5T33H

Crystal structure of strain-specific glycan-dependent cd4 binding site-directed neutralizing antibody cap257-rh1, in complex with hiv-1 strain rhpa gp120 core with an oligomannose n276 glycan.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
223
structure length
223
Chain Sequence
QVQLVESGGGLFQPGRSLRLSCVASGFSFNEKAMHWVRQAPGKGLEWVAIIWYNSIHKNYADSVKGRFTISRDNSKNTLYLQMNSLRADDTAVYYCANAGGGKYDYLDVWGRGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CAP257-RH1 heavy chain
publication title Structure of an N276-Dependent HIV-1 Neutralizing Antibody Targeting a Rare V5 Glycan Hole Adjacent to the CD4 Binding Site.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2016-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t33H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t33H01
5JIKA 3X3GH 3QDGA 1A1OA 2ZWLT 5C70A 4HF5H 5C09E 1N6QL 4HPOL 3MBXL 3BQUB 4PRDA 4L8CB 2P7TB 4GW5A 4AH2B 2X4UB 4NO5A 1JNHA 4K7PH 2AEPH 2L4OA 4UBDD 3LRHA 5E6IC 3L3IB 4CN6A 4OLXL 3BKML 1EZVY 2L0DA 2JE8A 2GEEA 1A6VH 2HAZA 1ZK9A 2MPAH 4HK0B 4MQXD 5HHVH 1KIPB 5BCAA 2F54D 1MY7A 2Q3ZA 5BS0A 1CR9H 3BPLB 5MEPB 1L0YA 2Q6WB 3NFNA 3GSUB 4PLJC 4G3YL 4NYLB 1D5IL 3QUKA 4KY1L 3P9LB 4I77L 1ULVA 4EBQL 1XT5A 2B20A 4PIRF 3UROR 4GSDH 4JQIL 1QFWH 1U8LB 3GNML 1JPGB 3K7UA 4WV1A 1OAXH 4GKNB 1JV5B 4ZXBC 2YA0A 4BM7A 3O81A 5CZKA 3HCVB 2V17H 3EFFA 3SGEI 1J8HD 3KJ6L 4HJGB 1KB9J 2VZSA 3PWPE 1VFBB 2CRMA 2AEQL 4FQCL 3VXSA 1UENA 4P4KC 4V1DE 3QFDA 3U30B 3H9SB 4MA1C 1OOAA 3CFEB 4HH8A 3PQYA 1IT9L 3MRQB 1DDHB 4OZFB 4PLKD 3FT4A 4MWFA 1NGPH 2R23B 3MOBL 3L7EB 1JWSB 4C56B 5D1ZD 4PLOB 4QWWD 1VFUA 4RDQG 4UNUA 4ETQB 3L7FA 2DQIH 2VN7A 4U1NB 5CJQH 4YIQB 4ZUVA 4MD4B 5EG6C 4Z7NE 1JMXA 1QBML 1EX0A 4KI5D 3VI4E 5EZJB 3D39B 3TH2T 3O41A 3UO1H 4G9FB 1JNNL 2B5IB 4NRXA 3LSOA 3IFPA 5FHAH 1U95A 3HZVA 2P5ED 4I2XB 5IW6A 1FVDB 2F58L 1QLEL 3JWDL 4N1HB 1ZTXL 5DURB 1OLLA 1A6ZB 1XH3A 4P46C 3ZE0E 1PW3A 4M7LT 3KLAB 5C0AD 1VENA 4HKBA 3VWJA 5ICZA 5DA0B 1WWCA 3V4PH 1EZVX 3ULVE 4JPKH 3RY6C 4OD2B 3X11A 3O8XB 3QUYA 3S96A 4OLEA 2NY4D 4S2SA 5JA9A 3V0VA 4J6RH 3MMEA 3VXQB 3GUTA 4KI5E 3TF7C 4NOBA 2ADFH 2HJLB 5I30L 1GZPB 2E7HA 4U1LB 4PRPB 5D4QA 2OSLA 1NC2A 3BKJL 1HN1A 1C5DA 3BN9D 4MMZC 3UTSB 5DJ2B 5F6IC 5I1CL 2E3VA 3ZDXF 3B9VA 2FLBT 4P9HH 2DN7A 4HUWB 1GPOL 2ZNXA 4UOJA 4OZFG 1YJDL 3O45A 1IAKB 1AC6A 5D8JH 2HKFL 3CVIL 1RMFL 4X0KA 3FJTA 4MNQB 5AYUL 4LCIL 3MACH 4PRIA 1D9KB 5GIRB 4EZMA 3EDEA 1LE5A 1FGNH 4GUPB 1JF1A 2YHGA 4PBWD 1MRDL 2APFA 1FFQA 5KSVA 1BVKA 3HZMA 4L4VB 5HVHC 1F8TH 3NA9L 4OFIA 2FHBA 5DDHB 4O5LL 1F3RB 2DLFH 5CHNB 1XF4A 5DJXB 5LGKA 1T2JA 1WIOA 2ZZUT 2XFXA 5FKPA 2C7UB 3MFFB 4LPYA 4YAQA 1FJ1A 1LEIA 2VZTA 2HG5A 4L29A 1LD9A 2EDEA 1N2RB 4JDZB 3GO1H 4ZFZA 4R0LA 3O2DL 5K9QG 3BI9X 3UX9B 1S5HA 2UY6A 3P4NA 4OD3L 4JG0H 1XFPA 2NY5H 1I3GH 2NXYD 4K23H 3QWOA 4XI5D 1CFVH 3RWEB 1SYVA 3ARGC 5ALCL 1JZ7A 3B9DA 2VITA 3WV0A 3DOSA 4GQ9H 5GRVL 5CS7A 4XBEH 5LBSL 1FCCA 2C3GA 3MA9H 3MLXL 5HGDB 5TF1H 2VZVA 3C60B 4G6KH 1AP2A 1INDL 2X4QA 1AKJB 3F12A 4NQSB 3GBNL 3B2UD 3WHE1 1FZJB 1HSAB 1YEFH 1NDMA 4MHHI 4CU6A 3TO4D 3ARBD 4TTDD 3TYGL 5DD1L 2BMKA 1TETL 2FJFB 5GZNC 2AQ2A 1U8QA 2IQAA 3BEVA 4NT6A 3BH8A 1H3GA 1Q72L 1CXIA 5HJ3A 1F3DH 5FIEA 2Z91B 4YHOH 2PNDA 2P48B 5EOTB 2HFFB 2ICWJ 2P42B 1KCSL 1CU4L 3TBYA 6FABL 3WNKA 4WY7H 4LOUC 2EC9T 3E1F1 1U42A 1ADQH 2ICWI 1Z3GH 3FO0L 3Q2CA 1HHGB 1I1AA 5TGBA 5IEHA 1KJMA 2VDKL 4KRLB 2Q8AH 5FYLE 2CRZA 3FRPG 3LOWA 3I50L 5HI3C 3QB7C 4BZ1L 1XGTB 3MODH 3WDIA 4GG8A 4HKZB 1M71A 4LRIC 1A9BB 5FB8B 4BELD 3KPQA 4QRRB 4G5ZL 4PV8A 2DQUH 4EUPB 3IS1X 3EO1B 3BGFB 4G6JH 4GMSH 1CD9B 3K1DA 1QSFE 4M93B 4ZUUA 3FZUD 3RKDD 4OLZL 1G9MH 4PBXA 3O6FC 3RWCA 3DBXA 1GL4B 3TNMB 3HI1B 4LVNC 3CJJA 2NXZD 2OQJB 2A77H 4F58H 5TE6L 3Q48A 3QEUB 5KSBA 1ZLSL 3VRJA 2A9NL 1RZ7H 3PL6B 1IGIH 3MUJA 3UAJD 1ZT7B 5F1NA 3MJ8B 3V7AE 4GAGH 4TUJB 5HYSB 3L5WB 3L6FB 4IMKC 4MXVE 3ARFB 3OV6A 1JYXA 2VKXA 4P2RD 2A6DB 3V79C 2R4RH 3EJYC 3RNKA 5JHDB 3PIQB 2BVPA 3LKOB 4H20H 3KPRA 1S7RA 4NKDB 3VFNA 5J89A 2IF7A 2G5BA 5ESVB 3CFCL 3DSNA 4G6FB 1BQHB 2GY7B 5CZXC 3RWFB 4GG6B 4Z7UF 2X7LA 3QQ4A 3C6LA 2BHUA 4KK8D 1RHHB 1U58A 3HPJB 4NRYB 3NN8A 3ZE1F 4XXCC 5FM5O 4OLXH 3VGAC 3BKMH 1T83A 3MRRB 4P2CG 3IYLW 3ZHDA 1C5BL 3QFJD 3BSZL 2HTLC 4KFZC 2F74B 2HT4C 1FSKC 1T03L 3QDME 1NCAH 4EUPG 1IEAB 5I19H 3IFOB 3MOQA 1D5IH 4RFOH 3TPKA 1B0RA 2VLMD 3LS5L 1MVUA 4JQIH 5AEAA 5A2IH 4Y2DA 5HYJE 3GNMH 3LEYH 2XNAA 4OLWH 5BVJB 1OTSD 4HKXB 1YN6B 3K46A 1T1YA 3CGTA 2XG5A 3PNWB 1VGEL 4PRHB 2B8OT 3MV7E 5GGVY 3KJ6H 3PE9A 2H6PB 1KNOA 2AEQH 3IAQA 4ZSOA 4MA3B 5HYSG 5E9DE 1HZHH 1A6WL 3GB7B 5D1QC 4TUOB 1S9KC 2EDJA 3KXFD 3QFJE 4PGBB 4O9HH 4QHMA 5ABDE 5DSCB 4OIIH 3UMTA 4P23B 2UY7A 2HKHH 3GJFH 4YFDB 4X6BA 1S3KH 2AV7A 2G75B 5GGTH 4BUGA 1JHKL 3KNBA 5H2BA 2FJGA 4L9LC 1U8NA 1BQHG 3SDCC 1WCBA 4M1DL 2D03L 3IKKA 1QBMH 4N8CL 1TCRB 5I74B 5C0BE 1AXTH 1IQDB 3FO1B 4D9RE 2A73A 4ZFOL 4OD1L 3O4LA 1G7JB 3SDAB 1Y0LB 5DRNA 1FV1B 4XZUA 2F58H 4FQXC 4IJ3C 3JWDH 1ZTXH 4RAVB 1J0JA 3ULVL 1CD8A 4FHBD 1MCJA 4MJ6B 1QRNB 4HX1A 1L6ZA 4L3CB 3W9EB 2AXFB 3KXFE 3HRPA 1U91B 3HE7B 1QFOA 3HUJA 1KJ3L 3QQ9D 4X8JB 2H3NA 1QSEB 4F7PA 4WHTA 2NCMA 3O3DB 4LPWA 1V5JA 4NO0B 2F53B 1N5AB 1MOEA 1KGCD 2EDDA 4M48L 4RFNC 4OQTA 4LASH 5D1XD 4L8SB 2WBKA 5I30H 3QJHA 4GFTB 3MYZA 2Y1VA 4XPBL 1S7QA 3BKJH 2VRAA 1VKXB 2PO6B 5I1CH 1WBZB 4MSWB 3RDTC 1H0DB 1T0NB 2PW1A 1NKOA 4WFEE 4QHKJ 3IU3A 4O2FA 1YJDH 2GUOB 1OP3K 2HKFH 1RMFH 4LCIH 1FLTX 3M1BB 3QUXA 4MB4A 3R06B 4V2CB 4QHKI 5HSFA 2EEBA 1MRDH 1R5VB 3WFCH 2GI7A 5EBWA 1NBZA 2IALA 1P1ZB 2VB5A 3RVWC 4JHBA 2GJ6D 3UTPD 3T0EA 3NA9H 2FD6L 1KGCE 2FL5A 4G8GE 4M7ZB 3GDBA 2ITDB 1D5MB 1H9VA 1IC5L 2IFGA 4YZFF 3WJJA 2VISA 1JZ5A 2J2ZA 3I3DA 5BVPL 2P8PB 3EYSL 3BXNB 1A6TB 2AJVL 4JRWA 4JHAL 4OI7A 3CAFA 3MLPA 3V5HA 2BP3A 4YHZL 1QO3A 1FAIL 1OB1A 3O2DH 1P5UA 2OTWA 5EBLA 4NPYB 4OD3H 5F9WC 1KJ2L 5JOPD 3GKZA 4LPUA 4KROD 3O3UN 5A3ID 4AL8H 5DZOA 3OMZA 2WZPD 4JQVA 5ALCH 3QUML 3ARDD 4EIZC 1L0XA 5I76B 2COQA 5F72S 3HS0A 5LBSH 1CDGA 3CUPA 3MRKA 4D8PB 1A3LL 5IVXB 1INDH 5LAXB 3GBNH 4XCCL 5A43C 5IM7B 3X14B 4YX2L 4CVWA 2EXWC 5IBLD 2Y72A 2JJUA 1ZT4A 3TYGH 4WO4A 4N9OB 1TETH 4JPWH 4JQXA 1W72L 1I8IB 2WIIB 2W1NA 1Q72H 3FT2A 5GRJH 5FYLL 3ARWA 1FL5A 3BUYA 1UEYA 4FFWC 3DO7A 2EDYA 4JREC 5JOPE 4G80B 2QSVA 1OP5H 3S3JA 3BOVA 1FC1A 3ES6A 1KLFA 4LSDA 4ODTL 4UQ3B 2VDRL 2ENSA 2VDKH 1IVLA 4RQQA 4RRPG 3QIBA 3I50H 2J12B 1KPRB 5I73B 1Z2KA 5D7IA 1RUPH 3CVHB 3K74B 5HHPB 2W65B 1A6AA 4OCMC 3EYOA 3GSNH 4G5ZH 4QTHB 3HI5L 3JV6A 4R4FL 3TC9A 4POZC 3KAAA 5LXGL 2Y9RT 1LGVA 4XPAL 5CLWA 5TQ0L 4OI9A 4IBLT 3ET9F 1KFAL 1H8NA 5T1LD 1YPZE 1K3IA 5TE6H 4F80A 5CSGA 1DQTA 1JCKA 1ZLSH 4C55A 3PG2A 4EI5B 3U2SB 4F9PC 2A1WH 1IJ9A 1PBYA 1MIML 3G08B 2PW2A 3D87B 4EN3C 3STZA 3P77B 1G7PB 4RDQF 4DEPB 2VXQL 2WUCL 1ZOXA 1GC1L 4HSQA 4MD0B 3MCG1 1PD6A 1I8LC 1Q9KB 5LCVL 5EZLA 3DRQA 1DE4A 4UAOC 5DK0B 1XF1A 4L5FH 4QTIH 5CILH 3LHPL 5I1AA 2AEWA 4LSTL 1MCOL 5C09A 1P7KB 2AS5M 3CPLB 3GSQA 4IHOA 5JXAL 3G9AB 5DRXA 3EO0B 4YHYB 3CFCH 1KELL 4XPHL 3M17B 4KZDL 32C2A 5DHVB 4RAUB 1ZGLB 4TULL 3FQTA 5AYQA 1HHHA 1WJ3A 1GGCL 4NC2B 5E00A 4KKAD 4F7EA 5EIQA 3VG0L 1F2QA 3O2VH 3BSZH 1NCNA 4Y4HA 1T03H 2W9EL 5E7BA 3L3KA 2WINA 3ZDYE 1PG7X 1FE8L 1S78C 2BSSB 4GAJL 3VU2A 1F4XH 4JKPL 1NC4B 1HKFA 4HUXA 3ZE2E 4CMMA 3QG6B 5DJCB 2BSTB 5B3NA 4FQHA 4GJTB 1S7UB 5ERWA 1C5CL 1P9MC 3GRWL 3PWPA 5D7SL 1ND0A 5E8DL 3RUGF 1RD6A 1VGEH 2CXKA 1UXWA 2GITA 2IAMA 3G6JE 3O3EA 3EGSA 5KTEL 1I7UA 4KJPC 3GSXA 4V1DA 5ANMB 2V5TA 2YD1A 2MSPA 4BH8A 1HYSD 4K7PY 3G5VA 3TCLB 4K9EL 1A6WH 1A7QH 4AIZA 5F8RC 4RZCA 1IAOA 3IGAA 2HJKB 3MLZL 4L3EE 3BQUD 5E8PB 4JDTL 5DJ6B 3WN5A 2VIRA 3UTQB 5F7DA 1HXMA 2R1YB 4HIIB 3HC0A 3T0BA 1OP9A 4JHWL 4LP5A 3FB6A 2BVYA 1M6OA 4PYGA 1FNLA 4PJ5B 2AJXH 2VTFA 3LDBC 1JHKH 1FVEB 3H0TA 5HHNA 1ORSA 4M1DH 3SKNA 2D03H 1SHMA 5EZIL 4N8CH 2ORBH 1B2WL 2PR4H 4YH6A 1G7MB 2P5WB 4OD1H 4XBPA 1HK6A 4M6NL 1DVFB 4K94C 4DKEL 1A1NB 4AIOA 1JWMB 4UTBL 4F8QA 1JF6A 2O5ZH 4P46B 5DQ9B 4NRZB 1LILA 1AY1L 1OPGL 4U6YA 2FECL 1KJ3H 4MAYB 1X5FA 3UEZA 2Z8VC 5SWQA 4X80L 2BNQB 4FXGB 5KS9F 3FOMA 2CUHA 1S9VB 1ZHNA 3RWDB 4KZEH 1MCKA 3F6IA 4U1GC 4WEBL 2O93L 3IETB 3QUYC 3H9SD 3QA3B 1KTLA 5I9QB 5HI4D 4M48H 3SDXB 3PHQA 1AO7E 4AZ8A 2D7TH 2OLDA 4NQEB 3BN3B 3QUZB 4PJCF 4C56D 4LAJH 2R2EA 5JLZB 5KOVC 4UB0H 1UWEL 3TBSB 3DGCR 5GHWH 5KVEL 3NCBB 1R0AH 2JIXB 2V7HB 3N9GL 3WIHL 1RUMH 1AGCB 3TN0A 3U48A 1B88A 1BVLA 1S7VA 3D39D 4HZLB 3BT2L 3L3OB 4L9DA 1A6PA 4YHMH 1YC8A 3BYTA 5J3HC 4R90H 4M6ML 2DLGA 2F15A 1X44A 3HTLX 2BXZA 4HPYL 2EZ0C 2QHLA 3AS2A 4A6YB 4JN1H 1N3NB 2V7NB 3LKNA 2HRLA 5DURD 1SJHA 3B3IB 5T1KB 2FD6H 3HNTL 2PXYB 1CVSC 1N59B 3DI3B 3MV01 3BO8B 4QXTB 1UB6B 3EYUH 4FQJH 2WWMD 3JSSA 1ROWA 1DLFL 1G7IB 2IBZY 5J11B 5BVPH 5FO8A 3EYSH 3O8XD 4OLVH 3C2SA 4IOFD 3NPSB 4I8DA 2C1PB 5IHBA 2FIKA 2DB8A 1R3IL 5GS1C 4JHAH 4NM8H 1XGUB 3H42L 3VXUB 4YHZH 3V5KA 1DZBA 4NKMA 3GK8L 4WW2B 3A67H 1NMCB 3EOYG 4R0LC 4G9FE 3O6ML 4CVUA 3VXRA 4HCRH 1JPTL 3KS0J 3OKDA 3FAXA 1KJ2H 3RX5A 4MVBD 3UTSD 7CGTA 3T4AB 2VDOL 5DD6A 3GM8A 3MGOA 3IDMB 4X5XA 3H3BC 1IAII 1WFTA 3EOBB 1A6UH 3JUZA 2XWJB 1QNZH 4MNQD 4JANB 2NNAB 1D9KD 1KJVA 5D93C 5T3ZE 4XCCH 2DQCL 3QUMA 4DVBA 3KDMA 1CN4A 3BD3A 4YX2H 1DUYB 3BD5A 1K4DB 4WEUD 5E1AA 2HT2C 3WIFB 2Z4QA 4D0DB 1A7OL 3BESR 1QHOA 12E8L 1JPST 2BVTA 2XV6B 4L4VD 1W72H 3DVNB 3U6RB 3S88L 1ZHLA 3VH8A 1BOYA 3LV3A 2R2CA 4LF3B 4PJFA 3IF1B 3C5JA 5T1DL 2IG2L 5IB1B 2ARWA 2H1PH 4I18B 1W72A 4PRPE 1N7ML 4X4YB 4MLSA 5EU6E 5SWZE 3WLBB 1ED3B 3MA7A 3L3GB 5DTFB 2AJ3B 4J1UB 3K2UL 4XRCA 4WWKA 4ODTH 4X98B 2VDRH 2KUTA 1I1AC 4XGZB 4MB5A 3FCTB 4YBHA 1EMTL 4JRYE 2J5LB 3IDGA 4EI6A 4LCCA 5EA0L 1U8PA 3CXHJ 5TDPA 2D7PA 4D2NA 5D7LB 1T2QL 2HRPL 4JAMA 4XVUC 4DQOL 2J8UB 1QSFA 5K9KB 3MX0A 3MJ6A 2DMCA 3D0LB 3HI5H 4JFEB 4R4FH 4MQ7A 5D7JA 4IRSB 3VCLB 4MNHB 2VZ1A 2X4RA 1T1WA 3C60D 3P4OB 2MOVA 5TQ0H 2IBZX 1AKJD 4KXZH 1X5HA 1WZMA 5HY9A 1DUZB 3ILPA 1KFAH 2FEDC 5I8KL 4L8DB 4JFQB 3FFCE 2Z35B 5DJZA 3QIUB 4NQXA 1X5ZA 1WBXB 5DEGA 1DLHB 3UZEA 4RX4A 2OXGA 3IFNL 5KVGL 5FM8A 1NGQL 1T2XA 1D5BB 3KYKL 4PJDB 1L7TH 3ECBB 1IZJA 3DX9B 4LSTH 1MCOH 4JKLA 4MNGB 5HHQA 4E41E 4HFWB 4NQCA 4XPHH 5B38A 1KXQE 4YHPA 3ROOA 4DZBA 1NAMA 4KZDH 3EYQD 4QRRD 1AIFB 4LLYB 2HT3D 4YEEA 4X7TB 4N8VA 4FG6C 4JFXB 5TH2A 3AS0A 3ZDZE 4DK3A 1GGCH 3CFKA 3QDMA 5FF6B 1EAPB 1T83C 3BISA 2DQGH 5EC2B 1YMHB 3CCHB 4MCZB 5GJTH 5E8NB 5DMKB 5KAQG 2CLRB 1H5BA 4L8BA 2VKWA 4LBEB 4PJHB 5DFTA 3PL6D 1RZIA 2VDML 3QIWA 3WJLC 1BGXL 5HYJA 1FE8H 5J9PB 4GAJH 2X1WL 3FB7B 1YEDB 3SGKA 4JFHE 2R1XB 4JKPH 4HEME 5FEBA 4QRPE 1VA9A 4YO0A 4K3DL 5HGBB 3VFGH 3RGVB 1P2CB 4G43B 2FHCA 4S11A 3GSVA 3ARFD 3MV7A 4X6DB 4YWGL 3GRWH 5L0QC 2AKRB 3MRPA 3IDJA 2BY3A 5E8DH 5CJ5A 3MCKA 4R7DB 5E9DA 1NGWA 1UYWL 1ZWIA 5DFVC 3IJSB 5F7EL 1QP1A 5JHDD 1E27A 4DFIA 2J6EL 1J1PL 3WL9A 4NO3B 5DR5H 4YK4C 5I1JL 3RP1A 4LRNL 2G5RA 1FVCA 4JFOA 4E42B 4G6FD 3MLZH 1I1CA 4NKIL 2YPKB 1CFTA 4G8EB 2MCPL 5C08A 5F7HA 5E1HB 1FNEB 2VQ1A 5J6HB 3MRCB 4KRPC 1LP9B 2B0SL 5CIPA 3RIFK 2WQ8A 3GSRA 4KKCC 1W8OA 3SDCB 4LCWE 5C0CE 3SY0A 4YBQC 4XMLH 4Q6YA 1XGYL 4ODSL 4KJWC 2GT9B 1B2WH 1YNLL 1JZ3A 3DGGB 3RZWA 1EO5A 4K71C 3DYOA 4FQXB 4PREB 1JPFA 4UTBH 1G9NC 5IGXH 4X99B 2CH8A 3K1KC 3QHZL 3VWKA 5MHSD 3E2HB 1H3PL 3WFEL 4GG6E 3HZKB 4OCRL 4PRHD 4X80H 4QOKB 5IMLA 4O51A 1Y18B 3W0WA 1WIPA 1Q94B 4PJIE 1XIWB 2X4SA 4X7DC 5HYIA 4N0RA 3VXTA 1Q1JL 2VE6A 4WEBH 5CEYB 1RZFL 4PRAB 1ZGLP 1VEOA 2IWGA 1B6DA 2P24B 5DHYB 1U93A 4R3SA 5I75B 3KPMA 4QRUB 4HWBH 4GRLA 1X5XA 5FDWB 1ACYL 5DJAB 3ULUE 2Q86B 4ONHB 1N0XL 5FKAA 3PDOA 2UUDH 4FQ2H 3R0NA 1UWEH 4Z77B 5KVEH 1MWAL 3B9KB 3QI9C 4UDUB 3N9GH 3WIHH 1BOGB 4Q2ZA 3MRFB 5MHSE 3RVXC 3SKOB 3BT2H 5JZ7D 1Q9WA 2H26B 1ZANL 1AHWA 4LVOB 1CGSL 4GKSA 4APQB 3SDAD 4M6MH 1FHGA 3KPNB 4UDTB 2XRAL 1MIEH 4HPYH 4JPIB 3SKJL 2ZSWB 3KLHC 4F2MB 4G8GA 4PLNC 1LK2A 3C9NB 4XNQB 2XTLA 1QRND 5DK2B 1IAIM 3D18B 4JGUA 1PYWA 4PJ9C 3HE7D 3HNTH 5D7KD 2C1OB 4Q9BA 4KHTL 2J3SA 3WO4C 1TPXB 1FFPA 1QSED 3NCYP 1N26A 2D0FA 4JFZL 2Z92A 4LLUB 2DBJA 5I1DB 3GMRB 1DLFH 1VGKB 5CJBA 2F5AL 5IMKA 4NO0D 2F53D 1ZVSA 1QD0A 1CD1B 1XGRA 5I1GL 3VD9A 1R3IH 2YD9A 3WKML 3QXUA 4PG2C 1A8JH 1CT8A 4ODXA 4P3DB 3GK8H 1DANT 3WXWH 3ARRA 3RQ3A 3MLRL 2H2PD 4IIQA 1JPTH 1ES0B 5T3ZL 4MQTB 3V0WL 1CDJA 2OCFD 2VXTL 2PO6D 3F58L 2EDHA 2VDOH 3RI5F 2ZUVA 2OTUA 4R97C 1QQDB 5C07D 4JQVC 4K07A 3N85L 2V9TA 1J05A 2CLZA 3BKCH 2X4PB 3W11D 1CF8H 1M7XA 1KTDA 2DQCH 3EHBC 1LO4H 5C0GB 1QSEE 1K8IB 2R2BA 5JXED 3SCMB 4DJMA 3QQ3A 2WWKT 1A7OH 1AXSB 5E56A 1KBGH 3WS6A 1CGTA 12E8H 1ONQA 3CFBA 3W5MA 3D25A 5IMOB 5EOCH 4YR6B 3S88H 1KN2L 3T0AA 5EIIB 3DPBA 4P3CH 5EC1A 3DVFA 1VEPA 1G9EA 2XN9E 3KLSA 4H88H 1FPTL 4YEFA 2IG2H 2QLVB 3DV6A 4DGVH 1N7MH 1C1EL 1MLBB 3GI8H 2HFGH 3LKPA 4TVPD 1OD9A 2E7LA 4OCSL 2BVUA 4G7VL 3K2UH 5ENWA 1AD9B 3QNXA 4CVXA 3ZYJA 2E27H 4MQSB 4Z7VB 3CH1A 1EMTH 1LO5B 2HLAB 5DC0A 5T33H 4TPRH 5E8OB 1VADB 4WUUB 4KTYA 3QNZB 4IRZL 2OR9L 7FABL 3RAJH 3WBDA 1T2QH 2LAGB 2HRPH 4DQOH 1V7ML 4RFEA 4UT6H 1U8MB 5EORL 1U92B 1AR1D 3HLAB 3WEXB 4OZGB 1YPZA 4PJXB 4PTUB 2DM7A 3ZYIA 3EOAA 5DO2C 4U49A 2VMFA 4JPVL 1XR9B 2HFEB 5BW7A 2OJEA 2DBLL 4YFEA 5FCUL 1F13A 4TVPE 4KU1A 5IROA 1I9EA 3OKKA 2DWDA 3G5ZB 3UJJL 3U9UA 3LEVH 4XP6L 5F96L 1ZHKA 3CZJA 3VFRA 2VSCA 4LHUA 3NFPA 4XWOD 1GGYA 4QXUL 5KVGH 3KYAA 1JL8A 1NGQH 3KYKH 2FWOB 5AD0B 3EAKA 2X6MA 1J0HA 4JM2B 3MO1A 3NIFE 5F7YC 5F7MC 1GRWA 4KVNL 1A1OB 1JRHI 1HQRA 1V3JA 1KN4L 4PRDB 3GGWA 5I71C 1BAFL 3VGBA 3D0VB 3ILQC 4O2EA 3ZO0A 4GW5B 5C0DA 3WUZA 4M6AA 1EK3A 1JNHB 4NO5B 1DBMH 5MERA 3BWAA 3MQIA 4JZJA 4W68A 4XNZB 2XIDA 3HE6A 4QT5A 2DMBA 5TE7L 5JOFA 2X89D 1MFDL 1AQKL 3TYFA 2FGWH 2ADJA 5BS0B 4KWUA 5IB5A 3NFNB 4Y4HC 3BP4A 4RISH 3ZDXE 4EI5D 3QUKB 1BGXH 4OZHA 4WCYL 1KIRA 2EDNA 1NMAL 4K3DH 3I3EA 4WV1B 3FQWA 3H7BA 4NIKB 4YWGH 4A2MA 1FZMA 1A7RH 4XHQA 3BJ91 1WAAE 4QHNA 3EFFB 2ZOKA 3CNKA 3RJDA 3VXSB 1YY8B 4L3EA 1JTTA 1J1PH 4OT1L 5I1JH 3QFDB 4LRNH 5E2UL 3PQYB 4U31A 5I8CA 4NZUL 2APTA 2MCPH 2J6EA 3FT4B 4B50A 1EEYA 4MWFB 5IVNA 3DUUA 3RTQC 1FG2A 1TITA 1ORQA 3LDBB 1RZJL 4D9LL 3L7FB 5D2NE 2EKSA 3L9RB 5DS8A 3IRZA 4PD4J 4ZUVB 4DKFH 4DCQA 1XGYH 2VDNL 3O41B 4ODSH 4WUKH 4M62H 3WUWB 3H9YA 4NRXB 3LSOB 3IFPB 1CICA 1U95B 1RUKH 2Y07L 3HZVB 3OXSA 3FFDA 2BERA 5IW6B 5ID1A 1M1SA 3MLYL 1NC4D 5T5NG 1BIIA 3K4ZA 1XH3B 4GKOA 1TENA 4HKBB 1H3PH 3RZCB 1R24B 3WFEH 3VWJB 1MQ8A 4OCRH 1NL0L 1B0WA 2G2RA 3WNLA 3ARPA 3RL1A 4AEHL 3X11B 3ULUL 4IRJC 4LCYA 1TIUA 3S96B 4S2SB 4DAGH 3V0VB 5E94A 3V8CA 2FX8L 3MMEB 4JY6A 3GUTB 2EIEA 5FOJA 2GY5A 5JW4N 5I66A 4X7FC 2QQLL 5BV7L 4YNYA 2OSLB 4E0RA 1NC2B 3K81A 1C5DB 3D5OF 2DOCA 4PJ5D 1ACYH 4PGEA 4NGHL 4TSBL 1UKTA 1KB5A 4FZ8L 1U8IA 3QJFA 2ICEA 3O45B 2CGRH 1P53A 4X0KB 4X4ME 4PRIB 3PP3K 3OAYK 4OZFH 1CGSH 3R1GL 2P5WD 3O9WC 1LE5B 1MWAA 5ANME 2EDBA 1DVFD 1KEGL 2XRAH 4ZS7L 3SKJH 4GBXC 5DF0A 4JCLA 5AWNL 5KSVB 1BVKB 3HZMB 5IB3A 4YDJA 1HH9A 1ETZA 3WUWG 4MAYD 4KHTH 1BQSA 1XF4B 2QKIA 2Q76A 1FH5H 1OL0A 2BNQD 2XZCL 4WW2F 5E2JA 5IHUL 1NGZA 4JJ5A 2XY1A 3FQUA 1E4XH 2XFXB 5FKPB 4YAQB 3CXDH 1LEIB 2QHRH 5I1GH 2HG5B 4L29B 1LD9B 2GJJA 5FM4A 3CLFL 3WKMH 2DWEA 4HKJA 5E8EA 4ZFZB 4R0LB 4F3FA 4BUHA 1S5HB 4NQED 3MLRH 3QUZD 4AYFA 2P5WE 2IMNA 1CDHA 1PKOA 4NUJA 3QWOB 2X05A 3V0WH 5FAAA 3W5NA 5EZOH 3MRMA 3VI3E 1SYVB 1RURL 3F58H 3NPZB 4D9QE 4QGYA 2ZUWA 2JIXD 2N4IA 2VITB 1G6RA 5CZVL 1ZA3A 2R4SL 4XPFH 2A6JA 1UM6L 1DBJL 1NBVL 4G42A 4H1LA 2X4QB 3F12B 1W0VA 4Z7UE 1OCWH 3U46A 3OTTA 1JI1A 4EDWH 1NDMB 4LLWB 5EUOB 3JWOH 4HS8L 3QPQD 4NUGL 4JHZA 1FBIH 5GS0D 4B41A 2Y5TA 4OSUH 2BMKB 1JHTA 4P2QD 2GTWA 3BEVB 1U8QB 2IQAB 1UADC 1AXIB 4IDJH 3BAEL 4YHKH 5T1KD 4NT6B 3BH8B 3F7RA 2PXYD 4ENED 2B7DT 5HJ3B 3M45A 4HK3J 5I1LA 5EU6A 1DL7H 5SWZA 3GMMA 4LSRL 2LVCA 1PAMA 5FUCC 3PDDA 3U79A 2Z9TA 4NQVA 3TBYB 1C1EH 4P59H 3C8KA 1R3KB 1T0PB 4FQIL 4OCSH 4G7VH 5TGBB 1N6UA 4I48A 5IEHB 1J86A 3VXUD 3HMWL 4Y5YA 4KPHL 1NFDF 3RVTC 4GG8B 5EU5A 1M71B 2PTVA 2EEDA 4IRZH 2OR9H 7FABH 1X7QA 2IANE 3KPQB 4ODVL 1PKQA 3AM8C 2WW8A 4Y5VA 5KG9A 2YPLA 4TVPL 5D7JC 1YDPA 5EORH 4ZUUB 3RWCB 4LGRB 4S1DC 1QOKA 3MRBA 2Y6SD 2VC2L 2WAHA 3DBXB 3FFCA 4I3GA 1R5WA 4XT1C 1ZMYA 1B4RA 1OAKL 3VRJB 2DJUA 2CLVA 3HR6A 3PGFH 4JGMA 5GZND 3BKYL 5F1NB 1WF5A 2YD4A 3G5XA 4HAFA 3UJJH 1YUHA 3HG1A 4XP6H 5F96H 2FO1A 1TNNA 3V9FA 5JIHA 1C16B 1FIEA 3C8HA 2AXJA 4X7EC 3SE8L 2YEZA 4XMKL 1R3LA 4E41A 3RNKB 3T0XA 5B39A 2BVPB 3KPRB 4JM4H 4P2OA 3VFNB 2AJZA 2G5BB 2D0GA 1KN4H 2RBLA 4DUWA 4JO1L 4PRNA 4ALAL 4M5YH 5D7LD 5B8CC 2FJHA 2X7LB 3QQ4B 3C6LB 4JVWA 1U58B 5FYKD 4JFED 4X9IA 3NN8B 3PV7A 2VZUA 4IRSD 4M7LL 1WZ1L 5TE7H 3TBVA 3UTZA 3UJIL 4KRMB 3S35X 2HVKA 5JIPA 1OY3B 1H5BC 3CVHL 4AM0A 3QIWC 1OQOA 4WCYH 2WBWB 3QIUD 4ELKA 4K8RC 4EUPH 3SDDA 1TZGL 3NTCL 1B0RB 1MVUB 2BRRH 4Y2DB 5GGSY 1WEJH 1NMAH 4LEXH 4QYOA 2XNAB 4UV7H 5TE4L 4XCYA 5L0QB 1QPXA 1T1YB 4HHAA 4YHIA 5CGTA 2D7OA 2J8UE 4P2YA 4RCAA 4ZS6D 2C9AA 1FO0L 3T08A 4YK4B 4ZSOB 4NZDA 4PJGA 5FUZL 4OT1H 4XX1G 5E2UH 5CZXD 1XGPB 4NZUH 4JB9H 1S7XA 1INQA 3MXWH 5D2LF 3MFGB 1KULA 3DMMA 2DLHA 4PGCB 1P7QA 3CFDA 4X6BB 3UTTE 4LCWA 5C0CA 2AV7B 4TUKL 1FGVL 3BIBX 4DOHE 2IADA 4IMLA 1RZJH 3KNBB 4D9LH 2FJGB 3KPSA 3DO3A 2XQYK 2FATL 1MFEL 3S37H 1WCBB 1QR1B 3P30L 4JY5L 4LVEA 1WQVT 2YPVL 4PJDE 3ZZ1A 2A73B 2EDWA 5MENA 3O4LB 2Y07H 5DRNB 4XZUB 1BD2A 4F33A 4LPXA 5ADOH 4H26A 3MLYH 3I6GA 4MNGE 1F00I 4HX1B 3D3VE 3RGVD 3H3KA 3TH4T 2P47B 3HUJB 5HDBE 4PJIA 4R96A 5EO1A 5IHLB 3Q1SL 3KYOA 2H3NB 2JCCF 4F7PB 2P49B 1PLGH 3MLUL 4DZ8A 4WHTB 3EO9L 4P5TC 1M05A 3DHMA 2NY1B 4AEHH 5T3XD 4OCWL 1A22B 4B7LA 3K8KA 4GAYA 4B5EA 1MCWW 4PY8J 5D5MF 4DVRL 4MDIA 4OZIB 3QAZC 2BZDA 1EUTA 3U4BL 5GGRA 4PJHE 3VRLF 3QJHB 2QQLH 4PY8I 1S7QB 4OF3A 5FYJD 1K8DA 4NGHH 3LB6C 4A2LA 4TSBH 4DGIH 2DJSA 3C5ZC 2EDLA 2PW1B 4U3CA 3C09C 5I8EA 3A6CL 2X1XR 3IU3B 4O2FB 4X6DE 1AE6H 4ETYA 3KLDA 4ZAKC 3QUXB 4W6YB 3R1GH 4LSPL 1OGAE 3VD3A 1J0ZA 4ZS7H 5IVZA 1GAFH 5C92A 5EBWB 1NBZB 4CW1A 2IALB 5AWNH 5J57B 4M1GL 1OTTC 3T0EB 3ZKXB 3OGCA 1Z5LA 4U1IA 4WHYG 3UDWA 2X9WA 1J8HA 2FZ3A 1MQKL 3WO4B 4Z0BL 5L8LB 5AZ2L 5BOZG 2VISB 4QOKD 2ATPA 1XIWD 1H15A 2BHYA 5I6XC 3IVKA 3VFTA 2EEAA 3CD4A 5TPWL 3CLFH 1QO3B 3JV0A 1OB1B 2OTWB 1AJ7H 3JUYA 4PR5A 5EBLB 2UWEE 4WI6A 1IC7L 3BMWA 1DCLA 4WI3A 4XC1L 2CKBA 1NFIA 4R97B 1RURH 4OUUA 4E5XA 2V9RA 3EYVA 3VD5A 2CO7B 3B9KD 4JO2H 5CZVH 2R4SH 1DBKL 3HS0B 3CUPB 1UM6H 1NBVH 2WSKA 4XP5H 2H9GA 1J0YA 2DAVA 5EPMA 4JFYA 4APQD 3VXNA 2OZ4A 1RZ8A 4NUGH 4JGJA 2I07A 1CLZL 43C9A 1ZT4B 2X4TA 1D6VL 4WO4B 5FOBA 5AG9A 1HXYA 3ZYZA 4EOWH 5DMYA 2XN9A 4EXKA 5D70L 2VL5A 3IS0X 3FT2B 2HJFA 2Z31C 3MGAA 1T1ZA 1LMKA 1FL5B 5C0FA 4XP9L 4YDKL 5DQJA 3DO7B 5F7KC 5IJKA 2QQQA 3AB0C 4P9HC 4LSRH 4PGDA 1IAMA 3BIKA 1R3HB 4LU5L 1H3VA 2J8HA 1ERNA 3EDKA 4KDWA 3ES6B 4FQIH 4A6YL 2E7LC 2GFBA 5F7FA 3IDYC 3QDJB 2RJMA 1T7ZA 1JFQL 4RQQB 3QIBB 3HMWH 1F4WL 4CMHB 3LEXA 4CJ0A 3RUGE 4M9OA 1IGTA 1Q38A 5D7IB 1ZV5A 8FABB 3L3HA 1A6AB 1CK0L 3HAEA 4XB7A 3T0DA 4HMCA 3JV6B 3T2NL 5CGYC 4FABL 2FB4H 4TVPH 3QEGL 5KJRL 3MRGA 5E2VL 4DN4L 4PJBF 5HHOA 2AJSL 9CGTA 1UZ6F 3TVMA 3MRDA 3B9AA 3SCMD 4YE4H 1EFXA 3OJDA 4ZUTA 1XZ0A 4LVHC 3BKYH 1G7LA 3AY4A 5L2JA 2PW2B 3LD8B 3STZB 5SWSE 2VJXA 3ALWA 3UC0L 1EHLL 4ONGL 2ZKHL 4N5UA 2NY5C 4G6AC 1FDLH 4X8XA 4Y4KC 5BXFA 4UUJA 1K6QL 5GRYA 3FL7A 5DUPL 5GQBA 3ZKQD 4KK9C 1QFPA 2JJTA 5EZLB 1A0QL 3DRQB 1DE4B 3SE8H 4XMKH 1E0OB 2YD6A 2B1HL 5I1AB 4QXWA 5GS2D 3WFBH 3NCJL 5C09B 4ZUWA 3GSQB 4IHOB 2DKUA 4L4JA 2DI8A 4WRLA 1Y6NR 2Q7NA 2CIKA 5DRXB 1CCZA 2GK2A 4WUUD 5I71B 4ALAH 3PGDA 2W07A 32C2B 3ULSA 2X4NA 1O5DT 5F6HJ 3JBG7 3WFDH 1J1OL 1FIGL 3FQTB 1S9XB 1RJLA 2VERN 1MNUH 4M7LH 1HHHB 1I7RB 5E00B 2AJUH 4F7EB 15C8L 4KGLA 5DEZA 3VW3L 3ARBA 1RI8A 1PX4A 5LG1A 4Y4HB 3W82A 3L3KB 4NN6C 2GHWB 3SKUD 3CVHH 2WINB 5H35A 3N06B 2NY2C 1DP0A 2OP4H 5IHZA 4M7KH 1TZGH 3NTCH 5CMAA 4HUXB 4PRBA 4TRPL 4CMMB 1NFKA 4FQHB 3QWRA 5ERWB 1CGWA 4WUUE 4XTRD 1YYMH 5F3HA 5TE4H 5GZOC 1V05A 3Q6FA 3PWPB 3B2VL 2ICWA 1ND0B 1UXWB 2GITB 2IAMB 4L4TA 3O3EB 3EGSB 4PJEF 1I7UB 4V1DB 3GSXB 3BGMA 3MCLL 5GRXG 1AGEA 4JM2D 2VDQL 4OKVA 1BQUA 4BH8B 3G5VB 3AGVA 4I3RH 3S7GA 5C2BH 4RAHA 4XVSH 5FUZH 3S4SA 4AIZB 4RZCB 1IAOB 3I2CL 4WIQA 2B2XH 3IGAB 1FO0A 3NGBB 3WN5B 1AI1L 2EO9A 3EOTL 5F7DB 1HXMB 3PUCA 2HH0L 3OKOA 3HC0B 3MBEC 3QHTC 4XHJC 5D2NA 3FB6B 1M6OB 1FL3A 1AR2A 5CSZA 2G9HA 4P9ML 4WU5A 1RUAL 3H0TB 1YECL 4NFBA 1ORSB 5ICXA 2FATH 3M8OL 1S7WA 3CMGA 5BS0D 3P0GB 2YPVH 3BEWA 2C3HA 3JTTA 3P0YL 1S78D 4XBPB 3JV4A 5DHVH 3Q0HA 1CDBA 1IM9A 3UYOD 4N0UE 1MHPL 2OM5A 3QDGE 4ZFOB 1K4CA 4Y5XA 4U6YB 2X4OA 2A0LC 5E6IA 4P2RA 3ZKMD 3NACH 5DVOA 4OF7A 2FLRT 3Q1SH 5SWQB 4KJPD 2AW2A 3V4UL 4ZFGL 1IC1A 1QFWI 4KDTA 4WDIA 3FOMB 3MLUH 3DTXA 3GJFK 1ZHNB 3EO9H 3E0GA 3HNVL 2O61A 3VXSD 2EH7L 3SE4A 1NAKH 3GMPA 1M7DA 1ZLVH 2M1KA 3ABZA 3PQYD 1KTLB 4L3AA 3PHQB 4DVRH 2ADIA 1P69B 2GW5A 3DX7A 3U7YH 2VAAA 2VLJE 1RJYB 2R2EB 5E2TL 1BQLL 4HGWA 1BPVA 5SV4A 3S36X 4Z95L 4ZXBA 4X4MA 2KQNA 3HRZA 4OGZA 3LCYA 3VA6A 3TN0B 1BVLB 1S7VB 1N8ZB 4P4KA 5IW1A 4LSPH 1OARL 4WENB 5F1KC 4U4BA 3LKNB 1BX2B 1TQCB 5IKCA 3P3YA 2W9LA 1SJHB 2BY2A 2XWBA 4OV6F 4FFYL 4M1GH 3HKFA 3CX5K 3QHFL 3RZCD 3OZ9L 4R9HA 4Z0BH 3VWJD 25C8L 5JOEA 2VO5A 5AZ2H 3FMGL 2N7BA 4X4ZA 4Z7WF 3OAUL 4ODHL 1VACA 5FO8B 5CEZE 1A02N 4Y89A 4HIHA 2FIKB 3K8MA 3LN9A 3QG7H 2OX5A 5TPWH 4C4KT 3V5KB 1I3UA 4NKMB 3IDUA 4GMTH 5CP7A 4NN5C 4BSJA 3WSQL 4RMUA 3VXRB 1I1YA 3OKDB 2OS7A 1NC2D 3PXHA 3V0AC 4OKDA 5EUOF 1IC7H 3P11L 4XC1H 3VG9C 5DD6B 4J23A 3MGOB 5JORA 4Z7UA 5GXBB 4X5XB 2MWCA 3OR6A 1FFOA 1II4E 1P5VA 3VFUA 1YN7A 1JNLL 2XICA 4PRID 3RY6A 2ZG1A 2H41A 3QUMB 4DVBB 3KDMB 5JO5A 1EXUA 1R3JA 4LSVL 1FN4A 3DSFL 5E1AB 2Z4QB 3FHQA 4AEIL 4X7SL 1WUNT 2NY0B 5D70H 2VXVL 4S1SH 1ZHLB 3LV3B 1CTNA 4PJFB 1CYGA 5MEQA 2XACC 3IJYA 2A6KB 4XP9H 3TH3T 4YDKH 3MRNA 3C5JB 1X4YA 1NKRA 2DIAA 1W72B 3MA7B 2FR4A 1CBVL 1MUJB 1YJDC 5GS0H 4XRCB 4RGNC 4WWKB 4A6YH 1MJUH 4I5BA 2JB5L 5DVKA 3WMSA 3OKNA 3KG5A 4Y7MA 1KLUA 5DZLA 2LV4A 1UJ3A 2F8VA 1F4WH 2IANA 5GRVK 3IDGB 1S9YA 1TQBC 4J3SA 4EI6B 4LCCB 1U8PB 5TDPB 5I16A 1QZ1A 4JAMB 1KACB 2LFGA 4MXWL 2P43B 1QSFB 5AAMA 1CK0H 5ACLA 4AJ0A 5J12B 1SBBA 4Y5VC 3LH2H 1IEBA 4O2CA 2D31A 4MQ7B 4FABH 3PP4H 2AEIT 3QEGH 1E4KC 3RX7A 2HLFC 2X4RB 1T1WB 5KJRH 2WP3T 4IDLA 5E2VH 5HY9B 3ZHKA 4Z78A 3ILPB 1KG0A 4BSWA 2AJSH 2D7MA 3HPLA 4GKZA 3SEPA 3NAAL 2AJYL 4KTEH 1Z6JT 2XXCB 3QCTH 4HWUA 5DJZB 4NQXB 5K33A 2EYSB 2R69L 3A0OA 2QSCL 3UC0H 1C7SA 1EHLH 4ONGH 5DEGB 1X5JA 2YUZA 2ZKHH 5JTWA 1U3HC 2DDQL 2L7JA 3ARGA 1F3DJ 2C3WA 3RVVC 1K6QH 5DUPH 1SJXA 1NCCL 3STLA 1A0QH 2B1HH 5AUMA 1JK8A 2LVEA 5JUEL 5HHQB 2BOBA 1OAZL 4KMLB 1LVEA 4XWGL 4OB5L 1TJIH 4NQCB 1LEKA 5B38B 3PWNA 2ZUYA 5ESQA 4YHPB 3ROOB 2IPKA 1NAMB 4DZBB 1T66C 3D6GA 3GBML 1Q9LA 4HMEA 5D71L 4G6ML 1QVOA 4N8VB 3RWHA 5TH2B 4ZNEE 1FIGH 3RIAK 3CFKB 3OXRA 4RA0C 3QDMB 2KZ1B 2XZQL 15C8H 1CG9A 2B4CH 3MOAL 4AQ1B 4GLRI 5ISZA 4PG9A 3T2OA 1H5BB 2IEPA 4L8BB 4LP4A 3QT2A 3G5YA 1RZIB 4UIKH 4OFYA 4UT7H 4HUNB 3QIWB 1HHKA 2JB6A 5HYJB 1LO2L 3PXJA 3CU1A 3MV8E 4JFDE 3RRQA 1BJ8A 4LRIA 3I75A 5FYKH 1JTPA 2BNUA 4YO0B 3WXVL 5CP3A 3GSVB 1TZIB 3MV7B 4KDVA 3V7AG 1GZQA 5E03A 3U7WL 3MRPB 3B2VH 3IDJB 2FO4A 3TT3L 1U0QA 3MCKB 3O6FA 5E7FA 5E9DB 3RVUD 4FXKA 1NGWB 1ZWIB 2H8PB 3GIVB 2VDQH 1E27B 2HYMA 4WFFE 3KPRD 3WL9B 3RWJA 4U0QB 1FVCB 4JFOB 1MCCA 3UTTA 2WBJC 1CFTB 5C08B 5CJOL 3EOTH 2QTEA 3CSBA 5KSBE 2VQ1B 3C6LD 1QFWM 2XZAL 5C0NC 2XKSA 3HZYB 5CIPB 4UNVA 4IMKA 3MLWH 3GSRB 1BFOA 4P9MH 4RWYL 5HI5D 5C0BB 3MUZ1 1YECH 5CD3A 3SY0B 5T1LA 1D6EA 3ARVA 4Y16C 5B38G 3M8OH 3RHWK 1ZLWH 3KJ4B 1X9QA 2NY6B 4KQ3H 1BREA 2YS4A 3RWIA 2UV3A 4N8VG 2PKDA 3D3VA 1MCLA 4OJFL 5E0QA 5FGCB 4HGKC 3V6OA 4Y2DD 1MHPH 3TWCL 4KQ4L 4IOIA 3VWKB 4KJYA 4WFGE 4PS4L 1NQBA 5TDOA 4MS8D 4N90E 2BC4A 4XXCA 4OZIF 2X1PA 5E5RB 3V4UH 4ZFGH 5IMLB 4O51B 3W0WB 4PP2B 5EULV 2X4SB 1T7YA 1LEGA 4KK5D 4KUCF 2EH7H 4TOYL 4NN7B 3VXTB 2VE6B 4QHLA 4FMKA 5IIEA 2W60A 2CSPA 2XY2A 5J1SC 1N0LA 5GRUL 5FA4A 4R3SB 1KB9K 3KPMB 3F7PC 4P5MA 1EHAA 1JPSL 4GRLB 4UBDC 4KV5F 5E2TH 1BQLH 4C54A 1EEQA 5FKAB 3PDOB 4Z95H 4KKCD 3MV9A 3WDHA 2R56L 5T3XH 4LLDA 4MQXC 5GPRA 1CXKA 1MJJA 4Q2ZB 3MJ7A 4POYA 1TVBA 5MI0C 1Q9WB 4KRNA 1TTFA 1AHWB 5D1QA 3O4LD 2VLRD 4G8GB 1LK2B 5ACZA 1FYTE 5FYJH 2DF3A 3GI9H 1T5XA 5CEZL 2W0KA 4UINL 1PYWB 4Z8FL 1YYLL 1VEMA 3QHFH 3UDWC 2QADB 3BX7C 1L9NA 25C8H 1FFPB 1OWRM 3FMGH 4C59B 4L9LA 3OAUH 1DFBL 2CR3A 2ZCLL 3F5WA 4ODHH 1TJHL 2NY1D 4FTVE 5IMKB 4M00A 1XGRB 2JKXA 2I27N 2XTJC 2AK4E 2EICA 1PX3A 4PLKC 5DJDA 2ZUUA 4F7MA 1KSRA 1CT8B 4ODXB 3T8XA 5CFHA 3WSQH 4MJIA 4IIQB 5D1ZC 1LO3L 4QWWC 3LN5A 1MCSA 2V2WA 3P11H 3RX8A 4YLQT 1YEJL 2OTUB 4FZEL 2DRUA 4HC1H 4KI5C 3OJ2C 1CDIA 4PJAF 4Z76A 5J7CC 1J05B 2CLZB 3RVXD 2APVA 2FDBP 3N1MC 1KTDB 1Q0XL 3QUXD 2EIZA 4XAWH 4J7RA 2EDKA 2Y06L 3GIZL 2R2BB 5EBMA 4LSVH 1A4JA 2GQHA 4I0KA 4X7SH 1ONQB 3U9PH 3S37X 3D25B 4HJJH 3T0ED 2VXVH 3HCVA 4NBYB 3DROA 5EC1B 4Q58C 3BPCA 2ICCA 1CGXA 3NZHH 5DMJB 3RDTA 5GRZA 5GGQL 5IJKC 3DV6B 3MRLA 2ZSVA 3LKPB 1CBVH 2NY4C 2CUMA 1E4JA 2VWEC 5ENWB 5A2JH 4Q6IB 3OKMB 3RUGA 2JB5H 3QNXB 4GRWE 4CVXB 1PZUB 3CH1B 1GGIL 3OL2A 4XPGL 2CDFA 3BN9C 5D72H 3U0PA 1XR8A 3ZHLA 2ZUXA 4MXWH 3F7YA 4RFEB 2I26N 3QQNA 2NY7L 4D0CB 3BVNA 4WFHD 5I1IL 3WIIH 1BMGA 4YDLB 5FXCH 1YPZB 4WWID 2H2SD 5JDSA 4I2XA 3EOAB 1YY9D 3VXME 3ARXA 3IDXH 2DJ4A 1BLNA 1NLDH 1SM3L 5SWSA 2OJEB 3NAAH 2AJYH 5C0IA 4WO4D 2CK2A 3S8WA 3T3MF 1HWHB 3OKKB 2QSCH 1XCQA 3U9UB 4M5ZL 1MVFA 1ZHKB 2DDQH 3VFRB 4LHUB 3NFPB 4ZTOL 4ORGA 3MGTA 1JGLH 1NCCH 5FYKU 3IRPX 1E6OL 4KKBD 2R8SL 3MO1B 3NCYS 3QDJD 1QHPA 4CJ1A 5KS9A 3FB8A 4TN9A 4XCFL 5JUEH 3QIBD 3QEQE 1T89C 5C9JA 5EOQL 4X6CE 1OAZH 4J4PD 1HQRB 3OGOE 4XWGH 4OB5H 1P4BL 4PP1D 5KSAA 1P6FA 3GGWB 4OGAD 2NXYC 4XI5C 1UC6A 1FZKA 1DQMH 4O2EB 5C0DB 2GIYA 1PQZA 5BZWA 3TIDA 5MERB 3S9DB 3N1QC 3BWAB 1F42A 4JZJB 4ONFL 4XVJL 1CLCA 4O4YL 4HS3A 4OCYL 3HE6B 4I3SH 4QT5B 4W6WB 4PJCA 5JOFB 5GS2H 3PWJA 4F9LA 5DVLA 1T04A 2XZQH 5DJ0A 3TYFB 2VDPH 3MOAH 4WEMB 3TO4C 4PJ7F 1MH5A 3ARBC 2NYYD 2ADJB 4AQOA 1OF2B 2ED9A 1OAUL 5IB5B 5K93A 3BP4B 5F3BA 2X42A 3D2UA 4OZHB 4I0PB 1LO2H 1KIRB 2LABA 1KC5L 3DRTA 1CL7H 1UFUA 2BNRA 1MCDA 5F9DC 4LKXA 2ZUQB 3IXAA 1WFNA 1SEQH 3QO1A 3FQWB 1WT5A 3H7BB 4LAQH 3FONA 3U7WH 1FZMB 5D7IE 1ZAGA 4L1HA 5CKGA 4QHNB 1OT1A 5DD0L 2ZOKB 1VPOH 3VGGA 5C09D 1DN2A 2V2TA 4L3EB 5F44A 1AGFA 2Z93A 4LHUG 3VI4F 5I8CB 4F9PA 3SE3A 3ILQD 2OK0L 3HMXL 4JFPB 5J4MA 4EN3A 1EEYB 5KVDL 2XZAH 2EDQA 3DUUB 3TEUA 3LPGA 1FG2B 1FNGA 3FZUC 3RKDC 3K4DA 2X70A 4OIAA 2WMPA 4RWYH 2EKSB 4UTAL 2NXZC 1X5IA 3U4AA 4RGMC 3GSOB 2NPLX 4DCQB 1MCFA 4Y4HD 5HYFA 1B3JA 4BH7A 1CICB 3UAJC 3G9VA 3X3FL 4N0UA 3OXSB 3FFDB 5ID1B 2W0PA 3NZ8A 4OJFH 1HIML 3KGRA 3V6ZA 1NDGA 4KI5F 2GKIA 4LEOA 1JRHL 4Y5XC 3PWPD 4F37F 4LPCA 2R2HA 2DIBA 4ZFFA 1TMCB 4R4ND 5FYJU 2IAMD 4HW6A 4V1DD 4NHCL 4KDTC 3TGXA 2G2RB 3LRSB 3RL1B 1RZKC 4LCYB 4TOYH 1CLOL 2BJML 5E5UB 5C0EB 1WLHA 4CU7A 3SE4C 1AO7B 2VYRE 1L7IH 4M8VA 1QEWA 5E94B 4JY6B 2VLJA 4WTZG 1WZKA 5GRUH 1Z0NA 3GMOA 1HKLH 4KK8C 1FQ9C 2EH8L 5I66B 1JPSH 3ARZA 4FFVD 3U1SL 4YNYB 4E0RB 1B4JL 5ETUA 4PGEB 1A4KA 1P9MA 1BFSA 1KB5B 1OWWA 3UZQA 3O4OC 5JW3H 1O7VA 1NFDE 1U8IB 2DYPA 3QJFB 2ICEB 3RA7L 4X9GA 2CDEA 4BFBD 4YBLC 2PETA 1U3JA 2AABH 3PJSA 3QH3A 1MWAB 2HVJA 1LDPL 5F21B 1R5IA 1O0VA 2VLLA 1JJUA 3PV6A 5IB3B 3REWA 3DWTA 1OTSC 2I9LA 1AD0A 1HH9B 1ETZB 3UTOA 4EXPX 2A38A 4UINH 4CNIA 5HDQL 4Z8FH 4RIRA 3ULVD 4JFFE 2QKIB 2Q76B 1MI5E 1NGZB 1DFBH 4JJ5B 3FQUB 2ZCLH 4X4XA 3NA4A 1TJHH 4YXKL 4DN3L 5GRWA 5HPOA 3E6HA 2JLLA 1LO0L 4UOW1 4BJLA 4XNXL 2DWEB 4HKJB 4OLUH 5E8EB 4NN5B 5GSRA 2OJZH 4F3FB 3WLWD 2DTSA 4NRYA 5INCA 1LO3H 4BKLA 4NUJB 1I1FA 3REVA 3MRMB 3EDDA 4ESKA 1YEJH 3CMOL 4FZEH 1G6RB 1A3RL 1ZA3B 4NWTL 2A9ML 2A6JB 3TN0D 3I6LE 4LSQL 4G42B 4H1LB 1WICA 3A6OA 1W0VB 3U46B 4OQTL 5E08H 1T7WA 1Q0XH 2R0ZL 3GIZH 1A7PL 5CBEB 3HA0A 2FEEI 2Y5TB 4HQQH 1L0QA 1JHTB 2GTWB 4P3WA 4HKXA 2WANA 2LTQC 2F5BH 5JQ6H 3QQ9C 2V2XB 3B5TA 5I1LB 5EU6B 5SWZB 3BRDA 3QXDB 3GMMB 3K8LA 4NNPH 4MA3A 1IGML 1QRKA 3LKRA 4NQVB 3VRIA 2EYRA 3QXAA 4HH9A 1OW0C 4U0RC 3C8KB 3HC4L 4RGNB 4JRYB 1QBAA 1RIUH 1RSFA 2V5RA 4I48B 5E4EC 2BK8A 5D1XC 4ZO7A 4Y5YB 3LQAL 1UJ3C 2GCYA 5EU5B 1GGIH 3VXRD 1TVDA 1KCKA 3PWUA 4XPGH 2CQVA 1X7QB 1P84J 1DQLL 1PKQB 2YN5A 4Y5VB 1EA9C 5KG9B 3MNZA 1AGDA 1FZOA 2FYYA 2YPLB 2NY7H 4ZD3L 1BEYL 5I1IH 2AQ1A 4UI2A 1J88A 4MXVF 3MRBB 5KVFH 5D2LE 5FDYA 4D3CL 3FFCB 5DD5L 3UJTL 1R5WB 3QXVA 4KK6D 1ZT1A 3C2AH 5GS1A 3TBTA 2CLVB 3BZEA 1EGJL 3Q5TA 2NY0D 4WI8A 3G5XB 4H1LG 1HHJA 1YUHB 1T3FA 3W39A 4OTXL 5DT1L 3VFSA 3BZFA 4ZTOH 2M26A 3VXRE 4YDIL 1J9CT 5HD8D 5FYLD 2YEZB 3ZLQC 1R3LB 4E41B 1KTKE 1MAKA 4WWKD 3T1WA 5B39B 4P2OB 5DA4A 5B21A 4XCFH 2AJZB 2NZ9D 3JV5A 1J8KA 1AFVL 3X12A 1UJTA 1F5WA 2BXYA 2JCCE 4PRNB 4KROC 1NCDL 2UZXB 1HYRC 4ZNEA 2FJHB 2MCG1 1QSFD 3MXVL 1T0NA 2VXSL 5C07A 5F7UA 3ARDC 2BVEA 4ONFH 4XVJH 1S9WA 4ISVA 1YMME 4O4YH 2PYEE 4OCYH 5E99H 2VUOA 5D5ME 2O5YL 4NQDE 4PJFE 4HFUH 3UTZB 1LE9A 5BOPA 3H9ZA 2HVKB 3VRLE 5CD5D 2Y25A 4N9GA 1R5VA 3L3DA 5IBLC 1KPVA 1GGUA 3MV8A 1OAUH 5FUCE 4JFDA 3QXWA 5D6DC 4LARL 3SO3C 4QRPB 4AM0B 2VN4A 1CTOA 4KXZI 5I1HL 4ELKB 2OR7A 5L6YL 3SDDB 1KC5H 5LQBL 1NCBL 3E3QC 1U8KB 1CXFA 2OMBA 4QYOB 4RX4D 5CINH 1RV6X 3D1MC 3QP3A 1OAYL 5AAWA 4XCYB 4HMDA 4MD5A 1D3CA 4HHAB 1HI6A 4YHIB 3ZL4H 4N0FB 3CH8A 2LU3A 4RA3A 3CDGA 4J3OC 1MAMH 4HWEL 4DK6A 4NQCD 4AG4H 1OSPL 1S7XB 1INQB 3U0TA 3IFLL 2OK0H 4J8RA 3DMMB 4YXLL 1P7QB 3CFDB 4KJQD 5KVDH 4FA8A 3HNSH 5B39G 5HVWA 4LCWB 1RAMA 5C0CB 4R4BA 2M2DA 1KCVL 3HMXA 2IADB 4IMLB 1OLZA 3KPSB 3QDMD 3SHSA 4UTAH 1S8DA 4I1NB 2I5YL 3O3BA 3TJHD 4OLYL 1Q0YH 5MENB 3S98A 3QIWD 5HYJD 2WIIA 1BD2B 3H9HA 4POUB 4F33B 4H26B 4PBVC 1WSST 1N6QH 4HPOH 3I6GB 3MBXH 3QRGL 5FA3A 5BRZE 3V6OC 4HXAL 4CAGA 4U1SA 4C57C 3MV7D 4Y19E 4NQCE 4NM4L 4U1KA 4PJIB 4R96B 5EO1B 4JVPA 2AAVA 1WTLA 2KKQA 3AROA 1JGVL 2GK0A 5IG7A 3KYOB 5E9DD 2E9IA 3MLTA 4NHCH 4DZ8B 1RPQA 3MJ9L 4C83B 3QR2A 1M05B 2DS4A 1MCWM 1IGCL 4GAYB 2ERJC 3TCXA 3GHBL 3WJLA 4G3YH 4KY1H 2D4DA 3O11A 4MDIB 4I77H 4WGWB 2R0KL 4EBQH 5GGRB 2EH8H 3SJVE 4ELME 3OKLA 4DTGL 3J7HA 1U8OA 4LLMA 4OBRA 2X89A 1K8DB 2UZIL 5BJTA 5C0BD 4CUCA 1A21A 4Q9RL 3I84A 4D9RD 5BV7B 1W0YT 3BP5A 1IZKA 3RA7H 4P0DA 3BPNC 2NY6D 3VJ6B 5E95B 4FQCH 3KPLA 5DYOA 1FYTA 5DJYA 4XNUL 5IVZB 1Z0MA 2E9JA 4Y1AE 3K2MC 1IT9H 3BPOC 4CW1B 2I9TA 1AGBA 1F4HA 3S3PA 1OVZA 1EDQA 3VWKD 4N0YL 2X40A 1E28A 3OGCB 1Z5LB 3MOBH 4U1IB 5DC9B 5HDQH 1QKZL 2FZ3B 5C08E 4FTVA 4PUBL 4WHYH 1BBJA 2ATPB 4GOSA 1ZVHA 1HYSC 2AK4A 1MHCA 4YXKH 3FOLA 4DN3H 1H15B 2FECI 3EO0A 3DXAA 4JY4B 4M1CD 1LO0H 2XTJB 4XNXH 3UBXI 3IVKB 3BQUC 3VFTB 1JNNH 2H32A 3Q3GA 5D6CA 1QLEH 1IARB 1FL6A 4PR5B 4GRLD 4J3WA 2F8OA 4WFED 5GJSL 1H3XA 4PJ8B 3T4YA 2CKBB 1NFIB 4OUUB 1CFSA 5FGCE 4E5XB 1SVZA 2E6PA 3CMOH 1A3RH 2XA8L 2C4FU 3B5GA 4NWTH 1QLFA 3ZKSD 3ZTJH 3BPLC 4LSQH 2ATKA 2FIRT 2H9GB 5MEOA 4M6OL 5EPMB 4OQTH 4JFYB 3VXNB 3W0WE 1RZ8B 5DUBA 2I07B 5J56B 1A7PH 1T22A 2MQ0A 43C9B 2X4TB 4G8GD 4XXDA 5FOBB 5F9AC 3RL2A 1HXYB 3G6AA 4TNWK 2XN9B 1CE1L 2VL5B 3L5JA 2HJFB 4GRWH 3OAZH 1T1ZB 5C0FB 2QADD 5GSVA 5DQJB 1MREL 5HYEA 4P57A 4PGDB 3BIKB 1GPOH 3QI9A 1A3QA 1IGMH 2E8YA 4Z0XA 1LWRA 1KPUA 2DQFA 3HC4H 1U36A 2GFBB 3CVIH 5AYUH 5KOMC 5HI4C 1HHIA 4NKOA 2MHAA 1UACL 1A1MA 2MTPA 3LEXB 3LQAH 1DTUA 4PJEE 4U7SA 1CGUA 1IGTB 4NC0B 5EO0A 1DQDL 1I85A 3L3HB 4MA8L 3VFVA 4PJ9A 3ESUF 3HAEB 3EBAA 1JI2A 3NCFB 4O5LH 4YFLF 1Q8MA 4R2GC 2K7PA 4BK5A 5IV2A 4XVTL 1BEYH 3VXMA 2ED8A 3MRGB 2B5IC 4KMQA 3DVGA 2IH3A 4D3CH 4P48A 5HHOB 1DQQB 3MUGA 4BK4A 1WWBX 3TVMB 3DV4A 3MRDB 5CCKL 3L1OL 4PG2A 1J7VR 1EFXB 3OJDB 2VLKE 2ZCKL 1XZ0B 4ZUTB 5ICYA 5DFWH 4OFVA 5H94A 1G7LB 5L2JB 5LGJB 1U3YA 4LK4A 5EOCJ 2Q1EA 4OTXH 5DT1H 2CO6B 2WWMC 1KXTB 4UUJB 5BXFB 4DKDC 1EGJA 5GISL 1RK1A 1FAKT 5F88A 3O8XC 3DIFA 3PWVA 3BZDA 4Y4FA 3MLXH 1KENL 3K0WA 3Q5OA 3QEQA 5TF0A 2AERT 2HP4A 4X6CA 4CU8A 4UU9A 4ZUWB 3LPWA 3WKNA 3JWOC 2CIKB 1F6FB 4ZYKA 1AFVH 3U0WL 5KSAC 1EJOL 5DD1H 4MVBC 4V2BA 1NCDH 3ZDYF 3PGDB 4U6HA 1WBYA 3MXVH 2ILLA 1IFHL 4QRSA 3ULSB 2X4NB 6CGTA 4N8PA 5IP4A 4M3JA 1RJLB 3ZE2F 2P45B 3NFSL 3OG6B 4HZLA 1P4LA 1OT2A 2WLYA 3CXHK 2O5YH 1WGOA 4ZQKA 1D9KC 1KCSH 4F9LC 1MRCL 3ZTNL 1CU4H 4R8WL 5HDOA 1YEGL 3ARBB 6FABH 4J2XA 1FLRL 3TBWA 3G6JF 4ZTPL 3R4DA 3FO0H 3HAEG 1JBJA 3ROLB 3MROA 4U2ZA 5DRZA 4P2QA 4OUOA 3TM6A 3U4EA 4LARH 1F6AA 4YFLI 5H35B 5DQDL 5IESL 3DYMA 4BZ1H 2JJVA 5IHZB 5CMAB 1NCBH 4PRBB 1I9IL 4LHUD 5ALBL 1EBPA 4FFZL 3VFWA 3V5DA 1OAYH 1WT5C 3Q6FB 2ICWB 2DM4A 4D94A 1KV3A 1DANU 4L4TB 2FBJL 1NEZA 4OLZH 3BGMB 1I4FA 1AGEB 2XWTA 4U6VL 5F1SA 4OKVB 1MFAL 1ZKAA 4JDVA 4OAWA 4WW2A 5DI8A 2VABA 1WISA 1P4IL 2XKNA 3S4SB 1H3UA 4HWEH 2A9NH 4J3VA 5L88L 4Z7WE 1FO0B 3MLSL 3SE3C 3D69A 3IFLH 1C08A 1PG7L 5GGUA 3F7VB 3OKOB 4YXLH 1F45A 5D2NB 3EOBA 4KAQL 3DETC 1FL3B 3VGHA 5CSZB 2G9HB 3HE6D 2XWJA 4LSSL 1KCVH 4WU5B 3C60C 2DD8L 5KVMC 4HLJA 3P4MA 5IWLC 5ICXB 4ZOEA 1S7WB 4FS0A 2I5YH 5KN5A 4OLYH 1MSPA 3BEWB 2ARJA 2YA1A 1NAML 4H5SA 1SJEA 3DYPA 4I0PD 3JV4B 3TNNA 1BBDL 4LF3A 4QKXB 2BY1A 4XC3L 5IFAL 1IM9B 1MEXL 4MHHG 4JR9L 3QRGH 1EPFA 5B4MD 1K4CB 2EYTB 3LS4L 4HXAH 2X5PA 2X4OB 2DTML 1KYOJ 4NM4H 5E6IB 4QCIA 4P2RB 2OL3L 2FX7L 1JGVH 4NP4L 4WDIB 3DTXB 2O61B 1C5BH 4L3ED 4K8RL 1GHFL 5TQ2L 1IGCH 4QHUA 4GO6B 1M7DB 3GHBH 3MJ9A 1RFDL 1JGEA 3EYQC 2EKJA 2DQDL 2ADIB 1B6UA 1N64L 2HT3C 2R0KH 3VXOA 3DX7B 3BGFC 1JVKA 2VAAB 1GOHA 3LS5H 4OZHE 3KR3L 2Z8RA 4HGWB 4M93C 2DM2A 1NFDA 2CMRL 3MYJA 5L2KE 4JO4L 4ZXBB 1A14L 4TSCL 2UZIH 3HRZB 5FECA 3ZKND 4Q9RH 1FORL 5ELIA 2ZP0T 3THML 5ITBL 4KKNA 4NQUA 1CICD 4P4KB 5IW1B 3U83A 1A5FL 1CFQA 3OHXA 4MA1B 2NW3A 3B8SA 1DEEA 2Z8WC 1NJ9A 5IKCB 3F8UB 2XWBB 4JFFA 3ARFC 1JF5A 4N0YH 3RTQA 1MI5A 3C5SA 4M9PA 2DLTA 1QKZH 3ZT5A 4TNWF 4LNVA 2FSEA 5IR1A 3NVQA 1SY6A 3X3GL 1VACB 3DNKA 5E70A 4HF5L 4HIHB 1AO7D 4QRQA 1Y6MR 2A2QT 3FO2A 1RVFL 4G9DA 2ID5A 1T6VN 5LWYL 5CP7B 2AEPL 4NJ9L 1I1YB 3ULVH 2MJWA 3KPOA 5GJSH 4CL7A 2V9QA 3EDJA 2V5YA 3WS3A 2CKNA 3KYMA 4Z7UB 5JORB 3OR6B 1CR9L 2XA8H 4KC3B 5BMFL 5SX5H 3VFUB 4XB8A 1YN7B 4X83A 5T1MA 3SGDH 1I9JL 3TJEL 4YPGA 5KBNC 4M6OH 4IRJA 3QXTA 1EXUB 1ZLUK 1G7QA 1R3JB 2R1XA 1FN4B 4LHQB 3BDXA 1HE7A 1OAXL 2LU4A 5IFHL 1T0MA 5MEQB 4N0CD 4XPBH 5F6IB 3IJYB 3MRNB 1MREH 3NIGF 4ZPTA 4U0RB 4R26L 2FR4B 4OF6A 4I5BB 5HGAA 1BP3B 3OKNB 4G9FD 5BZDA 3O9WA 4K7PX 1KLUB 1UACH 1HEZA 1UJ3B 2IANB 4GBXA 1E4XI 1S9YB 1NLBL 2CK0L 2JELL 5HVHB 5I16B 5I8OL 3VDBA 1EHXA 1DQDH 4MA8H 2Z0BA 3T65A 2DQIL 5CJQL 3T1FB 1IEBB 4O2CB 5D2LA 5T3ZD 1IC5H 1I9RL 4XVTH 3I9GL 5I74C 4RWHA 5LVEA 5FHAL 3STBA 5K9QI 5JZ7C 4X7CC 1GIGL 3SDAC 2IGFL 1KG0B 5JDJA 4BSWB 3IJHA 2CRYA 2A83A 2X2YA 3HPLB 4GKZB 2AJVH 5CCKH 3L1OH 1C7TA 3V4VL 1FAIH 3PP3H 3OAYH 4X9FA 1SJVA 3HE7C 5L8KB 4PRPD 5EU6D 4LLQA 5SWZD 3ARGB 5GISH 5A16A 1KLGA 3QUMH 2WV3A 5TFSL 3STLB 5IF0A 4QNPF 1JGDA 2GAZA 3UYRL 1KENH 4JRYD 1H3TA 3ZDZF 1A3LH 5AUMB 5EU7C 5HHME 1ACZA 1JK8B 2JCCA 1KT2A 2ADFL 4L8SC 5INDA 1CVRA 2H2PC 1LEKB 2Y5EA 4M43L 3PWNB 5ESQB 2IPKB 4HV8A 5HHXL 1YMMA 2PTUA 2PO6C 2PYEA 1V3LA 5ACMA 5D5MA 3DX6A 1Q9LB 4NQDA 3UZVB 1QVOB 3RWHB 1IQWL 5FYLH 3QISA 5D8JL 1J0IA 3MRFA 1K2DA 3NFSH 4X5LA 3GM0A 4K3GA 5C2UB 3OXRB 3W11C 1CG9B 1MRCH 5DUML 4R8WH 3VMOA 1OM3L 3ZTNH 4APQA 1UZ8A 3FFCD 4Z7QE 5ISZB 4PG9B 4ZTPH 3G5YB 2UYLA 4L1DA 1HHKB 4CRPA 3ARYA 4HS6A 3KHQA 2JB6B 4RGNE 1QR4A 1G0YR 5IESH 3RI5K 4EEEA 3NCMA 2YK1L 1A2YA 3I75B 2X09A 2BNUB 5F97E 1I9IH 3AM8A 3RVVD 3N1PC 3KWWA 4Q0XL 4FFZH 5MP6L 2KDGA 3RWGA 3T77A 2FO4B 1CE6A 5LXGH 1PKQE 3O6FB 1GGBL 2K9UA 4FXKB 4KUZL 2FBJH 4E41D 3GBLA 2DQEL 5LKNA 4XPAH 2DMKA 2YPLE 4LVNB 3GO1L 4P2OD 1TJGL 3RWJB 4JLRA 1I3GL 2KL6A 3UTTB 5IOPB 3C08L 1BJ1H 3MLSH 1MIMH 2ARJQ 1PG7H 4DOHB 2EDRA 4GQ9L 3WFZA 4KAQH 3UCRA 3W2DL 2A74A 2BSRB 2VXQH 2WUCH 1BFOB 4LSSH 3MZTA 2X4PA 3LN4A 1GC1H 1K85A 1XF2A 1VFOA 3HG1E 1C8PA 5C0GA 1YEKL 5LCVH 4LDEB 4N5ED 2ZUSA 5SX4I 4GG6F 3SCMA 1GOGA 3LHPH 3EW3B 4FQPA 4JFHD 3RWIB 1YEHL 5BRZA 5JXAH 1NAMH 3B83A 1G7HA 4QRPD 4I4WA 3D3VB 1HILA 1BBDH 4LGPB 1QYGL 4Y19A 3SDDD 4DWHA 1KELH 4PJAE 4YHOL 4JR9H 5IFAH 3FHAA 5B8CA 2J8OA 4HAGA 4XWOC 3LS4H 4IOIB 2KBGA 3C8DA 5TDOB 1T5WA 2BC4B 3CSGA 1CDUA 3VDAA 2OL3H 4TULH 4ZPVB 3VD7A 3VGAB 3I6KA 4NP4H 4M4RA 1AQDA 4XH2A 3VG0H 4PGZA 1LEGB 1XMWA 2OL3A 4K8RH 1FSKB 4XCEA 1GHFH 4QHLB 5TQ2H 2W38A 2ERJB 4YHNA 5IMMA 5IIEB 2HTKD 2W60B 2W9EH 3SJVA 4ELMA 1KXVC 3GMLA 2D9QB 1JMZA 5EFIB 5I1EL 4TQEL 2C4FT 4U1MA 1NGYA 1N64H 3DMMD 3EKCA 3RGHA 4P5MB 1P7QD 1CFBA 1BF8A 1FCGA 4LCWD 5C0CD 2C3XA 2YWYA 3MV9B 1C5CH 4JO4H 4NDMA 1A14H 3KPSD 5D7SH 2A77L 4LLDB 3DECA 1OGAB 5KTEH 3BPNB 1IGIL 1TVBB 3ARTA 5SV3A 5ITBH 4MJ2A 4EI5C 5MEND 1EO7A 3BHBB 4Y1AA 5D1QB 4GAGL 4K9EH 1A5FH 1EBAA 1BD2D 3H2WA 4PJBA 2VL4A 5JW4M 4LFHG 4PD4K 5CIPH 4JZOB 5IQ9A 4DEPC 5ACZB 3LMJL 5JR1L 4PJGE 4JDTH 3AMKA 1A9EA 4P5KA 4DUVA 5AD0A 4JHWH 2OXHA 1ZLVK 2VSDA 2NX5E 5KZCB 4LLAA 4L9LB 4H20L 1MFBL 4AT6A 5JW5A 2Q7YA 5ILTL 1UVQA 3T3ME 2X41A 3F5WB 5FV2A 3OBAA 4WNQB 3VGDA 4XBGA 5EZIH 4YHYC 3KPSE 3RPIA 3CDFA 1RVFH 3D0VA 3FRUA 4RGOL 4BZ2L 5DJDB 4F7MB 2UWEB 5LWYH 3T8XB 3ULUD 4IJ3B 4M6NH 4DKEH 4MJIB 5MENE 3AREA 4NJ9H 3LN5B 3CDCA 2GJZA 1BD2E 2V2WB 1F4AA 1AY1H 1OPGH 4OM1L 1VHPA 1NCAL 4Z76B 5BMFH 4P5TA 5I19L 4O58L 2P1YA 1E4WL 1I9JH 3TJEH 5DD3L 1I7ZA 5A1AA 3CU7A 2EIZB 3GMQA 4RFOL 1NANI 3VXPA 5EBMB 1S7SA 1A4JB 4RFNB 5F70A 3LEYL 4UQ2A 5M94B 3CDYA 2ESVA 3IT8D 4OLWL 2OMNA 2CIIB 3ZSTA 2DKMA 4JKKA 4P23D 1KB5L 4PJ7E 1IKNC 1OSZA 3DX8A 5IFHH 1NSNL 3DROB 3BPCB 5AZEL 2QSQA 1T6WA 1OTUD 3C5ZA 3RDTB 1JN6A 1U9KA 4EDXA 5JHLL 1YY8A 1SMAA 3MRLB 1HZHL 4IEFB 2ZSVB 3VE0A 4R26H 4ODUA 2XTJD 4J3XA 1H8OA 4O9HL 3RUGB 2F54E 4ZAKA 4PJEA 4OIIL 2HKHL 4NO2A 2XPGA 1ODAA 1S3KL 3QRFM 4LHJB 5K59E 1NLBH 2WWKO 3CC5A 2CDFB 2NR6D 3BW9A 2CK0H 1WC7A 5GGTL 2JELH 3U0PB 1XR8B 5I8OH 3EZ8A 4PJ8D 1I85C 3TFKD 3L9RA 3F7YB 4MJ5A 4R2GB 3BVNB 1AXTL 3WUWA 1JYNA 1I9RH 3I9GH 3H7LA 3C6SA 3EJZD 5JDSB 1J8HE 4Y8DC 1GIGH 1SMOA 2BVOA 3UPRA 1ZHBA 2VLKA 2IGFH 1DVFC 4ZMAT 1JWUA 3E6FA 4HWZB 1BLNB 4HT1L 5SWSB 3NIFF 5C0IB 3RY5A 3H42H 3V4VH 1HDMA 2XN9D 1MHHA 2XTJE 3RZCA 5IVXF 5F9WB 3O6MH 1R24A 1XCQB 1G6RL 4MAYC 5IT2L 2NW2A 5D96C 1DJSA 2AV1A 4JRXA 4OGXL 4WI5A 1TTGA 3SKMA 1A7NL 4ORGB 3SOBL 3SQOL 3MGTB 2DICA 4MLIA 1KIQA 4M02A 5TFSH 1FNSL 3UYRH 4Y4FC 5CWSA 1NCUA 4LASL 1IMHC 5I9QC 3AXLA 1CFNB 1QACA 5KS9B 3FB8B 2IMMA 5C9JB 1K5NA 5EN2A 3QUZC 2P5EE 5KSAB 4M43H 3L5IA 4XNMA 1FZKB 3H8NA 4MXQD 4LPVA 5HHXH 1MCEA 2VR4A 3WCYA 1PQZB 5BZWB 3TIDB 2Z31A 4MA7L 5FO7A 2DL9A 1IQWH 5HPMA 4HS3B 5C0AE 4JREB 4PJCB 5T1DH 2K1MA 3PWJB 1T04B 5DJ0B 3VMPA 5DUMH 1GXEA 1OM3H 3ZYOA 1G0XA 3QPQC 1WAAF 1MH5B 5HHOD 3WFCL 5GS0C 2CJUL 3TVMD 4ZNCD 2JF1A 2ZG2A 5F3BB 1EFXD 3D2UB 2VWEE 1BM3L 1UCTA 3FB5A 4LIQE 3DRTB 2PXYC 4ENEC 2YK1H 5EA0H 1HNGA 2BNRB 4LKXB 3IXAB 3QO1B 1X5AA 4H25A 4Q0XH 5J11C 3OX8A 3FONB 5MP6H 1YNTA 3CK0L 2CUIA 3NPSC 1GGBH 1G0DA 1ZE3C 4KUZH 1A47A 2DQEH 3MZGB 5C6WH 2V2TB 3X17A 2NY3C 2LU7A 1AGFB 4Z7WA 1TJGH 2Z93B 3R8QA 4X9BA 4WW2C 1NMCC 5I8KH 5F1OB 4HBCL 4LCUA 2EDFA 3C08H 3QO0A 5HHOE 4AL8L 4EN3B 3ORJA 4S1RL 4X6FA 1FNGB 4Y4KA 5TJWK 1F3JB 3W2DH 3IFNH 2QR0B 2X70B 1NEUA 2Y6SC 4LLWA 5EUOA 4UAOB 1YEKH 2A6IA 3PHOA 2E9WA 4OFPA 5D9SA 5M7QA 4JPWL 3TLRA 4BH7B 1YEHH 3C87A 2I25N 4N0UB 3DURA 3QDGB 1MAJA 2J4WL 2YSSA 3RBGA 3NZ8B 2Y7QA 5GRJL 4ZDHA 5TDNA 1D5ZA 1QYGH 2HMID 5H37G 3MRJA 4UNTA 4U6XA 4KKLC 3V6ZB 1NDGB 2I60L 3QWRD 4LEOB 4I18C 1SBSL 2R2HB 1FG9C 1R3KA 1VFAA 4ZFFB 4RNRA 4L4TD 3PABA 4XAKD 3QEHA 2B4CC 2J5LC 1ADQA 1RQ5A 4Q74A 1RUPL 1QEWB 4FP8L 4Y2OA 2VLJB 3OR7A 2VDMH 5FGBC 5I1EH 3GSNL 4TQEH 3HB3D 5E2WL 3GMOB 4GLRH 5EBGA 5L2KA 1ZLWK 3UPCA 3RNQA 4IRSC 2R1WA 5ETUB 1A4KB 3P73A 3B8YA 2GSGA 2DYPB 5F7WC 5T5FL 4OF5A 2CDEB 1UYWH 3SDYL 5F7EH 2DI7A 2RR3A 2A1WL 3MUHL 3PJSB 3QH3B 2J6EH 4L4TE 3LQMA 2HVJB 3QIUC 1XEDA 3T0VA 3OB0H 4XAKE 3FO9A 1IM9D 1R5IB 4ZO6A 2KZWA 4HUMB 1C16A 4Q9CA 4NKIH 5JR1H 2VLLB 3LMJH 3PV6B 3REWB 2I9LB 1AD0B 1U6AL 3MBEA 3I02A 2L7UA 2X1QA 4CNIB 2QV2A 2B0SH 5E6ID 4ZS6C 4RIRB 5CILL 4L5FL 4QTIL 2W91A 2P46B 4MX7A 4RMVA 3VI3F 1MFBH 2P4AB 5ILTH 4X4XB 3SQBA 3AU1A 2IBGA 3E6HB 1IGJA 3MTRA 4OCXL 5KSUA 4PY7A 4PLJD 1YNLH 3T04D 5IFJA 4RGOH 4HIJA 3GMNA 4BZ2H 1UKSA 1LNUA 5GSRB 3TESA 3SPVA 2YD7A 5INCB 3DVIA 4BKLB 1I1FB 3REVB 4BFIA 3QHZH 4ZXBD 2D3VA 5EB9A 3O2VL 5FV1L 1UWXK 1HQ4A 5EUKA 4OM1H 5DJ8A 3SDXF 5ICZB 1SEBA 5JPNA 4GH7B 1IE5A 4OM0L 2V5SA 4O58H 4P2RE 4U1GB 1HNFA 1E4WH 5DD3H 4P4KD 1F4XL 2PN5A 3QUYB 1I7TA 1Q1JH 3BH9A 1RZFH 1PY4A 4HUKB 4J12A 3RGVC 1KB5H 3HFML 1FFRA 1IBGL 3OF6D 4WHCA 1NSNH 4YC2C 2VQUA 5AZEH 1N0XH 3NH7L 5JHLH 1Z9MA 4MCYA 3LKRB 1A7QL 2ZOLA 2BVQA 3VRIB 1MWAH 2EYRB 3QXAB 4HH9B 3X13A 1XGPA 1SVCP 1ZANH 4PGCA 1JF1B 1ZVYA 4GS7C 3PHSA 2GCYB 5DXWA 2AJXL 4EVNA 3PWUB 4D9QD 2FH6A 4P46D 3GJFA 2VLME 4U3HA 3VGFA 3OJMB 3MNZB 1AGDB 1FZOB 1QSZA 2FYYB 3IKCA 5GGTA 4JVUA 1QR1A 2ORBL 4W4NA 2PR4L 4JFZH 4ZO9A 1MCRA 2CDGA 1UCBL 2F5AH 4ONOA 4YGVA 2VLRA 1ZT1B 8CGTA 4LDLB 5GS1B 1FJ1B 5L7XL 2O5ZL 4HT1H 3TBTB 2GTZA 4OZ4A 1G1CA 3MJGX 2CKBL 4G7YL 3BZEB 4RBPH 4S1QL 1U2HA 3P4NB 3E2HC 1HHJB 1T3FB 1G6RH 5IT2H 4K3EL 3ALPA 5T3ZH 3W39B 3VFSB 3NCEB 2XG4A 4OGXH 2VXTH 4H1LH 3BZFB 1A7NH 3SOBH 3SQOH 4DUXA 4KZEL 1XIWC 3EJJX 2OZ4L 2VR9A 3TZVA 3N85H 1FNSH 1MPAL 4S0TD 4ERSL 1AP2B 3I3BA 5D93B 4OZIA 1QG3A 2D7TL 4BQ6A 3AAZA 5I75C 4OQ1A 3MNVA 2IAND 3W9DA 1JZ6A