5T3HA

Bovine trypsin soaked with selenourea for 5 min
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Selenourea: a convenient phasing vehicle for macromolecular X-ray crystal structures.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t3hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t3hA02
1L1GA 3SQHE 2CHAC 3MFJA 4U30A 1P09A 1P3CA 1LVYA 4I8JA 2BVXH 1S82A 2PTNA 1SBWA 2OC8A 3EAJA 5FHTA 3RXJA 1U6QA 3O8DA 1JIRA 1RTKA 4GLYA 1NFWA 3ZZDA 2JETC 2ZG0H 2ANWA 2ZFFH 3OY6U 4UDWH 2ZHWH 3ZYDA 3ELAH 1HAZB 3ESTA 1C4Y2 2BD5A 4NGAH 1ABIH 1UTQA 1MBMA 1ZHRA 4Y0ZE 1Y3WA 2W26A 3RXHA 4CBOA 1DDJA 2Q6FA 2H5DA 1D3TB 1FMGA 3KCGH 1D4PB 1NU7B 4AB9A 3LJJA 3SV9A 3OU0A 3VB6A 4Y8ZA 1P2OA 2FX4A 2G4TA 3MO9A 4DCDA 1SGCA 1GDUA 1NTPA 1UTLM 4NIYA 5L6NH 3B9FH 3U69H 3DA9B 4Y6DA 2HALA 1K1LA 5CHAC 4AB8A 2O8UA 1LKBA 3HKIB 1O3EA 1N6XA 1RTLA 2FOCA 1O3IA 1C5YB 1DUAA 2RA0A 3Q00A 1C5WB 1BHXF 5G4BA 3V12A 3PMJA 1O5CB 3VEQB 3BF6H 4ABHA 3UWIA 3UFAA 1X7AC 3QK1A 3QTOH 4MPWA 7LPRA 3UNRA 2BD3A 3RXMA 2P95A 2GCTC 4KP0A 4VGCB 1AWHB 1XVMA 1HLTH 1C1OA 2TIOA 5F8XA 3KQBA 3P92A 4GSOA 2QY0B 1ESTA 3FAOA 4YO9A 2JKHA 2EI7A 2WPJS 9LPRA 4I8HA 1YLCA 1ELGA 1DICA 2DE8A 2TGPZ 1FY3A 4I33A 2HPQH 2A31A 3EA7A 1BJVA 2FOFA 1NESE 3ZV9A 4WJG2 1O2UA 2QCYA 1GJ4H 1BOQA 4X1QU 1MKXH 3F6UH 1UTNA 4Y79A 4YOJA 4IC5A 4TWYA 2GT8A 2NU2E 4E05H 4HZHA 2J9NA 1E36B 1OWDA 1QB6A 4NSVA 1S85A 1OWKA 1GMCG 3RLYH 3PTNA 3MNSA 3TNTA 1DM4B 1ZTKA 3TVJB 1LQEA 2Y81A 3GDSA 1BBRE 4ZHAA 5C67A 1XXFA 1S83A 3NUMA 4AX9H 3D62A 4HGCA 1GJAB 1QTFA 3GICB 1EAXA 2ZKSA 3CP7A 4I31A 1XM1A 1W11U 3AAUA 4X8TH 2F3CE 2Y5FA 1ZHMA 1G9IE 4XOJA 1V3XA 2ULLA 1TQ0B 1ZMJA 1SGDE 1O3FA 3LIWA 5EW2H 1V2JT 3M35A 5EU8A 1AI8H 3GCTG 1ELCA 3SU6A 3EE0B 4X6NA 1GVLA 1NRPH 1AO5A 2AFQB 2ZI2H 2BQ7B 1W12U 5DO4H 1SLXB 1P0SH 1SL3A 1HAOH 3RC4A 3MU0A 1PPHE 2ZGXH 1BZXE 1C5OH 1RTFB 1ZJDA 4KTUA 4DIIH 3UR6A 2XCFA 5ABWA 1C1WH 5IYTA 1GI0A 1V2PT 1XMNB 1ZGIA 3M61U 3SBKA 2YNAA 3FZZA 3NKKA 1WU1A 2FWWA 5DP8A 3SJKA 1H8IH 2ASUB 3UNSA 3QWCH 1S84A 3LGYA 3SNCA 2AGEX 4I8KA 3AW0A 1QGFA 5FPTA 2GZ7A 3P6ZB 2F91A 1BTUA 5FX6A 4RSPA 4BAKB 1ZTLA 1ETRH 1L4ZA 3MWIU 3JZ2B 1GBBA 3RXQA 2VU8E 2VWLA 3MH7A 1C2MA 1UK4A 2A2XH 1UTPA 2SGDE 4K1EA 1VGCB 2F9VA 4AYYB 4KELA 1EOLA 2A4RA 1RS0A 1HAGE 3GCHB 1KIGH 1TOMH 4MPXA 1O2YA 2BOKA 5HGGA 1GMCF 1GHXH 1TRNA 1BTYA 2RDLA 2GV6A 1SGNE 5JBBS 2FEQH 3Q3XA 1CT4E 5EQQA 3M3TA 4BTIB 3A83A 2FZZA 5AFZH 1O2TA 3MNCA 1J15A 1QR3E 4NZQA 3DD2H 3BV9B 1XUIA 2SNVA 1GG6B 3ZZCA 2C8WB 2XBWA 5EPNA 1TPSA 4X2WA 5BPEA 3NWUA 1FY8E 1GMHF 3EA9A 1AUTC 3BIVH 1EAUA 2JH0D 3MH6A 3U8OH 1BJUA 3V3MA 2PTCE 3BSQA 1MTSA 3P95A 2ZFSA 3E0NB 4ZXXH 1JOUB 1CA0B 1VITF 2FTLE 1V2UT 1A61H 2A0QB 2F9OA 4WH8A 2WYJA 1C5UA 2PGBB 2RCEA 3MO3A 4MNVA 2ZPRA 1SPJA 3NK8A 3RM2H 2BDBA 3M3SA 4FUJA 2THFB 1SGFA 1OWEA 1GHAF 1O2HA 1GCTB 2QN5T 1KLTA 2FOHA 2PUXB 3A7XA 1V2LT 1BDAA 1DSUA 1EZSC 5FPSA 5GCHG 2HNTC 3S7HB 5C3NA 2VIQA 4X1RU 2Z7FE 3RU4D 1O3NA 3TJVA 2ILNA 4O03A 2FS9A 3GY6A 3M37A 1YPHE 2WPLS 4LK4A 1Y5UT 3SO3A 2ZIQH 4X8VH 4AFQA 1CO7E 1AKSB 5LH8A 3A85A 5DKMA 2ODQA 2FXRA 1DWDH 4B2CA 2BDYA 2R3UA 3A8CA 3LH1A 3LPRA 1QIXB 4DJZB 1KLIH 1Z8JB 2CF8H 2ALPA 1SGFG 1OWHA 1BUIA 4MNWA 1TAWA 2GMTC 3TH3H 1P06A 1AHTH 1AVXA 1NRRH 5JBCS 4ZMAH 1HDTH 2ZU5A 1C5RA 3KEEA 4UFEH 4THNH 2P3TB 3SV6A 4NG9H 1GGDC 1QRZA 4ABEA 3GYLB 1W10U 2OLGA 1O0DH 3BTQE 1O2LA 1MKXK 1Z6JH 4CH8B 1CBWC 3RXBA 4NA8A 1HXEH 2IJOB 3BTWE 1ELAA 2BLQA 1GBEA 3Q76A 1RIWB 4ASHA 1AVGH 1WBGB 3SU5A 1YPKH 3SUEA 1Z8GA 1GBHA 1P2IA 1A4WH 5AFYH 5GIBA 1QL7A 3SHCH 1HFDA 4E06H 2H5CA 2ZTYA 1DLEA 2AMQA 3QGJA 3T28A 1QL9A 1VCPA 3S7KB 3WY8A 1ZRKA 2AIQA 3SNEA 1J14A 5A2MH 2A2QH 2QA9E 1OOKB 2C8XB 1O5EH 3BEIB 3SNAA 1GVKB 1PYTD 3Q3YA 3U8RH 1EASA 3MHWU 1GHBF 1ESBA 1GBCA 4FUCA 2H6MA 2PKSB 1P2KA 3OYPA 1EUFA 1QA0A 1O2QA 4FU7A 1C1TA 1MTUA 5EW1H 3TNSA 3TGKE 2FX6A 1GPZA 1HBTH 1T8LA 2OTVA 2WPKS 3RM0H 4WXIA 3TJNA 1EP6A 5T6FA 2FI3E 2GV7A 4YT6H 2XC4A 1XXDA 1AN1E 1RJXB 4BAMB 3E6PH 3LGIA 1IHSH 3IITA 1FAXA 2QF3A 4K1SA 2ZU2A 1A0LA 4X2VA 2ZC9H 2J38A 3W95A 1P2NA 2ANYA 1FAKH 1D3QB 1OYQA 3LGTA 4Y0YE 4TPYA 3RXRA 3PV4A 4INHA 3ZZ3A 4A6LA 4CHAB 4Y7AA 2UWPA 3KQEA 1PPEE 4CRAA 3O8CA 1SLUB 1K2I1 2R9PA 2VIWA 1HYLA 1LO6A 5FBIA 2F9PA 1C2HA 4K2YA 3A7YA 4ABIA 2QC2A 1V2WT 4ZUHA 1FI8A 4WY3A 3U1JB 2GCHF 1P2JA 1C1MA 2FDAA 2PWXA 1L4DA 8GCHG 3TK6A 3N7OA 2VWNA 3HKJB 3SU2A 4A1XA 1OX1A 2AGGX 1YPEH 2PKAB 2PFEA 5C5OA 1SGQE 2QIQA 4FVBA 4ZHMU 4LZ1H 1BTZA 3RXOA 3OTJE 2HPPH 4K3JA 1AKSA 3IG6B 3RLWH 1GI7B 2A7JA 4ZKNU 1KSNA 1Y3VA 4NA9H 1C2IA 1KXEA 4X8UH 2BYAX 2EEKA 3RXUA 1W8BH 1NROH 1IHTH 4K8BA 1JMOH 1NFXA 2H2ZA 2FLBH 3M7TA 1ZPBA 3OX7U 2BDCA 4YTAA 4YOGA 2GP9B 3GOVB 2CN0H 1SR5C 3KIDU 1BIOA 1S6HA 3FFGA 3PMBB 1UJ1A 1K1JA 5DP3A 2BZ6H 2W3KA 5B6OA 1O5GH 2ZF0H 1O3PB 3VGCC 1HUTH 3A89A 3LGWA 4K8YA 1P9SA 3B8JA 2FOBA 3PB1E 4F49A 1AIXH 1IQIA 1DS2E 2QXIA 4B74A 1TBRH 3MU4A 5HM2A 5A0CA 1YLDA 2D1JA 3U98H 1NY22 4UEHH 2GDEH 1V2MT 1Y5AT 1YP9A 1P2QA 2FP7B 1GMDG 3S69A 1T7CA 5DJ7A 3BTEE 1GI1A 4FUDA 1DFPA 3STIA 3O8RA 1G2LA 1MZDA 1NPMA 4D8NA 4UE7H 1HCGA 1INCA 1CT2E 5JBTA 1EX3A 2ZFQH 1AFQB 2D2DA 4NFFA 3SQEE 3LDXH 1TRYA 2G5VA 4U2WA 1O33A 1OWIA 1J17T 2ZDLA 3MNBA 3E91A 1BMNH 2XWBI 5A8ZA 2G52A 2GD4B 1O3DA 1LMWB 1MU8B 3FVFB 1AE5A 1A5IA 1C9TA 1G2MA 2QXJA 4X8SH 4ABBA 2Z94A 3V0XA 2B0FA 2Z9LA 4I32A 1GDNA 3A87A 7GCHF 1TLDA 1DUEA 4O97A 3PTBA 4IMQA 4XFQA 5A0BA 1TA2A 1W13U 1C5PA 1VJ9U 1EAIA 1SFIA 3M5LA 1NFYA 3GYMA 2ANMH 4QT8C 1C2JA 1WCZA 1J16A 1KTTB 2BY5X 4FU8A 2Q1JA 2PKAA 4JCNA 5H4IB 2BDHA 5C1XA 3BTKE 5ETXA 2ZECA 4JYVH 1PQ8A 2FYRA 5DP4A 2ZGCA 1C5SA 2JH6D 4AFZA 1W7XH 3R0FA 3F9GA 4ZAEA 2WPMS 1BMLA 3ZZBA 3I77A 3GY8A 2TGTA 1GI4A 3RXKA 2PR3A 3LT3A 4BNRA 2OCVB 2JETB 1ETTH 1GBDA 1UCYE 1FUJA 2R0LA 3QZQA 1UVUH 1A46H 4R8TB 1O39A 5E0JA 3V13A 3EYDA 4GUXA 1GBMA 3RC5A 2G5NA 3T2NA 1WUNH 2AIPA 3QO6A 4Y76A 1H9HE 2NWNA 4FUFA 2ZFRH 2FODA 1CQQA 3RXVA 3E16B 1GI9B 3VB4A 1AVWA 2J92A 1FONA 1XVOA 2ANKH 1CHGA 2BD4A 3ZVGA 1AMHA 2GDDA 3HGNA 5CHAB 1AGJA 1AQ7A 3R3GB 3SU1A 3LC3A 2ESTE 1QA7A 1Y8TA 1WSSH 3TH2H 2FOGA 2J34A 5AHGH 1O3AA 2QAAA 2IOTA 2Y82A 2A4OA 1TX6A 1E34B 3ZVFA 1GVZA 3A7ZA 1VJAU 2BX3A 1TNIA 4AYVB 1CT0E 1BTHH 2Y5GA 2ZCHP 1KLJH 4K1TA 1LPZB 4Y8XA 1K1OA 4ZH8A 3H7TA 1P57B 4JK6A 4WMEA 5GXPA 4GPGA 1DOJA 1ANEA 2DUCA 1ZTJA 2STBE 1UVPA 2BX4A 3A88A 3RXLA 2OQUA 5AVDA 4GCHG 1FPHH 2BB4A 7ESTE 1TNHA 4VGCC 2ZDNA 3QX5H 2G81E 2UWOA 3UQVA 5LPEA 3BTTE 3Q3KA 2XCNA 2ZGJA 3SGQE 1HJAB 5J4SA 1AB9B 1O34A 4D76A 2Y5HA 1DWEH 4MG3A 2Z3EA 1G30B 1SGIB 1L1NA 3BEFB 3LGUA 3RXSA 5HXFA 4OS5A 2BQWB 1C2DA 1UTMA 2VGCB 1O3CA 3GDUA 4UONA 2ZHQH 1GBAA 1VCQA 2W7SA 3RMNH 4ESTE 3UIRA 1Q3XA 5C20A 1WTHD 2ODPA 1L1JA 4YOIA 1S81A 2SFAA 2TGDA 3TU7H 1TMBH 2BLWA 2WINI 2V3HH 1BTPA 3E90B 1KTSB 3AW1A 4OS6A 2FESH 1DX5M 4A5TS 1NRQH 5F6MA 3FZDA 3SU0A 4IN2A 2NU1E 1ANBA 3SGAE 4ISNA 4WMDA 2GZ9A 4UFDH 1UVOA 1GI3A 3UR9A 2AGIX 3EDXB 3RXDA 4XE4A 3TPIZ 4IW4E 2XWAA 3VPKA 3ITIA 1SGYE 4YT7H 4ZHLU 2VIOA 5EXNA 4GVUA 3TGJE 4E7RG 4DOQA 3SV2H 3T26A 3I29A 1C9PA 3ODDA 1D6RA 3TK9A 2BY7X 1XUFA 1C1VH 5EXMA 1TALA 2BDGA 4JZEH 2NU4E 1F0SA 1MD8A 2OC0A 1QRXA 3P8GA 1UK3A 1Z1IA 1YCPH 1C4U2 1XKBC 4CRBA 1ACBE 4JK5A 1RD3B 2I6QA 4ZKOU 2ZPQA 1O31A 1IQEA 1EAWA 5EOKA 1QQ4A 2TRMA 3MH5A 3RXFA 3PLPA 1GI5A 3ZZ5A 2BQ6B 4H6SB 4K60A 4AGJA 1DXWA 3AASA 1O2NA 3RDZA 1O5AB 1T8OA 2OBQA 2XBXA 4GAWA 3M7UA 4ABAA 1TYNA 3UTUH 2AERH 4ISLA 4OS7A 3SJOA 1EQ9A 4B1TA 3PM3A 4JZ1A 3HPTB 1TX7A 1IOEA 3GISB 1ELDE 2JH5D 1CVWH 2QV1A 3STJA 4JYTA 5EQRA 2ZFTA 4DY7B 1HIAB 1WV7H 3ZVEA 1D9IA 1VGCC 3KF2A 2WPIS 4H6TA 5E2PA 4KKDA 2ZU4A 3BTGE 1P12E 4ISOA 1LCYA 5C1UA 1KXFA 1P2MA 3ZVCA 2Q6DA 1MTNB 3LU9B 1E0FD 4GHQA 2ZCLP 1KYNA 1G3CA 4NSYA 1T8MA 1YPLH 2ZTXA 1DY9A 3GCTF 2D26C 1GG6C 3ATWA 1ZZZA 3MU1A 5DP7A 1HXFH 1P8VC 1SGTA 1AE8H 4A1VA 3QUMP 1Q31A 3A8BA 2OUAA 3JZ1B 1UMAH 1GHZA 1O3GA 2ZCKP 4O9VA 1GBFA 3LC5A 1GBJA 1O2JA 2HWLB 1EPTB 4NIWA 3H7OA 1TNLA 3PYHA 3TJOA 1Q2WA 1A0JA 1NO9H 1BQYA 4IN1A 1CA0C 4YLUA 1A2CH 1ZMNA 3P8FA 4H4FA 1LVMA 2VVUA 1TNJA 2CXVA 1FY5A 1O2SA 1TGCA 1YC0A 2ZQ1A 4CRDA 4LXBH 1BRBE 1HPGA 1FQ3A 1AZ8A 1O30A 1SC8U 3MU5A 3SUDA 3BG4B 1H8DH 1S0QA 2PSXA 4OS4A 4AFUA 3GY3A 3PROA 1GCTC 4SGBE 4JYUH 1ID5H 5F03A 1O35A 2FO9A 1C5XB 1EOJA 4AORA 3H5CB 1O2PA 2HNTE 2IN2A 4KGAA 1NN6A 1TGSZ 1K1NA 4K5ZA 3E8LA 1SSXA 3CENA 1V2NT 1MBQA 4TY7A 8KME2 1TONA 1JXPA 3O8BA 1JRSA 1BRUP 5AF9H 5ESBA 4X6MA 2BVRH 1ESAA 4TY6A 2BTCE 3GY4A 1NS3A 2GMTB 1DXPA 1ZRBA 3ZYEA 1W7GH 2AMDA 3DT0H 2FI5E 2V3OH 1YCPM 1CGHA 3E1XB 3U9AH 1TABE 1GGDB 2J4IA 4JMYA 3QZRA 1PJPA 2FI4E 1DVAH 1M9UA 2VIPA 1CBWB 5GPIB 1QCPA 5DP9A 4F4OC 1MTWA 2F9NA 2H9TH 1J8AA 4X6OA 2XC0A 3S9AA 1FPCH 3P8NA 4Q7ZA 1ABJH 2Y7ZA 1FLEE 4I8GA 2P8OB 2Z9IA 1BTXA 1CE5A 2H9HA 3M5MA 3U8TH 3ZVAA 1RIWC 3QDZB 4ZROA 7KMEH 3GCNA 4PROA 1SLVB 2CMYA 2PSYA 1HJ8A 3HGPA 3GY7A 3URDA 1K1MA 1HIAA 1FV9A 1ZPCA 3ZZ4A 1ARBA 3M3VA 1LPKB 1DY8A 5GCHF 1BHXB 1E38B 3PO1B 3VB7A 5K7RA 5JB8S 3QGNB 1IQMA 4HFPB 3MH4A 2LPRA 1DPOA 2A7HA 2PKSC 2B7DH 1ZYOA 1FIWA 4NWKA 4Z6AH 1QY6A 1EZUC 4I7YH 1YPMH 3NZIA 2IPHA 4XDEA 1A7SA 1DT2A 1JWTA 3G01A 1F92A 4WVPE 4O3TA 1CSOE 1DSTA 2Y6TA 1Z7KA 3LKWA 1TPAE 4GHTA 2BOHB 2C8ZB 4XBBA 2OQ5A 2G55A 2Y80A 3RC6A 1YCPK 1SGEE 2G51A 1ELEE 2BLOA 3ODFA 5EODA 1GDQA 2ZHEH 4NZLA 1EPTA 1GJ9B 1O37A 2KAIB 3S0NA 3BTFE 4LOYH 3RMOH 2Z9KA 1C1RA 1CGIE 1ZSKA 1LHGH 2BMGB 1MQ5A 4CHAC 2DE9A 1DE7H 1HAVB 1XX9A 4A1TA 3RMMH 1NZQH 2CGAA 5L2ZH 1PPGE 4MDSA 1VCWA 1TMUH 2WV5A 1C4V2 2A45B 1TE0A 3M5OA 1Y5BT 1TPPA 1Y3YA 4AFSA 2F9BH 2Z3CA 1SHHB 2WUCA 1BTWA 4WMFA 5EQSA 6GCHG 1ELTA 4MVNA 1ELFA 3LJOA 1ARCA 2HRVA 1XKAC 2GTBA 4TPIZ 1XUHA 3F9FA 1DWCH 1UHBB 5F8ZA 1N8OB 4DW2U 1GJBB 4FUBA 4FU9A 1GBLA 1QNJA 3DHKH 1TA6A 3NXPA 3TIUA 2FOEA 3VFEA 2ZU3A 4XBDA 3F9HA 1MCVA 3UQOA 3ZZ9A 1EKBB 1PFXC 2F83A 3MOCA 2SGAA 1K1PA 1PYTC 3VXEH 4LZ4B 1Z8IB 3SNDA 1V2QT 2VH6A 1RXPA 3LH3A 3A8DA 1F0TA 3TH4H 3E0PB 5A8XA 4AN7A 1OSSA 4BAOB 1BRAA 5LGOA 2C8YB 2G00A 1TQ7B 1L2EA 4M7GA 1A1RA 4CREA 1CHOG 4YM9A 1O2OA 2PUQH 5FXLA 1B0EA 5FBEA 4YZUA 2B9LA 1WAYB 1LHDH 2ZHFH 1CU1A 2NU3E 3SI4H 4X0WU 2ZWLH 1V6DA 4ISHH 1MKWH 2C3SA 1G3EA 1Z1JA 4MNYA 6CHAB 3U1IB 1EZXC 4XSKU 2ZP0H 4DURA 3PLBA 3V7TA 1YPJH 4NIXA 3PLKA 4BTTB 3K6ZA 4MLFB 1F5KU 1UTKA 2CV3A 2VVVA 2ZDAH 4DT7B 3A82A 4BAQB 1O3LA 6LPRA 1P03A 3KGPA 8GCHF 4CRCA 5HMAA 1AY6H 4X2XA 3F9EA 2AH4X 1O3MA 2XC5A 1LQDB 5E2OA 1F7ZA 2XBVA 2UUFB 1O2XA 3UWJH 2Z6BD 5C5NA 1ANCA 3VB3A 2HLCA 3M36A 2ZHDA 2VNTA 2YNBA 1EATA 3UOPA 3SORA 1TOCB 4B2AA 1MQ6A 4CR9A 1C5TA 4INKA 3T27A 4AZ2B 3Q77A 3M7QA 1P05A 1A0HB 1QJ7B 1H1BA 1G37A 4AG1A 1V2OT 1TMTH 3L33A 2J95A 2M5TA 2OINA 2ZNKH 2ZZUH 3MNXA 1TX8A 3MI4A 3D23A 5DP6A 5CE1A 1MAYA 3P8OA 5DK1A 1QBNA 1MZAA 2VWMA 1SOTA 3MTYA 1HAVA 4FVDA 2HGTH 2H1UA 4ABFA 4KTCA 2SGPE 2P16A 3RU4T 1O5FH 1MUEB 2EC9H 2WUBA 1LHCH 1YM0A 3L3TA 3UNQA 5EGMA 1ANDA 2ALVA 3GY2A 1QJ6B 4U01A 1O5DH 3T25A 3A81A 1GJ7B 3BTHE 2CHAB 2OBOA 1O2IA 3K9XB 3I78A 4RN6A 4INLA 1O36A 4HTCH 1CGJE 1Y59T 4AOQA 5FCKA 1UVSH 1GMDF 3A7WA 2J2UA 1UHBA 3TJUA 1UCYH 3GY5A 1O2ZA 1FDPA 1GHVH 1GJ8B 1N1LA 5FAHA 2FOMB 4NWLA 4FUGA 1E37B 3SUGA 1C1NA 2TGAA 4H42U 1ZSJA 1THPB 3ZVBA 5TCAA 4MQAA 1UVTH 1IQJA 2ZFPH 4I8LA 1H4WA 2A1DB 1G3BA 1TGTA 4FUIA 1GWAA 2VJ1A 1UO6A 2A5AA 1W0ZU 4Q80A 2EI6A 1T31A 1DITH 1HAXB 2VIVA 3MYWA 4AGKA 4CR5A 2SNWA 3RXTA 2ZA5A 1S0RA 3ATMA 3T29A 1EXFA 3KQDA 1SHYA 1BCUH 3S9CA 1QBVH 2P59A 1C2GA 1TBQH 2B5TB 1FN8A 1TWXB 2GCTB 1PPBH 4DG4A 3ZZ7A 1XUGA 3QN7A 1W2KH 2XTTB 3A84A 1V2TT 4DGJA 2AEIH 1UK2A 3RXPA 4U32A 2A4GA 2Z9GA 4CBNA 1NC6A 1ZR0A 4ZXYH 5HYOA 1YPGH 2BY8X 2QYIA 1ZGVA 4KTSA 1GJ5H 2ZGBH 1ETSH 3FP7E 5TJXA 1F5LA 1C2FA 1D3DB 3NCLA 2UUJB 1HJ9A 1O2VA 4BAHB 4IBLH 1O3OA 4B76A 5E0GA 5EXLA 5JYIA 4XBCA 1A3BH 2GZ8A 3KHVA 3UY9A 5L30H 1ELVA 1IAUA 1AZZA 4B75A 1ZMLA 1C1PA 4OGXA 3UOUA 1YYY1 1LHFH 2XYAA 3FANA 2YOLA 3BIUH 1EB2A 1HJAC 1AB9C 2BD8A 2FMJA 1PQ5A 1T4VH 1JRTA 1EB1H 1T32A 2LNCA 3FP6E 4MPUA 1BBRH 1ZSLA 3CS7A 1MH0A 4ABDA 2VGCC 1G3DA 4SGAE 1TBZH 2AMPA 3ZZ6A 5JPMH 1P11E 1MAXA 4WH6A 1P10A 4K69A 5EPYA 1HAIH 1QRWA 3DFJA 5GWZA 2QF0A 4D9QA 1MKWK 2BD7A 1KDQB 1MCTA 3ZZAA 4UFFH 4DVAU 4JZDH 3PMHB 2XRCA 1ZJKA 3AAVA 3K2UA 2H9EH 3KNXA 3T5FH 2BDIA 3OY5U 3SZNA 2BDAA 2PW8H 2ZQ2A 2SGEE 1GMHG 1TGBA 3CS0A 4BANB 4ABJA 1OXGA 4BXWA 5HM9A 1O2WA 3A8AA 5F8TA 2I6SA 1EZQA 2QXGA 2UUYA 1EP5A 4D7GA 1UTJA 4FUEA 3ZVDA 2ZPSA 5E0HA 5FPYA 1VITG 1SQOA 1TNKA 3MMGA 3A7TA 2QGRA 4FUHA 2O9QA 2O8MA 1ELBA 1WYKA 1MMJN 4GCHF 3SI3H 1K28D 2FIRH 1C2KA 1QHRB 3P70B 3ZZ8A 1QB9A 1GHAG 1OYTH 1THSH 1LVOA 2WYGA 3SJIA 2ZO3H 1EJMA 5FCRA 4O3UA 1SVPA 2GGVB 2WPHS 2O8TA 3AVZA 9ESTA 4J2YB 1BT7A 1EJAA 1FJSA 1O2RA 3T62A 4Q7YA 1B0FA 1NM6A 2V6NA 3TLOA 2V35A 3SU4A 2A5KA 2CJIA 3SV7A 2FLRH 2STAE 1C5LH 1V2ST 3RXAA 1E35B 3BN9A 1WTGH 2BZAA 1KXBA 2F9UA 3DFLA 2R3YA 3LONA 1P04A 5T6GA 5SGAE 1PQ7A 1W3CA 3GCHC 4NA7A 2XNIA 2SGFE 1OWJA 2B8OH 1SGRE 4MTBA 1TB6H 2XBYA 2PV9B 4RKJB 1C5QA 2BY9X 1K22H 1AWFH 1CA8B 3ZV8A 2BD9A 1UCYK 4B2BA 1PPCE 3P17H 5BRRE 1RFNA 1FIZA 2P93A 3SGBE 5JDUB 1JIMA 2VB0A 1MTNC 2FM2A 4R0IA 4UFGH 5TCCA 1GJ6A 2VINA 1GBTA 5T3HA 2ZDMA 3SV8A 5K0HA 3SW2B 1ZLRA 4RKOB 2Y7XA 1FNIA 2Z9JA 3RP2A 3C27B 1DANH 2ZGHA 2A32A 4Y71A 1O2MA 2ODYB 2J94A 2Q6GA 3A86A 1G32B 1O3JA 1C2EA 1EPTC 5DG6A 4D7FA 1N6YA 1GHBG 4OGYA 3FP8E 3BTDE 1UTOA 1YPHC 1J9CH 1KDQA 3URCA 3A80A 4JZFH 3E3TA 3OSYA 4WF8A 3BG4C 1P02A 3UUZA 1F0UA 5EG4A 4A92A 1SQAA 2HVXA 2NU0E 4IS5A 5LPRA 4YESB 3QTVH 4MPVA 3W94A 5JB9S 3ATKA 1T4UH 5E8EH 2BLVA 1BRCE 1O2GH 1JBUH 2EA3A 3BG8A 1TRMA 2P3UB 5J4QA 1RRKA 1FXYA 1HNEE 2Z3DA 1WOFA 3UPEA 1YF4A 1Z6EA 3ENSB 1OPHB 2UUKB 1QBOA 3KL6A 2GVFA 1D6WA 4B71A 3NPSA 2R2MB 2PHBA 1YKTA 1C5MD 1HV7A 3HK6B 1C2LA 5C1YA 4Q2KA 4JZIA 4X1PU 4IC6A 1LVBA 5IDKA 4IGDA 4CH2B 3RXIA 1K21H 1O3KA 1P9UA 1THRH 1BB0B 1B5GH 2GCHG 1BBRK 2G8TA 2BD2A 1S6FA 2BXTH 3D49H 4FXGH 3C1KA 3TGIE 3RMLH 3MO6A 3F68H 1O5BB 3RXEA 3B23B 5ESTE 1C5VA 5A0AE 4AG2A 1LHEH 3ATIA 1FY4A 2AYWA 2BXUH 1V2KT 3KN2A 5L2YH 2R2WU 1W14U 3M5NA 1V2VT 2P8OC 3LOXA 5C2ZA 3SUFA 1BITA 1P01A 1GJDB 5CMXH 2ZU1A 2O8LA 4NIVA 4ZKSU 2C90B 4WWYA 1HB0B 1WQVH 1KXDA 2VH0A 5I25A 3QLPH 2FS8A 1GHWH 4ABGA 3S9BA 1LDTT 4X2YA 1NRSH 4Z0KA 3L6PA 1H9IE 1OKXA 1NT1A 3PO1C 3TK5A 2RA3A 3LGVA 3VXFH 1SI5H 1BMAA 5PTPA 1HAPH 1TPOA 2CF9H 2GT7A 1ORFA 1GI8B 1HAYB 3K6YA 2P3FH 1QFKH 2EI8A 3EQ0H 4BTUB 1D3PB 1XUJA 2RG3A 1HGTH 3RU4E 2W3IA 1HAHH 2BVSH 2TBSA 2O8WA 4X1SU 3RUOA 1QURH 3SN8A 4IMZA 1ZHPA 4Y11E 1K9OE 1IQKA 4BOHA 2ZDKA 1EJNA 4B73A 3GCOA 1BA8B 2AS9A 1TIOA 2FPZA 5T6DA 1QQUA 1V2RT 2OD3B 1LKAA 1O32A 2FTMA 2P94A 4MNXA 1OP2A 1GL0E 1GI2A 2GKVE 3UREA 2D8WA 3F1SB 1LPGB 5JBAS 1F5RA 1IQHA 1RGQA 1TNGA 1MD7A 1W0YH 1GHYH 1NFUA 1GL1A 1GJCB 2C93B 2BY6X 1IQLA 1GI6A 3KQCA 3SOSA 1GBKA 1A5GH 2XW9A 1O38A 3EA8A 5DP5A 1AUJA 3SJ8A 1GBIA 4A7IB 2C4FH 2ZTZA 2TPIZ 1N8OC 1Y3XA 1DLKB 3SNBA 1OP8A 1SG8B 2PGQB 4CRFA 1NU9A 1P3EA 4Y7BA 2WV4A 3BTME 5DGJA 2OP9A 3VGCB 2ZDVH 2FYQA 1FZZA 4D9RA 2SGQE 1PPZA 7GCHG 3ATLA 3D65E 1ZOMA 1O3BA 3RXGA 1H9LB 1YGCH 4BXSA 1O3HA 1QL8A 4YLQH 1C1SA 3DUXH 5I46H 2VVCA 1O2KA 4X1NU 2A4QA 2BHGA 1IQGA 1VR1H 1G36A 2PLXA 3TITA 4OS2A 2OC1A 4NFEA 3HK3B 8LPRA 4CRGA 1IQNA 3SU3A 1SGPE 2A7CA 1MTVA 1DWBH 2VIDA 6CHAC 1F0RA 4Y8YA 1KY9A 5DPAA 1SFQB 3PWCA 5A8YA 8ESTE 3K65B 1VZQH 4Y10E 6GCHF 1GCDA 1SMFE 1KXAA 1Z71A 2V0BA 1K1IA 3VB5A 1SOZA 1AFQC 4WXVA 1F2SE 1QJ1B 1MU6B 4HI3A 1SB1H 2R0KA 1FN6A 2OC7A 4Q7XA 4TWWA 1C1QA 5GJ4B 3MU8A 1XUKA 3SJ9A 2KAIA 2GX4A 1A3EH 1S5SA 1AU8A 4X6PA 4E7NA 1YBWA 2UWLA 1A5HA 5LPFA 4NCYA 2XXLA 4OS1A 3SHAH 1TGNA 2K1QA 5FX5A 1FY1A 1C1UH 2A5IA 1PQAA 2W7UA 1C5ZB 3A7VA 2HNTF 1C5NH 5GDSH 1VITH 3HATH 4J1YA 2G4UA 5A09A 1WQSA 3BEUA 2FOAA 1CHOF 1SQTA 4ZKRU 1BMMH 1OS8A 2VWOA 1ZPZA 2QXHA 4DIHH 6ESTA 1QB1A 1B7XB 1AFEH 1OP0A 4TYDA 1HRTH 2W5EA 1L0ZA 1Z8RA 1LTOA 1NRNH 1KXCA 1T8NA 4ISIH 4UD9H 1PPFE 3EGKH 1IQFA 3PWBA 3GDVA 3IWMA 1Y3UA 2ZEBA 3RXCA 1TFXA 1SLWB 2HOBA 2BM2A 3PMAB 1AD8H 2OXSA
chains in the Genus database with same CATH superfamily
1L1GA 3SQHE 2CHAC 3MFJA 4U30A 2VBCA 1P09A 1P3CA 1LVYA 4I8JA 2BVXH 1S82A 2PTNA 1SBWA 2OC8A 3EAJA 5FHTA 2OK5A 3RXJA 1U6QA 3O8DA 1JIRA 1RTKA 4GLYA 1NFWA 3ZZDA 2JETC 2ZG0H 2ANWA 2ZFFH 3OY6U 4UDWH 2ZHWH 3ZYDA 3ELAH 1HAZB 3ESTA 1C4Y2 2BD5A 4NGAH 1ABIH 1UTQA 1MBMA 1ZHRA 4Y0ZE 1Y3WA 2W26A 3RXHA 4CBOA 1DDJA 2Q6FA 2H5DA 1D3TB 1FMGA 3KCGH 1D4PB 1NU7B 4AB9A 3LJJA 3SV9A 1YY3A 3OU0A 3VB6A 4Y8ZA 1P2OA 2FX4A 2G4TA 3MO9A 4DCDA 1SGCA 1GDUA 1NTPA 1UTLM 4NIYA 5L6NH 3B9FH 3U69H 3DA9B 4Y6DA 2HALA 1K1LA 5CHAC 4AB8A 2O8UA 1LKBA 2L74A 3HKIB 1O3EA 1N6XA 4RT1A 1RTLA 2FOCA 1O3IA 1C5YB 1DUAA 2RA0A 3Q00A 1C5WB 1BHXF 5G4BA 3V12A 3PMJA 2F4LA 1O5CB 3VEQB 3BF6H 4ABHA 3UWIA 3UFAA 1X7AC 3QK1A 3QTOH 4MPWA 7LPRA 3UNRA 2BD3A 3RXMA 2P95A 2GCTC 4KP0A 4VGCB 1AWHB 1XVMA 1HLTH 1C1OA 2TIOA 5F8XA 3KQBA 3PV2A 3P92A 4GSOA 2QY0B 1ESTA 3FAOA 4YO9A 2JKHA 2EI7A 5HIZA 2WPJS 3EE7A 9LPRA 4I8HA 1YLCA 1ELGA 1DICA 2DE8A 2TGPZ 1FY3A 5KGOA 4I33A 2HPQH 2A31A 3EA7A 1BJVA 2FOFA 4TSFD 1NESE 3ZV9A 4WJG2 1O2UA 2QCYA 1GJ4H 1BOQA 4X1QU 1MKXH 3F6UH 1UTNA 4Y79A 4YOJA 4IC5A 2YMSC 2GT8A 2NU2E 4TWYA 4E05H 4HZHA 2J9NA 1E36B 1OWDA 1QB6A 4NSVA 1S85A 1OWKA 1GMCG 3RLYH 3PTNA 5EIYA 3FN8A 3MNSA 3TNTA 1DM4B 1ZTKA 3TVJB 1LQEA 2Y81A 3GDSA 1BBRE 4ZHAA 5C67A 1XXFA 1S83A 3NUMA 5F53A 4AX9H 3D62A 4HGCA 1GJAB 1QTFA 3GICB 1EAXA 2ZKSA 3CP7A 4I31A 1XM1A 1W11U 3AAUA 4X8TH 2F3CE 2Y5FA 1ZHMA 1G9IE 4XOJA 1V3XA 2ULLA 2V3MA 1TQ0B 1ZMJA 1SGDE 1O3FA 3LIWA 5EW2H 1V2JT 3M35A 5EU8A 1AI8H 3GCTG 1ELCA 3SU6A 3EE0B 4X6NA 1GVLA 1NRPH 1AO5A 2AFQB 2ZI2H 2BQ7B 1W12U 5DO4H 1SLXB 1P0SH 1SL3A 1HAOH 3RC4A 3MU0A 1PPHE 2ZGXH 1BZXE 1C5OH 1RTFB 1ZJDA 5EJ1A 4KTUA 4DIIH 3UR6A 2XCFA 4HG6A 5ABWA 1C1WH 5IYTA 1GI0A 1V2PT 1XMNB 1ZGIA 3M61U 3WW7A 3SBKA 2YNAA 3FZZA 2WPDD 1WU1A 3NKKA 2FWWA 5DP8A 3SJKA 1H8IH 2ASUB 3UNSA 3QWCH 1S84A 3LGYA 3SNCA 2AGEX 4I8KA 3AW0A 1QGFA 5FPTA 2GZ7A 3P6ZB 2F91A 1BTUA 5FX6A 4RSPA 4BAKB 1ZTLA 1ETRH 1L4ZA 3MWIU 3JZ2B 1GBBA 3RXQA 2VU8E 2VWLA 3MH7A 1C2MA 1UK4A 2A2XH 1UTPA 2SGDE 4K1EA 1VGCB 2F9VA 4AYYB 4KELA 1EOLA 2A4RA 1RS0A 1HAGE 3GCHB 1KIGH 1TOMH 4MPXA 1O2YA 2BOKA 5HGGA 1GMCF 1GHXH 1TRNA 1BTYA 2RDLA 2GV6A 1SGNE 5JBBS 2FEQH 3Q3XA 1CT4E 5EQQA 3M3TA 4BTIB 3A83A 2FZZA 5AFZH 1O2TA 3MNCA 1J15A 1QR3E 4NZQA 3DD2H 3BV9B 1XUIA 2SNVA 1GG6B 3ZZCA 2C8WB 2XBWA 5EPNA 1TPSA 4X2WA 5BPEA 3NWUA 1FY8E 1GMHF 3EA9A 1AUTC 4ZCNA 3BIVH 1EAUA 2JH0D 3MH6A 3U8OH 1BJUA 2KCOA 3V3MA 2PTCE 3BSQA 4RT0A 1MTSA 4XRNA 3P95A 4Z1MD 2ZFSA 3E0NB 4ZXXH 1JOUB 1CA0B 1VITF 2FTLE 1V2UT 1A61H 2A0QB 2F9OA 4WH8A 2WYJA 1C5UA 2PGBB 2RCEA 3MO3A 4MNVA 2ZPRA 1SPJA 3NK8A 3RM2H 2BDBA 3M3SA 4FUJA 2THFB 1SGFA 1OWEA 1GHAF 1O2HA 1GCTB 2QN5T 1KLTA 2FOHA 2PUXB 3A7XA 1V2LT 1BDAA 1DSUA 1EZSC 3N7EA 5FPSA 5GCHG 2HNTC 3FOAA 3S7HB 5C3NA 2VIQA 4X1RU 2Z7FE 3RU4D 1O3NA 3TJVA 1YWUA 2ILNA 4O03A 2FS9A 3GY6A 3M37A 1YPHE 2WPLS 4LK4A 3SZEA 1Y5UT 3SO3A 2ZIQH 4X8VH 4AFQA 1CO7E 1AKSB 5LH8A 3A85A 5DKMA 2ODQA 2FXRA 1DWDH 4B2CA 2BDYA 2R3UA 3A8CA 3LH1A 3LPRA 1QIXB 4DJZB 1KLIH 1Z8JB 4ACBA 2CF8H 4Q4LA 2ALPA 1SGFG 1OWHA 1BUIA 4MNWA 1TAWA 2GMTC 3TH3H 1P06A 1AHTH 1AVXA 1NRRH 5JBCS 2RDEA 4ZMAH 1HDTH 2ZU5A 1C5RA 3KEEA 4UFEH 4THNH 2P3TB 3SV6A 4NG9H 1GGDC 1QRZA 4ABEA 3GYLB 1W10U 2OLGA 1O0DH 3BTQE 1O2LA 1MKXK 1Z6JH 4CH8B 1CBWC 3RXBA 4NA8A 1HXEH 2IJOB 3BTWE 1ELAA 2BLQA 1GBEA 3Q76A 1RIWB 4ASHA 1AVGH 1WBGB 3SU5A 1YPKH 3SUEA 1Z8GA 1GBHA 1P2IA 1A4WH 5AFYH 5GIBA 4Q63A 1QL7A 2J98B 3SHCH 1HFDA 2LP6A 4E06H 5C94A 2H5CA 2ZTYA 1DLEA 2AMQA 3QGJA 3T28A 1QL9A 1VCPA 3S7KB 3WY8A 1ZRKA 2AIQA 3SNEA 1J14A 5A2MH 2A2QH 2QA9E 1OOKB 2C8XB 1O5EH 3BEIB 3SNAA 1GVKB 1PYTD 3Q3YA 3U8RH 1EASA 3MHWU 1GHBF 1ESBA 1GBCA 4FUCA 2H6MA 2PKSB 1P2KA 3OYPA 1EUFA 1QA0A 1O2QA 4FU7A 1C1TA 1MTUA 5EW1H 3TNSA 3TGKE 2FX6A 1GPZA 1HBTH 1T8LA 2OTVA 2WPKS 3RM0H 4WXIA 5IK2D 3TJNA 1EP6A 5T6FA 2FI3E 2GV7A 4YT6H 2XC4A 1XXDA 1AN1E 1RJXB 4BAMB 1K0HA 3E6PH 3LGIA 1IHSH 3IITA 1FAXA 2QF3A 4K1SA 1OHHD 2ZU2A 1A0LA 4X2VA 2ZC9H 2J38A 3W95A 1P2NA 2ANYA 1FAKH 1D3QB 1OYQA 3LGTA 4Y0YE 4TPYA 3RXRA 3PV4A 4INHA 3ZZ3A 4A6LA 4CHAB 4Y7AA 2XNDD 2UWPA 3KQEA 1PPEE 4CRAA 3O8CA 1SLUB 1K2I1 2R9PA 2VIWA 1HYLA 3F2HA 1LO6A 5FBIA 2F9PA 1C2HA 4K2YA 3A7YA 4ABIA 2QC2A 1V2WT 4ZUHA 1FI8A 4WY3A 3U1JB 2GCHF 1P2JA 1C1MA 2FDAA 2PWXA 4B6EA 2JDID 1L4DA 8GCHG 3TK6A 3N7OA 2VWNA 3F2FA 3HKJB 3SU2A 4A1XA 1OX1A 2AGGX 1YPEH 2PKAB 2PFEA 5C5OA 1SGQE 2QIQA 4FVBA 4ZHMU 4LZ1H 1BTZA 3RXOA 3OTJE 2HPPH 4K3JA 1AKSA 3IG6B 3RLWH 1GI7B 2A7JA 4ZKNU 1KSNA 1Y3VA 4M9FA 4NA9H 5CHBA 1C2IA 1KXEA 4X8UH 2BYAX 1NBMD 2EEKA 1W8BH 1NROH 3N99A 3RXUA 1IHTH 4K8BA 1JMOH 1NFXA 2H2ZA 2FLBH 3M7TA 1ZPBA 3OX7U 2BDCA 4YTAA 4YOGA 2GP9B 3GOVB 5T1VA 2CN0H 1SR5C 3KIDU 1BIOA 1S6HA 3FFGA 3PMBB 1UJ1A 1K1JA 5DP3A 2BZ6H 2W3KA 5B6OA 4B6FA 1O5GH 2ZF0H 1O3PB 1W0KD 4XD7D 3VGCC 1HUTH 3A89A 3LGWA 4K8YA 1P9SA 3B8JA 2FOBA 3PB1E 4F49A 2J98A 1AIXH 1IQIA 1DS2E 2QXIA 4B74A 1TBRH 3DSGA 3MU4A 5HM2A 5A0CA 1YLDA 2D1JA 3U98H 1NY22 4UEHH 3UAIC 2GDEH 1V2MT 1Y5AT 1YP9A 1P2QA 2FP7B 1GMDG 3S69A 1T7CA 5DJ7A 3BTEE 1GI1A 4FUDA 1DFPA 3STIA 3O8RA 1G2LA 1COWD 1MZDA 1NPMA 4D8NA 2IJD1 4UE7H 1HCGA 1INCA 1CT2E 5JBTA 1EX3A 2IPQX 2ZFQH 1AFQB 2D2DA 3F0OA 4NFFA 3SQEE 3LDXH 1TRYA 2G5VA 4U2WA 1O33A 1OWIA 1J17T 2ZDLA 3MNBA 3E91A 1BMNH 2XWBI 5A8ZA 2G52A 2GD4B 3VG8A 1O3DA 1LMWB 1MU8B 3FVFB 1AE5A 1A5IA 1C9TA 1G2MA 2QXJA 4X8SH 2KFWA 4ABBA 2Z94A 3V0XA 2B0FA 1NBME 2Z9LA 4I32A 1GDNA 3A87A 7GCHF 1TLDA 1DUEA 4O97A 3PTBA 4IMQA 4XFQA 5A0BA 1TA2A 1W13U 1C5PA 1VJ9U 1EAIA 1SFIA 3M5LA 1NFYA 3GYMA 2ANMH 4QT8C 1C2JA 1WCZA 1J16A 1KTTB 2BY5X 4FU8A 2Q1JA 2PKAA 4JCNA 5H4IB 2BDHA 5C1XA 3BTKE 5ETXA 2ZECA 4JYVH 1PQ8A 2FYRA 5DP4A 2ZGCA 1C5SA 2JH6D 2KM0A 4AFZA 1W7XH 3R0FA 3F9GA 4ZAEA 2WPMS 1BMLA 3ZZBA 3I77A 3GY8A 2TGTA 1GI4A 3RXKA 2KX4A 1H8HD 2PR3A 3LT3A 4BNRA 2OCVB 2JETB 1ETTH 1GBDA 1UCYE 3SYJA 1FUJA 2R0LA 3QZQA 1UVUH 3WWBA 1A46H 4R8TB 1O39A 5E0JA 3V13A 3EYDA 4GUXA 1GBMA 3RC5A 2G5NA 3T2NA 2WZQA 1WUNH 2AIPA 3QO6A 2WV9A 4Y76A 1H9HE 2NWNA 2K8IA 2ZFRH 2FODA 1CQQA 4FUFA 3RXVA 3E16B 1GI9B 3VB4A 1AVWA 2J92A 1FONA 1XVOA 2ANKH 1CHGA 2BD4A 3ZVGA 1AMHA 2GDDA 3HGNA 5CHAB 1AGJA 1AQ7A 3R3GB 3SU1A 3LC3A 2ESTE 1QA7A 1Y8TA 1WSSH 3TH2H 1BMFD 2FOGA 2J34A 5AHGH 1O3AA 2QAAA 2IOTA 2Y82A 2A4OA 1TX6A 1E34B 3ZVFA 1GVZA 3A7ZA 1VJAU 2BX3A 1TNIA 4AYVB 1CT0E 1BTHH 2Y5GA 2ZCHP 4ASUD 1KLJH 4K1TA 1LPZB 4Y8XA 1K1OA 4ZH8A 3H7TA 1P57B 4JK6A 3U28C 4WMEA 5GXPA 4GPGA 1DOJA 1ANEA 1SKYE 1ZTJA 2DUCA 2STBE 1UVPA 2BX4A 3A88A 3RXLA 2OQUA 5AVDA 4GCHG 1FPHH 2BB4A 7ESTE 1TNHA 4VGCC 2ZDNA 3QX5H 2G81E 2UWOA 3UQVA 5LPEA 3BTTE 3Q3KA 2XCNA 2ZGJA 3SGQE 1HJAB 5J4SA 1AB9B 1O34A 4I86A 4D76A 2Y5HA 1DWEH 4MG3A 2Z3EA 1G30B 1SGIB 1L1NA 3BEFB 2K0QA 3LGUA 3RXSA 5HXFA 4OS5A 2BQWB 1C2DA 1UTMA 2VGCB 1O3CA 3GDUA 4UONA 2ZHQH 1GBAA 1VCQA 2W7SA 3RMNH 4ESTE 3UIRA 1Q3XA 5C20A 1WTHD 2ODPA 1L1JA 4YOIA 1S81A 4F48B 2SFAA 2TGDA 3TU7H 1TMBH 2BLWA 2WINI 2V3HH 1BTPA 3E90B 1KTSB 3AW1A 4OS6A 2FESH 1DX5M 4A5TS 1NRQH 5F6MA 3FZDA 3SU0A 4IN2A 2NU1E 1ANBA 3FO8D 3SGAE 4ISNA 4WMDA 2GZ9A 4UFDH 1UVOA 1GI3A 3UR9A 2AGIX 3EDXB 3RXDA 4XE4A 3TPIZ 4IW4E 2XWAA 4P00A 3VPKA 3ITIA 1SGYE 4YT7H 4ZHLU 2VIOA 5EXNA 4GVUA 3TGJE 4E7RG 4DOQA 3SV2H 3T26A 3I29A 1C9PA 3ODDA 1D6RA 3TK9A 2F43B 2BY7X 1XUFA 1C1VH 5EXMA 1TALA 2BDGA 4JZEH 2NU4E 1F0SA 2RFKC 1MD8A 2OC0A 1QRXA 3P8GA 1UK3A 1Z1IA 1YCPH 1C4U2 1XKBC 3NRLA 4CRBA 1ACBE 4JK5A 1RD3B 2I6QA 4ZKOU 2ZPQA 1O31A 1IQEA 1EAWA 5EOKA 1QQ4A 2TRMA 2HVYB 3MH5A 3RXFA 3PLPA 1GI5A 3ZZ5A 2BQ6B 4H6SB 4K60A 4AGJA 1DXWA 3AASA 1O2NA 3RDZA 1O5AB 1T8OA 2OBQA 2XBXA 1VKYA 4GAWA 3M7UA 4ABAA 1TYNA 3UTUH 2AERH 4ISLA 4OS7A 3SJOA 1EQ9A 4B1TA 3PM3A 4JZ1A 3HPTB 1TX7A 1IOEA 3GISB 1ELDE 2JH5D 2WSSD 1CVWH 2QV1A 3STJA 4JYTA 5EQRA 2ZFTA 4DY7B 1HIAB 1WV7H 3ZVEA 1D9IA 1VGCC 3KF2A 2WPIS 4H6TA 5E2PA 4KKDA 2ZU4A 3BTGE 1P12E 4ISOA 1LCYA 2AHME 5C1UA 1KXFA 1P2MA 5C0UA 3ZVCA 2Q6DA 1MTNB 3LU9B 1E0FD 4GHQA 2ZCLP 1KYNA 1G3CA 4NSYA 1T8MA 1YPLH 2ZTXA 1DY9A 3GCTF 2D26C 1GG6C 3ATWA 1ZZZA 1H8ED 3MU1A 5DP7A 1HXFH 1P8VC 1SGTA 1AE8H 2W6JD 4A1VA 3QUMP 1Q31A 3A8BA 5EJZA 2OUAA 3JZ1B 1UMAH 1UW7A 1GHZA 1O3GA 2ZCKP 4O9VA 1GBFA 3LC5A 1GBJA 1O2JA 2HWLB 1EPTB 4NIWA 3H7OA 1TNLA 3PYHA 3TJOA 1Q2WA 1A0JA 1NO9H 1BQYA 4IN1A 1CA0C 4YLUA 1A2CH 1ZMNA 3P8FA 4H4FA 1LVMA 2VVUA 1TNJA 2KCYA 2CXVA 1FY5A 1O2SA 1TGCA 1YC0A 2ZQ1A 4CRDA 4LXBH 1BRBE 1HPGA 1FQ3A 1AZ8A 1O30A 1SC8U 3MU5A 3SUDA 3BG4B 1H8DH 2KR7A 1S0QA 2PSXA 4OS4A 4AFUA 3GY3A 3PROA 1GCTC 4SGBE 4JYUH 2PP6A 1ID5H 5F03A 3N7DA 1O35A 2FO9A 1C5XB 1EOJA 4AORA 3H5CB 1O2PA 2HNTE 2IN2A 4KGAA 1NN6A 1TGSZ 1K1NA 4K5ZA 3E8LA 1SSXA 3CENA 1V2NT 1MBQA 4TY7A 8KME2 1TONA 1JXPA 3O8BA 1JRSA 1BRUP 5AF9H 3DSOA 5ESBA 4X6MA 1W0JD 2BVRH 1ESAA 4TY6A 2BTCE 3GY4A 1NS3A 2GMTB 1DXPA 1ZRBA 3ZYEA 1W7GH 2AMDA 3DT0H 2FI5E 2JJ1D 2V3OH 1YCPM 1CGHA 3E1XB 3U9AH 1TABE 1GGDB 2J4IA 4JMYA 3QZRA 1PJPA 2FI4E 1DVAH 1M9UA 2VIPA 1CBWB 5GPIB 1QCPA 5DP9A 4F4OC 1MTWA 2F9NA 2H9TH 1J8AA 4X6OA 2XC0A 3S9AA 1FPCH 3P8NA 1KMHB 4Q7ZA 3PRDA 1ABJH 2Y7ZA 1FLEE 4I8GA 2P8OB 2Z9IA 1BTXA 1CE5A 2H9HA 3M5MA 3U8TH 3ZVAA 1RIWC 3QDZB 4ZROA 7KMEH 2QF5A 3GCNA 4PROA 2PSYA 2CMYA 1HJ8A 3HGPA 3GY7A 3URDA 1K1MA 1HIAA 1FV9A 1ZPCA 3ZZ4A 4DT4A 1ARBA 3M3VA 1LPKB 1DY8A 5GCHF 2V7QD 1BHXB 1E38B 2W6ID 3PO1B 3VB7A 5K7RA 5JB8S 3QGNB 1IQMA 4HFPB 3MH4A 2LPRA 1DPOA 2A7HA 2PKSC 2B7DH 5HIYA 1ZYOA 1FIWA 4NWKA 4Z6AH 1QY6A 1EZUC 4I7YH 1YPMH 3NZIA 2IPHA 4XDEA 1A7SA 1DT2A 1JWTA 3DSPA 1F92A 3G01A 4WVPE 4O3TA 1CSOE 1DSTA 2Y6TA 1Z7KA 3LKWA 1TPAE 4GHTA 2BOHB 2C8ZB 4XBBA 2OQ5A 2G55A 5DSFA 2Y80A 3RC6A 1YCPK 1SGEE 2G51A 1ELEE 2BLOA 3ODFA 5EODA 1GDQA 2ZHEH 4NZLA 1EPTA 1GJ9B 1O37A 2KAIB 3S0NA 3BTFE 4LOYH 3RMOH 2Z9KA 1C1RA 1CGIE 1ZSKA 1LHGH 2BMGB 1MQ5A 4CHAC 2DE9A 1DE7H 1HAVB 1XX9A 3OE7D 3RMMH 4A1TA 1NZQH 2CGAA 5L2ZH 1PPGE 4MDSA 1VCWA 1TMUH 2WV5A 1C4V2 2A45B 1TE0A 3M5OA 1Y5BT 1TPPA 1Y3YA 4AFSA 2F9BH 2Z3CA 1SHHB 5EJLA 2WUCA 2J5UA 1BTWA 4WMFA 5EQSA 6GCHG 1ELTA 4MVNA 1ELFA 3LJOA 1ARCA 2HRVA 1XKAC 2GTBA 4TPIZ 4P02A 1XUHA 3F9FA 1DWCH 1UHBB 5F8ZA 1N8OB 4DW2U 1GJBB 4FUBA 4FU9A 1GBLA 1QNJA 3DHKH 1TA6A 3NXPA 3TIUA 2FOEA 3VFEA 2ZU3A 4XBDA 3F9HA 1MCVA 3UQOA 3ZZ9A 1EKBB 1PFXC 2F83A 3MOCA 2SGAA 1K1PA 1PYTC 3VXEH 4LZ4B 1Z8IB 3SNDA 1V2QT 2VH6A 1RXPA 3LH3A 3A8DA 1F0TA 3TH4H 3E0PB 5A8XA 4AN7A 1OSSA 4BAOB 1BRAA 5LGOA 2C8YB 2G00A 1TQ7B 1L2EA 4M7GA 1A1RA 4CREA 1CHOG 2KCAA 4YM9A 1O2OA 2PUQH 5FXLA 1B0EA 5FBEA 4YZUA 2B9LA 1WAYB 1LHDH 2ZHFH 3AK5A 1CU1A 2NU3E 3SI4H 4X0WU 2ZWLH 1V6DA 4ISHH 1MKWH 2C3SA 1G3EA 1Z1JA 4MNYA 6CHAB 3U1IB 1EZXC 2KZ4A 4XSKU 2ZP0H 4DURA 3PLBA 3V7TA 1YPJH 4NIXA 1E1RD 3PLKA 5DN6D 4BTTB 3K6ZA 4MLFB 1F5KU 1UTKA 2CV3A 2VVVA 2ZDAH 4DT7B 3A82A 4BAQB 1O3LA 6LPRA 1P03A 3KGPA 8GCHF 4CRCA 3GS9A 5HMAA 1AY6H 4X2XA 3F9EA 2AH4X 1O3MA 2XC5A 1LQDB 5E2OA 1F7ZA 2XBVA 2UUFB 1O2XA 3UWJH 2Z6BD 5C5NA 1ANCA 3WWFA 3VB3A 2HLCA 3M36A 2ZHDA 2VNTA 2YNBA 1EATA 3UOPA 3SORA 1TOCB 4B2AA 1MQ6A 4CR9A 1C5TA 4INKA 3T27A 4AZ2B 3Q77A 3M7QA 1P05A 2JJ2D 1A0HB 1QJ7B 1H1BA 1G37A 4AG1A 1V2OT 1TMTH 3L33A 2J95A 2M5TA 2OINA 2ZNKH 2ZZUH 3OAAD 3MNXA 1TX8A 3MI4A 3D23A 1YLNA 5DP6A 5CE1A 1MAYA 3P8OA 5DK1A 1QBNA 1MZAA 2VWMA 1SOTA 3MTYA 1HAVA 4FVDA 2HGTH 2H1UA 4ABFA 5KECA 4KTCA 2SGPE 2P16A 3RU4T 1O5FH 1MUEB 2EC9H 2WUBA 1LHCH 1YM0A 3L3TA 3UNQA 5EGMA 1ANDA 2XOKD 2ALVA 3GY2A 1QJ6B 4U01A 1O5DH 3T25A 3A81A 1GJ7B 3BTHE 4TT3D 2CHAB 2OBOA 1O2IA 3K9XB 3I78A 4RN6A 4INLA 1O36A 4HTCH 1CGJE 1Y59T 4AOQA 5FCKA 1UVSH 1GMDF 2YMSD 3A7WA 2J2UA 1UHBA 1S6LA 3TJUA 1UCYH 3GY5A 1O2ZA 1FDPA 1GHVH 1GJ8B 1N1LA 5FAHA 2FOMB 4NWLA 4FUGA 1E37B 3SUGA 1C1NA 2TGAA 4H42U 1ZSJA 1THPB 3KQ5A 3ZVBA 5TCAA 4MQAA 3F3BA 1UVTH 1IQJA 2ZFPH 4I8LA 1H4WA 2A1DB 1G3BA 1TGTA 4FUIA 1GWAA 2VJ1A 1UO6A 2A5AA 1W0ZU 4Q80A 2EI6A 1T31A 2EQNA 1DITH 1HAXB 2VIVA 3MYWA 4AGKA 4CR5A 4RI0A 2SNWA 3RXTA 2ZA5A 1S0RA 3ATMA 3T29A 1EXFA 3KQDA 1SHYA 1BCUH 3S9CA 1QBVH 2P59A 1C2GA 1TBQH 2B5TB 1FN8A 1TWXB 2GCTB 1PPBH 4DG4A 3ZZ7A 1XUGA 3QN7A 5HKKD 1W2KH 2XTTB 3A84A 1V2TT 4DGJA 2AEIH 1UK2A 3RXPA 4U32A 2A4GA 2Z9GA 4CBNA 1NC6A 1ZR0A 4ZXYH 5HYOA 1YPGH 2BY8X 2QYIA 1ZGVA 4KTSA 1GJ5H 2ZGBH 1MABB 1ETSH 3FP7E 5TJXA 1F5LA 1EFRD 1C2FA 1D3DB 3NCLA 2UUJB 1HJ9A 1O2VA 4BAHB 4IBLH 1O3OA 4B76A 5E0GA 5EXLA 5JYIA 4XBCA 1A3BH 2GZ8A 3KHVA 3UY9A 5L30H 1ELVA 1IAUA 1AZZA 4B75A 1ZMLA 1C1PA 2YMSB 4OGXA 3UOUA 1YYY1 1LHFH 2XYAA 3FANA 2YOLA 3BIUH 1EB2A 1HJAC 1AB9C 2BD8A 2FMJA 1PQ5A 1T4VH 1JRTA 1EB1H 1T32A 2LNCA 3FP6E 4MPUA 4AC9A 1BBRH 3DCLA 1ZSLA 1SQRA 3CS7A 1MH0A 4ABDA 2VGCC 1G3DA 4SGAE 1TBZH 2AMPA 3ZZ6A 5JPMH 1P11E 1MAXA 2M2AA 4WH6A 1P10A 4K69A 1E1QD 5EPYA 1HAIH 1QRWA 3DFJA 5GWZA 2QF0A 4D9QA 1MKWK 2BD7A 1KDQB 1MCTA 3ZZAA 4UFFH 4DVAU 4JZDH 3PMHB 2XRCA 1ZJKA 3AAVA 3K2UA 2H9EH 3KNXA 3T5FH 2BDIA 3OY5U 3SZNA 2BDAA 2PW8H 2ZQ2A 2SGEE 1GMHG 1TGBA 3CS0A 4BANB 4ABJA 1OXGA 4BXWA 5HM9A 1O2WA 3A8AA 4OM9A 5F8TA 2I6SA 1EZQA 2QXGA 2UUYA 1EP5A 2QE7D 4D7GA 1UTJA 4FUEA 3ZVDA 2ZPSA 5E0HA 3OFND 5FPYA 1VITG 1SQOA 1TNKA 3MMGA 3A7TA 2QGRA 4FUHA 2O9QA 2O8MA 1ELBA 1WYKA 1MMJN 4GCHF 3SI3H 1K28D 2FIRH 1C2KA 1QHRB 3P70B 3ZZ8A 1QB9A 1GHAG 1OYTH 1THSH 1LVOA 2WYGA 3SJIA 5KEDA 1QZ8A 2ZO3H 1EJMA 5FCRA 4O3UA 1SVPA 2GGVB 2WPHS 2O8TA 3AVZA 2LELA 9ESTA 4J2YB 1BT7A 1EJAA 1FJSA 1O2RA 3T62A 4Q7YA 1B0FA 1NM6A 2V6NA 3TLOA 2V35A 3SU4A 2A5KA 2CJIA 3SV7A 2FLRH 2STAE 1C5LH 1V2ST 3RXAA 1E35B 3BN9A 1WTGH 2BZAA 1KXBA 2F9UA 3DFLA 2R3YA 3LONA 1P04A 5T6GA 5SGAE 1PQ7A 1W3CA 3GCHC 4NA7A 2XNIA 2SGFE 1OWJA 4FOUC 2B8OH 1SGRE 4MTBA 1TB6H 2XBYA 2PV9B 4RKJB 5C17A 3CNRA 1C5QA 2BY9X 1K22H 1AWFH 1CA8B 3ZV8A 2BD9A 1UCYK 4B2BA 1PPCE 3P17H 5BRRE 1RFNA 1FIZA 2P93A 3SGBE 5JDUB 1JIMA 2VB0A 1MTNC 2FM2A 4R0IA 4UFGH 5TCCA 1GJ6A 2VINA 1GBTA 5T3HA 2ZDMA 3KYGA 3FKSD 3SV8A 3SW2B 5K0HA 1ZLRA 4RKOB 2Y7XA 1FNIA 2Z9JA 3RP2A 2CK3D 3C27B 1DANH 2ZGHA 2A32A 4Y71A 1O2MA 2ODYB 2J94A 2Q6GA 3A86A 1G32B 2OXSA 1O3JA 1C2EA 1EPTC 5DG6A 4FETA 4D7FA 1N6YA 1GHBG 4OGYA 3FP8E 3BTDE 1UTOA 1YPHC 1J9CH 1KDQA 3URCA 3A80A 4JZFH 3E3TA 3OSYA 4WF8A 3BG4C 1P02A 3UUZA 1F0UA 3KYFA 5EG4A 4A92A 1SQAA 2HVXA 2NU0E 4IS5A 5LPRA 4YESB 3QTVH 4MPVA 3W94A 5JB9S 3ATKA 1T4UH 5E8EH 2BLVA 1BRCE 1O2GH 1JBUH 2EA3A 3BG8A 1TRMA 2P3UB 5J4QA 1RRKA 1FXYA 1HNEE 2Z3DA 1WOFA 3UPEA 1YF4A 1Z6EA 3ENSB 1OPHB 2UUKB 1QBOA 3KL6A 2GVFA 1D6WA 4B71A 5FL7D 3NPSA 2R2MB 2PHBA 1YKTA 1C5MD 1HV7A 3HK6B 1C2LA 5C1YA 4Q2KA 4JZIA 4X1PU 4IC6A 1LVBA 5IDKA 4IGDA 4CH2B 3RXIA 1K21H 2JIZD 1O3KA 1P9UA 1THRH 1BB0B 3PV5A 1B5GH 3F2GA 2GCHG 1BBRK 2G8TA 2BD2A 1S6FA 2BXTH 3D49H 4FXGH 3C1KA 3TGIE 1WDIA 3RMLH 3MO6A 3F68H 1O5BB 3RXEA 3B23B 5ESTE 1C5VA 5A0AE 4AG2A 1LHEH 3ATIA 1FY4A 2AYWA 2BXUH 1V2KT 3KN2A 5L2YH 2R2WU 1W14U 3M5NA 1V2VT 2P8OC 3LOXA 5C2ZA 3SUFA 1BITA 4F55A 1P01A 1GJDB 5CMXH 2ZU1A 2O8LA 4NIVA 4ZKSU 2C90B 4WWYA 1HB0B 1WQVH 1KXDA 2VH0A 5I25A 3QLPH 2FS8A 1GHWH 4ABGA 3S9BA 1LDTT 4X2YA 1NRSH 4Z0KA 3OEHD 3L6PA 1H9IE 1OKXA 1NT1A 3PO1C 3TK5A 2RA3A 5GNDA 3LGVA 3VXFH 1SI5H 1BMAA 5PTPA 1HAPH 1TPOA 2CF9H 2GT7A 2L6OA 1ORFA 1GI8B 1HAYB 3K6YA 2P3FH 1QFKH 2EI8A 3EQ0H 4BTUB 1D3PB 1XUJA 2RG3A 1HGTH 3RU4E 2W3IA 1HAHH 2BVSH 2TBSA 2O8WA 4X1SU 3RUOA 1QURH 3SN8A 4IMZA 1ZHPA 4Y11E 1K9OE 1IQKA 3OEED 4BOHA 2ZDKA 1EJNA 4B73A 2QF4A 3GCOA 1BA8B 2AS9A 1TIOA 2FPZA 5T6DA 1QQUA 1V2RT 2OD3B 3UB0A 3PRBA 1LKAA 1O32A 2FTMA 2P94A 4MNXA 1OP2A 1GL0E 1GI2A 2GKVE 3H09A 3UREA 2D8WA 3F1SB 1LPGB 5JBAS 1F5RA 1IQHA 1RGQA 1TNGA 1MD7A 1W0YH 1GHYH 1NFUA 1GL1A 1GJCB 2C93B 2BY6X 1IQLA 1GI6A 3KQCA 3SOSA 1GBKA 1A5GH 2XW9A 1O38A 3EA8A 5DP5A 1AUJA 3SJ8A 1GBIA 2GJGA 4A7IB 2C4FH 2ZTZA 2TPIZ 1N8OC 1Y3XA 1DLKB 2WHXA 3SNBA 1OP8A 1SG8B 2PGQB 4CRFA 1NU9A 1P3EA 4Y7BA 2WV4A 4ACAA 5B6LA 3BTME 5DGJA 2OP9A 3VGCB 2ZDVH 2FYQA 1FZZA 4D9RA 2SGQE 1PPZA 7GCHG 3ATLA 3D65E 1ZOMA 1O3BA 3RXGA 1H9LB 1YGCH 4BXSA 1O3HA 1QL8A 4YLQH 1C1SA 3DUXH 5I46H 2VVCA 1O2KA 4X1NU 3MQKC 2A4QA 2BHGA 1IQGA 1VR1H 1G36A 2PLXA 3TITA 4OS2A 2OC1A 4NFEA 3HK3B 8LPRA 4CRGA 1E79D 1IQNA 3SU3A 1SGPE 2A7CA 1MTVA 1DWBH 2VIDA 6CHAC 1F0RA 4Y8YA 2HLDD 1KY9A 5DPAA 1SFQB 3PWCA 5A8YA 2J97A 8ESTE 3K65B 2KCPA 1VZQH 4Y10E 6GCHF 3F0PA 1GCDA 1SMFE 1KXAA 1Z71A 2V0BA 1K1IA 3VB5A 1SOZA 1AFQC 4WXVA 1F2SE 1QJ1B 1MU6B 4HI3A 1SB1H 2R0KA 1FN6A 2OC7A 4Q7XA 4TWWA 1C1QA 5GJ4B 3MU8A 1XUKA 3SJ9A 2KAIA 2GX4A 1A3EH 1S5SA 1AU8A 4X6PA 4E7NA 1WXRA 1YBWA 3OTPA 2UWLA 1A5HA 5LPFA 4NCYA 2XXLA 4OS1A 3SHAH 1TGNA 2K1QA 5FX5A 4YXWD 1FY1A 1C1UH 2A5IA 1PQAA 2W7UA 1C5ZB 3A7VA 2HNTF 1C5NH 5GDSH 1VITH 3HATH 2EY4C 4J1YA 2G4UA 5A09A 1WQSA 3BEUA 2FOAA 1CHOF 1SQTA 4ZKRU 1BMMH 1OS8A 2VWOA 1ZPZA 2QXHA 4DIHH 6ESTA 1QB1A 1FX0B 1B7XB 1AFEH 1OP0A 4TYDA 1HRTH 2W5EA 1L0ZA 5CDFE 1Z8RA 5C0TA 1LTOA 1NRNH 3W1EA 1KXCA 1T8NA 4ISIH 4UD9H 1PPFE 3EGKH 1IQFA 3PWBA 3GDVA 3IWMA 1Y3UA 2ZEBA 3RXCA 1TFXA 1SLWB 2HOBA 2BM2A 3PMAB 1AD8H 1SLVB 3ZIAD
chains in the Genus database with same CATH topology
1L1GA 3SQHE 2CHAC 3MFJA 4U30A 1P09A 1P3CA 1LVYA 4I8JA 2BVXH 1S82A 2PTNA 1SBWA 2OC8A 3EAJA 5FHTA 3RXJA 1U6QA 3O8DA 1JIRA 1RTKA 4GLYA 1NFWA 3ZZDA 2JETC 2ZG0H 2ANWA 2ZFFH 3OY6U 4UDWH 2ZHWH 3ZYDA 3ELAH 1HAZB 3ESTA 1C4Y2 2BD5A 4NGAH 1ABIH 1UTQA 1MBMA 1ZHRA 4Y0ZE 1Y3WA 2W26A 3RXHA 4CBOA 1DDJA 2Q6FA 2H5DA 1D3TB 1FMGA 3KCGH 1D4PB 1NU7B 4AB9A 3LJJA 3SV9A 3OU0A 3VB6A 4Y8ZA 1P2OA 2FX4A 2G4TA 3MO9A 4DCDA 1SGCA 1GDUA 1NTPA 1UTLM 4NIYA 5L6NH 3B9FH 3U69H 3DA9B 4Y6DA 2HALA 1K1LA 5CHAC 4AB8A 2O8UA 1LKBA 3HKIB 1O3EA 1N6XA 1RTLA 2FOCA 1O3IA 1C5YB 1DUAA 2RA0A 3Q00A 1C5WB 1BHXF 5G4BA 3V12A 3PMJA 1O5CB 3VEQB 3BF6H 4ABHA 3UWIA 3UFAA 1X7AC 3QK1A 3QTOH 4MPWA 7LPRA 3UNRA 2BD3A 3RXMA 2P95A 2GCTC 4KP0A 4VGCB 1AWHB 1XVMA 1HLTH 1C1OA 2TIOA 5F8XA 3KQBA 3P92A 4GSOA 2QY0B 1ESTA 3FAOA 4YO9A 2JKHA 2EI7A 2WPJS 9LPRA 4I8HA 1YLCA 1ELGA 1DICA 2DE8A 2TGPZ 1FY3A 4I33A 2HPQH 2A31A 3EA7A 1BJVA 2FOFA 1NESE 3ZV9A 4WJG2 1O2UA 2QCYA 1GJ4H 1BOQA 4X1QU 1MKXH 3F6UH 1UTNA 4Y79A 4YOJA 4IC5A 4TWYA 2GT8A 2NU2E 4E05H 4HZHA 2J9NA 1E36B 1OWDA 1QB6A 4NSVA 1S85A 1OWKA 1GMCG 3RLYH 3PTNA 3MNSA 3TNTA 1DM4B 1ZTKA 3TVJB 1LQEA 2Y81A 3GDSA 1BBRE 4ZHAA 5C67A 1XXFA 1S83A 3NUMA 4AX9H 3D62A 4HGCA 1GJAB 1QTFA 3GICB 1EAXA 2ZKSA 3CP7A 4I31A 1XM1A 1W11U 3AAUA 4X8TH 2F3CE 2Y5FA 1ZHMA 1G9IE 4XOJA 1V3XA 2ULLA 1TQ0B 1ZMJA 1SGDE 1O3FA 3LIWA 5EW2H 1V2JT 3M35A 5EU8A 1AI8H 3GCTG 1ELCA 3SU6A 3EE0B 4X6NA 1GVLA 1NRPH 1AO5A 2AFQB 2ZI2H 2BQ7B 1W12U 5DO4H 1SLXB 1P0SH 1SL3A 1HAOH 3RC4A 3MU0A 1PPHE 2ZGXH 1BZXE 1C5OH 1RTFB 1ZJDA 4KTUA 4DIIH 3UR6A 2XCFA 5ABWA 1C1WH 5IYTA 1GI0A 1V2PT 1XMNB 1ZGIA 3M61U 3SBKA 2YNAA 3FZZA 3NKKA 1WU1A 2FWWA 5DP8A 3SJKA 1H8IH 2ASUB 3UNSA 3QWCH 1S84A 3LGYA 3SNCA 2AGEX 4I8KA 3AW0A 1QGFA 5FPTA 2GZ7A 3P6ZB 2F91A 1BTUA 5FX6A 4RSPA 4BAKB 1ZTLA 1ETRH 1L4ZA 3MWIU 3JZ2B 1GBBA 3RXQA 2VU8E 2VWLA 3MH7A 1C2MA 1UK4A 2A2XH 1UTPA 2SGDE 4K1EA 1VGCB 2F9VA 4AYYB 4KELA 1EOLA 2A4RA 1RS0A 1HAGE 3GCHB 1KIGH 1TOMH 4MPXA 1O2YA 2BOKA 5HGGA 1GMCF 1GHXH 1TRNA 1BTYA 2RDLA 2GV6A 1SGNE 5JBBS 2FEQH 3Q3XA 1CT4E 5EQQA 3M3TA 4BTIB 3A83A 2FZZA 5AFZH 1O2TA 3MNCA 1J15A 1QR3E 4NZQA 3DD2H 3BV9B 1XUIA 2SNVA 1GG6B 3ZZCA 2C8WB 2XBWA 5EPNA 1TPSA 4X2WA 5BPEA 3NWUA 1FY8E 1GMHF 3EA9A 1AUTC 3BIVH 1EAUA 2JH0D 3MH6A 3U8OH 1BJUA 3V3MA 2PTCE 3BSQA 1MTSA 3P95A 2ZFSA 3E0NB 4ZXXH 1JOUB 1CA0B 1VITF 2FTLE 1V2UT 1A61H 2A0QB 2F9OA 4WH8A 2WYJA 1C5UA 2PGBB 2RCEA 3MO3A 4MNVA 2ZPRA 1SPJA 3NK8A 3RM2H 2BDBA 3M3SA 4FUJA 2THFB 1SGFA 1OWEA 1GHAF 1O2HA 1GCTB 2QN5T 1KLTA 2FOHA 2PUXB 3A7XA 1V2LT 1BDAA 1DSUA 1EZSC 5FPSA 5GCHG 2HNTC 3S7HB 5C3NA 2VIQA 4X1RU 2Z7FE 3RU4D 1O3NA 3TJVA 2ILNA 4O03A 2FS9A 3GY6A 3M37A 1YPHE 2WPLS 4LK4A 1Y5UT 3SO3A 2ZIQH 4X8VH 4AFQA 1CO7E 1AKSB 5LH8A 3A85A 5DKMA 2ODQA 2FXRA 1DWDH 4B2CA 2BDYA 2R3UA 3A8CA 3LH1A 3LPRA 1QIXB 4DJZB 1KLIH 1Z8JB 2CF8H 2ALPA 1SGFG 1OWHA 1BUIA 4MNWA 1TAWA 2GMTC 3TH3H 1P06A 1AHTH 1AVXA 1NRRH 5JBCS 4ZMAH 1HDTH 2ZU5A 1C5RA 3KEEA 4UFEH 4THNH 2P3TB 3SV6A 4NG9H 1GGDC 1QRZA 4ABEA 3GYLB 1W10U 2OLGA 1O0DH 3BTQE 1O2LA 1MKXK 1Z6JH 4CH8B 1CBWC 3RXBA 4NA8A 1HXEH 2IJOB 3BTWE 1ELAA 2BLQA 1GBEA 3Q76A 1RIWB 4ASHA 1AVGH 1WBGB 3SU5A 1YPKH 3SUEA 1Z8GA 1GBHA 1P2IA 1A4WH 5AFYH 5GIBA 1QL7A 3SHCH 1HFDA 4E06H 2H5CA 2ZTYA 1DLEA 2AMQA 3QGJA 3T28A 1QL9A 1VCPA 3S7KB 3WY8A 1ZRKA 2AIQA 3SNEA 1J14A 5A2MH 2A2QH 2QA9E 1OOKB 2C8XB 1O5EH 3BEIB 3SNAA 1GVKB 1PYTD 3Q3YA 3U8RH 1EASA 3MHWU 1GHBF 1ESBA 1GBCA 4FUCA 2H6MA 2PKSB 1P2KA 3OYPA 1EUFA 1QA0A 1O2QA 4FU7A 1C1TA 1MTUA 5EW1H 3TNSA 3TGKE 2FX6A 1GPZA 1HBTH 1T8LA 2OTVA 2WPKS 3RM0H 4WXIA 3TJNA 1EP6A 5T6FA 2FI3E 2GV7A 4YT6H 2XC4A 1XXDA 1AN1E 1RJXB 4BAMB 3E6PH 3LGIA 1IHSH 3IITA 1FAXA 2QF3A 4K1SA 2ZU2A 1A0LA 4X2VA 2ZC9H 2J38A 3W95A 1P2NA 2ANYA 1FAKH 1D3QB 1OYQA 3LGTA 4Y0YE 4TPYA 3RXRA 3PV4A 4INHA 3ZZ3A 4A6LA 4CHAB 4Y7AA 2UWPA 3KQEA 1PPEE 4CRAA 3O8CA 1SLUB 1K2I1 2R9PA 2VIWA 1HYLA 1LO6A 5FBIA 2F9PA 1C2HA 4K2YA 3A7YA 4ABIA 2QC2A 1V2WT 4ZUHA 1FI8A 4WY3A 3U1JB 2GCHF 1P2JA 1C1MA 2FDAA 2PWXA 1L4DA 8GCHG 3TK6A 3N7OA 2VWNA 3HKJB 3SU2A 4A1XA 1OX1A 2AGGX 1YPEH 2PKAB 2PFEA 5C5OA 1SGQE 2QIQA 4FVBA 4ZHMU 4LZ1H 1BTZA 3RXOA 3OTJE 2HPPH 4K3JA 1AKSA 3IG6B 3RLWH 1GI7B 2A7JA 4ZKNU 1KSNA 1Y3VA 4NA9H 1C2IA 1KXEA 4X8UH 2BYAX 2EEKA 3RXUA 1W8BH 1NROH 1IHTH 4K8BA 1JMOH 1NFXA 2H2ZA 2FLBH 3M7TA 1ZPBA 3OX7U 2BDCA 4YTAA 4YOGA 2GP9B 3GOVB 2CN0H 1SR5C 3KIDU 1BIOA 1S6HA 3FFGA 3PMBB 1UJ1A 1K1JA 5DP3A 2BZ6H 2W3KA 5B6OA 1O5GH 2ZF0H 1O3PB 3VGCC 1HUTH 3A89A 3LGWA 4K8YA 1P9SA 3B8JA 2FOBA 3PB1E 4F49A 1AIXH 1IQIA 1DS2E 2QXIA 4B74A 1TBRH 3MU4A 5HM2A 5A0CA 1YLDA 2D1JA 3U98H 1NY22 4UEHH 2GDEH 1V2MT 1Y5AT 1YP9A 1P2QA 2FP7B 1GMDG 3S69A 1T7CA 5DJ7A 3BTEE 1GI1A 4FUDA 1DFPA 3STIA 3O8RA 1G2LA 1MZDA 1NPMA 4D8NA 4UE7H 1HCGA 1INCA 1CT2E 5JBTA 1EX3A 2ZFQH 1AFQB 2D2DA 4NFFA 3SQEE 3LDXH 1TRYA 2G5VA 4U2WA 1O33A 1OWIA 1J17T 2ZDLA 3MNBA 3E91A 1BMNH 2XWBI 5A8ZA 2G52A 2GD4B 1O3DA 1LMWB 1MU8B 3FVFB 1AE5A 1A5IA 1C9TA 1G2MA 2QXJA 4X8SH 4ABBA 2Z94A 3V0XA 2B0FA 2Z9LA 4I32A 1GDNA 3A87A 7GCHF 1TLDA 1DUEA 4O97A 3PTBA 4IMQA 4XFQA 5A0BA 1TA2A 1W13U 1C5PA 1VJ9U 1EAIA 1SFIA 3M5LA 1NFYA 3GYMA 2ANMH 4QT8C 1C2JA 1WCZA 1J16A 1KTTB 2BY5X 4FU8A 2Q1JA 2PKAA 4JCNA 5H4IB 2BDHA 5C1XA 3BTKE 5ETXA 2ZECA 4JYVH 1PQ8A 2FYRA 5DP4A 2ZGCA 1C5SA 2JH6D 4AFZA 1W7XH 3R0FA 3F9GA 4ZAEA 2WPMS 1BMLA 3ZZBA 3I77A 3GY8A 2TGTA 1GI4A 3RXKA 2PR3A 3LT3A 4BNRA 2OCVB 2JETB 1ETTH 1GBDA 1UCYE 1FUJA 2R0LA 3QZQA 1UVUH 1A46H 4R8TB 1O39A 5E0JA 3V13A 3EYDA 4GUXA 1GBMA 3RC5A 2G5NA 3T2NA 1WUNH 2AIPA 3QO6A 4Y76A 1H9HE 2NWNA 4FUFA 2ZFRH 2FODA 1CQQA 3RXVA 3E16B 1GI9B 3VB4A 1AVWA 2J92A 1FONA 1XVOA 2ANKH 1CHGA 2BD4A 3ZVGA 1AMHA 2GDDA 3HGNA 5CHAB 1AGJA 1AQ7A 3R3GB 3SU1A 3LC3A 2ESTE 1QA7A 1Y8TA 1WSSH 3TH2H 2FOGA 2J34A 5AHGH 1O3AA 2QAAA 2IOTA 2Y82A 2A4OA 1TX6A 1E34B 3ZVFA 1GVZA 3A7ZA 1VJAU 2BX3A 1TNIA 4AYVB 1CT0E 1BTHH 2Y5GA 2ZCHP 1KLJH 4K1TA 1LPZB 4Y8XA 1K1OA 4ZH8A 3H7TA 1P57B 4JK6A 4WMEA 5GXPA 4GPGA 1DOJA 1ANEA 2DUCA 1ZTJA 2STBE 1UVPA 2BX4A 3A88A 3RXLA 2OQUA 5AVDA 4GCHG 1FPHH 2BB4A 7ESTE 1TNHA 4VGCC 2ZDNA 3QX5H 2G81E 2UWOA 3UQVA 5LPEA 3BTTE 3Q3KA 2XCNA 2ZGJA 3SGQE 1HJAB 5J4SA 1AB9B 1O34A 4D76A 2Y5HA 1DWEH 4MG3A 2Z3EA 1G30B 1SGIB 1L1NA 3BEFB 3LGUA 3RXSA 5HXFA 4OS5A 2BQWB 1C2DA 1UTMA 2VGCB 1O3CA 3GDUA 4UONA 2ZHQH 1GBAA 1VCQA 2W7SA 3RMNH 4ESTE 3UIRA 1Q3XA 5C20A 1WTHD 2ODPA 1L1JA 4YOIA 1S81A 2SFAA 2TGDA 3TU7H 1TMBH 2BLWA 2WINI 2V3HH 1BTPA 3E90B 1KTSB 3AW1A 4OS6A 2FESH 1DX5M 4A5TS 1NRQH 5F6MA 3FZDA 3SU0A 4IN2A 2NU1E 1ANBA 3SGAE 4ISNA 4WMDA 2GZ9A 4UFDH 1UVOA 1GI3A 3UR9A 2AGIX 3EDXB 3RXDA 4XE4A 3TPIZ 4IW4E 2XWAA 3VPKA 3ITIA 1SGYE 4YT7H 4ZHLU 2VIOA 5EXNA 4GVUA 3TGJE 4E7RG 4DOQA 3SV2H 3T26A 3I29A 1C9PA 3ODDA 1D6RA 3TK9A 2BY7X 1XUFA 1C1VH 5EXMA 1TALA 2BDGA 4JZEH 2NU4E 1F0SA 1MD8A 2OC0A 1QRXA 3P8GA 1UK3A 1Z1IA 1YCPH 1C4U2 1XKBC 4CRBA 1ACBE 4JK5A 1RD3B 2I6QA 4ZKOU 2ZPQA 1O31A 1IQEA 1EAWA 5EOKA 1QQ4A 2TRMA 3MH5A 3RXFA 3PLPA 1GI5A 3ZZ5A 2BQ6B 4H6SB 4K60A 4AGJA 1DXWA 3AASA 1O2NA 3RDZA 1O5AB 1T8OA 2OBQA 2XBXA 4GAWA 3M7UA 4ABAA 1TYNA 3UTUH 2AERH 4ISLA 4OS7A 3SJOA 1EQ9A 4B1TA 3PM3A 4JZ1A 3HPTB 1TX7A 1IOEA 3GISB 1ELDE 2JH5D 1CVWH 2QV1A 3STJA 4JYTA 5EQRA 2ZFTA 4DY7B 1HIAB 1WV7H 3ZVEA 1D9IA 1VGCC 3KF2A 2WPIS 4H6TA 5E2PA 4KKDA 2ZU4A 3BTGE 1P12E 4ISOA 1LCYA 5C1UA 1KXFA 1P2MA 3ZVCA 2Q6DA 1MTNB 3LU9B 1E0FD 4GHQA 2ZCLP 1KYNA 1G3CA 4NSYA 1T8MA 1YPLH 2ZTXA 1DY9A 3GCTF 2D26C 1GG6C 3ATWA 1ZZZA 3MU1A 5DP7A 1HXFH 1P8VC 1SGTA 1AE8H 4A1VA 3QUMP 1Q31A 3A8BA 2OUAA 3JZ1B 1UMAH 1GHZA 1O3GA 2ZCKP 4O9VA 1GBFA 3LC5A 1GBJA 1O2JA 2HWLB 1EPTB 4NIWA 3H7OA 1TNLA 3PYHA 3TJOA 1Q2WA 1A0JA 1NO9H 1BQYA 4IN1A 1CA0C 4YLUA 1A2CH 1ZMNA 3P8FA 4H4FA 1LVMA 2VVUA 1TNJA 2CXVA 1FY5A 1O2SA 1TGCA 1YC0A 2ZQ1A 4CRDA 4LXBH 1BRBE 1HPGA 1FQ3A 1AZ8A 1O30A 1SC8U 3MU5A 3SUDA 3BG4B 1H8DH 1S0QA 2PSXA 4OS4A 4AFUA 3GY3A 3PROA 1GCTC 4SGBE 4JYUH 1ID5H 5F03A 1O35A 2FO9A 1C5XB 1EOJA 4AORA 3H5CB 1O2PA 2HNTE 2IN2A 4KGAA 1NN6A 1TGSZ 1K1NA 4K5ZA