA 3OFND 3LKWA 3PV5A 2OC8A 1A1RA 3O8DA 4XD7D 2XNIA 3OEED 5EPNA 2IJOB 5GPIB 4A1TA 1H8ED 5C17A 3WWFA 1BMFD 3PRDA 2QF4A 4K8BA 5ESBA 4Z1MD 1OHHD 2WHXA 2YMSB 5EQSA 3O8RA 2KCYA 3PRBA 2LELA 2OC0A 3N7EA 3OEHD 2M2AA 4JMYA 1JXPA 1MABB 2XCNA 4TSFD 3F0PA 5EPYA 3SU2A 5HKKD 4RI0A 3SV8A 1DXWA 3DSPA 3UB0A 3WW7A 2KCOA 3O8CA 3SV6A 2XNDD 1S6LA 2FOMB 2XOKD 1RGQA 4WH8A 3FO8D 1COWD 3RC5A 3SU4A 3SYJA 2IJD1 3U1IB 4YXWD 4ZCNA 3SU1A 2HLDD 3W1EA 1E79D 1H8HD 3M5NA 4NWKA 4M9FA 3SUFA 4WH6A 2F4LA 3SUDA 2L6OA 4KTCA 2KFWA 2K1QA 2QV1A 4B6EA 4A1XA 3SU5A 2OC1A 1SKYE 2FP7B 4U01A 2KM0A 2OBOA 3KEEA 2VBCA 3FOAA 3OAAD 1W0KD 3P8OA 5C0TA 1WXRA 4Q4LA 2OBQA 5GNDA 5CDFE 2YMSC 2JIZD 2KR7A 2F9UA 2QE7D 1E1QD 1E1RD 1W0JD 3E90B 5DN6D 1DY8A 2F43B 2A4GA 1N1LA 2A4QA 5IDKA 2KZ4A 2WV9A 1DXPA 3SU3A 2WSSD 4DT4A 3LONA 3N7DA 5GJ4B 3SU0A 3EYDA 4R8TB 4B75A 1BT7A 2A4RA 1RTLA 3DCLA 3KN2A 3FN8A 2YMSD 4B71A 4NWLA 4ASUD 5FPSA 3GS9A 3M5OA 2P59A 5CHBA 4I31A 3SV7A 1NBMD 1KMHB 2XCFA 1NBME 2F9VA 3LOXA 3KF2A 5F53A 5EQQA 4I33A 3P8NA 4B6FA 2V7QD 4TYDA 1FX0B 3FKSD 3NRLA 2KCPA 5ETXA 3L6PA 3SV9A 2JDID 2FM2A 2GVFA 2WPDD 4B73A 2OC7A 3RC6A 3SUGA 2YOLA 3H09A 5C0UA 3RC4A 3WWBA 5FL7D 3AK5A 2JJ2D 3F3BA 1CU1A 4FETA 5FPTA 4B76A 3PV2A 4B74A 2W6JD 4I32A 5T1VA 3SZEA 2K0QA 2OINA 2W6ID 3OTPA 3OYPA 2CK3D 4TT3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EQR A;  3U1J B;  3SU6 A;  2OK5 A;  3M5M A;  3KNX A;  4A1V A;  4A92 A;  5FPY A;  2WZQ A;  4OM9 A;  5B6L A;  3O8B A;  2GGV B;  3SUE A;  3O8R A;  1DY9 A;  1W3C A;  5H4I B;  4WF8 A;  2O8M A;  3M5L A;  3LKW A;  3PV5 A;  2OC8 A;  1A1R A;  3O8D A;  2XNI A;  5EPN A;  2IJO B;  5GPI B;  4A1T A;  4K8B A;  5ESB A;  2WHX A;  5EQS A;  2OC0 A;  4JMY A;  1JXP A;  2XCN A;  5EPY A;  3SU2 A;  1DXW A;  4RI0 A;  3SV8 A;  3O8C A;  3SV6 A;  2FOM B;  1RGQ A;  4WH8 A;  3RC5 A;  3SU4 A;  3SYJ A;  2IJD 1;  3U1I B;  3SU1 A;  3M5N A;  4NWK A;  4M9F A;  3SUF A;  4WH6 A;  2F4L A;  3SUD A;  4KTC A;  2K1Q A;  2QV1 A;  4B6E A;  4A1X A;  3SU5 A;  2OC1 A;  2FP7 B;  4U01 A;  2OBO A;  3KEE A;  2VBC A;  3P8O A;  1WXR A;  2OBQ A;  5GND A;  2F9U A;  3E90 B;  1DY8 A;  2A4G A;  1N1L A;  2A4Q A;  5IDK A;  2WV9 A;  1DXP A;  3SU3 A;  3LON A;  5GJ4 B;  3SU0 A;  3EYD A;  4R8T B;  4B75 A;  1BT7 A;  2A4R A;  1RTL A;  3KN2 A;  4B71 A;  4NWL A;  5FPS A;  3M5O A;  2P59 A;  4I31 A;  3SV7 A;  2XCF A;  2F9V A;  3LOX A;  3KF2 A;  5EQQ A;  4I33 A;  3P8N A;  4B6F A;  4TYD A;  5ETX A;  3SV9 A;  3L6P A;  2FM2 A;  2GVF A;  4B73 A;  2OC7 A;  3RC6 A;  3SUG A;  2YOL A;  3H09 A;  3RC4 A;  3AK5 A;  1CU1 A;  5FPT A;  4B76 A;  3PV2 A;  4B74 A;  4I32 A;  5T1V A;  3SZE A;  2OIN A;  3OTP A;  3OYP A;  1NS3 A; 
#chains in the Genus database with same CATH topology
 2Y7Z A;  4X2X A;  3M5M A;  1J9C H;  4DVA U;  2ZFR H;  1DFP A;  1K1M A;  1XUK A;  4NIY A;  4MPU A;  2QCY A;  3WY8 A;  2GTB A;  2BMG B;  1SG8 B;  1C5T A;  1HAV A;  2LPR A;  3Q00 A;  5GPI B;  2YMS B;  5EQS A;  1Z1I A;  2OUA A;  2XCN A;  1ABI H;  1CGI E;  2G4T A;  2AGI X;  2J34 A;  1RTF B;  2XWB I;  4OGY A;  1UTQ A;  1ELB A;  1C1O A;  2FOG A;  1BRB E;  1RD3 B;  4WXI A;  2ZTY A;  2XBY A;  1LQD B;  1C1M A;  1KXB A;  5DG6 A;  2EI7 A;  2XWA A;  2L6O A;  1Z8I B;  2PV9 B;  1O3J A;  2FS9 A;  3A7X A;  5ABW A;  9LPR A;  3SU5 A;  2KM0 A;  1W0Y H;  1C1S A;  1P3E A;  1JWT A;  2RG3 A;  1WCZ A;  2BOH B;  1RIW B;  1IQN A;  1OWD A;  3RXE A;  3FP8 E;  4INL A;  4AYY B;  1AFE H;  1SOZ A;  5EU8 A;  3MI4 A;  4FUE A;  5FX6 A;  1Y5U T;  1EAI A;  2NU2 E;  1JRS A;  1BMN H;  2J95 A;  3VB7 A;  4I86 A;  1O3P B;  4MVN A;  2KZ4 A;  1P57 B;  3K2U A;  3RXU A;  1GI0 A;  3K65 B;  1P2M A;  1WTG H;  1ZMJ A;  1XXF A;  1AI8 H;  2BDB A;  1KXA A;  4BAN B;  4FU9 A;  1EPT C;  4Q2K A;  1SC8 U;  4JK6 A;  1A5H A;  2RDE A;  4AYV B;  1BBR K;  3P8N A;  7EST E;  3A7Y A;  3T62 A;  1P8V C;  4BNR A;  2PKS B;  1SGD E;  4K1S A;  2WPJ S;  1MKX K;  4X6P A;  3SHA H;  1MKW H;  3HGN A;  2ZFF H;  2ZGJ A;  1SFQ B;  3D49 H;  1ESA A;  1MTN C;  3NXP A;  1QIX B;  2ZKS A;  4H6T A;  1BTX A;  2W6J D;  1QA7 A;  2TGD A;  1YCP K;  4Z0K A;  3OYP A;  2VIP A;  3A7W A;  1CHO F;  1P05 A;  2WPM S;  1SGR E;  1TAB E;  3C1K A;  2SFA A;  5JBB S;  2GGV B;  2QF5 A;  3ZIA D;  1O5F H;  1CE5 A;  2CF9 H;  1TPO A;  3OX7 U;  1GI3 A;  5T3H A;  3RXI A;  1G2L A;  4ABB A;  1UJ1 A;  3LKW A;  5JB8 S;  1AGJ A;  2YNB A;  4U30 A;  1DWC H;  4XD7 D;  5JDU B;  1WBG B;  1XKA C;  1EAS A;  1GI7 B;  4A7I B;  4B1T A;  1LPG B;  3V3M A;  3EQ0 H;  3M7Q A;  1O2R A;  5T6G A;  1S82 A;  3TJU A;  3F68 H;  1TON A;  1FQ3 A;  1QR3 E;  2FOH A;  2FOD A;  3F9G A;  4GCH G;  5GXP A;  5C5N A;  1HGT H;  1GI5 A;  1O2J A;  5GDS H;  1S5S A;  3BTQ E;  4SGB E;  1ZRK A;  1N6X A;  1SGY E;  1L1J A;  1GCT B;  2TGA A;  2A2Q H;  2TBS A;  1FJS A;  1SQR A;  2BX3 A;  4X1Q U;  3SYJ A;  2ZDM A;  3KL6 A;  4A5T S;  1AQ7 A;  1ELD E;  2R3Y A;  1GI8 B;  1EPT B;  3ITI A;  1VZQ H;  2QXG A;  4P02 A;  2C93 B;  1IQM A;  5C1X A;  1GHB G;  3KEE A;  3PMJ A;  1HJ8 A;  3M3S A;  4Y8Z A;  1Y3V A;  2ZDA H;  1ZHP A;  2HPP H;  2QA9 E;  2HPQ H;  1B5G H;  4UFG H;  1O5G H;  1ZSJ A;  5KED A;  1FN6 A;  1MTN B;  2AIP A;  1YPM H;  2QGR A;  2PWX A;  1GMD G;  1O3M A;  2ZCL P;  5IDK A;  1OYQ A;  4MNX A;  2AER H;  1MUE B;  4MNV A;  3KQC A;  3TVJ B;  3DSG A;  1GBB A;  4JCN A;  5LPE A;  2ZGC A;  2W7S A;  2GV7 A;  3TJN A;  1NRS H;  1YPL H;  2ZHD A;  1ZHM A;  2A5K A;  7GCH G;  1NBM E;  3VEQ B;  2F9V A;  1QTF A;  5T6F A;  1L1N A;  4OS7 A;  1DVA H;  1Y8T A;  3RP2 A;  3FKS D;  1DPO A;  5T6D A;  2ZC9 H;  2WPD D;  2CF8 H;  3H5C B;  3RC6 A;  2EQN A;  3TNT A;  4D8N A;  1H9I E;  1UK2 A;  4ABA A;  4AX9 H;  1OP2 A;  1CU1 A;  5GWZ A;  4OS6 A;  1U6Q A;  1FAX A;  3SZE A;  2W6I D;  4JYV H;  2CK3 D;  1TPS A;  1G9I E;  3A82 A;  4FU8 A;  2JH5 D;  1CA0 B;  1HBT H;  2H5D A;  3VG8 A;  1P09 A;  2Y5H A;  1HUT H;  1ZPB A;  2J97 A;  1AN1 E;  3SGB E;  2ASU B;  2GZ9 A;  1GBT A;  2GX4 A;  3NWU A;  4Q63 A;  4H6S B;  5DP7 A;  1YCP M;  3GY6 A;  2F83 A;  1BA8 B;  3OE7 D;  1CBW B;  1AUJ A;  1HDT H;  1TX6 A;  1F2S E;  3PV5 A;  2ZEC A;  2XNI A;  2WUB A;  4CHA C;  1W14 U;  3LGT A;  4A1T A;  1DOJ A;  2C4F H;  2IPQ X;  1NRN H;  2C3S A;  1EB1 H;  1GGD C;  1GBD A;  1YPJ H;  2OLG A;  1BB0 B;  2H6M A;  1KLT A;  3ZZ4 A;  1QL9 A;  3F9F A;  5DP8 A;  2Z3D A;  4B2A A;  3UNQ A;  1MMJ N;  2WPI S;  4ISL A;  2P94 A;  4DGJ A;  4ZHA A;  1ESB A;  1O39 A;  2R2M B;  3RXS A;  3VXE H;  1W12 U;  2BY9 X;  2UUK B;  5DO4 H;  1ZR0 A;  1QCP A;  5A0B A;  1D4P B;  3Q3X A;  3P8O A;  5JYI A;  5A0A E;  3GDS A;  1HCG A;  1GBM A;  1UTJ A;  5CDF E;  5C3N A;  1EUF A;  1O2M A;  2FX4 A;  1E1Q D;  1E1R D;  4D76 A;  5DN6 D;  1F7Z A;  2ANW A;  1V2O T;  2R2W U;  1KYN A;  3LGU A;  1OWI A;  4ISI H;  3MYW A;  6CHA B;  4DT4 A;  3N7D A;  1X7A C;  3RXA A;  1AB9 B;  1GJC B;  5FCK A;  1Z6J H;  1C2G A;  1KXF A;  1XX9 A;  3GIS B;  2OQ5 A;  4X8V H;  3SJ9 A;  2BX4 A;  1AWH B;  2J9N A;  4FUF A;  3M5O A;  3VPK A;  1Q31 A;  5CHB A;  1WSS H;  4F4O C;  3HAT H;  3ZVF A;  2FTM A;  3U8O H;  3Q76 A;  1V2S T;  1DST A;  1FUJ A;  1ELF A;  1BMM H;  5AFZ H;  2Y81 A;  1NT1 A;  4B2C A;  1HV7 A;  1Z8J B;  2GCT C;  1GMC G;  1OXG A;  1HXE H;  1T31 A;  3NRL A;  1B7X B;  1A0J A;  3SI4 H;  4ABD A;  1GJ7 B;  3SN8 A;  1QA0 A;  2F9N A;  2FM2 A;  3R0F A;  5L6N H;  5EGM A;  2V6N A;  3GIC B;  3RXR A;  2ZDL A;  3EDX B;  3KCG H;  3K9X B;  2ODP A;  1OP8 A;  3GOV B;  1S0R A;  5TJX A;  2WV4 A;  3UQV A;  4VGC B;  5HXF A;  1C2F A;  3OU0 A;  3BG4 C;  1NS3 A;  2CMY A;  2K8I A;  3P92 A;  4X1R U;  2CHA C;  5IK2 D;  5DP3 A;  3TGJ E;  2D1J A;  1CA8 B;  1FY5 A;  1XUI A;  4A92 A;  3OTJ E;  2PGB B;  2BLO A;  1KLI H;  5B6L A;  1IOE A;  3SUE A;  1FAK H;  2B5T B;  4GAW A;  4WF8 A;  5DK1 A;  1BOQ A;  2BZ6 H;  3SJI A;  3S69 A;  5BPE A;  1TNK A;  1E38 B;  4O9V A;  5C17 A;  2PGQ B;  1J16 A;  3RXK A;  3WWF A;  3PRD A;  2QF4 A;  2RFK C;  2STB E;  4I8K A;  1BHX F;  5JPM H;  1NFW A;  1W7G H;  3PRB A;  2ZHQ H;  1MZA A;  1C4U 2;  1FY8 E;  1VGC C;  3SU2 A;  4JZI A;  1DXW A;  1QY6 A;  3F9H A;  2DE9 A;  3U28 C;  1SGN E;  3UUZ A;  2BY5 X;  1JIM A;  1NFY A;  2A2X H;  4I8L A;  2EY4 C;  4WH8 A;  3OSY A;  2ZU1 A;  1UTP A;  1GJ8 B;  1E79 D;  1AY6 H;  3SUD A;  4CR9 A;  1ELG A;  1MQ6 A;  2FEQ H;  2VIV A;  1FMG A;  1THS H;  1CHO G;  1UTK A;  3VB5 A;  1K0H A;  1O2X A;  1WXR A;  5GND A;  3QLP H;  4Y7A A;  1B0E A;  3A8A A;  1ZTL A;  1HJ9 A;  1YPH E;  1IHT H;  1HAV B;  4O03 A;  1C2H A;  4CBN A;  3SU3 A;  5GJ4 B;  2J98 A;  3H7O A;  2I6S A;  3EYD A;  4B75 A;  4DUR A;  1BT7 A;  1GBI A;  4BXW A;  1ELV A;  1RTL A;  4AFQ A;  1UCY E;  1A4W H;  1O5C B;  1OWH A;  1C5M D;  4ASU D;  1YYY 1;  3A8D A;  3ZZA A;  2FIR H;  1MD8 A;  1NBM D;  2ZF0 H;  1LO6 A;  2A0Q B;  1TFX A;  4YOJ A;  2PKA A;  4K8Y A;  2BVR H;  3MO9 A;  1UVT H;  3SNC A;  2Q1J A;  4FUD A;  4I33 A;  5A09 A;  4B6F A;  3STJ A;  5FBI A;  1DWD H;  3UR6 A;  1N8O C;  1RRK A;  3DFJ A;  1CGH A;  1HPG A;  4R0I A;  2G5V A;  1T8L A;  1MKX H;  2D2D A;  2H1U A;  1VCW A;  4YT7 H;  1SHH B;  1CSO E;  1P01 A;  1K2I 1;  3AW0 A;  4UEH H;  1FPH H;  1BZX E;  1EZS C;  3PMB B;  1YCP H;  2HNT C;  3QX5 H;  1EQ9 A;  2JJ1 D;  1FIZ A;  1AUT C;  2ZPS A;  1AD8 H;  2O8W A;  1T8O A;  5A0C A;  1EFR D;  1GJD B;  1GMH F;  3QZR A;  4FXG H;  2VVU A;  2J2U A;  1TQ7 B;  3VGC C;  1MTV A;  3RXM A;  2BD7 A;  1FLE E;  4GPG A;  1A1R A;  1ETR H;  1INC A;  2XBX A;  2ZWL H;  4Q7Z A;  5DP6 A;  5DP5 A;  4AFZ A;  1E0F D;  1K21 H;  2VVC A;  2KCY A;  3RU4 T;  1TYN A;  2FZZ A;  1TNL A;  3LGW A;  1Y5A T;  3GDV A;  5EIY A;  1DE7 H;  1LHC H;  1GHB F;  1HRT H;  1BUI A;  4BXS A;  2Z7F E;  4RKJ B;  1HAP H;  3ZVA A;  2CN0 H;  2FX6 A;  2ZDN A;  4JZ1 A;  5CE1 A;  1TA6 A;  2J38 A;  2TGP Z;  3ATL A;  1GI1 A;  3U8R H;  1BJU A;  1RGQ A;  3SU4 A;  4ZCN A;  3NKK A;  1XM1 A;  2FYR A;  1ABJ H;  3UWI A;  1L4Z A;  4KTC A;  1VKY A;  4K3J A;  2PLX A;  3RXH A;  4Z6A H;  2HVX A;  4YO9 A;  1A0H B;  4ABF A;  3PRO A;  2TRM A;  5EJZ A;  1ELE E;  1EJA A;  1GBE A;  5HMA A;  7GCH F;  2KR7 A;  3PM3 A;  2A4G A;  2A4Q A;  3ZZC A;  1Q2W A;  1SBW A;  3H7T A;  3AAV A;  4CR5 A;  1CO7 E;  2HGT H;  4X6M A;  4ZXY H;  3FN8 A;  1PQA A;  3FP7 E;  3EST A;  4DW2 U;  1YLD A;  2HLC A;  3AAU A;  1O3H A;  4O3U A;  2FTL E;  5E2P A;  1K1L A;  1UTN A;  3ZVE A;  2W5E A;  2H9E H;  4NZL A;  5E2O A;  5EQQ A;  4FUJ A;  2G55 A;  4TYD A;  2PFE A;  5ETX A;  1P12 E;  4K5Z A;  3SJK A;  1C4V 2;  1BBR E;  1D3T B;  3CS0 A;  1C2M A;  1BJV A;  4K1T A;  2YOL A;  5L2Z H;  5FCR A;  1ZMN A;  3RXJ A;  5EW2 H;  1RS0 A;  3CP7 A;  3F3B A;  1FI8 A;  2P16 A;  4FET A;  2Z3C A;  4NG9 H;  4X8T H;  4BAH B;  2R9P A;  5EQR A;  1HJA C;  1S6F A;  4A1V A;  1NU9 A;  1D3Q B;  1C1Q A;  1VIT H;  1Z6E A;  1HAY B;  3SNA A;  1TMB H;  1LCY A;  1S85 A;  4ACA A;  3PV4 A;  1TPP A;  1K1O A;  1VCQ A;  1PYT D;  4X1N U;  1GHA G;  1Q3X A;  2UWP A;  4JZE H;  1CQQ A;  2HRV A;  3SOR A;  2DUC A;  3OFN D;  3RDZ A;  5EPN A;  1HXF H;  3VB6 A;  2IJO B;  3T2N A;  2ZIQ H;  2D26 C;  1GDU A;  3SQE E;  5F8Z A;  5K7R A;  1F0U A;  2ZU2 A;  3DA9 B;  2M2A A;  3GY8 A;  2BM2 A;  1TGB A;  3I78 A;  2Z9K A;  3G01 A;  3QZQ A;  1C2J A;  4Q80 A;  1IQH A;  5JBC S;  3PWC A;  3SV6 A;  5G4B A;  3PTN A;  3KID U;  2ZTZ A;  4K60 A;  1SQT A;  1COW D;  4BAM B;  3MH5 A;  1AFQ C;  1P11 E;  3SU1 A;  3KQE A;  1O2W A;  1H4W A;  1QUR H;  1UMA H;  3GCT F;  4NWK A;  2JH6 D;  1Y3Y A;  3SJO A;  1PQ5 A;  2BXT H;  1WDI A;  1ZLR A;  4TPY A;  4FVD A;  1SKY E;  1P9S A;  5JB9 S;  1H9L B;  1O32 A;  3U9A H;  3MNX A;  4KEL A;  5I46 H;  1CT2 E;  2JH0 D;  1O0D H;  1C9P A;  2A7J A;  3LU9 B;  3BTW E;  4Y0Y E;  1NO9 H;  4MQA A;  1GMC F;  1S6H A;  2WV9 A;  1C5S A;  1DXP A;  1KDQ A;  3TJV A;  4FUI A;  5HGG A;  1O2Z A;  2BDC A;  1MU8 B;  4WME A;  5DPA A;  3E0N B;  2LP6 A;  1PYT C;  2V35 A;  1AIX H;  1O2L A;  1C5W B;  3BSQ A;  1BRU P;  3RXQ A;  1P2O A;  2ZGH A;  3OY6 U;  2P59 A;  2SGQ E;  2PTN A;  4PRO A;  1EJN A;  2FOA A;  1NRP H;  3KYF A;  2V7Q D;  1H1B A;  4X6N A;  1GBA A;  5L2Y H;  1ZTK A;  1AVX A;  1N6Y A;  2GVF A;  3A88 A;  1BIO A;  4RT0 A;  2VIW A;  1O3O A;  5C1Y A;  4JK5 A;  4Q7Y A;  1UO6 A;  3M36 A;  2Z9L A;  1QQU A;  4B74 A;  2A7H A;  1C1P A;  1O2I A;  2VIO A;  1GDN A;  2OXS A;  3QTO H;  1PJP A;  2TIO A;  3SO3 A;  4XRN A;  3PMH B;  2AHM E;  3UOP A;  5JBT A;  1Y3X A;  3F2F A;  3LGI A;  2GP9 B;  1VJA U;  4X1S U;  1XUJ A;  1YLC A;  1TGT A;  1P10 A;  3UTU H;  1D6R A;  1TNG A;  4XBC A;  4ZHL U;  3MO6 A;  4IMQ A;  1DS2 E;  1V2K T;  3O8D A;  5I25 A;  1XMN B;  2BD3 A;  1IHS H;  3ZZ3 A;  3T5F H;  1TA2 A;  1P2K A;  5ESB A;  3NPS A;  1V2U T;  3PLK A;  2UWL A;  1HAI H;  2ZNK H;  3S9C A;  2UWO A;  8EST E;  1MCT A;  4OGX A;  1AND A;  1T8M A;  3LGY A;  1GJ9 B;  4Y0Z E;  1C1U H;  3HK6 B;  4H4F A;  1O2V A;  1BTZ A;  4FUG A;  1ARB A;  1C9T A;  3EE7 A;  4O3T A;  3RU4 E;  3URD A;  3GY5 A;  3BIV H;  3EA7 A;  1O30 A;  3PTB A;  3W1E A;  4CRC A;  2FES H;  1YBW A;  3M5N A;  3ENS B;  1G32 B;  5CHA C;  2FLB H;  3Q3K A;  2HNT F;  1LQE A;  3FP6 E;  4GVU A;  1KXD A;  2GJG A;  1G36 A;  2NU3 E;  2OC1 A;  4ABG A;  2Z9I A;  1OWJ A;  1TNJ A;  3BG8 A;  3NZI A;  1AHT H;  3P8G A;  1JIR A;  1GMH G;  3GCN A;  1DY8 A;  3GY2 A;  4JYU H;  1AKS A;  3BN9 A;  4CRE A;  3PLB A;  3V12 A;  1ZPC A;  1P2N A;  1O2K A;  2GDD A;  1QBO A;  1RTK A;  2AS9 A;  3ATK A;  2EEK A;  1BHX B;  5A8X A;  4E05 H;  3A84 A;  1QRZ A;  1FY3 A;  8KME 2;  1KMH B;  3JZ2 B;  1MBQ A;  3W94 A;  1TLD A;  1O3A A;  1GBF A;  1WU1 A;  1ZYO A;  2Z9G A;  2F91 A;  1OYT H;  1SLV B;  3ATM A;  4LXB H;  2JDI D;  4Q7X A;  1ANE A;  1QBV H;  3ZZ6 A;  2BQ6 B;  3MH6 A;  2P3T B;  4YTA A;  5A8Z A;  2BYA X;  1O3F A;  1Y59 T;  2BDG A;  3ELA H;  5FPT A;  2ZU4 A;  3EE0 B;  2VID A;  2VVV A;  3ZYD A;  1DX5 M;  3GCO A;  2TPI Z;  2L74 A;  2VWN A;  1C5O H;  3BF6 H;  3PO1 C;  1K28 D;  5F03 A;  3V7T A;  1QJ6 B;  3ODF A;  1BTH H;  1GBL A;  5CHA B;  3DSO A;  4NA8 A;  2O8M A;  1F0T A;  1T4V H;  2Y5G A;  3QDZ B;  1BTW A;  1C2E A;  1H8D H;  2AYW A;  2QXJ A;  1H8E D;  4UFD H;  4GHT A;  1C2D A;  4K8B A;  4YOI A;  1CHG A;  2VGC C;  2PKA B;  4CBO A;  4UON A;  5EW1 H;  2ULL A;  1YY3 A;  5EXM A;  2LEL A;  4GHQ A;  4U32 A;  1UK3 A;  5HKK D;  2ALV A;  4RI0 A;  1C5U A;  4MLF B;  4Y7B A;  3TH2 H;  4BAK B;  6EST A;  2ZEB A;  3HK3 B;  3UY9 A;  1T8N A;  2A4O A;  2P3F H;  1UHB B;  2XND D;  4AC9 A;  1YPE H;  3UWJ H;  4ABI A;  2ZPQ A;  1T7C A;  1TNI A;  4YXW D;  3BEI B;  4THN H;  1ZSL A;  4YES B;  2WPK S;  1H8H D;  3BTG E;  1ARC A;  1F92 A;  2QV1 A;  3MMG A;  4TPI Z;  5F6M A;  1ZZZ A;  2QIQ A;  5EOK A;  4ACB A;  4XBB A;  3F1S B;  2JET C;  3BTH E;  3K6Z A;  4XFQ A;  1XUF A;  3OAA D;  5C5O A;  1AO5 A;  1W0K D;  7KME H;  2C90 B;  1HAZ B;  2G8T A;  1DUE A;  1Z8R A;  1Z7K A;  1P9U A;  2OTV A;  2WSS D;  1PFX C;  2BY7 X;  5TCC A;  3HGP A;  4HI3 A;  2P8O C;  2GCH F;  1AMH A;  1THP B;  2VJ1 A;  1GDQ A;  4NA9 H;  1G3D A;  2F9B H;  1KTS B;  1NN6 A;  2WYG A;  4I31 A;  3DUX H;  3SND A;  2GV6 A;  3SW2 B;  3M61 U;  3RLY H;  2XC5 A;  4M7G A;  1EKB B;  1NU7 B;  1XXD A;  1ZGV A;  2KCP A;  1D3P B;  1IQJ A;  1GHA F;  1D6W A;  1L1G A;  3GCH C;  1O34 A;  1NES E;  2ZGX H;  1EB2 A;  4A6L A;  1V2M T;  3GCT G;  3KQ5 A;  3RXP A;  5FL7 D;  1UCY H;  1GPZ A;  3K6Y A;  3SHC H;  4KKD A;  3TGK E;  4I32 A;  4K1E A;  3V0X A;  4OS1 A;  3DD2 H;  2R3U A;  1PPE E;  4RSP A;  4IC6 A;  5J4S A;  1EAX A;  1YC0 A;  4BOH A;  2BQW B;  2XC0 A;  4ZHM U;  4FVB A;  4WMF A;  4CHA B;  1G3E A;  1BTP A;  1SSX A;  2ZDV H;  8GCH F;  2SNW A;  3SGA E;  4F49 A;  1T4U H;  1IAU A;  1SGQ E;  2OC8 A;  4K2Y A;  3OEE D;  2H9H A;  4ZH8 A;  4RKO B;  1GBC A;  2OCV B;  3TJO A;  1GGD B;  2BZA A;  1TGC A;  3TK5 A;  2WHX A;  3TIT A;  3BTE E;  3P95 A;  1GI6 A;  1C5L H;  2O8U A;  4XOJ A;  1F0R A;  3RML H;  1MAB B;  1C5R A;  3MOC A;  1OWE A;  3IIT A;  1L0Z A;  1TOC B;  3BEF B;  3HPT B;  3KQB A;  1BTY A;  4WVP E;  2FOE A;  2JKH A;  2ZCH P;  5DP4 A;  3FO8 D;  2C8X B;  2XBV A;  2WV5 A;  3UQO A;  1DLK B;  4NCY A;  1GHX H;  1O5D H;  1MQ5 A;  1WQV H;  2GZ8 A;  1EZU C;  1AZ8 A;  4U01 A;  2W3I A;  5AFY H;  1GVZ A;  2VBC A;  4IS5 A;  1UVU H;  1NZQ H;  5C0T A;  2ZFS A;  3ZZ5 A;  2A1D B;  2B7D H;  3VXF H;  5F8X A;  1NRO H;  4MPV A;  2QYI A;  1QL7 A;  1MKW K;  1SHY A;  3RM0 H;  2AGE X;  4OS2 A;  2A31 A;  1C5Q A;  2BHG A;  1EOL A;  1DSU A;  3MH7 A;  3BTK E;  4X2Y A;  1E37 B;  5C2Z A;  2A4R A;  2ZFQ H;  2F9P A;  1PQ8 A;  2Y7X A;  3A85 A;  2VWM A;  1KXC A;  2R0L A;  1G2M A;  2QXI A;  1GG6 C;  2GCT B;  3ZZ8 A;  5AVD A;  3RMO H;  3TGI E;  4IC5 A;  3GY7 A;  3GDU A;  2AMP A;  2ZP0 H;  4FUC A;  1FZZ A;  4WMD A;  1QJ7 B;  1PQ7 A;  1SPJ A;  1SMF E;  3MNS A;  1UVO A;  4FUB A;  2FI3 E;  4FUH A;  4B73 A;  3QO6 A;  2BDA A;  1PPB H;  1UW7 A;  2OC7 A;  1MCV A;  5GIB A;  3BG4 B;  3AK5 A;  1W2K H;  2GDE H;  1C4Y 2;  4DCD A;  2CHA B;  3TH4 H;  1LHE H;  2OIN A;  3SJ8 A;  4CH2 B;  2P93 A;  4TT3 D;  1A3E H;  1QL8 A;  5GCH G;  4CRD A;  2IN2 A;  2ZFP H;  3DT0 H;  3KNX A;  3M35 A;  1V2T T;  1TRM A;  2RDL A;  2WPL S;  1KDQ B;  2A5A A;  5FPY A;  4ZKS U;  3ODD A;  1AE8 H;  2ZU5 A;  3FFG A;  3RXF A;  4F55 A;  1BBR H;  3E3T A;  3P70 B;  1C2L A;  3M3T A;  1QRX A;  1DDJ A;  2NWN A;  1VGC B;  1QBN A;  4ABJ A;  4AG2 A;  4Z1M D;  3UPE A;  1K9O E;  4ZMA H;  4ABE A;  2PSX A;  2ALP A;  1A0L A;  2CV3 A;  2J94 A;  2YNA A;  2PW8 H;  4UE7 H;  4BTT B;  3E0P B;  3WW7 A;  1T32 A;  2KCO A;  4DIH H;  5EXN A;  1G3C A;  3QUM P;  1QRW A;  3EA8 A;  3RMN H;  2XOK D;  1HAH H;  1SLW B;  5EG4 A;  2D8W A;  1A5G H;  3C27 B;  4AB9 A;  4FOU C;  4OS4 A;  3MU8 A;  1PPG E;  2V3O H;  1Y5B T;  2B9L A;  2FP7 B;  3E16 B;  2OBO A;  2PP6 A;  1FNI A;  2ANY A;  3BTD E;  4Q4L A;  1TIO A;  1QQ4 A;  1EAU A;  4CRF A;  2AFQ B;  1BMA A;  1W0J D;  3E90 B;  3LIW A;  2IPH A;  4NIX A;  1O2N A;  3A83 A;  1H8I H;  1EOJ A;  4INK A;  2VU8 E;  1V2W T;  4ABH A;  1GL0 E;  1MTW A;  2YMS D;  4NWL A;  3RXL A;  1HAX B;  4UDW H;  1HAO H;  2FDA A;  3A7T A;  4E06 H;  1ZJK A;  2XYA A;  2PR3 A;  3KF2 A;  2ZTX A;  5SGA E;  1N8O B;  2ANM H;  2ZHE H;  1C5N H;  2OQU A;  3SV9 A;  3L3T A;  1SGT A;  2VH6 A;  3MH4 A;  1S84 A;  4AFS A;  1TRY A;  4X8S H;  1FY1 A;  1NY2 2;  5FXL A;  4E7N A;  4BAQ B;  3U69 H;  1EAT A;  5T1V A;  3LT3 A;  5A8Y A;  4EST E;  1GVK B;  3DSP A;  5HIZ A;  3SU6 A;  1DUA A;  1F5R A;  5E0J A;  3TNS A;  5KEC A;  4Y8Y A;  4YZU A;  1DM4 B;  3ZZ9 A;  3ZZD A;  3VGC B;  3MWI U;  2Y82 A;  1FON A;  4OM9 A;  5C1U A;  3O8R A;  1DAN H;  3E1X B;  4OS5 A;  1QJ1 B;  4KGA A;  4IW4 E;  4YOG A;  4CRG A;  5FAH A;  4ZUH A;  3A86 A;  1BMF D;  2GCH G;  1C2K A;  4ZKR U;  3EA9 A;  1S83 A;  4D7F A;  1C5V A;  1FPC H;  2CXV A;  1ACB E;  4Y11 E;  4GLY A;  6LPR A;  3URC A;  1TGN A;  3E8L A;  3AW1 A;  2P95 A;  1O35 A;  3LGV A;  4NSV A;  5DKM A;  1GJA B;  5TCA A;  2VNT A;  1KLJ H;  4O97 A;  1LDT T;  3ZVC A;  5AF9 H;  3RXT A;  2GKV E;  2B0F A;  4MNY A;  1TWX B;  2VIQ A;  3RXC A;  1K1N A;  4AG1 A;  1EP6 A;  1ID5 H;  5EST E;  2HLD D;  1TAL A;  4WWY A;  2AH4 X;  3LH1 A;  3Q3Y A;  1LHD H;  3QN7 A;  2TGT A;  1P06 A;  2KFW A;  3RUO A;  5LPR A;  3KGP A;  4FU7 A;  1FV9 A;  1L4D A;  4IGD A;  4KP0 A;  2XTT B;  4Y8X A;  3TH3 H;  2QE7 D;  4KTS A;  3PB1 E;  3M7T A;  1YLN A;  1MBM A;  1RIW C;  2SGA A;  8GCH G;  1C1R A;  1UTO A;  2XC4 A;  1OPH B;  1IQF A;  3IG6 B;  2BXU H;  1W7X H;  3BV9 B;  2PTC E;  4CRB A;  1LVY A;  1EST A;  4ZXX H;  1TX8 A;  4DII H;  3AAS A;  3E91 A;  3D23 A;  2EC9 H;  2R0K A;  1UK4 A;  3SV7 A;  3ATI A;  2EA3 A;  3PMA B;  4NFE A;  1HFD A;  1SGF A;  2J92 A;  3DFL A;  4MDS A;  3TK9 A;  5K0H A;  2W7U A;  2FI4 E;  1H9H E;  2KAI A;  1TOM H;  1HB0 B;  2BDI A;  1LMW B;  1W10 U;  1NPM A;  3R3G B;  2BD5 A;  4XSK U;  1Z8G A;  1GL1 A;  1YGC H;  3LJO A;  2PKS C;  2ILN A;  4BTU B;  5B6O A;  1HJA B;  2Q6G A;  2K0Q A;  4NGA H;  1KY9 A;  1AWF H;  2FOF A;  2ZI2 H;  1TQ0 B;  2OK5 A;  3RXO A;  3ZZB A;  1CT0 E;  3QWC H;  4AN7 A;  3F2H A;  1NM6 A;  1ELA A;  1M9U A;  1VIT F;  1EJM A;  3O8B A;  1DY9 A;  1W3C A;  3N99 A;  2AIQ A;  1E36 B;  3UOU A;  1QHR B;  2A45 B;  4ISN A;  3LPR A;  3D62 A;  1SR5 C;  1XVM A;  2ZPR A;  1O2H A;  3PYH A;  3UFA A;  3NUM A;  2VWO A;  1E35 B;  3F9E A;  4INH A;  4K69 A;  1V2Q T;  5J4Q A;  2OC0 A;  4SGA E;  3SNE A;  4YLQ H;  2AEI H;  1ELT A;  1J17 T;  4ZKO U;  3M37 A;  3UB0 A;  1XVO A;  1WQS A;  2AMQ A;  4X8U H;  1AFQ B;  3TLO A;  1O5B B;  1SLX B;  1IQL A;  1ZGI A;  4BTI B;  1LVM A;  4X2W A;  1WUN H;  2F3C E;  1ZTJ A;  1O2T A;  1P0S H;  1YPK H;  1TX7 A;  1YPH C;  3W95 A;  1GCT C;  1V2J T;  4P00 A;  2WYJ A;  2CJI A;  1TB6 H;  4ISO A;  4B6E A;  3S9B A;  1W0Z U;  2RCE A;  3A8C A;  2QN5 T;  3FAO A;  4Y79 A;  1O2U A;  1DLE A;  4YT6 H;  4I8G A;  3TU7 H;  3RXB A;  2JIZ D;  1O31 A;  1AVG H;  1TBR H;  1DWB H;  1HLT H;  1P2J A;  1C1W H;  1V2R T;  1GBK A;  3UNR A;  2BDH A;  4J2Y B;  1TE0 A;  2Q6D A;  1EP5 A;  4LZ4 B;  1NRR H;  2V3H H;  1Y3W A;  4B71 A;  3UR9 A;  1UVS H;  2Z3E A;  4BAO B;  1P03 A;  5GCH F;  3BEU A;  1CT4 E;  1XUH A;  9EST A;  1AZZ A;  2ZDK A;  1KTT B;  1RXP A;  3KYG A;  1THR H;  1HAG E;  3TPI Z;  3MQK C;  1A2C H;  3EGK H;  1CVW H;  1OWK A;  8LPR A;  1DT2 A;  4TWY A;  3H09 A;  1O36 A;  3RC4 A;  2CGA A;  1GCD A;  1QB6 A;  4B76 A;  3A89 A;  5EJL A;  2G81 E;  1LHF H;  3RXV A;  3P8F A;  4CRA A;  2UUF B;  2V0B A;  3OTP A;  4HZH A;  3KQD A;  4UD9 H;  2ODY B;  1KSN A;  1Z1J A;  3T25 A;  3F2G A;  1VR1 H;  3GY4 A;  1UTL M;  3TIU A;  2BLQ A;  5H4I B;  4H42 U;  1CA0 C;  3KHV A;  1OOK B;  2UUJ B;  3M5L A;  3MNB A;  2J5U A;  3NK8 A;  1GI9 B;  1LVO A;  1GHY H;  3JZ1 B;  1TGS Z;  2PSY A;  2HNT E;  1CBW C;  1DWE H;  3F6U H;  3N7E A;  1SGC A;  2W3K A;  1J14 A;  3GY3 A;  1HIA A;  2Z94 A;  1NRQ H;  2XRC A;  3FZZ A;  2BD8 A;  3S0N A;  2BY6 X;  2M5T A;  4YLU A;  2J98 B;  4AFU A;  4Y6D A;  1S6L A;  3MFJ A;  5E0H A;  1P04 A;  1GHZ A;  1V2P T;  1SGP E;  1JOU B;  3STI A;  3SNB A;  1IQK A;  1C1T A;  3SGQ E;  2G5N A;  4Y76 A;  2A5I A;  2P3U B;  1TMT H;  3SUF A;  2F4L A;  3HKI B;  1ZPZ A;  1O2G H;  3A87 A;  1TNH A;  2HAL A;  2FPZ A;  3P6Z B;  4TY7 A;  4NA7 A;  5EOD A;  1SB1 H;  3PLP A;  3T29 A;  2FLR H;  1NC6 A;  1GI2 A;  3ZVG A;  3FOA A;  2VB0 A;  1BCU H;  1WV7 H;  3B8J A;  2ZG0 H;  1KIG H;  3HKJ B;  3ZVB A;  1KXE A;  2KX4 A;  1GJ5 H;  1IQE A;  1BRC E;  1W11 U;  1YP9 A;  1YWU A;  1C1N A;  2BQ7 B;  1O3L A;  3I77 A;  1O3K A;  4TY6 A;  4D9R A;  1IQG A;  3V13 A;  2ZO3 H;  3DCL A;  3QGJ A;  3T28 A;  2VIN A;  6CHA C;  2AMD A;  1D9I A;  1AB9 C;  1JRT A;  2BB4 A;  5BRR E;  1O5E H;  2Y6T A;  1IQI A;  1EAW A;  4MPX A;  4UFF H;  1QZ8 A;  4IN1 A;  4DJZ B;  2ZQ2 A;  2BVX H;  1VCP A;  2OD3 B;  6GCH F;  1FIW A;  1OS8 A;  3RMM H;  1HNE E;  3L6P A;  5HM2 A;  2AGG X;  4AB8 A;  5C20 A;  3U98 H;  1WYK A;  2BD9 A;  3WWB A;  2C8Y B;  2JJ2 D;  1MAY A;  1O3E A;  3PV2 A;  1ZML A;  3PO1 B;  1SI5 H;  3A81 A;  4D9Q A;  3ZV9 A;  3S7K B;  1FY4 A;  2FI5 E;  4Y71 A;  5HIY A;  5PTP A;  1W8B H;  2KCA A;  4Y10 E;  2GT8 A;  4LK4 A;  5C94 A;  4ZKN U;  3L33 A;  2WPH S;  2SGE E;  2Z9J A;  4VGC C;  1QFK H;  2ZGB H;  3SI3 H;  4ZRO A;  2OP9 A;  1K1I A;  2VGC B;  1RJX B;  2BTC E;  5IYT A;  2ZQ1 A;  1MH0 A;  1JBU H;  1O3I A;  1SGF G;  2FS8 A;  2Z6B D;  1YKT A;  2ZHW H;  3OEH D;  3CEN A;  4JMY A;  1JXP A;  2SGD E;  2QC2 A;  1F5K U;  2QXH A;  3ATW A;  1P2I A;  3UNS A;  1NFX A;  4HTC H;  1P02 A;  3ZV8 A;  5HM9 A;  3BTF E;  1HYL A;  4CH8 B;  3A8B A;  3T26 A;  1OKX A;  1DIC A;  2C8Z B;  2FOM B;  3IWM A;  1C1V H;  1ZOM A;  2WUC A;  3SQH E;  2IJD 1;  3U1I B;  3VB3 A;  1V2V T;  3MU0 A;  2VH0 A;  4F48 B;  3MU5 A;  1V2N T;  2JET B;  1TMU H;  3VFE A;  4A1X A;  1J8A A;  3FAN A;  1W13 U;  2XW9 A;  2WIN I;  1O38 A;  1V6D A;  3FZD A;  2F9O A;  3N7O A;  3LC5 A;  5C67 A;  2OBQ A;  1VIT G;  2F9U A;  1PPH E;  4D7G A;  2V3M A;  2Y80 A;  1SL3 A;  4XE4 A;  4DT7 B;  1QGF A;  3RU4 D;  1GWA A;  2P8O B;  5LH8 A;  3SOS A;  1OSS A;  1BML A;  1O37 A;  3I29 A;  2ZZU H;  2O8T A;  4LOY H;  5F8T A;  2BDY A;  3UAI C;  3VB4 A;  4HFP B;  3AVZ A;  3U8T H;  2GMT C;  1PPC E;  1BIT A;  4DY7 B;  5JBA S;  1QB1 A;  3Q77 A;  4X6O A;  1SFI A;  4GUX A;  1TPA E;  2XCF A;  1WAY B;  3RXD A;  4AGJ A;  5EJ1 A;  1O3G A;  3QGN B;  2B8O H;  3GCH B;  3LOX A;  2J4I A;  3NCL A;  4MG3 A;  2BD4 A;  1Z71 A;  1LPK B;  4NFF A;  1G37 A;  1O2O A;  1O3D A;  3S7H B;  1O3B A;  1BQY A;  1LVB A;  1B0F A;  4I8H A;  2ODQ A;  1ETS H;  3MO3 A;  4HG6 A;  3SV2 H;  2GT7 A;  3DHK H;  2QF3 A;  1GJ6 A;  1BDA A;  3M7U A;  3LC3 A;  4WJG 2;  2Q6F A;  5AHG H;  1F5L A;  1ANB A;  1S81 A;  4ZAE A;  1FN8 A;  1EPT A;  5DJ7 A;  1LHG H;  3LDX H;  4IN2 A;  1A5I A;  1YPG H;  1PPZ A;  3M3V A;  4JZD H;  5CMX H;  1ANC A;  1ELC A;  5HYO A;  3OY5 U;  1D3D B;  1SOT A;  4IBL H;  1A46 H;  2SGP E;  2GZ7 A;  4NSY A;  1GJB B;  1OHH D;  2ZFT A;  3URE A;  2KAI B;  3TK6 A;  1S0Q A;  2G4U A;  1MAX A;  1GI4 A;  4TSF D;  2STA E;  2HVY B;  3P17 H;  1C5P A;  2PHB A;  1GJ4 H;  3EAJ A;  3GYM A;  1PPF E;  4I7Y H;  2G51 A;  1OP0 A;  1ZHR A;  3LH3 A;  2GMT B;  3MTY A;  3B9F H;  1G30 B;  4MPW A;  4QT8 C;  4UFE H;  2RA0 A;  4DG4 A;  4DOQ A;  2NU1 E;  1OX1 A;  1EZX C;  1Y3U A;  4M9F A;  1K1J A;  1SVP A;  1ZRB A;  2BD2 A;  2K1Q A;  4NIW A;  1V2L T;  2ZCK P;  1AE5 A;  3RM2 H;  5DP9 A;  4X1P U;  1LKA A;  2G00 A;  2BLV A;  4WXV A;  1SQO A;  1DIT H;  1GHV H;  1O3C A;  1A7S A;  1TBQ H;  4JYT A;  5LPF A;  3E6P H;  5DGJ A;  1ORF A;  1UHB A;  1SGI B;  3MHW U;  1O2P A;  1GG6 B;  3LJJ A;  4IMZ A;  2NU4 E;  3QTV H;  1FDP A;  3ZZ7 A;  3ZVD A;  4AOR A;  2NU0 E;  2QAA A;  3GS9 A;  1EZQ A;  2UUY A;  2H5C A;  1EX3 A;  1G3B A;  2QY0 B;  4GCH F;  4AOQ A;  1UTM A;  5L30 H;  5F53 A;  2HWL B;  2I6Q A;  3ZYE A;  2HOB A;  1FX0 B;  2FXR A;  1ZJD A;  4XDE A;  2XBW A;  2Y5F A;  1NFU A;  1SLU B;  3SUG A;  2ZU3 A;  1C5Y B;  1O2Q A;  2BOK A;  2O9Q A;  1SQA A;  1RFN A;  2BVS H;  1GVL A;  2GD4 B;  1CGJ E;  4X2V A;  1JMO H;  3BTT E;  1XUG A;  1AU8 A;  2BLW A;  3BIU H;  1MZD A;  1V3X A;  2A7C A;  4KTU A;  2H9T H;  3U1J B;  2FWW A;  1O5A B;  3RXG A;  3UIR A;  2FOC A;  2WZQ A;  5DSF A;  2EI8 A;  2XXL A;  5EXL A;  1GMD F;  1GHW H;  1LTO A;  3F0O A;  5KGO A;  2EI6 A;  2EST E;  5E0G A;  4RN6 A;  2SGF E;  3QK1 A;  4I8J A;  1BTU A;  2BY8 X;  2FOB A;  1ETT H;  4NIV A;  3MNC A;  4NZQ A;  1O3N A;  3RLW H;  1F0S A;  1WOF A;  2ANK H;  1LKB A;  3T27 A;  1C2I A;  4JZF H;  1MU6 B;  5EPY A;  1J15 A;  1P3C A;  3F0P A;  4YM9 A;  5FHT A;  3SV8 A;  1AKS B;  1O2S A;  3CS7 A;  1TBZ H;  3O8C A;  4X0W U;  1ZSK A;  4WY3 A;  6GCH G;  4J1Y A;  2PUX B;  1K1P A;  1FXY A;  1K22 H;  3RC5 A;  1P2Q A;  1O2Y A;  1YM0 A;  4HGC A;  4MNW A;  1MD7 A;  4RT1 A;  3FVF B;  1TRN A;  1E34 B;  1QB9 A;  4WH6 A;  1YF4 A;  7LPR A;  2FMJ A;  3A7Z A;  3D65 E;  1GBH A;  1NTP A;  2FYQ A;  3A7V A;  1C5Z B;  1QNJ A;  2A32 A;  1XKB C;  2G52 A;  3MU1 A;  4U2W A;  2YMS C;  1LPZ B;  3BTM E;  4ISH H;  3CNR A;  1L2E A;  3PWB A;  4TWW A;  2F43 B;  2O8L A;  1GBJ A;  1N1L A;  1EXF A;  1A61 H;  1UCY K;  5FX5 A;  3LON A;  1O33 A;  3SU0 A;  2ZA5 A;  4R8T B;  1HIA B;  3KN2 A;  1MTS A;  2FO9 A;  5E8E H;  2PUQ H;  5LGO A;  2ZHF H;  2C8W B;  2W26 A;  5FBE A;  3GYL B;  5FPS A;  4B2B A;  1MTU A;  4E7R G;  1UVP A;  4ASH A;  2RA3 A;  3B23 B;  3SBK A;  3S9A A;  1A3B H;  3MU4 A;  1SGE E;  1VJ9 U;  2VWL A;  3SZN A;  1AVW A;  2H2Z A;  5A2M H;  3A80 A;  1BRA A;  4AZ2 B;  2DE8 A;  4AGK A;  5C0U A;  4LZ1 H;  1TAW A;  2THF B;  4XBD A;  2IOT A;  2SNV A;  1C5X B;  4MTB A;  1WTH D;  2QF0 A;  2LNC A;  4GSO A; 
#chains in the Genus database with same CATH homology
 5EQR A;  2KCA A;  3SU6 A;  2K8I A;  2OK5 A;  3M5M A;  3KNX A;  3U1J B;  3VG8 A;  2AHM E;  4A1V A;  5IK2 D;  2JJ1 D;  4A92 A;  5FPY A;  3F2H A;  3F2F A;  1NS3 A;  2WZQ A;  3F2G A;  4OM9 A;  5B6L A;  1EFR D;  2GGV B;  2QF5 A;  3O8B A;  4Q63 A;  3SUE A;  3ZIA D;  1DY9 A;  1W3C A;  3DSO A;  3N99 A;  4WF8 A;  5DSF A;  5H4I B;  2O8M A;  4F55 A;  3OE7 D;  3M5L A;  3F0O A;  2J5U A;  3OFN D;  3LKW A;  3PV5 A;  2OC8 A;  1A1R A;  3O8D A;  4XD7 D;  2XNI A;  3OEE D;  5EPN A;  2IJO B;  5GPI B;  4A1T A;  1H8E D;  5C17 A;  3WWF A;  1BMF D;  3PRD A;  2QF4 A;  4K8B A;  5ESB A;  4Z1M D;  1OHH D;  2WHX A;  2YMS B;  5EQS A;  3O8R A;  2KCY A;  3PRB A;  2LEL A;  2OC0 A;  3N7E A;  3OEH D;  2M2A A;  4JMY A;  1JXP A;  1MAB B;  2XCN A;  4TSF D;  3F0P A;  5EPY A;  3SU2 A;  5HKK D;  4RI0 A;  3SV8 A;  1DXW A;  3DSP A;  3UB0 A;  3WW7 A;  2KCO A;  3O8C A;  3SV6 A;  2XND D;  1S6L A;  2FOM B;  2XOK D;  1RGQ A;  4WH8 A;  3FO8 D;  1COW D;  3RC5 A;  3SU4 A;  3SYJ A;  2IJD 1;  3U1I B;  4YXW D;  4ZCN A;  3SU1 A;  2HLD D;  3W1E A;  1E79 D;  1H8H D;  3M5N A;  4NWK A;  4M9F A;  3SUF A;  4WH6 A;  2F4L A;  3SUD A;  2L6O A;  4KTC A;  2KFW A;  2K1Q A;  2QV1 A;  4B6E A;  4A1X A;  3SU5 A;  2OC1 A;  1SKY E;  2FP7 B;  4U01 A;  2KM0 A;  2OBO A;  3KEE A;  2VBC A;  3FOA A;  3OAA D;  1W0K D;  3P8O A;  5C0T A;  1WXR A;  4Q4L A;  2OBQ A;  5GND A;  5CDF E;  2YMS C;  2JIZ D;  2KR7 A;  2F9U A;  2QE7 D;  1E1Q D;  1E1R D;  1W0J D;  3E90 B;  5DN6 D;  1DY8 A;  2F43 B;  2A4G A;  1N1L A;  2A4Q A;  5IDK A;  2KZ4 A;  2WV9 A;  1DXP A;  3SU3 A;  2WSS D;  4DT4 A;  3LON A;  3N7D A;  5GJ4 B;  3SU0 A;  3EYD A;  4R8T B;  4B75 A;  1BT7 A;  2A4R A;  1RTL A;  3DCL A;  3KN2 A;  3FN8 A;  2YMS D;  4B71 A;  4NWL A;  4ASU D;  5FPS A;  3GS9 A;  3M5O A;  2P59 A;  5CHB A;  4I31 A;  3SV7 A;  1NBM D;  1KMH B;  2XCF A;  1NBM E;  2F9V A;  3LOX A;  3KF2 A;  5F53 A;  5EQQ A;  4I33 A;  3P8N A;  4B6F A;  2V7Q D;  4TYD A;  1FX0 B;  3FKS D;  3NRL A;  2KCP A;  5ETX A;  3L6P A;  3SV9 A;  2JDI D;  2FM2 A;  2GVF A;  2WPD D;  4B73 A;  2OC7 A;  3RC6 A;  3SUG A;  2YOL A;  3H09 A;  5C0U A;  3RC4 A;  3WWB A;  5FL7 D;  3AK5 A;  2JJ2 D;  3F3B A;  1CU1 A;  4FET A;  5FPT A;  4B76 A;  3PV2 A;  4B74 A;  2W6J D;  4I32 A;  5T1V A;  3SZE A;  2K0Q A;  2OIN A;  2W6I D;  3OTP A;  3OYP A;  2CK3 D;  4TT3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...