5T33H

Crystal structure of strain-specific glycan-dependent cd4 binding site-directed neutralizing antibody cap257-rh1, in complex with hiv-1 strain rhpa gp120 core with an oligomannose n276 glycan.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
223
structure length
223
Chain Sequence
QVQLVESGGGLFQPGRSLRLSCVASGFSFNEKAMHWVRQAPGKGLEWVAIIWYNSIHKNYADSVKGRFTISRDNSKNTLYLQMNSLRADDTAVYYCANAGGGKYDYLDVWGRGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAP257-RH1 heavy chain
publication title Structure of an N276-Dependent HIV-1 Neutralizing Antibody Targeting a Rare V5 Glycan Hole Adjacent to the CD4 Binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2016-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t33H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t33H01
4XI5C 3C60A 4FQXB 1UM5L 4GBXD 1JZ7A 2OQJB 4IRZL 3JTTA 1KJ3H 5AG9A 1A6WL 3CFKB 4LP5A 3DETC 5HSFA 1NC4D 5SWZD 1TZGL 3PGCB 5TPWH 3PIQB 3F5WA 4UUJB 5ISZE 2W9DH 3MLZH 1BOGA 2XA8L 4JKMA 4LHUB 5LGJB 1TQCB 3ARFA 4LLMB 4KKLC 3CK0L 5DQ9B 3BGMB 3GSUA 4URTB 4MJ4A 2X7LB 3KYAA 2P46B 3L3GA 5TF1H 4V1DD 4HQQL 5FM5M 3G04B 4XNQA 4PJHE 3QHTC 3VXOA 5DI8A 3RNQB 5I66A 4LLVB 2NZ9C 5HI3D 4K9EC 3KR3L 4WO4A 2R29L 2XZAH 2AJVH 1VEPA 4LPCA 5ECJE 1KEGL 2A77H 3O41A 3IFLL 2AXGB 1A4KB 4M8QA 3FTGB 5IQ7H 2OR8A 3DBXB 1Q9OA 3X17A 3CH1B 4KDTC 4MQTB 5JMOC 3SO5A 5LBSH 1VGEH 4ZUSB 5IR1B 1DQJB 3MV8B 4GG6F 4ORGA 3L3OA 3DOSA 3DPBA 5GJTL 4HFWB 5D5MF 2Z31D 4GW1B 1R5VB 2VLJA 4DUVA 3CXHK 4P5MA 4Z7VA 4GKSA 3TYFA 3HC4H 4DGIL 1CDBA 2VNCA 1OGAD 3LKPA 2W1NA 1UXWA 1DL7H 1MJUH 1LO3L 3LEYL 4FTVD 4DEPB 2BMKA 2XWBA 4Y5XC 5E8PA 3GO1H 4YDVB 4EN3B 3EOTH 2QQNH 3SDDA 5C0RL 3U0TA 4IIQA 3FCTB 1BMGA 3L6FB 1BHGA 1S7SB 4LLWB 4YDIL 5I16B 5IWLA 3TNMB 1CGSH 1A7QL 1IC5H 4N5EC 4I18C 4M43L 4RIRA 2ZUQB 5F6HI 4KI5E 4E41A 2PYED 2QSTA 2IG2L 3IKCB 4FQHB 4PJEF 1ORQA 5F7KC 5CEZE 5CILH 1NGWA 2V9QA 1I9IH 4KTEL 4BZ2H 3WNPA 4YZFF 5GSRA 4W4OA 1G6VK 5IW1B 5KN5B 1HCFX 3B43A 1A7NH 2A73A 5EORH 4JQVA 3MJ8B 3KYNB 4MD5B 5F3HA 1WTGT 4I5BA 3MGOA 3UBXA 3H7BA 1FFPA 3BPOC 4OFIA 2M2DA 2NMSA 5FCUH 1K5NB 2FX9L 2ZWLT 3NVQA 3VXMA 4M6NL 1F02I 4D3CL 1OW0C 4Q2ZA 4ZXBB 1I1CA 3BGAA 3CVHA 3FFDA 4XB8A 5T5NF 3TH4T 4YIQA 1QG3A 5E6IA 5FV2A 1QYGL 1FFQA 5JMRA 3GHBL 3RKDD 2KKQA 3TVMC 2ENSA 1E4WH 2VXSL 3F58L 3BQUD 1ZLVH 4TOYH 1HHKB 5JHLL 2CUHA 3V5KA 2VDLH 4TPRH 1K4CA 5CIPB 1WAAF 1T89C 4PRNB 2ATKB 4LLQB 4RAVA 3Q6FA 2EH8L 1DEEB 4GG6B 5TJWK 3NPZB 1ZLUK 1MH5A 2FLRT 3H6JA 4WEBH 5E9DD 5D7LE 1A0QH 4IMLB 5D5MB 4P2OC 2UYLB 1R5IA 3TT1L 3RL2B 5E2JA 5B38G 3RVUC 2R56L 3K81A 2E7BA 3WUWB 5DRNA 3MLUL 3VCLB 2E6JA 3QIUB 4AMKH 5I17A 3W9EA 4WUKL 2Z4QB 4F37F 3V6OC 5HHPA 2EIZB 1N0XH 3H3PH 4IJ3C 1UB5A 3PWUA 3VXSE 1WBXB 4YXLL 5HY9B 1A4JB 5J13C 4H1LG 1XF2A 3BH8A 1SYSA 3BIKA 4LRIA 3DURA 2ICCA 2HH0L 3MLXL 1P4LB 5DJ6A 3KGRA 5HDBE 2D2OA 3FL7A 3STLB 3DX8A 2EXWC 2CKBH 5EUOF 2IH3A 5JHDB 5C0FA 5I73B 3HI1B 4LIQL 3RKPA 1DVFB 1BOYA 2OL3A 2V7NB 3RNKA 3VWKC 4PJEB 1U93B 4KKCC 2CDFA 1TJIL 5F8QC 3LCYA 3HZKA 3BKCH 4BQ6A 3L5WB 3MROB 3O3BA 5D1QC 2R4SH 4U3XA 4MAYC 2OJZH 2PETA 3AM8A 3TBTA 2X2YA 1J1XH 4OF3A 3UTSA 1JGLL 2A9ML 4JY5H 2Y06L 3V6ZB 3BEVA 5DWUL 3C8KA 4IBLT 5D71L 4BH7A 1CD1B 4YHIB 1HEZA 3UC0H 4LLUB 4QRPB 3QCUH 5ID0B 3U7AA 4MJID 4Z78B 5KZCB 1OSZA 1NCAH 3N1MC 1H3TA 2EEAA 4OBRA 3N9GL 3WFCL 3JXAA 4NQXA 5DRZA 3IJHB 4JGMA 4D0CA 1DUYB 5D70H 3MREB 2IAMB 3TIEA 2VXQH 3VXTB 3B9EA 3RGVA 5HDQH 2DJ4A 1FL3A 3IDIB 5DS8B 3VXQA 4JO1H 2VZUA 3K1DA 4MSWB 1PQZA 5EOQL 5DMIH 5T5FH 3LKRB 4KZDL 2L0DA 4G8GB 3VXUB 1LDPL 4KXZH 4PJCA 1U58B 2D0HA 3UTPD 1GGCL 5EB9A 4LSUH 2OJEB 3QCVL 4XPHH 4X4XB 2BSTA 1U9KA 1TETL 5HDOA 1NCNA 5D1ZD 4CMHB 4ZUVA 4Z6AT 4Z95H 1WBYB 4KZEH 4R0LB 4M1GL 3BYTA 1YMME 4KKNA 1HOCA 4Q6IB 1EK3A 4BK5A 4Y2DC 1I3GH 2ZJSL 2C3VA 4PRBB 3FQTA 3PNWB 4XHJC 3L9RB 4YDKL 1N6VA 5IB5A 3MFGB 1D9KD 1IL1A 1ZA3A 2Y7QB 4Q9RH 5BOPA 3B9KC 1DLFL 2VO5A 5KSUB 4GQ9H 3D5OF 5EUOB 5L0QC 2X4NA 1AI1L 3OXSB 3ZDXF 1B2WH 1FNEB 2CQVA 4HH9B 4ZSOE 4K3DH 2K1MA 5I9QB 3EBAA 3WL9A 2G2RB 3FQWB 3P9WB 3MNVB 2F8XC 4UAOC 4YBQD 4PGCA 4ZO9A 2MOVA 1CD8A 4H26B 5IVXE 3GRWH 2YA2A 5TDPB 1WITA 2EKJA 1VA9A 2PO6D 4KAQL 4RQQA 4TRPL 3HZMA 2ZNWA 4Q0XH 5GGTA 4KI5C 2VE6B 3QO1B 1RZJL 1SEQL 3FONB 1F00I 1NBZA 4OFDA 4XP1H 4MB5A 5D1XB 5HHOD 4Y19A 4WDIB 4OLXH 5D93C 4LNVA 3UAJD 12E8H 1KN2H 5CJXC 3QJFA 4Z76B 1L7TL 5F7FA 3VG0L 1IFHL 4J7RA 1J0ZA 4JZNB 3MRIA 3BSZH 2VXVL 1IGCH 2R2EB 3P9MA 3K80A 3Q48A 5DHVH 4JFFD 1JGUL 2DD8H 1UZ6E 5ANME 4EI5C 5DHYA 5IB3A 5KS9A 1I8LA 1FO0L 2MWCA 3EIFA 4QRSB 5BS0B 1U36A 2ICWI 5D6DC 3WUZA 3DSFH 2VITA 4LU5L 3E1F1 5FUOH 5DMJB 3LIZH 3TZVB 2F74B 1PJ9A 5IIEA 5KAQF 3RWGB 4XXDA 1FL6B 1IAKB 2EDWA 3T04D 1MY7A 3OAYK 3VMOA 5JQHC 4M9PA 4NRZB 1WT5C 3KXFA 2FNBA 4BFEA 5BVPH 1U8KB 4Y4KC 3Q6GL 1QNZL 4EUPH 5DJ0B 4YNYA 1UJ3B 1VB9A 2DQEH 2QSCH 5DXWA 3IDNA 1J1PH 4WFFD 1OAXH 4P23C 4HXAH 4JRYE 3DVIA 3H9HA 2O5ZH 3OGOE 2VDPH 5IMOB 3C5ZD 3CVIL 3PQYD 3T09A 1ZLUH 3OQ3B 4JFEA 5DVNA 4JFQB 3C6SB 4HCRA 2B20A 2PTUA 3RWIA 5DJYB 5J6GA 3H42L 5C09B 3T2NH 1TQBB 5CP7B 1UYWL 3OL2A 4F33B 3T1FB 5MENE 3ULUL 3BP5A 1YNLH 3DARA 2R2HB 2IPKB 4OCLC 3HS0B 1F3JB 2AV7B 5DO2D 4QHLB 3N1QC 2X9WA 1Q72L 4UV4L 3ARYA 4TNWK 4F57L 1DN0B 3NCFB 5KOVC 1X5AA 3CLFL 5ETUA 4JQIL 2Y9RT 1JPTH 1JFQL 5ILTL 3GKWL 2X4SB 4R26L 3A6OA 3AU1B 1S5IH 1CR9L 2BOCB 5E8EB 2DLTA 1EIBA 1C16B 2I27N 1YUHA 1S9VA 1OTSC 4HV8A 4WEMB 5JIIA 5LJYH 4EQ2A 4DCQB 3PGDA 1JI2A 5E7BA 4X5XB 1JGVH 1HH6B 3M8OH 1IGIH 5BRZD 1CE1H 3CXDL 2B5IB 1KELH 1KOAA 4NJ9H 1MAMH 1DTUA 4P4KD 2IJ0C 3V4UL 3P40A 2SEBB 5IFJB 4QWWC 4RRPG 1T3FB 5KSVA 3QDMB 1ZS8A 4O02H 3KPOB 1KXQE 4OJFH 3OSKA 2EH7L 3I6GB 4Q6YA 4UNUA 1BLNA 1J8HE 1PG7H 1QHPA 1U8HB 4KTDL 1EEYB 1N8ZB 1SJHA 2NY4C 5D2LE 2UWEA 1LEKB 4PG2A 1QSFD 4HIXL 4K7FB 3D87B 3FOLB 4UINL 4DN3L 1NAMH 2FGZA 3BPCB 3GSWA 7FABL 3C5JA 1K2DA 1FVDA 4OQTA 4QXTB 4G8FA 3MYZA 2CRMA 2VABB 5F7MC 3SKUD 1CLOH 4WW2A 3O45B 3QFJD 1LNUB 3MOQA 3U46B 4K9EH 3T4YB 5KANG 3DRQA 2Y4SA 2YA1A 1UGNA 2LTQC 4N8VA 4KK5D 3TA3A 4WNQA 5DMGD 6FABH 4F7MB 2H9GA 5J3HD 1VERA 4R7DB 1YYMH 5GHWL 5LGKA 1CICC 4HPYL 3QIWA 4W68A 5FO8B 1J5OH 2JJWA 1X5GA 3L3HB 3LSOA 1BWMA 1RZ7H 4KROC 4PFEA 4ZUWB 3U0WH 1H8NA 1T21B 5DD1L 4H20L 5CLWA 5MHSD 1RZGA 2I60H 3CPLB 5EOCH 4P9HC 1VGKA 3R06A 4GQPH 2DAVA 4OFVA 5AEAA 2OTUB 3CFCH 1FJ1B 2VDQH 3O9WC 2FEDD 4LVHC 4NQVA 4JHAL 5IVNA 2B1AL 2IANE 2ILLA 2BOBA 1UXSA 2V5RA 4U1MA 3KPMB 3MLWL 5IVZB 3SJVB 5D8JH 4N90E 3WFBH 4QGYA 4ODHL 4F58H 4GKZB 3CU1A 4U0RC 4S2SA 1T2XA 1G7LB 3TNNA 3W9DA 2FBJL 3ZTNH 4DFHA 3HFML 4FHBD 4XVSL 3RWCB 2EE3A 3O2DA 4U6HA 5HYIA 2BNUB 3WN5B 2D03L 5E00B 4YK4C 1YECL 1CGWA 2Q76A 4AM0A 1YPZE 2VISA 1B0GB 4M02A 4CU7A 4OV5B 5FYJE 3ARBB 1JPST 2XPGA 1LP9A 4AL8L 4HGMA 2HKHH 1XR9B 2X6MA 5DMKB 1XGQB 5C0CD 1JPGB 3VXPB 1YNTA 5JR1H 1LDSA 4PRHE 1F5WA 5D2NE 1AH1A 4OZIA 4OGYH 5JXAH 5FYKU 1U6AL 4Y4HA 1NGYB 5DQJB 4DUXA 1AIFA 3QUXD 5TF0A 3VGGA 4XPTL 3IDMB 5I1HH 4TUOB 1MUJB 5HVWA 2ESVD 2FH8A 1MEXH 2I5YL 5INDB 3QEQA 1S8DA 2ITDA 1XF4A 3DVNB 4K71C 5HGBA 3S35L 1IAIH 3SO3B 4HK0A 3O3EB 5HGDA 4WCYL 3RL1A 4JGJA 1NSNL 3DHMA 2A83B 3ZHLA 3GB7B 4L8CA 1NC2D 3ULVE 2DYPA 4JDTL 3HB3D 4FXKB 1WIUA 4IOFC 3DIFB 4XCEB 1OAUL 3OKLB 4ZAKC 3S9DB 4YHMH 4ZYKB 3OB0K 3PXHA 4OF5A 3DXAD 1PG7X 4OLZH 4Z0BL 4JN2A 1WWWX 3T0EC 1T22A 1UWEL 3P11L 1FNFA 1UM4H 2EYTB 3R1GL 2CO7B 2HFGL 2JIXA 3QUML 1WICA 1MFNA 1NCBL 4NO2A 1PKOA 4NKMA 2XV6B 3OAYH 9CGTA 1KB5A 4M7JL 2X1QA 4AG4L 1RHHB 2B7DT 4HFUH 1G0YR 5KW9L 1KCRH 3W81A 3F12A 3IDXL 4UDTA 3FB7B 1NMAH 4P2QA 4M62H 2IPTL 3NAAL 1OGTB 1HE7A 1WEJL 3IB4A 3FZUD 3V4PL 4S1QL 4FG6C 3VFMA 4TSCH 4RDQF 3A6CL 4KRNA 2OX5A 5L8KB 1RJZA 4HGWA 5J9PB 1SJVA 5FV1L 1FYHB 4BFIB 1U8MB 4YHLL 1MRCL 2QBWA 2EDNA 5FGSA 4ZTOL 2P5WB 3I50L 4N1CA 3DV4B 4BUHA 1A3LL 1S9YB 1X44A 3GSQA 5SWQB 3S36L 3P30H 4P2RD 1OAZH 4K7PL 1IM3A 3HKFA 4KPHL 4BZYA 5CGYC 2X05A 3B9AA 1MREH 4CVWA 4FRWA 4DAGH 4K3EH 4YE4L 1G0XA 3HTLX 3OAUL 5TE7L 5EBWA 1E27B 3MLRL 4GAFB 2FECL 2GI7A 4UV7L 2XZCH 5IP4A 2O5XH 2V5TA 3KPNA 4JY4A 3FB8B 2X70A 4LSTL 1RZFH 1P4IH 2EE2A 3KPSB 3P9LB 2WUCL 1ERNA 3DX6B 1PDKA 1UADC 3KHOA 1T83A 1SHMA 3LHPL 2F19L 2BSSA 1F42A 2GT9A 1EERB 4OZGA 3VG9B 2YD3A 3T3MF 2HJKA 2FD6L 3QNZA 4IDLA 1DBML 2NLJA 1K4DA 2EYSA 2X4PB 1A6AB 1T7ZA 4QTHB 1L4IA 5EU3B 4DKEH 2VLJE 2YKLH 2YS4A 4Z7VE 1EO8H 43CAB 4X0KB 4ODTH 1XR8A 4N0YL 1PSKL 5CJOH 1HQ4A 5K93A 2XG5A 5MEOA 3DMMA 4JGUA 1KUMA 4QCIB 1NANI 3VGHA 4Z18A 4APQC 3VFTB 1A1OA 5DYOB 2H3NA 4XPAL 5FO7A 3LRGA 1JF5A 3VA2C 4Z7UF 1LE9B 3GMQA 3MXVL 4XVUD 2X44D 2YBRA 3MFFB 4MMXC 2R2CA 5BZWA 4BQBA 5BMFH 2PW2A 5B39B 5IEHB 4GBXB 4NKOA 1P7QA 3QQ4A 4E41E 5LXGH 4MA3A 3F7QA 5I1KH 3D2UD 1LEIA 4KC3B 2R8SH 2PXYC 1CFSA 3HAEA 4XI5D 35C8H 5DQDH 3BUYA 1S7XA 4C56D 1NC4B 3MRNB 5SWZB 2DM2A 4I0PA 1ZANL 1OB1A 4QLRA 1OWWA 3OAZH 2OK0H 1G7QB 3IXAB 3TM6A 1NEZB 3BWAB 4GAGL 3DETD 3N85H 1G7JB 3VXME 2RCSH 4FFZH 4XZUA 2Z8WC 1BD2A 1IC1A 3QEHB 4OCRL 2DL9A 3OKEA 4V1DB 5EFIB 1I7UB 5SWSD 4KKLD 4XNUL 1JPFA 2Q87A 2VL5A 4YDJA 1RIVH 1IGMH 2BSED 2VR5A 5AZ2L 4ENEC 1QFWM 4M7ZC 1KPVB 1CGYA 5F8RC 3VXNB 1BP3B 1NGPL 4JAMA 4NYLA 5FF6A 1I3VA 3GHEH 3QEGH 4HWZB 4TN9A 3EW3B 1T66D 1R3HA 2NZ9D 4WFGD 3RVXC 5IESH 4D0DB 1OD7A 1EMTL 2DIJA 3CFBA 2YUWA 5CD3A 2EEDA 4IRSD 3TH3T 1G7IB 1QEWA 1JWMA 4NQDA 1FVEA 2Z31B 4NHUA 4YHNB 3ILQC 5ITBL 4XWGH 2HLAA 3WJJA 4HEME 4FA8A 4PRIA 4JG0H 1OGAB 4LSSL 2DQTH 1YJDL 2A6KB 1A22B 1W72H 4M6OH 2PTVA 5D96B 2AJSL 5TQ0L 4FTVB 4ODXB 5L2KA 4ZD3H 3AC0A 4G3YH 2VIRA 2QQQA 1V7ML 4JZJB 5H35B 3QJHA 1LMKA 1I9RH 4Z7UB 3RJQB 4OCYL 4XNMA 2HJFA 1JGEB 4HHAA 5I1AA 2ICWA 5J6HA 4NQSA 4JANA 3GGWB 3TBVA 5GS0L 2BC4B 2J6EL 4XNYH 4G80B 1MIEH 4MA8H 3VI3F 2F9BT 2F15A 2PYEB 1HYSD 2OMBA 1FBIL 2XN9B 5C0BB 3NA9L 3KPRA 3OB0H 2L4OA 4FQQA 4Z8FL 3OX8A 5JW3L 2FL5A 4UB0H 4N5ED 2C1PB 1T5XB 4DK3A 2DQFB 4FFWC 3ARGC 4X7TB 4F80A 1ADQL 4P5TC 1QQDA 2QR0B 4X4ZA 3FO1A 3C60C 1AXIB 3GSXB 1OCWL 1X9QA 4PJGA 2W60B 1DLHB 3QB7C 2EDXA 3UTSE 2FECI 5GIRA 5FM5O 2LABA 3LPFA 4FQCH 1HILA 3BHBB 1IGJB 3GK8H 3W0WA 4NHCL 4EEEA 1VENA 2CMRH 3LRSB 1BECA 5F96H 1D5BA 3WIFA 4POYA 1T1XB 3LDBC 2P5ED 2R1XA 4L3EA 3CCHB 4DWHA 5FDYA 2NR6D 4X4YB 4J1UA 1S7TB 4X7SL 1H3WM 3ISWA 3P4OB 3CAFA 4PY7B 3QI9A 3UEZA 1G1CA 4JPVH 3E8UH 1A6UH 4RFEB 1FNSL 1MHHB 3B9DA 3BQUB 3T4AB 1C08B 1B9ZA 4QKXB 1EVUA 1SJXA 5DRWA 4AEIL 5I1GH 1BIIA 3VD3A 4QT5B 2DLFH 1YEIH 5GSVA 1KJMB 1NBVL 2RBLA 2F53B 3TVMD 3WLWC 5E70A 2A74B 4WO4C 4OCWL 4PJCE 5E9DB 4LGSB 1MCSA 2HJLB 3SKJH 2NXZC 3C09B 3NCCB 4BK4A 3RZCD 4G6AC 4O2FA 5ICYB 4NSKB 2DQGH 3D9AH 2CDGA 2JB6B 2JJSC 5KJRH 5D6CB 4J3SA 4NNXB 1RU9L 1MRFL 4P2OD 4R96B 1CG9B 5EC1B 1JGDB 2VLKD 3CFDA 3X11A 3RVUD 3D69A 3IETB 3O2VL 1FZKA 2Y6SD 4N1HB 5GRYA 4YEFA 2ZUSA 3GUTA 1HYRC 3VFSA 4MA1B 3KNBB 4PJXF 1NFDF 3N0PB 3MRMA 1A7RL 1LEGB 4P57A 4MB4A 2XTLA 4X99A 3ZT6A 2V6HA 4QXGH 3ILPB 1UC6A 1FL5A 4GMTH 3TN0D 3DECA 4G7VH 2DF3A 5FCSH 3DROA 4PREB 5EBGA 5LQBL 4LSVL 1FNGA 4NM4L 4P46D 1LO4H 3FFCA 4P99A 2EXWD 2WIIA 3KJ4C 4O2EA 3O6FC 5FAAA 5DJXB 4BYHA 4AH2B 4FP8L 3AB0B 3AY4A 3VWKD 4KKCD 5IWLC 3UZVB 1J86A 3I75B 5C0GA 3QPQD 1EZVX 3L1OH 3WNKA 1JF1B 2VOTA 5D1QD 3GSRB 4ZODA 4C83B 5DGQA 5E2WH 4Y19E 1DANU 1ZSDB 3SDXF 4F7CA 3JV6B 5E5MB 3LB6C 3SDCA 3LEVH 3EOAA 2JF1A 2YRLA 4MJIB 3BPLC 1LWRA 2R23A 1KCUH 3VRJA 4Z7WA 2ICEB 4U1GB 3SN6N 2HT2D 4JHWL 1YDPA 2D3VA 2YPKA 1FPTL 4G6ML 5E2VH 2AQ2A 3WXVH 5HHVH 3RWEA 3VFOA 4D9QE 1GHFL 3UJIL 3TO4A 2VSCA 5KS9E 1UG9A 5C07D 1IKNC 2X4TB 5E6IC 5E8NB 5DK2A 1A1MA 3L5XL 3MJ9H 5LGHH 4NUGL 5AWNH 1WCBB 1F2XK 5IKCA 3NZ8B 4XB7A 2DBLH 1F4YH 1FO0A 4YXKH 3U0PB 1QR1B 1FGVH 4KKAC 4O58H 1MRDH 2XNAB 5T1LA 3OZ9L 3GMRB 5D1ZB 3G6DH 4K3HA 4KUCD 3K4ZA 5IUSA 3UPAA 3G5YB 3NABH 4XC3H 3WE6A 5TE6L 1T1WB 3KXFE 3P4NB 4PRPB 3FHQA 1S7RA 1CLZL 3RTQC 3ZDYE 4Y5YA 3ETBF 2Y36H 4DZ8A 4N9GB 3WCYA 8CGTA 1MCWM 4PJXB 1D9KB 3HNSH 4MWFB 4RA0C 1NFDB 4WV1A 5ESVA 1TPXC 2DKUA 1Y18A 2DTMH 4JVPA 3HNTL 1MSPA 2ORBH 4Y2DD 3F7VB 3IS0X 5BJTB 4XHJD 3UO1H 5MP6L 1P9MC 2VDMH 1JWSA 2R0KH 1R3LB 1UACH 2DDQH 3B9KD 4NZUH 4PR5B 4JFEE 5FHBL 5HJ3A 1RUKL 3V5HA 4CVZA 1IILE 1VFAB 4LRIC 4HS8H 2NY2C 2PO6B 4PTTA 2ADGA 5BV7L 3S6CA 3GIVB 4BQ8A 5CZKA 5HHOB 3GSOA 1HSBA 2AXFB 5FO9B 3JWOL 1WZKA 4UT9H 3SDXB 2X4QB 4KI5D 3KLDA 5C8JA 2K9UA 1JNNL 5M95B 3PHOB 1FLTX 1YMHA 3X13A 1U8PA 4UQ3B 3OJVC 4JFFB 1GAFL 3LMJL 4UTAH 1RPQA 1DQDH 1JYVA 2BVPA 3TJHD 1IKFL 3LS5H 4IOIA 2YWZA 4J3XA 4PGEA 3MRKB 1NGQH 4EI5D 5E8DL 4P5KB 4FQ2H 2AV1A 5D7SL 4OD3L 4NZTL 4OFKA 3B6SB 3BE1H 4LCYA 3SDAA 3VGAC 1J10A 4JM4H 1T7XA 3GBML 4PGDA 1I8MA 2A2QT 4I8DA 1CFQB 4NO3A 3PWJB 3ELAT 1MHEA 3QG6B 3D3VD 2UWEE 3GSNH 3QAZB 1YC7A 2Z35A 4HIIA 1MQ8A 4M03A 4M61A 2NX5D 5DJ2A 4KQ3H 3KYMA 4HIHA 2X1PA 5C0AA 3GEWB 5GPRA 1MI5A 4P3CH 4Y4KD 4ZUTA 3WXWH 3LN4A 3RDTB 4F7TA 1OP3K 5FUZL 1M1SA 1T2JA 1T2QH 1T6VN 4J3UA 2Q86B 3KLHC 2GW5A 1CDJA 3IS1X 5E08L 4ZO6A 4F2MA 5L88H 4GW4B 4XP5H 3Q5TA 5GRVL 3C5ZB 2FZ3B 1RULH 5MERA 4O5LL 1CK0H 1NFIB 4FQXA 3FB5A 1CVSC 4U1LB 4HLZG 2OQJA 3MRJB 4WIQA 3U4EB 4QHUA 3MJ7B 2CK0H 1CZ8L 1K8IB 1FV1B 1AJ7L 3QUZB 1OSPH 2ZZUT 3PGCA 5FHAL 2FRGP 3PIQA 4UUJA 2IH1B 4TUKL 4H1LH 3R8BB 4LHUA 5LGJA 4LLMA 3BPNC 1UKTA 3J8F7 2CJUL 1BGXH 1I4FB 4K7PY 2VN7A 3BO8A 5DQ9A 3BGMA 1ZHLB 1UWGH 5I1EH 1MFBH 2X7LA 1JRHI 3G04A 3PWVB 1FN4B 2MQCA 3K2MC 4LCIH 2DS4A 4DOHE 4OT1H 5HD8C 4NUJB 3VDAA 3RNQA 1KEMH 4LLVA 2HKFL 5BRZB 4JR9L 1KLGB 1NAKL 2E3VA 4OUUB 2HTKC 4P4KB 2AXGA 3UJJH 1A4KA 1F6AB 3FTGA 5CBEB 4Z7QE 1LP9E 1S7UB 1F4XH 3TBWB 1G7HB 3DBXA 4YC2C 3TJEH 1NLDL 3CH1A 4BUGA 4ZUSA 5IR1A 1DQJA 4WFHE 3C08H 4KJWD 3MV8A 2FX7H 4OZIE 2NTFB 3SCMC 1X5KA 1I8LC 4QWWD 4HFWA 5DLML 2KQNA 4X80L 1ZWIB 1P5UA 4GW1A 1HWGB 1R5VA 1QSFB 3NFSH 5C0JB 3I2CL 4NQCD 2ZUTA 4ETQB 2W0FB 4ZOEA 3QEQE 4PB0H 2NY4D 1NKOA 3QFJB 3K3QA 4YDVA 1OP5K 4EN3A 4OB5H 2A6IB 2CKBB 4U1NB 1T80A 1A5FH 3FCTA 2AK4D 3CDCA 3ZE0E 2D4DA 1JI1A 3L6FA 3MLSL 4XXCA 1S7SA 4LLWA 1RUML 5I16A 1MLCB 3TWCL 3VFVB 2O93L 3TNMA 1BFTA 4ZTPH 3R4DA 5J89A 5HHXH 3IKCA 4ZFGH 4FQHA 3UROR 4ZO7A 4MXVF 1CICD 3FJTA 4ONGH 1GGBL 4F9LA 1K8DB 5E1AB 3SPVB 2R9HC 3CJJA 3ZYZA 1OVZA 1DFBL 4KROD 3VGFA 5IW1A 5KN5A 3O6MH 5FA3A 5ICXB 3MJ8A 3KYNA 1H3PL 4MD5A 2J88L 3QUMA 4MNHB 3HG1E 2W07A 4EDXB 1EXUB 1XCQB 4P2QE 2YRZA 2VAAB 3O9WD 1K5NA 4G7YL 3NIGF 2WANA 5I30L 4NN6B 3R8QA 4EDWH 4PJBF 4WWKD 4ZXBA 2LE9A 4BH8B 2VDNH 3JWDC 1LO5B 2P8PB 2XA3A 1A9EB 1PX3A 3ES6B 4KV5E 4OD1H 3VFRB 1TJGL 3EDEA 5AZEL 1FG2A 2OZ4H 1HHKA 4PB9H 3LY6A 1CFVL 5C0CB 1JNHB 2ATPB 4OZFG 1F3DH 4PRNA 2ATKA 4LLQA 4GG6A 1DEEA 5TFSH 5JOPD 3QUXB 2Z9TA 3PP4L 2ESVB 3BI9X 4IMLA 5D5MA 4XBEL 5A2JH 3RL2A 4N8CL 4FMKA 1FORL 3WUWA 4ODVL 4MQXC 2R15A 1JZ3A 4I3SH 3VCLA 3QIUA 4RFOH 1JK8B 2Z4QA 3H9ZA 4XVJH 1DQMH 2EIZA 3DLQR 1NC2B 3S5LB 1EUUA 1IQDB 4W6WB 5F44A 1WBXA 3BMWA 1A4JA 5HY9A 3SE8H 2LU4A 4PD4K 1JZ6A 3DXAB 1P4LA 4LARH 4S1RL 4OZGE 3STLA 3EFDL 3MCLH 5JHDA 4IOFD 1SVCP 3HI1A 1DVFA 2V7NA 4ZAKD 1LK2B 1U93A 4OKVB 1CI5A 5JUEL 3KAAA 4UMGA 1TZHB 4D94A 3T0ED 4MNQA 2NW2A 4KVCL 4NBXB 4PIRF 4Q58C 4DW2H 1VFMA 2BHZA 2XQBH 3MROA 2YC1B 4NGHH 4JZOB 2YMXL 1AC0A 5D72H 1RIUL 1GXEA 1INDL 2R69H 5GGVL 2E9BA 2ZUYA 3V6ZA 2W0PA 5IVOA 1I3UA 1Q94B 1OP3H 1CD1A 4YHIA 5L6YH 3PHQB 3T2PA 4L4TD 4LLUA 4QRPA 2EC8A 4MA7L 4PJBB 1I7ZB 5DHVB 3VW3L 4PP1C 3QHZH 5ID0A 4MHHI 1PYWB 2D7TH 1DBKH 2NY6C 3WMSA 3ZYJA 2BHUA 5E03A 5EO9B 1IRAY 3IJHA 5JLZB 1DUYA 1BJMA 1YQVH 4F15C 3MREA 3VXTA 1GPOH 4MQSB 1SM3L 4CKVX 3IDIA 5DS8A 3LKSB 1CL7I 4DVRL 1WAAA 1W8NA 2X40A 4MSWA 3LKRA 3B5TA 4R90L 4P2RB 1BF2A 4Q97A 4G8GA 3VXUA 1G9NL 5DMYA 3T1WA 1SBSH 4HKJB 1U58A 3RVWC 4Z9KB 1J1OH 3ZL4L 1BD2E 1QACA 2ZOKB 3SBWA 4X4XA 5CSBA 4C57C 3B2UC 1E4XI 4EUPB 2GAZB 2CRZA 1N4XL 4DTGL 3IDJA 3PWPD 5E99H 1WBYA 3D0VA 4R0LA 4Y4HC 3ZHDA 1FYTA 3B5HA 4HKBB 4Q6IA 3ECBB 3PABB 4U1SB 4B5EA 4FZEH 3K0WA 2RGSA 5IG7B 4PRBA 3PNWA 3L9RA 1JIBA 1LD9B 3MACH 2MHAB 2VH5L 4LVOC 3UJTL 1F8TL 2EO9A 3B8YA 1U2CA 4XNXL 4JFHE 5EUOA 5K9JL 4NQDE 5GS1B 3OXSA 2EDFA 5I15L 4X7DC 1QSED 1FNEA 4HH9A 5I1IL 4PRIE 4E5XB 4JREC 1CF8H 2G2RA 3FQWA 3MNVA 4RGNC 4PPTA 2HG5B 4Y7MA 1MAJA 4JLRB 3QXVA 4H26A 4M1CC 5TDPA 3MRLB 3NGBB 1A2YB 3IRPX 2EE9A 3GIZL 3N06B 5L2KE 3WDJA 1GH7A 2VE6A 3QO1A 3ULSB 4LPWA 1CE6B 1YEFH 5D1XA 2CH8A 4RMVA 1S78C 3WFHB 1NUDA 2WQ8A 4WDIA 1OP5H 4APQD 2ZCHL 1F4WH 5BQ7A 2BVYA 4Z76A 5JW4Q 2F54D 5I19L 1AY1H 3OKKA 4YHYC 2J5LB 4M6ML 3KPRE 1NCWL 4QNPE 2XKUA 2R2EA 4M7KL 3OF6A 4HKZB 3WSQH 1NBYB 3ARDC 2J6EA 4C56B 2IAND 4LIQE 5BVJB 2HWZL 4QY8B 3CU7A 2Q8AH 1GGYA 2VKWA 2PXYD 4K8RC 4PJGE 2AGJH 4DN4H 4QRSA 2UZYB 5BS0A 1N6QH 1LK3L 4F37K 5EA0L 1ADQA 1MJJB 3V4VH 3W0WE 1CDGA 4WU7B 3Q1SH 5FKAB 3QG7H 3TZVA 2F74A 5SWSB 1IC7H 1MOEA 2E7HA 1ZTXH 3O4LD 5IEKB 4M7LL 3PJSB 4XPGH 1Z6JT 4L3EE 1WUNT 4TULL 1FL6A 1IAKA 1NAMB 3NCMA 4NRZA 3JV0A 1OAKL 3PL6D 1U8KA 3LV3B 3KS0J 5DJ0A 4NC1E 5T1KD 1FIGH 4LASH 2E9IA 5EIIB 3LEXB 4L9DA 1UJ3A 2XZQL 4PJIF 3U4AA 1CXEA 4LQFH 1KJ3L 5I2IB 3LQAH 2Y5EA 5EDXA 5HHMB 3RVXD 1J0YA 2X9XA 1EGJH 2ED8A 3HCVB 4PY8J 5TPWL 4YXHH 5IMOA 1PGRB 4NT6B 1Y6KR 5J11C 2W9DL 3MLZL 4KRLB 4JFQA 3C6SA 1JJUA 3C8DA 1Z9MA 1KB9K 1PAMA 3SKNB 3ILQD 1IJ9A 5C09A 1O7VA 2APFA 5CP7A 4F33A 3T1FA 1YY8B 2BFVH 4AIZB 1IZKA 3FT4B 2R2HA 1U8JB 2D31B 3HS0A 5TF1L 1F3JA 2AV7A 3ZE1E 4QHLA 1DBAH 5KVEH 2WW8A 1DN0A 4Y5XB 5DURD 2XZAL 2AJVL 2A77L 3QWRA 2X4SA 3L7EB 1WFNA 2ADJB 5IQ7L 3AU1A 2BNQD 2JK5B 4I18B 3FFCE 5LBSL 1VGEL 4BZ1H 1C16A 3OJMB 3O8XC 4DCQA 3ZHKA 4X5XA 3HRZB 1HH6A 3MRFB 1QZ1A 3EHBC 1WZ1H 3QDAA 3MX0A 2DMBA 4FFWD 4LCCC 4C55A 2EDKA 2EICA 3HC4L 4PJ5D 4DGVH 1K6QH 2SEBA 2JLLA 5IFJA 1T3FA 3TPKA 3OKOB 1DL7L 4FABH 1MJUL 3BPOB 1QLRB 3GI9H 2KUTA 4XCFH 8FABB 4ONFH 3KPOA 3WD5H 3WFEH 3I6GA 5IHBA 1U8HA 2QQNL 4G43A 1N8ZA 2I9TB 5ACZA 4KVNH 3QQNA 3O6LH 4K7FA 3FOLA 3LKNB 4KRPC 4K3GA 3ZKND 3MA9H 1CGSL 1IC5L 4YFEA 1EV2E 5TDOB 4QXTA 2VABA 3AREC 5JORB 3TVMB 5EU5B 3O45A 3TT3H 3U46A 2X1OA 4PJIB 4YHKH 3T4YA 3VRIB 1GJIA 4OZHF 3AS3A 4BZ2L 1I9IL 2VLME 3RZCB 2VC2L 4JCLA 2WUBL 1A7NL 4FQJH 4F7MA 5EORL 2YEZB 3MCG1 4R7DA 5FUCC 4X9BA 5FO8A 5T3ZH 4KUCF 5DA4A 3L3HA 5I8OH 1JMXA 4NNPH 5F9WC 2NXZD 1T4KB 4ZUWA 3FN3A 4P2OB 5EU4B 1T21A 4Z7NE 1MF2H 3CPLA 3DI2B 1G9MC 5C3LD 3L3IB 1Q0YH 2OTUA 4RMRA 1FJ1A 4WTXA 4F7PB 2FHCA 3C2SA 1IM9D 1A3QA 4G9FD 1ND0B 4IJ3B 4ALAH 4LEOA 3KPMA 5J13B 5IVZA 1AGFB 1EO5A 4KJQD 3TN0B 1E4WL 4J3WA 4GKZA 5I76B 2E9JA 4TOYL 1G7LA 1JUFB 2VDLL 4TPRL 1IEBB 5IB4B 4P46B 3FRPA 3RWCA 5F89B 4Q7DA 4IMKC 4WY7H 2BNUA 3WN5A 1MCOL 4MAUH 4U7MA 3VWKB 5E00A 4GKOA 4WEBL 4LSQH 3VD4A 1A0QL 1B0GA 4NN7B 4OV5A 5ESAB 3A67H 5ICZB 5D1QB 3O6FD 1OTTC 3ARBA 2DN7A 4MAYB 3RBGA 1INEH 1I9JL 5EULV 4NDMB 4WI8A 4OGXH 4EXPX 5DMKA 3F7PC 1B0RB 1XGQA 1JPGA 4KI5F 1NL0H 4AMKL 3VXPA 1TCMA 1F45A 3ULUE 1N0XL 2I07B 2EDBA 4EIZC 3H3PL 1I1AA 1AO7D 1NGYA 5DQJA 5HYEA 3CX5K 4LHJB 1S7WB 3IDMA 3U7WH 1UT9A 4RISH 4TUOA 1MUJA 1BFOB 1NEUA 5INDA 2EDYA 4KQ4H 3F65A 1TVDA 3ZSSA 3AS2A 4DUWA 3DVNA 3MRRB 5DD3H 3HZYA 2CKBL 1W0VB 3S96B 3O3EA 5C07B 5EN2B 2A83A 3SEPA 4M4PA 3DUSA 3GB7A 3FQXB 4OZHB 1P5VA 2EIEA 5C2BH 3K2UH 3FO9B 3LD8C 4FXKA 5FA4B 1YZZA 3QI9C 1X5ZA 3U7YH 5IHLB 4XCEA 4XMLL 2XFXB 3OKLA 2R4SL 4NC1C 2OJZL 4ZYKA 2IEPA 3LQMA 1J1XL 4NC2B 5JXEC 4JY5L 2EYTA 1R0AH 3BP6B 1M7IB 4MJ6B 3U30C 1R3JB 1EHLH 4AK1A 4KKAD 4ZPTB 1RI8A 2IALB 3UC0L 1XGYH 3UMTA 5EZOH 5F71A 5DZNA 5C0AE 3QCUL 1RHHA 1KCVL 2DI7A 4N5UA 1MI5E 4X8JB 1NCAL 5DR5H 2WWKO 2DQHH 5IBUG 3KDMB 4YO0A 3GJEA 3MRGB 2VAJA 3RTQD 4I9WE 4TSAH 4Y2DB 3BP4A 3FB7A 5D70L 3MUZ1 1OGTA 2WZPD 4P59H 5HDQL 1FH5H 3LKOB 3B9KB 5GGRB 4JO1L 4NKDB 1ZT1B 3JZ7A 5L0QB 5DMIL 2XTJC 2H41A 3K1KC 4I4WB 5T5FL 4NM8H 1H3VA 1S7QB 5J9PA 2XZZA 4FXLA 3GSVA 4FOMA 3QISA 4I48B 1G7PA 4LSUL 4PJDF 4BFIA 1U8MA 3AMKA 4K07A 4UAOB 3VFNB 5J12B 2P5WA 1I1YB 4JVWA 4R2GC 2CLVB 2QADD 1TCRB 5J1SC 1S9YA 4YFLF 4Z95L 1H5BC 4KZEL 4H88H 3DNKA 1P53A 4X4MA 3IJSB 4X7FC 3PUCA 4PGBB 5D93B 1I3GL 1MELA 1J0KA 4ONOA 1A21A 3BP7B 1AR2A 1DDHA 1AE6H 4Q9RL 1A7PH 2V2WB 4XMPH 4GQ9L 1QUNA 1S9WB 2VRAA 1CD9B 1Q9LB 2ENYA 3SDCC 1E27A 4BSVB 1B2WL 4QRRD 1RZJC 1BBJB 3CFEB 4EI5B 4LPXA 4HIEB 3ORJA 1GVIA 3P9LA 3TO2B 2CLZB 2MKWA 3RI5F 3DX6A 4MD4B 2DM7A 3MV8E 4Q0XL 5SX4I 2V5YA 2UUDH 5GS2H 3QZWG 4TUJB 1W72B 3D3VB 2X4PA 1A6AA 4QTHA 4XP1L 3TCLB 2EO1A 1TTUA 1M7DB 2NX5B 5C08D 4RMWA 43CAA 4OLXL 3DYMA 4X0KA 12E8L 1KN2L 3MV7D 4QRUB 2O61B 2D7QA 1U8LB 3LKQB 1FE8H 2XWJB 4QCIA 4Y4KB 1KC5H 3BSZL 1IGCL 5DEFB 3VFTA 1U41A 1V5JA 5DYOA 2NCMA 4I0KA 5GGVY 2DD8L 2H32H 3U48A 5GRVK 3TBSB 4UU9B 1R24B 3SKMB 1DBJH 1LE9A 1J88A 4NFBA 3EDJA 5K9KB 3MFFA 4CDGC 4KJYB 2YPLD 3B5GA 4Y5YC 4AZ8A 5B39A 3W5MA 4PJFF 5IEHA 4GBXA 3MCKB 3V0WH 4KDVA 3DSFL 5I71C 4WV1C 2X42A 3MLYH 1FP5A 1QBAA 5FUOL 3EOBB 1RV6X 3LIZL 4PJDB 4NZRH 2FEEL 3ZDZF 3EYQC 5JOEA 1NC4A 3MRNA 5SWZA 4HUXB 4N0FB 4UOW1 2VDKH 1B90A 1G7QA 3IXAA 3RIAK 5BVPL 4WFED 1NEZA 3BWAA 2FATL 1G7JA 4F8TA 2FYYB 2IQ9H 4K23H 3WHE0 3QEHA 5IVXF 4V1DA 5EFIA 1I7UA 5D7KD 2DQEL 4YR6B 2QSCL 1Z9OA 5IV2B 1J1PL 3B83A 1OAXL 3P4LA 3I85A 3ULUC 3FB6A 2X89D 1FC2D 3VXNA 1GZPB 4WHCA 2CD0A 3RIFK 5GRXG 1HHHB 4HWZA 3BAEH 4D0DA 3BZEB 3T2NL 2CXKA 3HI5H 2DQCL 4GG6E 3KPQB 5IGXH 1G7IA 4K8RH 4EXKA 4Y16D 4B41A 5T3ZD 3FOMB 5JDJA 2Z31A 4YHNA 2CLRB 3MLTA 5D5ME 4NQCB 1X4ZA 2ADIB 3UZQA 4D9QD 1OGAA 3MBXH 4L4VD 3SCMD 2A6KA 2NY4B 1KIRA 5DFVD 5FIEA 4LCWD 2DKMA 1HKLL 2IPUG 4FTVA 1S5IL 3PP3K 1JZ5A 3E0GA 4ODXA 4LKCB 3B8SA 1CLYH 3JV5A 1FZJB 2MCPH 1A6WH 5SV4A 4JZJA 5H35A 5D7JA 2AK4B 5FYKH 1JGEA 4TYUA 1JGVL 2ITCA 2F58L 5F72S 3M8OL 1CE1L 2YR3A 4PJFB 3EYUH 4G80A 1KELL 5JHDE 4NJ9L 4L8SC 1MAML 4U6TA 2Q6WB 3QXAA 3MRCB 4YDLC 1ITBB 1BJ1H 1CICB 4JPKL 3QT2A 3O3AA 4PGZA 2NW3B 3HE6C 3ZLQC 4MNQE 2UY7A 2C1PA 1P1ZB 1T5XA 3QPXH 2DQFA 4KROB 4YZFE 4O02L 4X7TA 2QR0A 2YD7A 3GFUA 1AGBB 4FQXC 2R29H 3GSXA 1E4KC 2W60A 1DLHA 3TFKD 3O9WB 4JFPB 4LVHB 3BHBA 3MXWH 1IGJA 3OPZH 1NAML 4GRLD 1MCCA 4MMZC 2IAMD 3PF2A 4Q9QH 3LRSA 4WWKB 5IVXB 4QRPE 3A6BH 1T1XA 4OBSA 1T0PB 1IEAA 1B4JH 3CCHA 4K9EL 3M07A 4U0RB 4X4YA 3S8WA 1TTFA 1S7TA 4U05A 4XH2B 3P4OA 5JO5B 1ZK9A 4PY7A 2WNGA 6FABL 1P69B 5E6ZA 5FECA 1FRGH 1YYML 4RFEA 1MHHA 3BQUA 5I1CH 4YK4B 1M71B 1J5OL 1C08A 5F7UA 1X5JA 1ZA6B 3S88H 1LQSR 1RZ7L 4QT5A 3U0WL 1KJMA 3LEYH 1WAAE 1CGTA 3V8CA 2I60L 3L3KB 4G8GE 3VXUE 5EOCL 5HVFB 5E9DA 1KPRB 2ZSWB 3CFCL 2HJLA 4HXBL 2VDQL 2VSDA 3PWNB 1UEYA 4NSKA 1R5WB 3RX8A 1W8OA 2JB6A 5A16B 1N5AB 1WFOA 1J9CT 5D6CA 1ITCA 3C6LC 4M43H 4NNXA 4XMKH 3WO4C 3WFBL 4F58L 1CIDA 4O4YH 4R96A 1CG9A 2IG2H 3I3EA 5EC1A 1BQSA 1JGDA 2CIIB 4GW5B 1FYTE 1IGFH 4K71B 3ZTNL 3IETA 1VKXB 2VQTA 4C4KO 4NO0D 3F6LA 1AGDB 1MFDH 3GKZA 2FEEI 3DRTB 3IFOB 1YEJH 1LEGA 1SY6H 4HX1A 3ILPA 1I8KB 2JJTA 5CJQH 5EUOE 4ZAKB 4Y1AD 2HKHL 4XP6H 2HT4D 4PREA 2N1KA 3T0EB 2Z93B 3QDJD 2AP2A 1JWUB 1AD9B 1JL8A 4OGYL 2N7AA 2YD8A 5JXAL 4M1DL 5DJXA 4AH2A 4MXWH 1CS6A 1N5YL 1ZGLB 1N3NA 3HPJB 1MLBB 1ZKAA 3U4BL 4D9RE 1YYLH 4JRYB 4I3RH 3I75A 5I1HL 2BXYA 2ZUQC 3RP1A 1MEXL 4HF5L 1JF1A 1V05A 4U3CA 4K3JL 1X3DA 2DJSA 3GSRA 4C83A 4NOBA 1DN2A 1G9MH 1IAIL 1F2QA 5AUMB 1ZSDA 4L4TB 5J56B 3O11B 1GOHA 3JV6A 5E5MA 1B88A 5D7IE 2P4AB 4KK8C 2A0LC 4LSRL 4QEGA 4MJIA 3VRLF 3E6FB 4BFBD 4CN1A 1J0IA 5E2TH 4FS0A 4JPIB 4RMTA 1H15B 1AGEB 5EU6D 3MNZA 3KHQA 2OCFD 5ENWB 1GGTA 2ICEA 1OOAA 3SQBA 4YHML 4OAWA 4HLZH 4OLZL 3WDIA 4PRDA 2Q20A 1UM4L 4LDOB 3C9NB 4ZXBC 4CW1B 3WKNA 3Q3GB 1Q9WA 5BS0E 2X4TA 3WO3B 3EO1B 5E8NA 5IMLA 1MCHA 5CD5D 1MCRA 1WCBA 1XMWA 4HFUL 5GS2D 3UBXI 1NQBA 3PGFH 4NFDA 5HI4D 1KCRL 1QR1A 3GSNB 4OCNC 4YAQB 1QRKA 2XNAA 4U1KB 3GMRA 2OM5A 5D1ZA 3RVWD 2DLEA 3PWPB 1NMAL 3D85D 4FFVC 4R8WL 4JVUA 4LIQH 4M62L 5IHUL 4UILH 5I18H 2EDDA 3ZKQD 1T1WA 3P4NA 1EHXA 3K8KA 3QR2A 3B2UD 3S7GA 2FGWH 4TSCL 5IB2B 2DLIA 3V7AE 5I6XC 5L8JB 4N9GA 1YNKH 5BZDB 3HC0B 4PJXA 1ZLWH 1D9KA 3UX9B 4MWFA 1NFDA 4GO6B 4O9HH 4AY0A 4MHHG 1II4E 3F7VA 2BZDA 2J8UF 5DTFB 5BJTA 1QSEB 1ZVSB 3ZDXE 3JV4B 5IJKC 2W92A 2H2SC 2VB5A 3GNMH 4M5ZH 1R3LA 4PR5A 5B38B 4HS6B 1UKSA 4MLIA 1VFAA 2V7HB 4HUMB 2XRAH 5CS7A 3ARUA 3P30L 1QHOA 1A7OH 3DTXB 4JDVB 2PO6A 5C09E 1OAZL 1V3JA 2AAVA 5JDSB 5KSAD 3GIVA 4HZLB 5F70A 1O7SA 1DVFC 4RGND 1MREL 4H1LB 4DAGL 4K3EL 5HHOA 4M1CD 2AXFA 5FO9A 4OIAA 4APQB 5ESQB 3SE3A 3SDXA 2X4QA 5HHNA 2F54B 2HFEB 2FB4H 2BY0A 2XZCL 2O5XL 4AT6B 5E95B 3WNMA 1RZFL 1P4IL 1FZMB 1KIPB 3PHOA 5F7NC 1S78D 4UQ3A 3RY5A 4JFFA 3QCVH 4R97C 4M4RA 2JJVA 3HPLB 2IANB 4HS3B 4M7LT 3QDMD 5LAXA 4PG9B 3HG1D 3IXTB 2J8OA 2PXYB 4X6DF 3VE0B 3ARDD 3MRKA 3QO0B 1EFXD 4DKEL 2YKLL 3S34H 4P5KA 1EO8L 2OP4H 5FYLD 4ODTL 2LVEA 5CJOL 5DEZA 4K8RD 2ZJSH 3O4LB 3WNLA 4YDKH 1P2CB 3AUVA 3UYRH 1TJHL 2YK1H 4L29B 1IQWH 1CFQA 1V8HA 2DOCA 5AD0B 3PWJA 2WP3O 4MDIB 3QG6A 3PL6B 1C5BH 4P48A 3FN0L 5F7LB 5BMFL 3RVVC 1PD6A 1ZT4B 2NY0C 3QWQB 3VH8G 4M7ZB 1H3GA 4NRXB 2XXCB 5LXGL 3CH8A 5CP3H 5EZJB 1QFWL 4KRMB 5I1KL 4TRPH 5FYKD 4WHTB 3RGHA 2R8SL 4NO5B 3H8NA 35C8L 1XAUA 5DQDL 3IAPA 2J8UB 5ADOL 1LO2H 4OZFH 4GW4A 3V6FB 2N7BA 4U0QB 1VEMA 5CKGA 1RZ8B 3C5ZA 3PQYA 4ZG1A 5DK3A 2OK0L 1NFIA 3O6KH 4MQ7B 4U1LA 3E3QE 3N85L 4MXQC 3MRJA 3U4EA 1IFHH 3SJVD 3SY0B 4K2UH 2RCSL 4FFZL 1RURH 3MJ7A 3NACH 1K8IA 1FV1A 2HVJB 3GJFH 3L5HA 4HT1H 2V17L 5I9QC 3RPKA 5DURB 1DQTA 1IGML 1RIVL 2VZOA 4ZFZB 3OHXB 3MV01 2QHRH 1B4RA 5EO0B 3GHEL 3QEGL 1I4FA 4LF3B 4LOUC 1ZHLA 5IESL 2X09A 2P8MB 1ED3B 3PWVA 1FN4A 1TZIB 4G42A 3RVTC 1WV7T 5I1JH 4NUJA 4QXUH 5DC4B 3HE7C 4DZBB 3LQZB 4X6DB 1AR1D 1JMZA 1KLGA 4XWGL 5FKPB 2XKNB 3ARGB 2IWGA 4OUUA 4P4KA 4PJ5B 4JG0L 4OLVH 4P5TB 1F6AA 2HTLD 3O8XD 5CBEA 1S7UA 3TBWA 4GXUM 1G7HA 2IBZX 4F9PA 1CN4A 3C60B 5GS0C 1W72L 4M6OL 3ROLB 4LL9A 3B3IA 2ZUUA 3QUYC 3OKMB 1HHGB 4R4FH 3ARSA 4YEEA 2NYYC 2NTFA 1NJ9B 4HEPG 4ZD3L 3AS0A 4G3YL 4JJHA 2WLZA 1NKRA 4TVPE 2ZSVB 1I9RL 1ZWIA 2WSKA 5TQ2H 1QSFA 1DQLH 5C0JA 3V6BR 1QBBA 4RGOH 4ETQA 2W0FA 1EBPA 4H8WC 4XNYL 5E4EC 2FJGB 1MIEL 2BVTA 4MA8L 4ZOBA 1FLRH 2C3WA 3MUGB 3QFJA 3LPGA 4CUCA 1REIA 5FGRA 2DKSA 1VCAA 3ZKMC 1L7IH 4UB0L 1URLA 1MFCH 2A6IA 2CKBA 2L7UA 4U1NA 2X9YA 3CX2A 3ALXA 4KK6D 4OTXH 1Q72H 3ARED 5EC2B 1CCZA 1PW3A 5DUPH 1KB9J 4XGZB 4MYWB 4WO4B 1MLCA 1X6NA 3LAFA 4JQIH 1R3IH 1QO3B 2NXZB 1C5CH 5DJCB 3O41B 4FQCL 3ZE2F 3GK8L 3W39B 5B3JF 1CXLA 3MV9D 2P42B 5F96L 1K8DA 4IS6B 4U3HA 4Y89A 3H9SD 5E1AA 1T20B 1IM9B 4G9FB 1P4BH 5ICXA 4M8VA 3QXTA 1UZ8B 4X7CC 4OF8A 2H26B 4MNHA 4NQDD 4EDXA 4DFIA 1EXUA 4MCZB 5INCA 4JPVL 3E8UL 1A6UL 2VAAA 2VLRD 4Z7OF 1WF5A 4M3JA 4JKLA 5I1GL 2WBJC 2PN5A 2DLFL 1YEIL 5C92A 3RZWA 3REWB 3SDYH 2BMKB 1QVOB 2XWBB 2BNRD 4BH8A 4EBQH 4H0GA 5HYJD 1HH9B 1LO5A 2P8PA 3KJ4B 1A9EA 4EKXA 3ES6A 3O6FB 3VFRA 2DQGL 2P5WE 1M6OB 1ZLSH 5KJRL 4LAJH 5C0CA 1JNHA 2ATPA 1P84K 3GMPB 4PYGA 3BOVA 1OTTD 2B8OT 1QFWI 1EJOH 3QUXA 4X4ME 3OTTA 5HDLA 4UT7L 2B5IC 2A1WL 2ESVA 3RPIB 3KPSD 2P44B 2BX5A 3QQ9C 3BPLB 3X3GH 2VR4A 3PWLB 5F3HB 3FT2B 1QFUH 3BZ4B 1FFPB 2WINB 4QXGL 4MDJB 3G5ZB 1JK8A 4GMTL 4KKBC 4G7VL 5DD1H 5A3IC 1MCEA 3F6IA 1NC2A 3S5LA 2PTTB 1IQDA 1LO4L 2DMCA 2I26N 3MLVH 4HBQA 2DRUA 2C4FU 2BVEA 1Z0MA 3H9YA 3NCEB 4OCSH 1DCLA 3DXAA 2KL6A 2H1PH 3NIFE 5I0DA 3DI3B 3WHE1 5EO1B 1QOKA 5E2WL 3S4SG 4PLJC 4S10A 1LK2A 3I6LE 4OKVA 3W11D 2J12B 1UVQB 4M48H 1TZHA 2K3TA 2RHEA 4XVSH 2Y07L 3LEVL 4Y5VA 5JXED 4XP9H 2YC1A 1NANH 1RZIB 2D03H 1CFNA 2BSRB 4JZOA 1KCUL 1HSAB 2D9CA 3JWNC 3RTQB 1K85A 3E3QC 1RY7B 5CHNB 2VXUH 1Q94A 4HUWB 5E2VL 1QRND 3WXVL 5HHVL 1TPXB 3T65B 3QNYA 3PHQA 3OR7A 3W9EB 1I7ZA 5DHVA 5K59F 1PYWA 5LGHL 2E6PA 1U6AH 3PWUB 4RNRB 4GMSH 5AWNL 3JVGC 5L8LB 15C8H 1F4YL 2R1YB 5IROC 1NGZB 4YXKL 3VXRD 2XTJD 5JLZA 1T0MB 3DURB 4O58L 4LBEB 5I8EB 1MRDL 5SWZE 5JPMA 2QEJA 3DX8B 3G6DL 4EOWH 4TTDC 2QADB 2YWYA 4ERSH 5HGHB 3LKSA 3QDGD 1Y6NR 3CX5J 3NABL 4XC3L 4P49A 4PGJA 4P2RA 3LPWA 2CDFB 4GS7C 4XBGB 3WIIL 4HKJA 2G5RA 4R2GD 4MD0B 1RUAH 3FFCD 1QBMH 2ZOKA 4V1DE 1ZMYA 2HRPH 3HNSL 3OGCB 2YUVA 4EUPA 2GAZA 2DTML 5BV7C 2ORBL 1NDGB 5DT1L 4QRRB 1A47A 2HFGH 2NXYC 4P2CG 3UO1L 1I1AC 1FFNB 3QUMH 3LZFH 2R0KL 4HKBA 2YZ1A 1HEZB 4NZUL 2DDQL 1KLUA 1EAPB 3JWOC 3ECBA 1FGNH 3SDCD 3PABA 4PJ8D 4YFLI 3SE9H 5IG7A 4OI9A 4JFDD 1W0WB 1LD9A 5JA8B 4O51B 3T3ME 1BWWA 5DJ8B 2CSPA 3VGAB 1BZ9B 1INQB 5GS1A 1TNNA 1RJLB 1V3KA 3D39D 4KMQA 5JOFB 5C08B 3CLEH 3V4PH 4E5XA 1QPXA 1OGAE 4UT9L 3DHJA 3MV7B 2NNAA 3L3JB 2HG5A 4WTZA 1IAMA 3EYVB 2I9LB 2GUOA 3JSSA 4FTVE 4R4ND 2NY1C 3ZO0A 3VDCA 2XN9D 1ZEAH 3ME0A 5C0BD 2HT3C 3MBED 1WWBX 3D25B 3ULSA 1CE6A 4P3DB 3BZFB 5TDNB 1AFVH 1ACZA 1HQRB 2YPLB 5FK9B 3WFHA 2F5AH 3LS5L 5T3XH 4S11A 2JB5H 1NGQL 3AXLB 3GMMB 4NQED 3D2UA 2NTSP 4HKZA 3BE1L 1NBYA 4LKXB 3RWFA 3U2SB 2HLFD 4JM4L 4C56A 2YUXA 5IB5B 5TH2B 4HUNB 1IL1B 1C1EH 5FGCB 4QY8A 2X4NB 3MLRH 3WLBB 2C4FT 1EJ6A 3ZZ1A 4QXWA 4I2XB 5IQ9B 3GSNL 1JZ2A 1KCSH 2Q3ZA 4DGYH 4ONHB 3H2WA 3C5SB 1BQHG 1MJJA 4KQ3L 2MKLC 4H25B 3BN3B 4WU7A 5FKAA 3RWJB 5SWSA 3VFGH 5IEKA 1QR4A 4J12A 4P3CL 3PJSA 4RQQB 3G6JF 3WXWL 1T2QL 4RFNB 5J06A 2F53D 1RJYB 3HMXH 1FCCA 1NAMA 3QFDB 1MCWW 1MQKH 4UZGA 4ELKB 4PY8I 5L88L 2LV4A 3WYRA 4XP5L 1JE6A 3LV3A 5KVGH 1RULL 2W65B 1CK0L 2UZXB 4HSQA 3RHWK 5EIIA 1MCPH 3LEXA 4HZAA 5KOMC 2X4OB 1SQ2N 4IRSA 2CO6B 5EH1A 5I2IA 2CK0L 4Y16B 4YC2B 2IQAB 4XPAH 4KDTA 5E9DE 5HVHC 4NPYB 1CDYA 5FM4A 4H0HB 2CIKB 1OSPL 3HCVA 3P3YA 4EI6A 1G7MA 5J8OA 1UCTA 4NT6A 4L4VB 3SCMB 4DKDC 4LCWB 3SKNA 2FWOA 1BGXL 2KBGA 4MS8D 4OF7A 1GC1H 1YY8A 2VITB 3SOBH 4AIZA 1GZQB 1F58H 1UWGL 5I1EL 3FT4A 1MFBL 1U42A 1U8JA 1EBAA 2XY2A 4JQXC 3ROOB 4LCIL 3QXUA 4OT1L 2RAMA 2XKSA 4DKFL 1KEML 2UV3A 3QA3B 1MJ8H 3QRFM 4Y5XA 4BA8A 4UIKH 2UWEF 3D18B 3KXFB 1CDCA 4JG1L 3VI3E 1MPAH 3L7EA 1U3HC 3UJJL 4CVXB 2ADJA 2O26U 1F4XL 1PZ5B 2JK5A 3TJEL 1F90H 4GG8B 4OCRH 3KYOB 2BRRH 3C08L 2FX7L 1A14H 2C4XA 2K7PA 5A43C 4N0CD 4D8PB 2X1XR 1GOFA 3HRZA 3MRFA 4ORZC 3INUH 3HE6D 4GBXC 4P0DA 2OS7A 1UH2A 3NFSL 2FX8H 3H7LA 1DE4B 5HYSG 4GRLB 4PB0L 3OKOA 1AXSB 1KTRL 1QLRA 2P5EA 8FABA 3I02B 3G6JB 4JKPL 4HIJB 4OB5L 2FIRT 3CUPB 4UT6H 2I9TA 1A5FL 1KYOJ 4X6CF 4WUUD 1SVZA 3IU3B 3LKNA 4YPGA 4LSSH 3T0WA 4ZTPL 5TDOA 3P0VH 4FQLH 5HHXL 5JORA 5GGRY 3TVMA 4ZFGL 5EU5A 4AENB 1Z2KA 4PJIA 3G9VA 5FFLA 1KXVC 3UTPE 4ONGL 4PRPD 2ADFH 1R3KB 3RY6A 1Y0LB 3RZCA 3O6ML 1T89A 4HV8B 1A6ZB 4J4PD 3HI6H 2Q8BH 3RFZC 4RBPK 3EJZC 5EU4A 4P2OA 2GJ6D 2OXGA 4Z7QF 4D9LH 2VLKA 1MHCB 4R3SB 4WHYG 5KG9A 4EDWL 2NY3C 3L3IA 1I3RB 4NO0B 3C6LD 4G6JH 4YHZH 4OZIF 4HG4J 1K3ZA 3V6OA 3T77B 4S1SH 1TNMA 4PJXE 4H8WH 1ND0A 1NFDE 5DVLA 5D96C 3BVNB 3J7HA 2UWEB 2YXFA 2YHGA 1AGFA 3QIBC 4OD1L 3TN0A 5IHZB 4Y1AB 5I76A 4I77H 1DZBA 2OZ4L 3W2DH 2E27H 1JUFA 4PB9L 1IEBA 4P46A 3QDJB 1I7TB 2W59A 4G8FB 5F89A 3TYGH 5D7JC 1NBQA 4R9HA 3M17B 1YEDB 3VWKA 5KVFH 4PRAB 5FDWB 5GRZA 3Q0HA 4YWGL 1ETZB 1U3ZA 1F97A 2R0LL 5ESAA 1BFVH 5ICZA 5D1QA 4JE4B 5HHOE 1BJ8A 4NDMA 3FHAA 4E42B 4CBPA 1B0RA 2VL4A 4I3SL 4RFOL 1WWAX 3MC0A 3SDXE 3W5NA 3LN5B 4XVJL 1DQML 1NBVH 1OTUD 3C2AH 3KPLA 4G9DB 5IMKB 5EU6B 5K33A 3UPCA 2UZIH 1S7WA 4YHPB 4JFFE 3SE8L 1EZVY 1BFOA 4QHNB 3GBNH 3AROA 4X6CB 5HGGS 3VDBA 1YY9C 4LARL 3MRRA 3MCLL 1W0VA 3OXRB 3HR5B 5DD5H 3S96A 5C07A 5EN2A 4F15B 2APWA 4L1HA 4IRJD 3FQXA 4MCYB 4QHMB 4OZHA 3U82B 5I74C 3RKDC 3FO9A 5FA4A 3MNWB 4DW2L 5F93C 4NGHL 2CXGA 2XFXA 5D72L 3C8HA 1MCFA 3EDDA 2R69L 3D85B 3WS6A 3BP6A 1M7IA 3RDTD 1R3JA 3RX5A 4HWBL 1J05B 3HHRB 2DI9A 4F8QA 3ARPA 4ZPTA 2IALA 5L6YL 1XGUB 2H32B 3QHZL 4OZIB 2D7TL 1DBKL 3KDMA 4FZ8H 1K3IA 3MRGA 3NTCH 2V5MA 2DM3A 4WFFE 4CJ0A 1ORSB 4Y2DA 2M8XA 1YQVL 4GRMB 5T3XD 5HTSA 1GPOL 3C87A 3FO0L 3L95B 4LVOB 3MOAH 4QF1B 1CGVA 1OAQH 2BJMH 1I75A 3B9KA 3LKOA 3PQYE 4IOSD 5DC0A 5GGRA 5I1LB 4NKDA 1ZT1A 3QUZD 5HGDB 3RL1B 3GZKA 4LAQH 2PNDA 4Y4FC 1RAMA 1S7QA 1ZXQA 1SBSL 3QEUB 5C1MB 5KSAB 1J1OL 4I48A 2H2SD 5F97E 3IFPB 2VQUA 1YQ2A 4RGNB 4LRNH 3ZTJG 1RJCA 3VFNA 3AAZB 2GSIB 2Y1VA 4NZJA 1C8PA 4ZPVB 2CLVA 3UBXG 2VMFA 1TCRA 2CK2A 5CCKH 1XIWC 1SMOA 2GITB 2ZKHH 1VPOH 1U91B 4HWNA 5ACMA 4KY1H 1JRHH 2ARJQ 4FZEL 5EZLB 3BP7A 1QLFB 3MACL 5F3BB 4YHYB 3BISA 2V2WA 5DJAA 3HG1B 2N4IA 1S9WA 1Q9LA 3ARDB 4JDZB 4BSVA 3IFNH 2VYRE 1EFXB 3OWEA 1BBJA 3CFEA 4ZS7H 2Z92B 3X14B 4U6VH 4EI5A 1TVHA 4HIEA 5GQBA 5GRUH 4D0BB 1CF8L 1CGUA 4A2MA 3TO2A 1NCTA 2CLZA 4U1GC 2HMID 4MD4A 4M5YH 5A2IH 1G1YA 2VZVA 3MJ6A 1KXTB 5D6DA 3I3DA 4MLSA 5C3TA 2HN7B 3T3PE 4PUBH 2ID5A 1VHPA 4ZO8A 2GCYB 2X4UB 4TUJA 5E8OB 1W72A 2DIAA 3D3VA 4X9IA 1YEFL 5GZNC 3MA7B 3TCLA 1QSFE 5EUKB 2NX5A 2VJXA 5T1DH 1LO0H 1F4WL 1H8OA 2BHYA 4QRUA 4XCNB 5F1NB 2O61A 1U8LA 1AY1L 3MOBH 4NBZB 4Y4KA 3QFJE 2UVFA 3GI8H 5BV7H 2B1HH 5D1ZC 3RVVD 5DEFA 4NN5B 3WSQL 5B8CA 2OR7A 1KIUA 2NY0D 5CMAB 4LDEB 4UU9A 1R24A 3SKMA 1ZV5A 3OAZK 4ZFOB 5LCVL 1CWVA 5K9KA 4KJPD 4TVPH 3OKDB 2YPVH 4NP4L 4CMMB 1AKJD 2XI9A 4GRWH 3WIHH 4WU5B 2AGJL 2LU7A 3BT2H 4DN4L 3MCKA 1N6QL 4KMTH 1NFKA 1KNOB 5A2KH 2D0GA 3K4AA 3E6HA 2PCPB 3V4VL 5MHSE 3GM8A 5J11B 3EOBA 3Q1SL 3QG7L 1NCCH 4PJDA 4RBPH 4XP4H 1E6OH 1H3XA 5T1MB 1ZTXL 2VR9A 3OR6B 3DX9B 3EAKA 2BSSB 4MXQD 4XPGL 4PTUB 2F5BH 4J8RB 4HUXA 4WTWA 5C71A 2YSSB 3K74B 4N0FA 1ONQB 3VWJC 1JYNA 2QSVA 2NLJB 2OR9H 5K9QI 1UQSB 3THMH 3NFNB 2IFGA 2PO6C 4ISVB 5DJDB 4JO3L 2FYYA 1FIGL 4KHTH 4LASL 5MEOB 3CD4A 1PEWA 3GM0A 2W91A 3O2WH 4YR6A 5T33H 1DSFL 3FT3A 4LQFL 3UAJC 5IV2A 4HPOL 3LQAL 3SE3C 4LOUD 4QOKD 3GMQB 1ZVYA 1T7WA 1GZPA 1EGJL 3NCYP 3O8XB 4YXHL 3RVTD 3Q5OA 3U9UB 3HE7D 1SMAA 5C0CE 3VD9A 1FHGA 3QRGL 3RIAF 3BZEA 2AS5M 4LCCB 2XYCA 5LWYH 5I0ZA 2BFVL 2ZUVA 2VDRH 4U1JB 1C7SA 2GSGB 2QTEA 3U1SH 3FOMA 1DBAL 2CLRA 2Z8RA 2ESVE 3QUYD 5KVEL 4NQCA 2ADIA 1EEQA 2NYYD 1LILA 3O4OB 1MWAH 4HWEH 3H3BC 1A6VH 2B4CC 1AQKH 3OMZA 3RIFF 4XZUB 4LKCA 4CRPA 4BZ1L 1BZQK 4BFGA 1TTGA 4V2CB 2AK4A 3AREB 1JPFB 1MHPH 5CWSB 3DXAE 3STBA 1IAIM 4X9GA 1CYGA 1VFUA 1WZ1L 3ZKMD 3O81A 4ZS6D 4PJFA 1TXKA 1TMCB 4DGVL 1K6QL 2Q6WA 3MRCA 4D2NA 4JN1H 1RMFH 3MV9B 2IGFL 2ZCLH 4NNYB 5ALBH 4A6YH 1X5YA 4FABL 2NW3A 3H9SB 1P1ZA 1T1ZB 3GI9L 4NFCA 4Z5RB 5C7XH 5CSGA 3VGDA 5ALCH 1MVUB 4ONFL 1QP1A 3WD5L 3WFEL 5F7HA 1AGBA 2RIKA 2WWKT 1CFBA 4NQDB 4GH7B 1T04B 4KVNL 2HLAB 2VLRB 3O6LL 3O9WA 4JFPA 3BWUC 1TIUA 1CT8A 3MA9L 3NIGE 1EPFA 5JZ7C 5DO2C 1ZHBA 4WWKA 2WV3A 2XQYK 3RI5K 2P48B 3TT3L 5J1TC 4YHKL 2BNRB 5CSZB 1WC7B 4XH2A 2WBJD 5HYJB 4OLWH 3SGKC 3UDWA 5F7EL 5JO5A 3QJHB 4X80H 4LK4A 3IDUA 4FQJL 3EZJB 3I2CH 1M71A 4OIIH 5T3ZL 1ZA6A 1CL7H 4NNPL 4GAJL 5KANI 3NCBB 2QQKL 3U9PH 4ESKA 5DK0B 4LVNC 4PV8B 2EECA 1MF2L 4P2RE 1FC1A 3L3KA 4M00A 4L5FH 1KPRA 1Q0YL 2ZSWA 2QLVB 3AFLA 1NH6A 4RMUA 1ZVHA 4P4KC 4HJGB 1E4XH 1R5WA 5C0ND 4F9PC 4ALAL 1X6LA 3BIAX 5L7XH 5A16A 4RAUA 2YD6A 4N9OB 5FOJA 5ABDE 3QQ9D 1HILB 3BD4A 1PBYA 3ZT7A 2CIIA 4LSPL 4GW5A 4ZUUB 5CBAB 1JZ8A 5JQ6H 1G6RH 4RX4A 5I75C 1VKXA 5C6WH 1AGDA 4MAUL 3DRTA 1OF2B 4MZ2A 3EJYD 3IFOA 3G08B 3FMGH 1YEKH 3EYSH 4LSQL 3LD8B 3SKOB 4MVBC 5JIPA 3QI9B 4JM2D 1I8KA 3A67L 4N1EA 2AEPH 2QQLH 4ZAKA 2E7LC 1INEL 2PW1B 4OGXL 2G9HB 3KYKH 4DQOH 1KTLB 4HWUA 2R39A 5DDHB 5FM8A 3T0EA 4KK5C 1JWUA 1AD9A 3G6AB 1M05B 4HAGA 4OFYD 5F88B 1BAFH 5IM7A 3EO9H 1LGVA 1ZGLA 3HPJA 3FO2B 3T8XB 1MLBA 4L9LB 2K7QA 3U7WL 4RISL 2CKNA 1QFHA 1OP9A 1U95B 4YUEH 3SGDI 3B9VA 5AZEH 3BJLA 2GK0B 1QRNB 4CADB 5DD3L 2G5BB 4FQIH 5AUMA 4L4TA 4R7NB 5H94B 4HBCH 4W4NA 3ALWA 4Z7NF 4HH8A 3UP1A 3E6FA 2CR3A 5DA0B 3VJ6B 4JPIA 1H15A 1AGEA 1MCIA 1M7XA 2VXTH 5E94A 1S9KC 3K2UL 5ENWA 2DBJA 1F4HA 3VXRB 2XTJB 2R4RH 4C56E 1XGRB 5CEZH 2XICA 7CGTA 1P6AB 1B3JA 1P84J 2COQA 3CGTA 5DD0H 3QDGB 1R0AL 3C9NA 5A2FA 1MFEH 4JFYB 4CW1A 1EHLL 3Q3GA 5EWIH 4PJ9C 5D2NC 3MRHB 5GJSH 4R2GB 3FFCB 5EZOL 4TTDD 2YRPA 4YH6A 4E0RB 2D9QB 1B6UA 1AHWC 1H5BB 5SWSE 3SQOH 5DR5L 3GSNA 4YAQA 4U1KA 3EOYG 4TSAL 1RK0B 3PWPA 5ERWB 2LU3A 4LNRB 4P59L 5HHMD 1FH5L 5IB2A 2FIKB 3ULVC 3SDCB 4WFGE 1BQLH 4PJ8B 1AP2B 3STZB 4NM8L 3QDHA 4FXGB 4JFDB 5BZDA 3HC0A 2P8LB 4WJ5B 2X5PA 4OZFB 1M4KA 3TF7C 4TVPD 2VKXA 4N8VG 5GGSB 5CINH 3KWWB 5DTFA 1QSEA 2YPKB 1ZVSA 3D39B 1XF5B 3JV4A 3VMPA 5IFHH 3RWEB 4EJ1C 1FQ9C 3O3DB 1MAKA 5C0EB 5B38A 5IB1B 4HS6A 4MA7H 2V7HA 1ZHNB 1SYVB 1MCQA 3DTXA 3GJFB 4JDVA 2V2TA 5JDSA 3MRQB 3MBEB 4HZLA 3UTTD 2RQ8A 3CDFA 1AE6L 4H1LA 5CJ8A 3EDKA 1A7PL 3IDGB 4XMPL 2KQMA 2NY1D 4APQA 1MIMH 5ESQA 4Y5VC 4XAKD 1IGTB 2F54A 1XH3B 1QBLH 2HFEA 2OBGA 4AT6A 1S7RB 4NQEB 1U3JA 3RA7L 1FZMA 1KIPA 4CDHA 4ZFFA 3EYOA 4BQ9A 3I84A 3L3DA 3HPLA 5I71B 3FZUC 4WV1B 4PG9A 3IXTA 1QA9A 1NMBH 3PE9A 1EEZB 1HNFA 2PXYA 3VE0A 4X9FA 3BFOA 2EXYC 1AD0B 1FSKC 3T08A 5DVOA 3ARFC 2PKDA 1WSST 3MZTA 5HJ3B 3V5HB 3MODH 1EX0A 1BX2B 4M93C 5JW5B 3O4LA 3S37H 3S3JA 1KC5L 2P5EE 2V2XB 1P2CA 3UJTH 5DSCB 4XT1C 3NPSB 4L29A 3GMOA 4JFZH 5AD0A 4H5SB 1D5MB 4KH2A 4MDIA 3CXHJ 1T03H 3PL6A 2AJXH 2MPAH 4LLAA 4LLDB 5T1KA 1ZT4A 4XCCL 1T1YB 1YN7B 2R0WH 2APBA 3V0WL 2IADB 4NRXA 3MLYL 2OMNA 3I3BA 4KK9C 4WHTA 4PJIE 4NO5A 2D7MA 2IFFL 3P73B 4NZRL 4XPBH 5J1AA 3P0GB 2FJHB 1FAIH 2J8UA 3V6FA 5BW7A 2VDKL 4MQ7A 2D7PA 5IF0B 1KACB 3OJDB 1CVRA 4XC1H 2VLKE 3SY0A 2IQ9L 4K23L 2HVKB 1ZHKB 4M7KH 3QBTB 5IT2H 4G6FD 4OZ4B 5HI5C 2HVJA 3SDDC 4YGVA 3V6OE 4OQ1A 4IIQC 1I1FB 1KIQB 2HWZH 4NO3B 2DWDB 4ZFZA 1T5WA 2A9NH 4NRYB 5HPOA 1X4YA 2Z35B 3BDYH 3MLPA 2Z0BA 5EO0A 2AVGA 3BAEL 2BNQA 4LF3A 5D4QA 4ODWB 3AS1A 5C0AB 4MAYD 3JBG7 4P9HH 2P8MA 1ED3A 1TZIA 4W4OC 3HI5L 4L8SB 4M7LH 5FYLL 1U3HD 3I6KB 2VWEE 4YDLB 2VERN 5IGXL 4N0UA 3TIDB 1PVHA 4K8RL 4X6EB 3TV3H 4DZBA 4JQVC 3KPPB 2OZ4A 3LQZA 3HE6B 3VFWA 4X6DA 5ADPH 3BIBX 3IAGC 1CGXA 2E6QA 5FKPA 2XKNA 1OAKH 1AGCA 4PJ5A 3MBXL 2R0ZH 5MI0C 3FB5B 3ROLA 3ARXA 5MEPB 5ISZD 3MUJA 4LLYB 3OKMA 2XZQH 4QHUB 4UBDC 1HHGA 3M1BB 2W0KA 3QULB 5C9KA 1NJ9A 3VFUB 4BJLA 5IW6A 1CLYL 1U8IB 3TESA 3G5VB 2MCPL 2ZSVA 3BKMH 5FYKL 3S3PA 3V8OA 4WUUB 4NBYB 4JRXA 1D6VH 2FHBA 5IBLC 2F8OA 3EYUL 2FJGA 5GGQH 4ZFOL 5F7WC 1OM3H 5C07E 3MUGA 1UJTA 3BO8B 1BM3H 4JO4H 4OGAC 2AJUH 4HJJH 2GK2A 4OZHE 1JYWA 3S37X 3QPXL 4EVNB 4U2YA 1DQQA 4Y0GA 4BSWB 5EC2A 4L3CB 1T66C 4XGZA 1SEBB 1BBDH 1QO3A 2GJ6B 4TVSa 5DJCA 4IRSC 1IT9H 3MXWL 1HHJB 1MNUH 3OPZL 3UYOD 2FLBT 3RU8H 5C0DB 3W39A 4Q9QL 2JJSA 2VTFA 4WI7A 3C6LB 1J87A 2AK1H 3A6BL 4IS6A 3EJZD 3WO4B 1T20A 3OBAA 5L9DL 1IM9A 1B4JL 4G9FA 2EDHA 3NH7H 4HWBA 1CD0A 1UZ8A 2H26A 1RIHH 2B4CH 2NY3D 2W9EL 4MCZA 1J12A 1U8OB 1JTTA 3MRBB 1FRGL 5I1CL 3S88L 3QP3A 1ULVA 3UTOA 5FB8B 1A6TB 3FQRB 1KJ2H 3QIBD 1UWXK 3HUJF 3REWA 3P77A 1QVOA 1VFOA 3RRQA 3V52H 1FVCB 5CEZD 4W6XB 3HAEG 1KPUA 3AM8C 4LVEA 1HH9A 1HYSC 4ELMF 1YEHL 5D7JD 3KLSA 3O6FA 1J0HA 1M6OA 2APXA 4XMKL 4O4YL 5LKNA 3GMPA 4X9HA 1CU4H 1AO7A 1IGFL 1MFDL 4MNGB 3RPIA 2VC2H 2WUBH 1ZGLM 2O5YH 4RWYH 5FA3B 2C3GA 5I8CB 4X6BB 1YEJL 2BY2A 5EOCJ 5FXCH 3HN3A 3PWLA 3QUMB 3FT2A 1SY6L 3RGVC 3BZ4A 1XZ0B 2CRIA 2WINA 2H2PC 5CJQL 4MDJA 3G5ZA 4OV6F 4XP6L 1IBGL 2NR6C 2B2XH 4IRJB 4FFYH 1YY9D 2PTTA 5GZOC 4J3VA 4ODUB 1NMCC 4RRPA 1WTLA 2GY7B 4GKNA 5AAMA 5EBLB 4XNZC 1IKNA 4MXWL 3IGAB 5SX4H 1BREA 1IE5A 2ZOLB 1YYLL 4PV9B 4I3RL 4S1DC 5D9SB 4Y8AA 5EO1A 2EDQA 4NC0B 3D3VE 5D7LD 2WP3T 1FG2B 3IF1B 1G9ML 2E7MA 1UVQA 5DFTA 2NX5E 2F8VA 3RY6C 5CZVH 3RZCC 3HLAB 4P23D 1F13A 1MCOH 1RZIA 2BSRA 5E2TL 1FZOB 1HSAA 3SGEI 3RTQA 1T7VA 4KUZH 3VXSD 4DKAA 2OI9C 5I6XB 2NQCA 4K94L 5CHNA 3CFKA 5EZIH 3P2TA 4G6KH 1I9JH 4HUWA 4ODSH 2Y6SC 3T65A 1UB6B 3D0LB 4C54A 5AG8A 1H0DB 3DYPA 3HUJB 4XAWH 2DWEB 1P9MA 4RNRA 2X4RB 2OTWB 2D7OA 2RB8A 4PJDE 3TN0C 5F9OH 2R1YA 4ELMB 1NGZA 3PGFL 1T0MA 4QRQB 3IYLW 4Y4FD 5I1DB 4LBEA 5I8EA 2AEIT 2JELH 4P46C 4WI9A 4TSBH 4OF0A 5HGHA 4BKLB 4UILL 5I18L 5E24E 1N0LA 2VWEC 4HC1H 1IGYB 1I85A 2FGWL 1UM6H 4XBGA 1OTSD 4MNQB 2NW2B 4MD0A 3QPQC 4X7EC 2ED9A 4NN7C 1YNKL 4XMLH 1XIWD 4KGLA 5KSBF 1QKZH 3OGCA 5DUBB 3S3SA 4O9HL 1A64A 4R97B 1NDGA 1KBGH 3IDYC 1RUPH 4QRRA 1A9BB 1YEGH 4BM7A 2ARJB 4PP2B 1FFNA 3B2VH 2YD1A 3GNML 4M5ZL 5GISH 5KVDH 5D7IF 1EAPA 2E7CA 4J3TA 2HT2C 3AMLA 4GLRI 2XRAL 1HNGA 5C6TH 3UPRB 1A7OL 1KCVH 2PR4H 5FYJH 1W0WA 3KJ6H 1J7VR 4LSDA 1EGJA 4IDJH 5BCAA 4O51A 4AIXA 1S9XB 1N64H 2DQUH 5DJ8A 3PHSA 3RUGF 1BZ9A 2ZG2A 1INQA 2MQ0A 3GMNB 5JW4M 1RJLA 3VMNA 1NCDL 4NQCE 3EO0B 4X98B 2HRLA 5JOFA 5C08A 3MV7A 2FB4L 3L3JA 1KJVB 5GZND 3EYVA 3CMGA 2I9LA 5AYUH 4FNLH 4RMSA 2NY0B 4AEEA 1YMMD 3S97C 3WS6C 3D25A 3DO7B 4U6YB 5CEXB 4P3DA 2YD4A 1D5IH 3BZFA 5TDNA 2AK4E 4LDLB 1HQRA 2QL1A 2YPLA 5FK9A 1J8KA 1AKJB 3ULVH 3IDJB 2EKSB 4YHOH 4PJFE 3AXLA 3D0VB 3NIDF 4U1HB 3S34L 1FYTB 3GMMA 2XXMB 2OP4L 3UCRA 1SJEB 5HYQB 5IBTH 4LKXA 3U2SA 2AI0H 2OTPA 1TENA 5TH2A 3UYRL 3ZDZE 1U8NB 2YK1L 3X3FH 1IQWL 4B0MM 3MRDB 5IBUB 3DV6B 4WHYH 3WLBA 4PJAF 4L4JA 4I2XA 5IQ9A 1C5BL 5H8DA 4YX2H 4TQEH 4ONHA 5H2BB 25C8H 3C5SA 5E56A 2RR3A 3VWJD 3PDDA 1A3RH 4H25A 2BP3A 1YEEH 3RWJA 3LH2H 4PJ7F 5J12C 3CMOH 1U3YA 5KSBB 1NLBH 2G60H 5CIPA 4PBWD 1R6VA 1RJYA 3QFDA 3IRZA 2CUMA 2X89A 4QOKB 4ELKA 3VI4E 1LO2L 1UWXH 2VZSA 2UYLA 2W65A 3HE7B 1OAYH 4KHXH 5D7IB 1JNLL 5BQ7B 3O6KL 3NCJH 1TFHA 3OKKB 2X4OA 3QQ3B 4K2UL 1RURL 3TJHC 4UOW0 1O5DT 5JOPE 3NACL 5CUSH 4Y16A 3ZT5A 2IQAA 3PDGA 4NPYA 3RUGB 5FEBA 1WFTA 3QUYB 4ZQKB 4HT1L 2CIKA 3QXWA 4PG2C 3D6GA 4QRTB 4S0SD 4OF6A 4L4VA 3SCMA 32C2B 4NWUH 2C9AA 2QHRL 1B0WA 4LCWA 3ZSTA 1CQYA 4WW2C 2WM0A 2DB8A 5K9QG 1GZQA 4PJEA 5E4EB 2C26A 3RHWF 3ROOA 1NUFA 3DVGB 3TA3C 5I1JL 4QXUL 2EDTA 2Q7NA 3QA3A 3L5WA 3MRPB 4X5LA 4MX7B 5DUMH 3QIWC 3MYJB 3EFFB 4JM2F 3D18A 2GJJA 2DLGA 4JRYD 3QZWB 2FATH 4OLVL 4CVXA 2ERJC 5B8CC 1PZ5A 3BKYH 4O00A 1C12B 5EU7E 3V2AR 3T0EE 4GG8A 2JCCF 3KYOA 3D48R 3IVKB 4R4FL 1RZKC 1KCLA 1H3UA 2CGRH 4D8PA 4Z78A 1HXYB 4L3AA 3V0VB 5MEND 4WVRA 4PJAB 5TQ2L 2A6DB 2W0LA 4FG6D 1DQLL 4NKIH 2DQIH 4P4RB 4RGOL 1DE4A 4HMCA 2VQ1B 4GRLA 2IAMA 3VA6A 3QHFH 4PS4L 5JIHA