5T3HA

Bovine trypsin soaked with selenourea for 5 min
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selenourea: a convenient phasing vehicle for macromolecular X-ray crystal structures.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t3hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t3hA02
2SGEE 5L6NH 5DKMA 8LPRA 2EI8A 5DGJA 5EPYA 1CHOF 1BRBE 4BAMB 1A0LA 3Q76A 3ZZAA 4CHAC 2CGAA 2AS9A 2W3IA 4FUDA 3HPTB 4MLFB 4WXVA 3TJNA 1ZMJA 3MYWA 3RXGA 4A1TA 2Y5HA 1C5TA 3FP8E 1GJAB 3EGKH 4Y7AA 2FOMB 1Z1IA 3A8CA 2GCHG 4KELA 1KY9A 3M3SA 4X8UH 1OKXA 2VGCB 3RXQA 1DT2A 1YKTA 3ITIA 4UFEH 1ZHMA 4CBOA 4DGJA 1HIAA 2XBXA 1QTFA 1V2NT 2BDCA 2V3HH 2YNBA 1MU8B 3SNAA 1P2JA 3RXTA 3BEUA 1BRCE 1H8IH 5E2PA 4JK5A 1F0SA 1Q2WA 1OWJA 3UOPA 4AB9A 3SV7A 2Y5GA 3V3MA 1EOJA 3T25A 3T26A 1T8NA 1YPKH 1FAKH 4AYYB 5AF9H 5DO4H 2Z3DA 1W12U 1U6QA 5E8EH 1L2EA 3E0NB 5DP9A 1IQEA 2WPIS 1GJDB 4OS5A 5FHTA 1SLWB 4B2AA 1PJPA 2Q6GA 5TJXA 4YO9A 5DP3A 3UNSA 1ARBA 2G8TA 3UPEA 2ZECA 1OWKA 2P59A 3MU8A 4IS5A 4WH6A 5FXLA 2GMTC 3M5NA 3OSYA 2BD2A 5E2OA 1TNHA 1AVXA 3U69H 2ZFFH 2R0KA 3PMHB 1L1GA 1EX3A 2FESH 3DFJA 4YM9A 2FWWA 2PTNA 1H8DH 1MAYA 2OLGA 1AFQB 1C1UH 3GY5A 5E0JA 2FDAA 1TBQH 1ZSKA 1IQFA 1P9UA 3CS0A 2ZHEH 1C2LA 1A0JA 3VGCC 2OBOA 3NWUA 2D2DA 2R9PA 5GJ4B 4B71A 3ZZ5A 2VIPA 1AMHA 3M5MA 1N1LA 2PV9B 2Z9IA 5FPYA 1BA8B 4WWYA 4ESTE 1B5GH 2ALPA 1OWDA 1MQ6A 3R0FA 2FOCA 1QJ1B 2ZDKA 1UVPA 3UQOA 1HAPH 1SGCA 3RP2A 1DY8A 4Z6AH 3NCLA 3K9XB 2BQ6B 3OY5U 1P03A 3SGQE 4X1NU 2A7CA 4KKDA 3GDUA 1GHYH 1C1WH 1SFQB 4NA8A 4D8NA 2QXGA 1O3OA 3SJ8A 1PQ7A 1ACBE 1AHTH 2G4TA 1DWCH 4I8JA 4ZKSU 1SGEE 1S84A 3RXIA 3ZYEA 1TNGA 4ZH8A 4VGCB 3GY2A 3VB4A 1S82A 2BLVA 3LKWA 3G01A 3A86A 5AFZH 1OP2A 1UK2A 1K1LA 3RXSA 4RKJB 3A84A 4CRCA 1BMAA 2AYWA 2J95A 3U1JB 2H6MA 2B7DH 3MNXA 2H9TH 4D7GA 1ESTA 1JIMA 1D6WA 1O2VA 4AYVB 1ABIH 3LPRA 1SQOA 1Z8GA 2SGDE 2PKSB 1S5SA 3ZV8A 2W7SA 1OYTH 1K1PA 2P94A 2Q6DA 3NXPA 3EQ0H 2VIQA 4ZXXH 1GL0E 1O5EH 1ESBA 3RXUA 1O3BA 1H9LB 3BN9A 4DG4A 1EOLA 3U9AH 2ZDAH 2RCEA 1GBBA 1TNIA 1RJXB 3SGBE 1P57B 1HAOH 4DJZB 2QYIA 2H1UA 3A89A 1UVUH 2ZQ2A 1TABE 1Z6EA 2BLQA 4MG3A 2W5EA 1NFUA 5FBIA 1CBWB 3RXPA 1XMNB 3ATWA 2ZGCA 1V2VT 1OP8A 1GBLA 3UREA 5F8ZA 3LGUA 3P6ZB 3R3GB 3D62A 3AAVA 1OWHA 3C1KA 1K1NA 4AGKA 1YPEH 3Q3KA 1NRQH 2VWNA 1KIGH 4K5ZA 1TGCA 4SGBE 1PYTC 2GGVB 1GMHF 1K22H 1BJUA 4OS4A 5A8ZA 2ZFQH 1EZSC 4HZHA 2NU0E 4JYUH 5T6DA 4BTUB 1TPSA 2XRCA 5BPEA 3E16B 5F03A 1QFKH 6GCHG 2NU1E 4GUXA 1ELGA 1M9UA 1GBMA 3EDXB 2ESTE 1MKXH 1ZMNA 2GTBA 3RMOH 5JBCS 3LIWA 3GCOA 1OYQA 2BQWB 1GMCF 4NGAH 2ODPA 3SU0A 4ZHAA 1BTHH 1OS8A 2TGAA 3A7XA 3UNQA 1DICA 1HV7A 1SGDE 4Q80A 3SU6A 1Y3VA 3VXEH 1O2WA 2A45B 5TCCA 5SGAE 1O37A 2P95A 2VIDA 2GCHF 2FP7B 4YLUA 1GJBB 1HXEH 1MTUA 3RXKA 4UEHH 3BTHE 1IHTH 5E0HA 4D9QA 2P3TB 1TOMH 2BY7X 1NS3A 4Y8YA 1WBGB 1QL7A 1GJ6A 1BB0B 1ZTLA 3OYPA 3HK3B 5EPNA 3ZZ3A 3SJ9A 2ZWLH 1THRH 3V13A 1THPB 1TX7A 1FJSA 1SBWA 2FLBH 4Q7YA 1V2RT 2PW8H 4A7IB 1JXPA 3T2NA 4INLA 4FUHA 3QX5H 1C2JA 2HNTE 4FUIA 7KMEH 1C2GA 1WTHD 4Y11E 1XUFA 3TJUA 3K6YA 1FN8A 3QZRA 4XFQA 1C4V2 1ORFA 2AGGX 2OC8A 1S0RA 1YCPM 1D3TB 1O2UA 3NUMA 1HAVB 3F6UH 2PHBA 1O30A 1TRYA 1L1NA 2V0BA 3O8CA 3D49H 5TCAA 4DIHH 5CMXH 2ZDLA 1O2NA 3RU4T 2OTVA 2OCVB 3ZZ4A 7ESTE 1LCYA 1TBRH 1N6YA 1BRUP 1AE8H 2CJIA 4IBLH 1OX1A 4MVNA 1HDTH 4D9RA 1SQTA 3NPSA 5L2ZH 1G36A 1TX6A 2F9BH 5DJ7A 1CBWC 1XVOA 4NIYA 1B0EA 1QRWA 3V7TA 2HLCA 4B2CA 1O3LA 1C5ZB 1C2IA 1O0DH 4E7RG 3HKIB 4K2YA 4TY6A 1A4WH 1O2JA 1TMBH 1P2OA 2ZU2A 4IW4E 4YOIA 1VITG 1IQIA 1VCWA 3M36A 3TK6A 1AKSB 1UVSH 4YTAA 2IOTA 3SV8A 3RXEA 4DT7B 2I6QA 3EAJA 2OC7A 1GHAF 1XUJA 3T62A 1HBTH 2GZ9A 3STIA 4K8YA 1QBNA 6LPRA 2CHAC 4WH8A 4ZHMU 3ZVEA 1RGQA 1WTGH 1TALA 4ISNA 3PYHA 1C4Y2 3NK8A 5G4BA 1AU8A 1ETRH 4DURA 1GBTA 1ELCA 1F5KU 1W0ZU 4ISOA 3MHWU 1QA0A 1SHYA 1TWXB 2SNWA 2Y5FA 4O3TA 3PLKA 2F9VA 4WMEA 5F8TA 1UK4A 2EI6A 1KDQA 4U32A 3EE0B 3QGNB 3STJA 3DD2H 3RXMA 4X1RU 5EODA 1VCQA 1TX8A 2BD5A 3TGIE 2C93B 1P09A 1NT1A 3MMGA 5GDSH 2FOEA 3HK6B 3LJOA 4B75A 1ZSLA 1FAXA 3LC5A 1D6RA 1YBWA 2TGDA 2FMJA 1C5RA 2H5CA 2BMGB 2A7JA 2BVRH 3HKJB 2SGAA 3KEEA 1AIXH 2XTTB 4Y76A 1BCUH 2P3FH 1TBZH 3TH2H 1DWBH 2F3CE 1YPGH 2ZFPH 1G3BA 1LPZB 1Z6JH 1TLDA 3CP7A 1F0RA 1SGFA 2HPPH 1GMDG 2BY8X 5JBBS 1AQ7A 1C9TA 1TGTA 2STAE 1DOJA 5FCRA 2FYQA 1V2OT 3L33A 1GHZA 1N8OB 3ATKA 4AGJA 1P04A 1G3DA 2JH5D 2F91A 2F9UA 2FI4E 1O2GH 1J9CH 1W13U 1GI8B 3U8OH 1MUEB 3E6PH 5C3NA 1GVLA 3VGCB 1TB6H 3VB6A 1Y3UA 1HPGA 1ZGVA 1PQAA 1GI9B 4ISHH 1J16A 1UTKA 3SUGA 3RC5A 2BDHA 2QXIA 2J2UA 3ZV9A 5LGOA 1V2UT 1EPTC 3A7ZA 1AUJA 4LZ4B 8GCHF 2XBVA 3MWIU 2HNTF 1W0YH 4U30A 1Y59T 4NFEA 1TQ7B 2XC5A 3SJIA 1GI1A 3TIUA 3PM3A 3RXDA 2UWOA 3MO9A 3E90B 1ANCA 4Y0ZE 1WQVH 1S81A 4OS6A 5DK1A 1LHEH 1C2HA 3NZIA 1F0UA 2Z3CA 1KXAA 2ODQA 1MTWA 2HALA 2F83A 9ESTA 1AGJA 1J17T 1GHBG 2VJ1A 4F49A 2A7HA 1NRRH 5AHGH 2PKAB 1TFXA 1YPHC 2EEKA 1TPPA 1C5WB 1MAXA 2Q6FA 1GHAG 1MH0A 1VCPA 1AI8H 4H6TA 4AORA 1NU9A 1YPHE 2V3OH 3SNBA 3S7HB 1A3BH 3S0NA 3I29A 1WAYB 1G9IE 2ZI2H 4QT8C 1C5XB 8ESTE 1C1VH 4Y0YE 1BTYA 4ABDA 1T8LA 2ZHWH 1ZJKA 5ESTE 3CS7A 4FXGH 1XKAC 2VH6A 3TU7H 1O2XA 2FXRA 3K6ZA 4IC5A 1C9PA 4UFFH 3DA9B 3LH3A 3TJOA 2ZU4A 1HJ9A 1V2JT 2F9NA 3TNSA 4MNVA 1RIWC 2EA3A 3U98H 1O36A 5GCHF 2PKAA 1IQKA 3TNTA 3RM0H 1FY5A 3RM2H 3GOVB 3IWMA 2ODYB 1L1JA 1EASA 1ZSJA 3ATIA 4UONA 1MKXK 1DWDH 1ANEA 4TPYA 1FY8E 2UUJB 1K1JA 3RXBA 1BTZA 1AB9B 1Y5AT 3UQVA 4Y8ZA 1O5DH 1GCTB 2JH0D 1KXEA 1W10U 3GCHB 2M5TA 2QN5T 5JPMH 5HM9A 1AVWA 1PPEE 1SGTA 4ZROA 4GHQA 3L3TA 2W7UA 3KNXA 4ABFA 3VXFH 3A7TA 2WV5A 1P2NA 2J9NA 2XBYA 3E8LA 5EW2H 1P01A 2XC4A 3VB3A 1TNJA 1V2WT 1C1OA 2Z7FE 1UTQA 1QL9A 1ARCA 2FX4A 5GIBA 3BTWE 3MU4A 1YYY1 2CN0H 1TMTH 1GBKA 1V2MT 4MDSA 3PV4A 1N6XA 4E05H 1HIAB 2G55A 2J38A 3ZVGA 2RA3A 2PGQB 3PB1E 2OUAA 1GL1A 4JMYA 2WUBA 4I7YH 1YCPH 1XX9A 1QHRB 1W8BH 1UHBB 1O5BB 3FP6E 4FVBA 2A32A 1ELDE 4GHTA 1BZXE 2VH0A 3SJKA 1F7ZA 3PO1C 1ELTA 5GCHG 5H4IB 2WPKS 3GCTF 1WV7H 5A2MH 2Y80A 3VEQB 1UJ1A 4BXSA 2P8OB 1ZHPA 3HGNA 4B2BA 2WINI 1ELFA 3TGJE 3M7QA 3TITA 2GCTC 3TPIZ 4OGXA 3F9FA 4GCHG 4TPIZ 1XKBC 4NWKA 1HJAB 2WYJA 1KDQB 2C8YB 1GMHG 1Y5UT 4YZUA 3RUOA 4GLYA 4Y7BA 2BOHB 1O2IA 2OQ5A 3A80A 4THNH 2NU2E 2O8UA 2PKSC 4MTBA 4O3UA 1AVGH 2FTMA 3LH1A 4Y10E 1TPOA 2BD9A 3UIRA 1W7XH 2VVUA 4A5TS 1KYNA 3VFEA 1Q31A 1SSXA 1AKSA 1GBCA 4K1SA 3URDA 1O2SA 4ZHLU 4E06H 3BTME 3P8GA 1VGCC 1Y5BT 1ANBA 2GDDA 4JK6A 4MPWA 1MQ5A 1D3QB 1VZQH 4WY3A 5DPAA 1BUIA 2TGPZ 4XOJA 3SBKA 2JH6D 4Q2KA 1C2EA 4X2WA 4JZIA 2J34A 1CHOG 1W11U 1YP9A 1YF4A 4VGCC 4GVUA 1K28D 1LO6A 4FU7A 3RU4E 3BF6H 1J14A 1O2TA 4A1XA 1PPHE 3A8DA 3QZQA 4FU9A 4JZDH 2QF3A 1GI6A 3AW1A 4CBNA 3SU3A 1ELEE 2BDBA 4K69A 5T6GA 2XC0A 1LHFH 3PMJA 1DSUA 2ANWA 4HGCA 1O5GH 1J8AA 2VWLA 3UR9A 3SN8A 1FZZA 2PSXA 2Z6BD 1C2MA 1ZYOA 1KXCA 2BD3A 2HNTC 1JRSA 2GT7A 5BRRE 4SGAE 1GHXH 3KF2A 4AFSA 1BQYA 1O35A 1W2KH 1O3CA 3KQDA 3KCGH 1GMCG 1FLEE 4KTSA 4RKOB 2R2MB 5LPRA 1FDPA 3SI4H 1AWHB 1CHGA 5F8XA 1Q3XA 2VNTA 3A83A 3GDVA 1GBDA 3UY9A 2ALVA 1G3CA 1P2MA 1O2LA 1LHGH 2TIOA 1DXWA 1O5FH 1T31A 2ZHDA 4Y8XA 3ZYDA 4TYDA 4ASHA 2WPHS 4CH8B 3RXVA 2SGQE 2FTLE 4UDWH 2JKHA 1UTNA 1FIZA 1O3AA 2BD8A 5DP5A 3W95A 3KHVA 1TGBA 1EAXA 1C2KA 4I32A 1NN6A 3AW0A 1BTPA 1NY22 4DOQA 1FY3A 5C1XA 2FYRA 3HGPA 4FUJA 4B73A 2THFB 5LPEA 1O3PB 1QA7A 1YLCA 1XUHA 1SLUB 1FIWA 2F9OA 4AX9H 5F6MA 2RA0A 1A5HA 1AUTC 1GJCB 1SL3A 2UWPA 4GCHF 1CT4E 1RTFB 5HMAA 1BTXA 1QRXA 3FFGA 4HTCH 2PSYA 4TWYA 4F4OC 2VIOA 3K2UA 2G51A 4X8TH 1BHXB 5EG4A 1P06A 1V2KT 2G81E 1QIXB 3ATLA 3QO6A 4X1SU 3Q3YA 1A5GH 4ZKNU 3A7YA 5B6OA 3URCA 1XUIA 4NSVA 3SV6A 5C20A 1F5RA 1PPBH 2J4IA 2OD3B 3BG4C 1TA2A 2V35A 2I6SA 3MU5A 3QWCH 1YLDA 1DS2E 5AFYH 2RG3A 1E36B 2ANKH 1BMNH 1G3EA 1BITA 2XXLA 1YCPK 2ZIQH 2BXUH 3AASA 5LH8A 1UTJA 1ZTJA 2ZO3H 4KTUA 1UHBA 1HB0B 3TJVA 4I33A 1K2I1 1T7CA 2CMYA 5LPFA 1O2OA 4J2YB 1O5AB 4CHAB 1HLTH 1EQ9A 2ZPQA 2ZQ1A 1VJAU 3RXLA 3UUZA 3ESTA 1DLEA 4GSOA 1O2KA 4INKA 1VR1H 7LPRA 1E35B 3DFLA 3K65B 4DW2U 3M7TA 2DE8A 9LPRA 2BOKA 1K1OA 4TWWA 1BBRK 2BY9X 3BTEE 3FZZA 1HYLA 5EQQA 2IJOB 5CE1A 1EZQA 1TONA 1V2PT 3VB7A 2ZGXH 1FI8A 1C5LH 2KAIB 5JDUB 3V0XA 4DVAU 1IQJA 3GCHC 2BXTH 1P8VC 1C1TA 1GCTC 1SHHB 3SNEA 1GVZA 4X6NA 4XSKU 3LGVA 2ZPRA 2ZDMA 2BVXH 1BT7A 3TLOA 2R0LA 2Y81A 5HXFA 2XBWA 1NZQH 3VB5A 1EP5A 3BG4B 1AD8H 1JWTA 1RIWB 2ASUB 2C8XB 2VVVA 1XXDA 5C1UA 1L4ZA 1E34B 2O8WA 2ZU5A 3RU4D 2XWBI 3SGAE 2F9PA 6ESTA 5L2YH 1NRSH 1TRMA 1CGIE 1V3XA 1K21H 1TYNA 2Y7XA 1O3IA 2GT8A 1HFDA 2XCFA 5EQSA 1CA0C 3GYLB 1RS0A 1T8MA 3RXHA 3FAOA 3MTYA 1GDNA 4LZ1H 5A8XA 4OGYA 1HXFH 4H4FA 2ZU3A 1SLVB 4GAWA 4NIVA 1GMDF 2A4GA 4YOGA 2B9LA 3GCTG 4ISLA 1B7XB 4BAQB 2G4UA 2B5TB 2ILNA 2BZ6H 3MFJA 1BTWA 3T5FH 3W94A 3PROA 4IMZA 6CHAB 2QIQA 3LJJA 5E0GA 1GI2A 1YC0A 1C1MA 1GGDB 4X8VH 1HAZB 1GJ4H 1H1BA 3ZVFA 3ZZDA 1E38B 1SOZA 2PUXB 1MD7A 3DHKH 3OU0A 4ABBA 1Y3XA 4UE7H 4AN7A 1O3HA 1KXFA 4BTTB 1HAVA 3GY6A 1X7AC 1JOUB 1EPTB 2CF8H 3LC3A 2HWLB 5PTPA 2AEIH 5GPIB 1CU1A 2XNIA 3JZ1B 5HM2A 4BNRA 2ZGHA 1NO9H 1BMLA 5ESBA 2OXSA 1PYTD 1ZRKA 1CSOE 1Z8RA 3GY3A 2A1DB 4E7NA 2C8WB 2FOGA 1TOCB 4AB8A 1ETSH 3TH3H 3QLPH 1HGTH 1KLJH 1N8OC 4BAKB 3MO6A 1EB1H 1QJ6B 2PUQH 5CHAB 4X1PU 3KN2A 2ZU1A 2GKVE 3KIDU 5GXPA 1BTUA 1C1NA 3DUXH 1A3EH 1IQMA 3E1XB 1D3PB 1JIRA 1G32B 1GBHA 1WCZA 2UUKB 2QCYA 1AO5A 1GCDA 1RTKA 5C1YA 1RTLA 4U2WA 3SI3H 4I8HA 4TY7A 1DANH 5A0AE 3F9GA 1C5PA 3P70B 3WY8A 2RDLA 3SUEA 1SMFE 3M3TA 1DVAH 1RFNA 3ELAH 1SVPA 2SGFE 3H7OA 1NPMA 3KGPA 1VITF 3FVFB 1AN1E 1QB1A 3IITA 4BANB 3TK9A 2BY6X 5JB9S 3M3VA 5FX6A 1C5NH 5DP6A 3ZVAA 2HRVA 2G52A 3E3TA 4MPUA 1A46H 2VINA 1TE0A 3ENSB 3BTDE 4HI3A 5T3HA 1E0FD 3U8TH 1GHBF 1PFXC 4JYVH 2ZPSA 4YT6H 1GBJA 1MD8A 5C5NA 1QQ4A 1SLXB 2BLOA 2O8LA 2VIVA 4CRBA 4X6OA 2ZFTA 1A1RA 3TGKE 1MBMA 1O2RA 1O38A 5EW1H 3OY6U 1C5OH 3LOXA 1C5UA 3Q00A 1GG6B 2GCTB 3ZZBA 3S9CA 4NIXA 1EJMA 3OX7U 4A1VA 5EQRA 3TVJB 3P95A 4X0WU 2GX4A 3S9AA 1DE7H 3RLWH 8GCHG 3ATMA 2P8OC 1O3NA 1LPKB 1ZTKA 3SU2A 3A85A 1GI5A 3SUFA 2OQUA 4LK4A 4R8TB 5A0CA 1K1MA 3MNBA 1G2LA 1SGFG 2GP9B 4ZKRU 3UTUH 1W14U 1V2QT 3A88A 1D4PB 2ZFSA 1D3DB 2A0QB 4HFPB 3SJOA 3PO1B 1Y8TA 1KLTA 3AVZA 3F9EA 1DXPA 1FPCH 1GDQA 1C5MD 3UOUA 1O3KA 8KME2 1V2TT 1C1PA 1MZDA 1O2MA 1QB6A 2A4OA 1GBIA 1SGPE 1SGYE 4ISIH 2Y6TA 2G5NA 2AIPA 2ULLA 1LVYA 2QXHA 3E91A 4X2YA 1LTOA 3M7UA 4B76A 2FPZA 4Q7XA 1MCVA 2HGTH 2V6NA 4XE4A 1F5LA 2BYAX 1GBFA 3MOCA 3PWCA 1A0HB 3RXAA 1SB1H 1KLIH 3ZZ8A 4K1EA 2H5DA 4I31A 1S85A 5K7RA 1CE5A 5EU8A 1C2FA 2ZP0H 1CQQA 3BSQA 3Q3XA 4ZMAH 5EOKA 1ZRBA 1IQHA 3QN7A 3MI4A 3UWIA 2TGTA 2OBQA 3PTBA 3MH4A 1IHSH 1RD3B 1MKWK 2FEQH 4DCDA 7GCHG 1MU6B 1QB9A 3SQHE 1Y3YA 4U01A 1SI5H 2GZ8A 4NZLA 1E37B 1AB9C 1QBVH 4X6PA 1TIOA 3RMLH 3BG8A 1UVOA 2Z9LA 2A4QA 1UCYH 2A5AA 4O03A 2J92A 1HUTH 1OP0A 3T28A 1DSTA 1HAXB 4JCNA 1HNEE 1O39A 1UO6A 1IQLA 1EAIA 3O8RA 4PROA 1FV9A 1SQAA 3A81A 4Q7ZA 1O3DA 2FS8A 4AG1A 2BDYA 2GV6A 3P92A 4IN2A 3S69A 1OSSA 3U1IB 4KP0A 3PMAB 3SHAH 2IPHA 2G00A 2Y82A 1F92A 1AFEH 1DPOA 1O2ZA 4KGAA 2D8WA 1D9IA 3AAUA 1JMOH 4JZ1A 2ZGBH 1ETTH 1NU7B 2WYGA 1P2QA 1GI0A 1KXBA 2AIQA 3EA9A 1A7SA 4I8KA 2CXVA 4ZAEA 5L30H 1CGHA 1QNJA 1VJ9U 4UD9H 4GPGA 3N7OA 4J1YA 2BQ7B 2B0FA 2FO9A 3GYMA 2QV1A 1K9OE 3M61U 5EGMA 3BV9B 3TK5A 2BDGA 2FOAA 5JYIA 3LGWA 4FVDA 5J4SA 3M35A 1GJ5H 5FBEA 2ZCKP 4O9VA 4XBBA 2W26A 1OOKB 1FPHH 2QAAA 1MZAA 3PWBA 1UTMA 2TRMA 3ODFA 3SUDA 3ZZ7A 2ZDVH 4Y6DA 4JZFH 1CVWH 2FI3E 3M37A 1SFIA 3B8JA 2JETB 1ZZZA 1YGCH 4ABJA 2C3SA 2ZCHP 1WUNH 4IMQA 2Q1JA 1BOQA 1QL8A 1JRTA 3ODDA 1DX5M 1ESAA 2NU3E 4BAOB 3HATH 1GWAA 2WPJS 4ABGA 1UVTH 3B23B 3F68H 2AGIX 1EZXC 3B9FH 1CO7E 3UR6A 1NRPH 4B74A 3MO3A 4IC6A 3RC4A 1JBUH 3DT0H 4X8SH 1GG6C 1SGQE 1P3EA 1LVBA 4DIIH 1TNLA 1MCTA 5JBTA 1CA8B 1OWIA 5T6FA 2H2ZA 2CF9H 2PGBB 1ZLRA 1AZ8A 1LVMA 2C4FH 2BDAA 2W3KA 1GJ7B 1T8OA 3GY4A 3QTVH 1K1IA 4X2VA 3EA7A 3S7KB 4AG2A 1QBOA 1C5YB 3RLYH 3F1SB 1P12E 1SGNE 1LKAA 1BRAA 2ZHQH 4YLQH 1SR5C 3RXJA 5A0BA 4MNXA 3LT3A 4K60A 2A31A 4AZ2B 5I25A 2PTCE 3EA8A 3GISB 4Z0KA 1AWFH 1WQSA 1H9IE 3SV2H 3PLPA 1FXYA 2VU8E 3BTFE 2Y7ZA 3I77A 3O8BA 3GY8A 4D7FA 4D76A 4NG9H 2DUCA 1ZOMA 3H7TA 1GPZA 5FX5A 4NFFA 3ZVBA 4I8LA 1DITH 4IGDA 1Y3WA 4LXBH 2QXJA 1KXDA 2CV3A 2ZZUH 3P8FA 2R3UA 1G2MA 1T4VH 1IAUA 1IQNA 2A2QH 3O8DA 3LDXH 3UWJH 3SV9A 1FONA 3A82A 4DY7B 5ABWA 1BDAA 1L4DA 1YPJH 4FUEA 1O2QA 3U8RH 1TMUH 2VWOA 1SC8U 1PPCE 1FY1A 4ABIA 3RXFA 1CGJE 2ANYA 5IYTA 1KTSB 2CHAB 1LHDH 1UCYE 1EAUA 4CR9A 1TAWA 4ABAA 2Z3EA 1DM4B 1LPGB 1HAGE 4WF8A 1ID5H 3QUMP 3RMMH 1O32A 4YT7H 2AMDA 1O3MA 1XXFA 2B8OH 2FOFA 4AOQA 5K0HA 2SGPE 1QJ7B 2G5VA 3Q77A 1DUEA 1G37A 1WYKA 3NKKA 2VWMA 4UFDH 5J4QA 1PPZA 2GD4B 4UFGH 1DUAA 1GHWH 2LNCA 2WPLS 2PFEA 1LQDB 1HCGA 1ANDA 1QY6A 4FU8A 1O3GA 2C90B 3MH7A 2P93A 2FZZA 2BZAA 1AFQC 2JETC 2WUCA 3RXRA 1FN6A 4CR5A 4CRDA 1NRNH 2A2XH 4M7GA 1BHXF 2QGRA 4KTCA 2FX6A 1TQ0B 2YOLA 4A92A 1FUJA 1YPMH 2QF0A 1HRTH 2BHGA 3C27B 2LPRA 2ZNKH 1QRZA 2DE9A 1GGDC 4MNWA 3KL6A 1GVKB 6CHAC 3RMNH 4OS2A 2FM2A 4FUGA 2ZHFH 3PLBA 2XW9A 1EXFA 1ZPZA 1NTPA 4I8GA 5FAHA 1Z8IB 2FODA 3RXOA 4NSYA 1O33A 5FPSA 1UTPA 1ELVA 4NIWA 5FCKA 3LGYA 3A7WA 1C1QA 1EKBB 2FIRH 3TH4H 5HGGA 4LOYH 1C1RA 1KTTB 1P02A 1O5CB 4NA9H 1EP6A 1ELAA 1PQ5A 1CA0B 1C4U2 2HPQH 2UWLA 1MTVA 3MH6A 2EC9H 1CT0E 3M5OA 2ZDNA 3ZZ6A 1TA6A 1UMAH 1QURH 4K1TA 3FZDA 2FOBA 3CENA 1V2ST 1IOEA 3KQCA 5C67A 1PPFE 3ZVDA 1DLKB 3LGTA 2H9EH 2VGCC 4NZQA 4CREA 4XDEA 1UTLM 2AGEX 1O3JA 1CT2E 3BIUH 4ZUHA 3A7VA 1S6FA 2BDIA 3SW2B 1ELBA 1F2SE 2VVCA 4MPXA 2ZFRH 3RXCA 1EZUC 1WOFA 1EJAA 4BXWA 3LONA 4XBCA 2Z9GA 1QCPA 4X1QU 2STBE 2J94A 1W7GH 2YNAA 2ZG0H 3QTOH 3OTJE 2AMPA 4CRGA 2C8ZB 2OC0A 3SOSA 6GCHF 2IN2A 1LHCH 1QQUA 3D23A 1O31A 1LQEA 1NFWA 2O9QA 3KQEA 1Z7KA 1J15A 3KQBA 2BLWA 3QK1A 1O3FA 4WMDA 3FP7E 2FS9A 1P2KA 2GZ7A 2WV4A 1MMJN 4NWLA 1TGNA 2NU4E 3RDZA 1V6DA 1YM0A 1PQ8A 1TRNA 4WXIA 3T29A 2Z9JA 1BIOA 4X2XA 5DG6A 4OS7A 1PPGE 4MPVA 2P16A 5JBAS 4BTIB 1BMMH 2GV7A 2O8TA 4H42U 4ZKOU 1BJVA 4IN1A 2UUFB 1G30B 1P05A 2ANMH 1GI4A 1MBQA 3P8OA 5A8YA 3SU5A 1O2PA 1QGFA 1MTSA 3UNRA 4FUBA 3S9BA 3SU1A 1P0SH 1TNKA 1WSSH 2BM2A 3GCNA 3SNDA 2VIWA 1UTOA 2XWAA 2SFAA 3PMBB 2BY5X 3QDZB 2O8MA 1IQGA 1THSH 3P17H 2Z94A 4AFQA 3BTTE 4NCYA 4ZXYH 1UK3A 2ZCLP 2HVXA 2QC2A 3LGIA 2OC1A 4RN6A 4INHA 3I78A 3SORA 4Y79A 2OP9A 1T32A 2QA9E 2AERH 1W3CA 4K8BA 1XUKA 2ZC9H 1NFXA 5FPTA 2BVSH 2R3YA 4OS1A 3QGJA 2XYAA 1B0FA 4JYTA 3T27A 4FUFA 1QR3E 5DP7A 1GHVH 1P3CA 4A6LA 3BTKE 5EXNA 1AZZA 1XVMA 3BTGE 2ZGJA 1C5VA 1C5SA 2UUYA 4WMFA 3GDSA 1C1SA 1HAIH 3BIVH 4H6SB 1FQ3A 1Z1JA 1EJNA 4R0IA 1MKWH 5ETXA 4MNYA 4O97A 1GBAA 5C5OA 1SOTA 2BX4A 3A87A 4CH2B 2VB0A 3MNCA 2BTCE 1FMGA 3H5CB 1MTNB 1UCYK 1EB2A 1GJ8B 2ZTXA 3MNSA 3VPKA 1MTNC 1HAYB 3F9HA 5CHAC 1NC6A 3V12A 3L6PA 2WPMS 4CRFA 4B1TA 1DFPA 2BD7A 3A8BA 1Z71A 4ABHA 1DDJA 1SGRE 1NESE 2GVFA 2A5KA 3MH5A 1DY9A 2AMQA 2D1JA 3SU4A 1KSNA 4BOHA 2H9HA 1GI3A 1XUGA 1RXPA 5EXMA 2ZF0H 3IG6B 2ZTYA 1H4WA 4WVPE 1OXGA 2HOBA 5EXLA 1SG8B 3ZZCA 5I46H 1F0TA 2FI5E 3SQEE 3ZZ9A 3SZNA 2XCNA 2AFQB 3SNCA 2BX3A 2ZKSA 2GMTB 2R2WU 2A5IA 1VGCB 2PR3A 1VITH 1SPJA 3UFAA 2TPIZ 5AVDA 2FOHA 2ZTZA 4ABEA 5DP8A 4XBDA 3M5LA 1P2IA 5C2ZA 1GDUA 1AY6H 1O2YA 1A2CH 1BBRH 1ZPBA 3BEFB 3GY7A 3MU1A 1FNIA 2GDEH 4AFZA 2EI7A 1AE5A 2K1QA 4WJG2 1ZR0A 2NWNA 4Y71A 1TGSZ 3A8AA 5A09A 2ZA5A 1EATA 1ABJH 1HJAC 2AH4X 4NA7A 1L0ZA 1O2HA 1YPLH 1LMWB 1EAWA 3SO3A 4MQAA 1GJ9B 4AFUA 1C5QA 4YESB 5HYOA 4CRAA 2PWXA 2A4RA 5GWZA 1FY4A 1ZJDA 3LU9B 1ZPCA 3P8NA 1WU1A 1INCA 2D26C 5DP4A 1RRKA 3PTNA 1GI7B 1HJ8A 1ZGIA 3MU0A 3ZVCA 4RSPA 1T4UH 1GBEA 3FANA 3BTQE 1P10A 4FUCA 2QY0B 4JZEH 2BB4A 1NROH 2P3UB 2Z9KA 1LDTT 1Z8JB 1H9HE 3EYDA 1A5IA 1EUFA 1TPAE 1V2LT 2BD4A 2ZEBA 1O3EA 1BBRE 1XM1A 4X6MA 1OPHB 1NFYA 1S83A 2KAIA 3JZ2B 2SNVA 3BEIB 4YOJA 1HAHH 2TBSA 1A61H 3RC6A 1ZHRA 1LKBA 1S6HA 3D65E 3GICB 3SHCH 5IDKA 5JB8S 1C2DA 1S0QA 7GCHF 1NM6A 1O34A 1DWEH 4BAHB 1SGIB 1ZMLA 4K3JA 1OWEA 1P11E 2OINA 1EPTA 1LVOA 1P9SA 2PLXA 3E0PB 2FLRH
chains in the Genus database with same CATH superfamily
2SGEE 5L6NH 5DKMA 8LPRA 2EI8A 2JJ2D 5DGJA 5EPYA 1CHOF 1BRBE 3NRLA 1A0LA 4BAMB 3Q76A 3ZZAA 4CHAC 2CGAA 2AS9A 2W3IA 4FUDA 3HPTB 4MLFB 4WXVA 3TJNA 1ZMJA 3MYWA 3RXGA 4A1TA 2Y5HA 1C5TA 3FP8E 1GJAB 3EGKH 4Y7AA 2FOMB 1Z1IA 3A8CA 2GCHG 4KELA 1KY9A 3M3SA 4X8UH 1OKXA 2VGCB 3RXQA 1DT2A 1YKTA 3ITIA 4UFEH 1ZHMA 4CBOA 3H09A 4DGJA 1HIAA 2XBXA 1QTFA 1V2NT 2BDCA 2V3HH 2YNBA 1MU8B 3SNAA 1P2JA 3RXTA 3BEUA 1BRCE 1H8IH 5E2PA 4JK5A 1F0SA 1Q2WA 1OWJA 3UOPA 4AB9A 3SV7A 2Y5GA 3V3MA 1EOJA 3T25A 3T26A 1T8NA 1YPKH 1FAKH 4AYYB 5AF9H 5DO4H 2Z3DA 1W12U 1U6QA 5E8EH 1L2EA 3E0NB 5DP9A 1IQEA 2WPIS 1GJDB 4OS5A 5FHTA 1SLWB 4B2AA 1PJPA 2Q6GA 5TJXA 4YO9A 5DP3A 3UNSA 1ARBA 2G8TA 3UPEA 2ZECA 1OWKA 2P59A 3MU8A 4IS5A 4WH6A 5FXLA 2GMTC 3M5NA 3OSYA 2BD2A 5E2OA 1TNHA 1AVXA 3U69H 2ZFFH 2R0KA 3PMHB 1L1GA 1EX3A 2FESH 3DFJA 4YM9A 2FWWA 2PTNA 1H8DH 1MAYA 2OLGA 1AFQB 1C1UH 3GY5A 5E0JA 2FDAA 1TBQH 2LELA 1ZSKA 1IQFA 1P9UA 3CS0A 2ZHEH 1C2LA 1A0JA 3VGCC 2OBOA 3NWUA 2D2DA 2R9PA 5GJ4B 4B71A 3ZZ5A 2VIPA 1AMHA 3M5MA 1N1LA 2PV9B 2Z9IA 4HG6A 1BA8B 4WWYA 5FPYA 4ESTE 1B5GH 2ALPA 1OWDA 1MQ6A 3R0FA 2FOCA 1QJ1B 2ZDKA 1UVPA 3UQOA 1HAPH 1SGCA 3RP2A 1DY8A 4Z6AH 3NCLA 3K9XB 2BQ6B 3OY5U 1P03A 3SGQE 4X1NU 2A7CA 4KKDA 3GDUA 1WDIA 1GHYH 1C1WH 1SFQB 4NA8A 4D8NA 2QXGA 1O3OA 3SJ8A 1PQ7A 1ACBE 1YY3A 1AHTH 2G4TA 1DWCH 4I8JA 4ZKSU 1SGEE 1S84A 3RXIA 3F0PA 3ZYEA 1TNGA 4ZH8A 4VGCB 3GY2A 3VB4A 1S82A 2BLVA 3LKWA 3G01A 3A86A 5AFZH 1OP2A 1UK2A 1K1LA 3RXSA 5C17A 4ACBA 4RKJB 2WZQA 3A84A 4CRCA 1BMAA 2AYWA 2J95A 1E79D 3U1JB 2H6MA 2B7DH 3MNXA 2H9TH 4D7GA 1ESTA 1JIMA 1D6WA 1O2VA 4AYVB 1ABIH 3LPRA 1SQOA 1Z8GA 2SGDE 3F2FA 2PKSB 1S5SA 3ZV8A 2W7SA 1OYTH 1K1PA 2P94A 2Q6DA 3NXPA 3EQ0H 2VIQA 4ZXXH 1GL0E 1O5EH 1ESBA 3RXUA 1O3BA 1H9LB 3BN9A 4DG4A 3W1EA 1EOLA 3U9AH 2ZDAH 2RCEA 1GBBA 1TNIA 1RJXB 3SGBE 1P57B 1HAOH 4DJZB 2QYIA 2H1UA 3A89A 1UVUH 2ZQ2A 1TABE 1Z6EA 2BLQA 4MG3A 1NFUA 2W5EA 5IK2D 5FBIA 1CBWB 3RXPA 1XMNB 3ATWA 2ZGCA 1V2VT 1OP8A 1GBLA 3UREA 5F8ZA 3LGUA 3P6ZB 3R3GB 3D62A 3AAVA 4Q63A 2J5UA 1OWHA 3C1KA 1K1NA 4AGKA 1YPEH 2AHME 3Q3KA 1NRQH 2VWNA 1KIGH 4XD7D 4K5ZA 1TGCA 4SGBE 1PYTC 2GGVB 1GMHF 1K22H 1BJUA 4OS4A 5A8ZA 2ZFQH 1EZSC 4HZHA 2NU0E 4JYUH 2WSSD 5T6DA 5EJZA 4BTUB 1TPSA 2XRCA 5BPEA 3E16B 5F03A 1QFKH 6GCHG 2NU1E 4GUXA 1ELGA 1M9UA 1GBMA 3EDXB 2ESTE 1MKXH 1ZMNA 2GTBA 3RMOH 5JBCS 3LIWA 3GCOA 1OYQA 2BQWB 1GMCF 4NGAH 2ODPA 3SU0A 4ZHAA 1BTHH 1OS8A 2TGAA 3A7XA 3UNQA 1DICA 1HV7A 1SGDE 4Q80A 3SU6A 1Y3VA 3VXEH 1O2WA 2A45B 5TCCA 5SGAE 1W0JD 1O37A 2P95A 2VIDA 2GCHF 2FP7B 4YLUA 1GJBB 1HXEH 1MTUA 3RXKA 4UEHH 3BTHE 1IHTH 5E0HA 4D9QA 2P3TB 1TOMH 2BY7X 1NS3A 2LP6A 3OEED 4Y8YA 3SZEA 1WBGB 1QL7A 1GJ6A 1BB0B 1ZTLA 3OYPA 3HK3B 5EPNA 3ZZ3A 3SJ9A 2ZWLH 2YMSD 1THRH 3V13A 1THPB 1TX7A 1FJSA 1SBWA 2FLBH 4Q7YA 1V2RT 2PW8H 4A7IB 1JXPA 3T2NA 4INLA 4FUHA 2KM0A 3QX5H 1C2JA 2HNTE 4FUIA 7KMEH 3ZIAD 1C2GA 1WTHD 4Y11E 1XUFA 3TJUA 2PP6A 3K6YA 1FN8A 3QZRA 4XFQA 1C4V2 1ORFA 2AGGX 2OC8A 1S0RA 1YCPM 5EIYA 1D3TB 1O2UA 3NUMA 1HAVB 3F6UH 2PHBA 1O30A 1TRYA 1L1NA 2V0BA 3O8CA 3D49H 5TCAA 4DIHH 5CMXH 2ZDLA 1O2NA 3RU4T 4M9FA 2OTVA 2OCVB 3ZZ4A 7ESTE 1LCYA 5GNDA 1TBRH 1N6YA 1BRUP 1AE8H 2CJIA 4IBLH 1OX1A 4MVNA 1HDTH 4D9RA 1SQTA 3NPSA 5L2ZH 1G36A 1TX6A 2F9BH 5DJ7A 1CBWC 1XVOA 4NIYA 1B0EA 1QRWA 3V7TA 2HLCA 4B2CA 1O3LA 4RI0A 1C5ZB 1C2IA 1O0DH 4E7RG 1WXRA 3HKIB 4K2YA 4TY6A 2WPDD 1A4WH 1O2JA 1TMBH 1P2OA 5HIYA 2ZU2A 4IW4E 4YOIA 1VITG 1IQIA 1VCWA 3M36A 3TK6A 1AKSB 1UVSH 4YTAA 2IOTA 3SV8A 3RXEA 4DT7B 2I6QA 3EAJA 2OC7A 1GHAF 1XUJA 3T62A 1HBTH 2GZ9A 3STIA 4K8YA 1QBNA 6LPRA 2CHAC 4WH8A 4ZHMU 3ZVEA 1RGQA 1WTGH 1TALA 3DCLA 4ISNA 3PYHA 1C4Y2 3NK8A 5G4BA 1AU8A 1ETRH 4DURA 1GBTA 1ELCA 1F5KU 1W0ZU 4ISOA 3MHWU 1QA0A 1SHYA 1TWXB 2SNWA 2Y5FA 4O3TA 3PLKA 2F9VA 4WMEA 5F8TA 2K8IA 1UK4A 2EI6A 1KDQA 4U32A 1FX0B 3EE0B 3QGNB 3STJA 3DD2H 3RXMA 4X1RU 5EODA 1K0HA 1VCQA 4Q4LA 1TX8A 2BD5A 3TGIE 2C93B 1P09A 1NT1A 3MMGA 5GDSH 2FOEA 3HK6B 3LJOA 4B75A 1ZSLA 1FAXA 3LC5A 4I86A 1D6RA 1YBWA 2TGDA 2FMJA 1C5RA 2H5CA 4AC9A 2BMGB 2A7JA 2BVRH 2J98B 2SGAA 3HKJB 3KEEA 1AIXH 2XTTB 4Y76A 1BCUH 2P3FH 1TBZH 3TH2H 1DWBH 2F3CE 1YPGH 2ZFPH 1G3BA 1LPZB 1Z6JH 2VBCA 1TLDA 3CP7A 1F0RA 1SGFA 2HPPH 1GMDG 2BY8X 5JBBS 1AQ7A 1C9TA 1TGTA 2STAE 1DOJA 5FCRA 2FYQA 1V2OT 3L33A 1GHZA 1N8OB 3ATKA 4AGJA 1P04A 1G3DA 2JH5D 2F91A 2F9UA 2FI4E 1O2GH 1COWD 1J9CH 1W13U 3PV2A 1GI8B 3U8OH 1MUEB 3E6PH 5C3NA 1GVLA 1KMHB 1TB6H 3VGCB 3VB6A 1Y3UA 1HPGA 1ZGVA 1PQAA 1GI9B 4ISHH 1J16A 1UTKA 3SUGA 3RC5A 2BDHA 2QXIA 2J2UA 3ZV9A 5LGOA 1V2UT 1EPTC 3A7ZA 5B6LA 1AUJA 4LZ4B 2KZ4A 8GCHF 2XBVA 3MWIU 2HNTF 1W0YH 1E1QD 4U30A 5KECA 1Y59T 4NFEA 1TQ7B 2XC5A 3SJIA 1GI1A 3TIUA 3PM3A 3RXDA 2UWOA 4TSFD 3MO9A 3E90B 1ANCA 4Y0ZE 1WQVH 1S81A 4OS6A 5DK1A 1LHEH 1C2HA 3NZIA 1F0UA 2Z3CA 1KXAA 2ODQA 1MTWA 2HALA 2F83A 9ESTA 1AGJA 1J17T 1GHBG 2VJ1A 4F49A 2A7HA 1NRRH 5AHGH 2PKAB 1TFXA 1YPHC 2EEKA 1TPPA 1C5WB 1MAXA 2Q6FA 1GHAG 1MH0A 1VCPA 1AI8H 4H6TA 4AORA 1NU9A 1YPHE 2V3OH 3SNBA 3S7HB 1A3BH 3S0NA 3I29A 1WAYB 1G9IE 2ZI2H 4QT8C 1C5XB 8ESTE 1C1VH 4Y0YE 1BTYA 4ABDA 1T8LA 2ZHWH 1ZJKA 5ESTE 3CS7A 4FXGH 1XKAC 2VH6A 2YMSC 3TU7H 1O2XA 2FXRA 3K6ZA 4IC5A 1C9PA 4UFFH 3DA9B 3LH3A 3TJOA 2ZU4A 1HJ9A 1V2JT 2L74A 2F9NA 3TNSA 4MNVA 1RIWC 2EA3A 3U98H 1O36A 5GCHF 2PKAA 1IQKA 3TNTA 3RM0H 1FY5A 3RM2H 3GOVB 3KYFA 3IWMA 2ODYB 1L1JA 1EASA 1ZSJA 3ATIA 4UONA 1MKXK 1DWDH 1ANEA 4TPYA 1FY8E 2UUJB 1K1JA 3RXBA 1BTZA 1AB9B 1Y5AT 3UQVA 4Y8ZA 1O5DH 1GCTB 2JH0D 1KXEA 1W10U 3GCHB 2M5TA 2QN5T 5JPMH 5T1VA 5HM9A 1AVWA 1PPEE 1SGTA 4ZROA 4GHQA 3L3TA 2W7UA 3KNXA 4ABFA 3VXFH 3A7TA 2WV5A 1P2NA 2J9NA 2XBYA 3E8LA 5EW2H 1P01A 2XC4A 3VB3A 1TNJA 1V2WT 1C1OA 2Z7FE 4B6FA 1UTQA 1QL9A 1ARCA 2FX4A 5GIBA 3BTWE 3MU4A 1YYY1 2CN0H 1TMTH 1GBKA 1V2MT 4MDSA 3PV4A 1N6XA 4E05H 1HIAB 2G55A 2J38A 3ZVGA 4P00A 2RA3A 2PGQB 3PB1E 2OUAA 1GL1A 4JMYA 2WUBA 4I7YH 1YCPH 1XX9A 1QHRB 3N7DA 1W8BH 1UHBB 1O5BB 3FP6E 4FVBA 2A32A 1ELDE 4GHTA 1BZXE 2VH0A 3OE7D 3SJKA 1F7ZA 3PO1C 1ELTA 5GCHG 4F55A 5H4IB 2WPKS 3GCTF 1WV7H 5A2MH 3KYGA 2Y80A 2KR7A 3VEQB 1UJ1A 4BXSA 3DSPA 5HKKD 2P8OB 1ZHPA 3HGNA 2KCYA 4B2BA 2WINI 1ELFA 4RT0A 3TGJE 3M7QA 3TITA 2GCTC 3TPIZ 4OGXA 3F9FA 4GCHG 4TPIZ 1XKBC 4NWKA 1HJAB 2WYJA 1KDQB 1NBME 2C8YB 2WHXA 5EJLA 1GMHG 1Y5UT 4YZUA 3RUOA 4GLYA 4Y7BA 2BOHB 1O2IA 2OQ5A 3A80A 4THNH 2NU2E 2O8UA 2PKSC 4MTBA 4O3UA 1AVGH 2FTMA 3LH1A 4Y10E 1TPOA 2BD9A 3UIRA 1W7XH 2VVUA 4A5TS 1KYNA 3VFEA 1Q31A 1SSXA 1AKSA 1GBCA 4K1SA 4P02A 3URDA 1O2SA 4ZHLU 4E06H 3BTME 2L6OA 3P8GA 1VGCC 1Y5BT 1ANBA 2GDDA 4JK6A 4MPWA 1MQ5A 1D3QB 1VZQH 4WY3A 5DPAA 1BUIA 2TGPZ 4XOJA 3SBKA 2JH6D 4Q2KA 1C2EA 4X2WA 4JZIA 2J34A 1CHOG 1W11U 1YP9A 1YF4A 4VGCC 4GVUA 1K28D 1LO6A 3PRBA 4FU7A 3RU4E 3BF6H 1J14A 1O2TA 4A1XA 1PPHE 3A8DA 3QZQA 4FU9A 4JZDH 2QF3A 1GI6A 3AW1A 4ASUD 4CBNA 3SU3A 1ELEE 2BDBA 4K69A 5T6GA 2XC0A 1LHFH 3PMJA 1DSUA 2ANWA 4HGCA 1O5GH 1J8AA 2VWLA 3UR9A 3SN8A 1FZZA 2PSXA 2Z6BD 1C2MA 1ZYOA 1KXCA 2BD3A 2HNTC 1JRSA 2GT7A 2EQNA 5BRRE 4DT4A 4SGAE 1GHXH 3KF2A 4AFSA 1BQYA 1O35A 1W2KH 1O3CA 3KQDA 3KCGH 1GMCG 1FLEE 4KTSA 4RKOB 2R2MB 5LPRA 1FDPA 3SI4H 1AWHB 1CHGA 5F8XA 1Q3XA 2VNTA 3A83A 3GDVA 1GBDA 3UY9A 2ALVA 1G3CA 1P2MA 1O2LA 1LHGH 2TIOA 1DXWA 1O5FH 1T31A 2ZHDA 4Y8XA 2QE7D 3ZYDA 4TYDA 4OM9A 5C0UA 4ASHA 3DSOA 2WPHS 4CH8B 3RXVA 2SGQE 2FTLE 4UDWH 2JKHA 1UTNA 1FIZA 1O3AA 2BD8A 5DP5A 3W95A 3KHVA 1TGBA 1EAXA 1C2KA 4I32A 1NN6A 3AW0A 1BTPA 1NY22 4DOQA 3DSGA 2RFKC 1FY3A 5C1XA 2FYRA 3HGPA 4FUJA 4B73A 2THFB 5LPEA 1O3PB 1QA7A 1YLCA 1XUHA 1SLUB 1FIWA 2F9OA 4AX9H 5F6MA 2RA0A 1A5HA 3CNRA 1AUTC 1GJCB 1SL3A 1H8HD 2UWPA 4GCHF 1CT4E 1RTFB 5HMAA 1BTXA 1QRXA 3FFGA 4HTCH 2PSYA 3F2HA 4TWYA 5CDFE 1QZ8A 4F4OC 2VIOA 3K2UA 2G51A 4X8TH 1BHXB 5EG4A 1P06A 1V2KT 2G81E 1QIXB 3N99A 3ATLA 3QO6A 4X1SU 3Q3YA 1A5GH 4ZKNU 3A7YA 5B6OA 3URCA 1XUIA 4NSVA 3SV6A 5C20A 1F5RA 1PPBH 2J4IA 2OD3B 3GS9A 3BG4C 1TA2A 2V35A 2I6SA 3OAAD 3MU5A 3QWCH 1YLDA 1DS2E 5AFYH 2RG3A 1E36B 2ANKH 1BMNH 1G3EA 3OFND 1BITA 2XXLA 1YCPK 2ZIQH 2BXUH 3AASA 5LH8A 1UTJA 1ZTJA 2ZO3H 4KTUA 1UHBA 1HB0B 3TJVA 4I33A 1K2I1 1T7CA 2CMYA 5LPFA 1O2OA 2F43B 4J2YB 1O5AB 4CHAB 1HLTH 3WW7A 1EQ9A 3MQKC 2ZPQA 2ZQ1A 1VJAU 3RXLA 3UUZA 3ESTA 1DLEA 4GSOA 1O2KA 4INKA 1VR1H 7LPRA 1E35B 3DFLA 3K65B 4DW2U 3M7TA 2DE8A 9LPRA 2BOKA 2K0QA 1K1OA 4TWWA 1BBRK 2BY9X 3BTEE 3FZZA 1HYLA 5EQQA 2IJOB 5CE1A 1EZQA 1TONA 1V2PT 3VB7A 2ZGXH 1FI8A 1C5LH 2KAIB 5JDUB 3V0XA 4DVAU 1IQJA 3GCHC 4F48B 2BXTH 1P8VC 1C1TA 1GCTC 1SHHB 3SNEA 1GVZA 4X6NA 4XSKU 3LGVA 2ZPRA 2ZDMA 2BVXH 1BT7A 3TLOA 2R0LA 2Y81A 5HXFA 2XBWA 1NZQH 3VB5A 1EP5A 3BG4B 1AD8H 1JWTA 1RIWB 2ASUB 2XOKD 2C8XB 2VVVA 1XXDA 5C1UA 1L4ZA 1E34B 2O8WA 2ZU5A 3RU4D 2XWBI 3SGAE 2F9PA 6ESTA 5L2YH 1NRSH 1TRMA 1CGIE 1V3XA 1K21H 1W0KD 2YMSB 4FOUC 1TYNA 1BMFD 2KCPA 2Y7XA 1O3IA 2GT8A 1HFDA 2XCFA 5EQSA 1CA0C 3GYLB 1RS0A 4ZCNA 1T8MA 3RXHA 3FAOA 3MTYA 1GDNA 4LZ1H 3WWBA 5A8XA 4OGYA 1HXFH 4H4FA 2ZU3A 1SLVB 4GAWA 4NIVA 1GMDF 2A4GA 4YOGA 2B9LA 3GCTG 4ISLA 1B7XB 4BAQB 2G4UA 2B5TB 2ILNA 2BZ6H 3MFJA 1BTWA 3T5FH 3W94A 3PROA 4IMZA 6CHAB 2QIQA 3LJJA 5E0GA 1GI2A 1YC0A 1C1MA 1GGDB 4X8VH 1HAZB 1GJ4H 1H1BA 3ZVFA 3ZZDA 1E38B 1SOZA 2PUXB 1MD7A 3DHKH 3OU0A 4ABBA 1Y3XA 4UE7H 4AN7A 1O3HA 1KXFA 4BTTB 1HAVA 3GY6A 1X7AC 1JOUB 1EPTB 2CF8H 3LC3A 2HWLB 5PTPA 2AEIH 5GPIB 1CU1A 2XNIA 3JZ1B 5HM2A 4BNRA 2ZGHA 2GJGA 1NO9H 1BMLA 5ESBA 2OXSA 1PYTD 1ZRKA 1CSOE 1Z8RA 3GY3A 2A1DB 4E7NA 2C8WB 2FOGA 1TOCB 4AB8A 1ETSH 3TH3H 3QLPH 1HGTH 1KLJH 1N8OC 4BAKB 3MO6A 1EB1H 1QJ6B 2PUQH 5CHAB 4X1PU 3KN2A 2ZU1A 2GKVE 3KIDU 5GXPA 1BTUA 1C1NA 3DUXH 1A3EH 1IQMA 3E1XB 1D3PB 1JIRA 1G32B 1GBHA 1WCZA 2UUKB 2QCYA 1AO5A 1GCDA 1RTKA 5C1YA 1RTLA 4U2WA 3SI3H 2WV9A 4I8HA 4TY7A 1DANH 5A0AE 3F9GA 1C5PA 3P70B 3WY8A 2RDLA 3SUEA 1SMFE 2J98A 3M3TA 1DVAH 1RFNA 3ELAH 1SVPA 2SGFE 3H7OA 1NPMA 3KGPA 1VITF 3FVFB 1OHHD 1AN1E 1QB1A 3IITA 5CHBA 4BANB 3TK9A 1EFRD 2BY6X 5JB9S 2F4LA 3VG8A 3M3VA 5FX6A 1C5NH 5DP6A 3ZVAA 2HRVA 2G52A 3E3TA 4MPUA 1A46H 2JIZD 2VINA 1TE0A 3ENSB 3BTDE 4HI3A 5T3HA 1E0FD 3U8TH 1GHBF 1PFXC 4JYVH 2ZPSA 4YT6H 1GBJA 1MD8A 5C5NA 1QQ4A 1SLXB 2BLOA 2O8LA 2VIVA 4CRBA 4X6OA 2ZFTA 3SYJA 1A1RA 3TGKE 1MBMA 1O2RA 1O38A 4B6EA 5EW1H 3OY6U 1C5OH 3LOXA 1C5UA 3Q00A 1GG6B 2GCTB 3ZZBA 3S9CA 4NIXA 1EJMA 3OX7U 4A1VA 5EQRA 3TVJB 3P95A 4X0WU 2GX4A 3S9AA 4YXWD 1DE7H 3RLWH 8GCHG 3ATMA 2P8OC 1O3NA 1LPKB 1ZTKA 3SU2A 3A85A 1GI5A 3SUFA 1UW7A 2OQUA 4LK4A 4R8TB 5A0CA 1K1MA 3MNBA 1G2LA 1SGFG 2GP9B 4ZKRU 3UTUH 1W14U 1V2QT 3A88A 1D4PB 2ZFSA 1D3DB 2A0QB 4HFPB 3SJOA 3PO1B 3UAIC 1Y8TA 1KLTA 3AVZA 3F9EA 1DXPA 1FPCH 1GDQA 1C5MD 3UOUA 1O3KA 8KME2 1V2TT 1C1PA 1MZDA 2XNDD 1O2MA 1QB6A 2A4OA 1GBIA 1SGPE 1SGYE 2IPQX 4ISIH 2Y6TA 2G5NA 2AIPA 2ULLA 1LVYA 2JJ1D 2QXHA 3E91A 4X2YA 1LTOA 3M7UA 4B76A 2FPZA 4Q7XA 1MCVA 2HGTH 2V6NA 4XE4A 1F5LA 2BYAX 1GBFA 2QF4A 2EY4C 3MOCA 3PWCA 1A0HB 3RXAA 1SB1H 1KLIH 3ZZ8A 4K1EA 2H5DA 4I31A 1S85A 5K7RA 1CE5A 5EU8A 1C2FA 2ZP0H 1CQQA 3BSQA 3Q3XA 4ZMAH 5EOKA 1ZRBA 1IQHA 3QN7A 3MI4A 3UWIA 2TGTA 2OBQA 3PTBA 3MH4A 1IHSH 1RD3B 1MKWK 2FEQH 4DCDA 7GCHG 1MU6B 1QB9A 3SQHE 1Y3YA 4U01A 1SI5H 2GZ8A 4NZLA 1E37B 1AB9C 1QBVH 4X6PA 1TIOA 3RMLH 3BG8A 1UVOA 2Z9LA 2A4QA 1UCYH 2A5AA 4O03A 2J92A 4Z1MD 1HUTH 1OP0A 2W6ID 3T28A 1DSTA 1HAXB 4JCNA 1HNEE 1O39A 1UO6A 1IQLA 1EAIA 3O8RA 4PROA 1FV9A 1SQAA 3A81A 4Q7ZA 1O3DA 5KEDA 2FS8A 4AG1A 2BDYA 2GV6A 3P92A 4IN2A 3S69A 1OSSA 3U1IB 4KP0A 3PMAB 3SHAH 2IPHA 2G00A 2Y82A 1F92A 1AFEH 1DPOA 1O2ZA 4KGAA 2D8WA 1D9IA 3AAUA 1JMOH 4JZ1A 2ZGBH 3EE7A 1ETTH 1NU7B 2WYGA 1VKYA 1P2QA 1GI0A 1KXBA 2AIQA 3FO8D 3EA9A 1A7SA 4I8KA 2CXVA 4ZAEA 5L30H 1CGHA 1QNJA 1VJ9U 4UD9H 4GPGA 3N7OA 4J1YA 2BQ7B 2B0FA 2FO9A 3GYMA 2QV1A 1K9OE 3M61U 5EGMA 2HVYB 3BV9B 3TK5A 2BDGA 2FOAA 5JYIA 1MABB 3LGWA 4FVDA 5J4SA 3M35A 1GJ5H 5FBEA 2ZCKP 3N7EA 4O9VA 4XBBA 2W26A 1OOKB 1FPHH 2QAAA 1MZAA 3PWBA 1UTMA 2TRMA 3ODFA 3SUDA 3ZZ7A 2ZDVH 4Y6DA 4JZFH 1CVWH 2FI3E 3M37A 1SFIA 3B8JA 2JETB 1ZZZA 1YGCH 4ABJA 2C3SA 2ZCHP 1WUNH 4IMQA 2Q1JA 1BOQA 1QL8A 1JRTA 3ODDA 1DX5M 1ESAA 5F53A 2NU3E 4BAOB 3HATH 1GWAA 2WPJS 4ABGA 1UVTH 3B23B 3F68H 2AGIX 1EZXC 3B9FH 1CO7E 3UR6A 1NRPH 4B74A 3MO3A 4IC6A 3RC4A 1JBUH 3DT0H 4X8SH 1GG6C 1SGQE 5EJ1A 1P3EA 1LVBA 4DIIH 1TNLA 1MCTA 1E1RD 5JBTA 1CA8B 1OWIA 5T6FA 2H2ZA 2CF9H 2PGBB 1ZLRA 1AZ8A 1LVMA 2C4FH 2BDAA 2W3KA 1GJ7B 1T8OA 3GY4A 3QTVH 1K1IA 4X2VA 3EA7A 3S7KB 2KFWA 4AG2A 1QBOA 3U28C 1C5YB 3RLYH 3F1SB 1P12E 1SGNE 1LKAA 1BRAA 2ZHQH 4YLQH 1SR5C 3RXJA 5A0BA 4MNXA 3LT3A 4K60A 2A31A 4AZ2B 5I25A 2PTCE 3UB0A 3EA8A 3GISB 4Z0KA 1AWFH 1WQSA 1H9IE 3SV2H 3PLPA 1FXYA 2VU8E 3BTFE 2Y7ZA 3I77A 3O8BA 3F2GA 3GY8A 4D7FA 4D76A 4NG9H 2DUCA 1ZOMA 3H7TA 1GPZA 5FX5A 4NFFA 3FKSD 3ZVBA 4I8LA 1S6LA 1DITH 4IGDA 1Y3WA 4LXBH 2QXJA 1KXDA 5DSFA 2CV3A 2ZZUH 3P8FA 2R3UA 1G2MA 1T4VH 1IAUA 1IQNA 2A2QH 3O8DA 3LDXH 3UWJH 3SV9A 1FONA 3A82A 4DY7B 5ABWA 1BDAA 1L4DA 2KX4A 1YPJH 4FUEA 1O2QA 3U8RH 1TMUH 2VWOA 1SC8U 1PPCE 1FY1A 4ABIA 3RXFA 1CGJE 2ANYA 5IYTA 1KTSB 2CHAB 1LHDH 1UCYE 1EAUA 1NBMD 4CR9A 1TAWA 4ABAA 2Z3EA 1DM4B 1LPGB 1HAGE 4WF8A 1ID5H 2QF5A 3QUMP 3RMMH 1O32A 4YT7H 2AMDA 1O3MA 1XXFA 2B8OH 2FOFA 4AOQA 5K0HA 2SGPE 1QJ7B 2G5VA 3Q77A 1DUEA 1G37A 1WYKA 3NKKA 2VWMA 4UFDH 5J4QA 1PPZA 2GD4B 4UFGH 1DUAA 1GHWH 2LNCA 1YWUA 2WPLS 2PFEA 1LQDB 1H8ED 1HCGA 1ANDA 1QY6A 4FU8A 1O3GA 2C90B 3MH7A 2P93A 2FZZA 2BZAA 1AFQC 2JETC 2WUCA 3RXRA 1FN6A 4CR5A 4CRDA 1NRNH 2A2XH 4M7GA 1BHXF 2QGRA 4KTCA 2FX6A 1TQ0B 3PRDA 2YOLA 4A92A 1FUJA 1YPMH 2QF0A 1HRTH 2BHGA 3C27B 2LPRA 2ZNKH 1QRZA 2DE9A 1GGDC 4MNWA 3KL6A 1GVKB 6CHAC 3RMNH 4OS2A 2FM2A 4FUGA 2ZHFH 3PLBA 2XW9A 1EXFA 1ZPZA 1NTPA 4I8GA 5FAHA 1Z8IB 2FODA 2KCAA 3RXOA 4NSYA 1O33A 5FPSA 1UTPA 1ELVA 4NIWA 5FCKA 3LGYA 3A7WA 1C1QA 1EKBB 2FIRH 3TH4H 5HGGA 4LOYH 1C1RA 1KTTB 1P02A 1O5CB 4NA9H 1EP6A 1ELAA 1PQ5A 1CA0B 1C4U2 2HPQH 2UWLA 1MTVA 3MH6A 2EC9H 1CT0E 1SQRA 3M5OA 2ZDNA 3ZZ6A 1TA6A 1UMAH 3OEHD 1QURH 4K1TA 3FZDA 2FOBA 3CENA 1V2ST 1IOEA 3KQCA 5C67A 1PPFE 3ZVDA 1DLKB 3LGTA 2W6JD 2H9EH 2VGCC 4NZQA 4CREA 4XDEA 1UTLM 2AGEX 1YLNA 1O3JA 2JDID 1CT2E 3BIUH 4ZUHA 3A7VA 1S6FA 2BDIA 3SW2B 1ELBA 1F2SE 4TT3D 2VVCA 4MPXA 2ZFRH 3RXCA 1EZUC 1WOFA 1EJAA 5FL7D 4BXWA 3LONA 4RT1A 4XBCA 2Z9GA 1QCPA 4X1QU 2STBE 2J94A 1W7GH 2YNAA 2ZG0H 3QTOH 3OTJE 2AMPA 4CRGA 2C8ZB 2OC0A 3SOSA 3WWFA 6GCHF 2IN2A 1LHCH 2CK3D 1QQUA 3D23A 1O31A 1LQEA 1NFWA 2O9QA 3KQEA 1Z7KA 1J15A 5KGOA 3KQBA 2BLWA 3QK1A 1O3FA 4WMDA 3FP7E 2FS9A 1P2KA 2GZ7A 2WV4A 1MMJN 4NWLA 1TGNA 2NU4E 2IJD1 3RDZA 1V6DA 1YM0A 1PQ8A 1TRNA 4WXIA 3AK5A 3T29A 2Z9JA 1BIOA 4X2XA 5DG6A 2KCOA 4OS7A 1PPGE 4MPVA 2P16A 5JBAS 4BTIB 1BMMH 5HIZA 2GV7A 2O8TA 4H42U 4ZKOU 1BJVA 4IN1A 2UUFB 4ACAA 1G30B 1P05A 2ANMH 1GI4A 1MBQA 3P8OA 5A8YA 3SU5A 1O2PA 1QGFA 1MTSA 3UNRA 4FUBA 3S9BA 3SU1A 1P0SH 2OK5A 1TNKA 1WSSH 2BM2A 3GCNA 3SNDA 2VIWA 1UTOA 2J97A 2XWAA 2SFAA 3PMBB 2BY5X 3QDZB 2O8MA 1IQGA 1THSH 3P17H 2Z94A 4AFQA 3BTTE 4NCYA 4ZXYH 1UK3A 2ZCLP 2HVXA 2QC2A 3LGIA 2OC1A 4RN6A 4INHA 3I78A 3SORA 4Y79A 2OP9A 1T32A 2QA9E 2AERH 1W3CA 4K8BA 1XUKA 2ZC9H 1NFXA 5FPTA 2BVSH 2R3YA 4OS1A 3QGJA 2XYAA 1B0FA 4FETA 4JYTA 3T27A 4FUFA 1QR3E 5DP7A 1GHVH 1P3CA 4A6LA 3BTKE 5EXNA 1AZZA 1XVMA 3BTGE 2ZGJA 1C5VA 1C5SA 2UUYA 4WMFA 3GDSA 1C1SA 1HAIH 3BIVH 4H6SB 1FQ3A 1Z1JA 1EJNA 4R0IA 1MKWH 5ETXA 4MNYA 4O97A 1GBAA 5C5OA 1SOTA 2BX4A 3A87A 4CH2B 2VB0A 3MNCA 2BTCE 5C94A 1FMGA 3H5CB 1MTNB 1UCYK 1EB2A 1GJ8B 2ZTXA 3MNSA 3VPKA 5DN6D 1MTNC 1HAYB 2HLDD 3F9HA 5CHAC 1NC6A 3V12A 3L6PA 2WPMS 4CRFA 4B1TA 1DFPA 2BD7A 3A8BA 1Z71A 4ABHA 1DDJA 1SGRE 1NESE 2GVFA 2A5KA 3MH5A 1DY9A 2AMQA 2D1JA 3SU4A 1KSNA 2M2AA 4BOHA 2H9HA 1GI3A 1XUGA 2V3MA 1RXPA 5EXMA 2ZF0H 3IG6B 2ZTYA 1H4WA 4WVPE 1OXGA 2HOBA 5EXLA 1SG8B 3ZZCA 5I46H 1F0TA 2FI5E 3SQEE 3ZZ9A 3SZNA 2XCNA 2AFQB 3SNCA 2BX3A 2ZKSA 4XRNA 2GMTB 2R2WU 2A5IA 1VGCB 2PR3A 1VITH 1SPJA 3UFAA 2TPIZ 3FOAA 5AVDA 2FOHA 2ZTZA 4ABEA 5DP8A 4XBDA 3M5LA 1P2IA 5C2ZA 1GDUA 1AY6H 1O2YA 1A2CH 1BBRH 3PV5A 1ZPBA 3BEFB 3GY7A 3MU1A 1FNIA 1SKYE 2GDEH 4AFZA 2EI7A 1AE5A 2K1QA 2V7QD 4WJG2 2RDEA 1ZR0A 2NWNA 4Y71A 1TGSZ 3A8AA 5A09A 2ZA5A 1EATA 1ABJH 1HJAC 2AH4X 4NA7A 1L0ZA 1O2HA 1YPLH 1LMWB 1EAWA 3SO3A 4MQAA 1GJ9B 4AFUA 1C5QA 4YESB 5HYOA 4CRAA 2PWXA 2A4RA 5GWZA 1FY4A 1ZJDA 3LU9B 1ZPCA 3P8NA 1WU1A 1INCA 2D26C 5DP4A 1RRKA 3FN8A 3PTNA 1GI7B 1HJ8A 1ZGIA 3MU0A 3ZVCA 4RSPA 1T4UH 1GBEA 3FANA 3BTQE 1P10A 4FUCA 2QY0B 4JZEH 2BB4A 1NROH 2P3UB 2Z9KA 3F0OA 1LDTT 1Z8JB 1H9HE 3EYDA 1A5IA 1EUFA 1TPAE 1V2LT 2BD4A 2ZEBA 1O3EA 3KQ5A 1BBRE 1XM1A 4X6MA 5C0TA 1OPHB 1NFYA 1S83A 2KAIA 3JZ2B 2SNVA 3BEIB 4YOJA 1HAHH 2TBSA 1A61H 3RC6A 1ZHRA 3F3BA 1LKBA 1S6HA 3D65E 3GICB 3SHCH 5IDKA 5JB8S 1C2DA 1S0QA 7GCHF 1NM6A 1O34A 1DWEH 4BAHB 1SGIB 1ZMLA 4K3JA 1OWEA 1P11E 2OINA 1EPTA 1LVOA 1P9SA 2PLXA 3E0PB 3OTPA 2FLRH
chains in the Genus database with same CATH topology
2SGEE 5L6NH 5DKMA 8LPRA 2EI8A 5DGJA 5EPYA 1CHOF 1BRBE 4BAMB 1A0LA 3Q76A 3ZZAA 4CHAC 2CGAA 2AS9A 2W3IA 4FUDA 3HPTB 4MLFB 4WXVA 3TJNA 1ZMJA 3MYWA 3RXGA 4A1TA 2Y5HA 1C5TA 3FP8E 1GJAB 3EGKH 4Y7AA 2FOMB 1Z1IA 3A8CA 2GCHG 4KELA 1KY9A 3M3SA 4X8UH 1OKXA 2VGCB 3RXQA 1DT2A 1YKTA 3ITIA 4UFEH 1ZHMA 4CBOA 4DGJA 1HIAA 2XBXA 1QTFA 1V2NT 2BDCA 2V3HH 2YNBA 1MU8B 3SNAA 1P2JA 3RXTA 3BEUA 1BRCE 1H8IH 5E2PA 4JK5A 1F0SA 1Q2WA 1OWJA 3UOPA 4AB9A 3SV7A 2Y5GA 3V3MA 1EOJA 3T25A 3T26A 1T8NA 1YPKH 1FAKH 4AYYB 5AF9H 5DO4H 2Z3DA 1W12U 1U6QA 5E8EH 1L2EA 3E0NB 5DP9A 1IQEA 2WPIS 1GJDB 4OS5A 5FHTA 1SLWB 4B2AA 1PJPA 2Q6GA 5TJXA 4YO9A 5DP3A 3UNSA 1ARBA 2G8TA 3UPEA 2ZECA 1OWKA 2P59A 3MU8A 4IS5A 4WH6A 5FXLA 2GMTC 3M5NA 3OSYA 2BD2A 5E2OA 1TNHA 1AVXA 3U69H 2ZFFH 2R0KA 3PMHB 1L1GA 1EX3A 2FESH 3DFJA 4YM9A 2FWWA 2PTNA 1H8DH 1MAYA 2OLGA 1AFQB 1C1UH 3GY5A 5E0JA 2FDAA 1TBQH 1ZSKA 1IQFA 1P9UA 3CS0A 2ZHEH 1C2LA 1A0JA 3VGCC 2OBOA 3NWUA 2D2DA 2R9PA 5GJ4B 4B71A 3ZZ5A 2VIPA 1AMHA 3M5MA 1N1LA 2PV9B 2Z9IA 5FPYA 1BA8B 4WWYA 4ESTE 1B5GH 2ALPA 1OWDA 1MQ6A 3R0FA 2FOCA 1QJ1B 2ZDKA 1UVPA 3UQOA 1HAPH 1SGCA 3RP2A 1DY8A 4Z6AH 3NCLA 3K9XB 2BQ6B 3OY5U 1P03A 3SGQE 4X1NU 2A7CA 4KKDA 3GDUA 1GHYH 1C1WH 1SFQB 4NA8A 4D8NA 2QXGA 1O3OA 3SJ8A 1PQ7A 1ACBE 1AHTH 2G4TA 1DWCH 4I8JA 4ZKSU 1SGEE 1S84A 3RXIA 3ZYEA 1TNGA 4ZH8A 4VGCB 3GY2A 3VB4A 1S82A 2BLVA 3LKWA 3G01A 3A86A 5AFZH 1OP2A 1UK2A 1K1LA 3RXSA 4RKJB 3A84A 4CRCA 1BMAA 2AYWA 2J95A 3U1JB 2H6MA 2B7DH 3MNXA 2H9TH 4D7GA 1ESTA 1JIMA 1D6WA 1O2VA 4AYVB 1ABIH 3LPRA 1SQOA 1Z8GA 2SGDE 2PKSB 1S5SA 3ZV8A 2W7SA 1OYTH 1K1PA 2P94A 2Q6DA 3NXPA 3EQ0H 2VIQA 4ZXXH 1GL0E 1O5EH 1ESBA 3RXUA 1O3BA 1H9LB 3BN9A 4DG4A 1EOLA 3U9AH 2ZDAH 2RCEA 1GBBA 1TNIA 1RJXB 3SGBE 1P57B 1HAOH 4DJZB 2QYIA 2H1UA 3A89A 1UVUH 2ZQ2A 1TABE 1Z6EA 2BLQA 4MG3A 2W5EA 1NFUA 5FBIA 1CBWB 3RXPA 1XMNB 3ATWA 2ZGCA 1V2VT 1OP8A 1GBLA 3UREA 5F8ZA 3LGUA 3P6ZB 3R3GB 3D62A 3AAVA 1OWHA 3C1KA 1K1NA 4AGKA 1YPEH 3Q3KA 1NRQH 2VWNA 1KIGH 4K5ZA 1TGCA 4SGBE 1PYTC 2GGVB 1GMHF 1K22H 1BJUA 4OS4A 5A8ZA 2ZFQH 1EZSC 4HZHA 2NU0E 4JYUH 5T6DA 4BTUB 1TPSA 2XRCA 5BPEA 3E16B 5F03A 1QFKH 6GCHG 2NU1E 4GUXA 1ELGA 1M9UA 1GBMA 3EDXB 2ESTE 1MKXH 1ZMNA 2GTBA 3RMOH 5JBCS 3LIWA 3GCOA 1OYQA 2BQWB 1GMCF 4NGAH 2ODPA 3SU0A 4ZHAA 1BTHH 1OS8A 2TGAA 3A7XA 3UNQA 1DICA 1HV7A 1SGDE 4Q80A 3SU6A 1Y3VA 3VXEH 1O2WA 2A45B 5TCCA 5SGAE 1O37A 2P95A 2VIDA 2GCHF 2FP7B 4YLUA 1GJBB 1HXEH 1MTUA 3RXKA 4UEHH 3BTHE 1IHTH 5E0HA 4D9QA 2P3TB 1TOMH 2BY7X 1NS3A 4Y8YA 1WBGB 1QL7A 1GJ6A 1BB0B 1ZTLA 3OYPA 3HK3B 5EPNA 3ZZ3A 3SJ9A 2ZWLH 1THRH 3V13A 1THPB 1TX7A 1FJSA 1SBWA 2FLBH 4Q7YA 1V2RT 2PW8H 4A7IB 1JXPA 3T2NA 4INLA 4FUHA 3QX5H 1C2JA 2HNTE 4FUIA 7KMEH 1C2GA 1WTHD 4Y11E 1XUFA 3TJUA 3K6YA 1FN8A 3QZRA 4XFQA 1C4V2 1ORFA 2AGGX 2OC8A 1S0RA 1YCPM 1D3TB 1O2UA 3NUMA 1HAVB 3F6UH 2PHBA 1O30A 1TRYA 1L1NA 2V0BA 3O8CA 3D49H 5TCAA 4DIHH 5CMXH 2ZDLA 1O2NA 3RU4T 2OTVA 2OCVB 3ZZ4A 7ESTE 1LCYA 1TBRH 1N6YA 1BRUP 1AE8H 2CJIA 4IBLH 1OX1A 4MVNA 1HDTH 4D9RA 1SQTA 3NPSA 5L2ZH 1G36A 1TX6A 2F9BH 5DJ7A 1CBWC 1XVOA 4NIYA 1B0EA 1QRWA 3V7TA 2HLCA 4B2CA 1O3LA 1C5ZB 1C2IA 1O0DH 4E7RG 3HKIB 4K2YA 4TY6A 1A4WH 1O2JA 1TMBH 1P2OA 2ZU2A 4IW4E 4YOIA 1VITG 1IQIA 1VCWA 3M36A 3TK6A 1AKSB 1UVSH 4YTAA 2IOTA 3SV8A 3RXEA 4DT7B 2I6QA 3EAJA 2OC7A 1GHAF 1XUJA 3T62A 1HBTH 2GZ9A 3STIA 4K8YA 1QBNA 6LPRA 2CHAC 4WH8A 4ZHMU 3ZVEA 1RGQA 1WTGH 1TALA 4ISNA 3PYHA 1C4Y2 3NK8A 5G4BA 1AU8A 1ETRH 4DURA 1GBTA 1ELCA 1F5KU 1W0ZU 4ISOA 3MHWU 1QA0A 1SHYA 1TWXB 2SNWA 2Y5FA 4O3TA 3PLKA 2F9VA 4WMEA 5F8TA 1UK4A 2EI6A 1KDQA 4U32A 3EE0B 3QGNB 3STJA 3DD2H 3RXMA 4X1RU 5EODA 1VCQA 1TX8A 2BD5A 3TGIE 2C93B 1P09A 1NT1A 3MMGA 5GDSH 2FOEA 3HK6B 3LJOA 4B75A 1ZSLA 1FAXA 3LC5A 1D6RA 1YBWA 2TGDA 2FMJA 1C5RA 2H5CA 2BMGB 2A7JA 2BVRH 3HKJB 2SGAA 3KEEA 1AIXH 2XTTB 4Y76A 1BCUH 2P3FH 1TBZH 3TH2H 1DWBH 2F3CE 1YPGH 2ZFPH 1G3BA 1LPZB 1Z6JH 1TLDA 3CP7A 1F0RA 1SGFA 2HPPH 1GMDG 2BY8X 5JBBS 1AQ7A 1C9TA 1TGTA 2STAE 1DOJA 5FCRA 2FYQA 1V2OT 3L33A 1GHZA 1N8OB 3ATKA 4AGJA 1P04A 1G3DA 2JH5D 2F91A 2F9UA 2FI4E 1O2GH 1J9CH 1W13U 1GI8B 3U8OH 1MUEB 3E6PH 5C3NA 1GVLA 3VGCB 1TB6H 3VB6A 1Y3UA 1HPGA 1ZGVA 1PQAA 1GI9B 4ISHH 1J16A 1UTKA 3SUGA 3RC5A 2BDHA 2QXIA 2J2UA 3ZV9A 5LGOA 1V2UT 1EPTC 3A7ZA 1AUJA 4LZ4B 8GCHF 2XBVA 3MWIU 2HNTF 1W0YH 4U30A 1Y59T 4NFEA 1TQ7B 2XC5A 3SJIA 1GI1A 3TIUA 3PM3A 3RXDA 2UWOA 3MO9A 3E90B 1ANCA 4Y0ZE 1WQVH 1S81A 4OS6A 5DK1A 1LHEH 1C2HA 3NZIA 1F0UA 2Z3CA 1KXAA 2ODQA 1MTWA 2HALA 2F83A 9ESTA 1AGJA 1J17T 1GHBG 2VJ1A 4F49A 2A7HA 1NRRH 5AHGH 2PKAB 1TFXA 1YPHC 2EEKA 1TPPA 1C5WB 1MAXA 2Q6FA 1GHAG 1MH0A 1VCPA 1AI8H 4H6TA 4AORA 1NU9A 1YPHE 2V3OH 3SNBA 3S7HB 1A3BH 3S0NA 3I29A 1WAYB 1G9IE 2ZI2H 4QT8C 1C5XB 8ESTE 1C1VH 4Y0YE 1BTYA 4ABDA 1T8LA 2ZHWH 1ZJKA 5ESTE 3CS7A 4FXGH 1XKAC 2VH6A 3TU7H 1O2XA 2FXRA 3K6ZA 4IC5A 1C9PA 4UFFH 3DA9B 3LH3A 3TJOA 2ZU4A 1HJ9A 1V2JT 2F9NA 3TNSA 4MNVA 1RIWC 2EA3A 3U98H 1O36A 5GCHF 2PKAA 1IQKA 3TNTA 3RM0H 1FY5A 3RM2H 3GOVB 3IWMA 2ODYB 1L1JA 1EASA 1ZSJA 3ATIA 4UONA 1MKXK 1DWDH 1ANEA 4TPYA 1FY8E 2UUJB 1K1JA 3RXBA 1BTZA 1AB9B 1Y5AT 3UQVA 4Y8ZA 1O5DH 1GCTB 2JH0D 1KXEA 1W10U 3GCHB 2M5TA 2QN5T 5JPMH 5HM9A 1AVWA 1PPEE 1SGTA 4ZROA 4GHQA 3L3TA 2W7UA 3KNXA 4ABFA 3VXFH 3A7TA 2WV5A 1P2NA 2J9NA 2XBYA 3E8LA 5EW2H 1P01A 2XC4A 3VB3A 1TNJA 1V2WT 1C1OA 2Z7FE 1UTQA 1QL9A 1ARCA 2FX4A 5GIBA 3BTWE 3MU4A 1YYY1 2CN0H 1TMTH 1GBKA 1V2MT 4MDSA 3PV4A 1N6XA 4E05H 1HIAB 2G55A 2J38A 3ZVGA 2RA3A 2PGQB 3PB1E 2OUAA 1GL1A 4JMYA 2WUBA 4I7YH 1YCPH 1XX9A 1QHRB 1W8BH 1UHBB 1O5BB 3FP6E 4FVBA 2A32A 1ELDE 4GHTA 1BZXE 2VH0A 3SJKA 1F7ZA 3PO1C 1ELTA 5GCHG 5H4IB 2WPKS 3GCTF 1WV7H 5A2MH 2Y80A 3VEQB 1UJ1A 4BXSA 2P8OB 1ZHPA 3HGNA 4B2BA 2WINI 1ELFA 3TGJE 3M7QA 3TITA 2GCTC 3TPIZ 4OGXA 3F9FA 4GCHG 4TPIZ 1XKBC 4NWKA 1HJAB 2WYJA 1KDQB 2C8YB 1GMHG 1Y5UT 4YZUA 3RUOA 4GLYA 4Y7BA 2BOHB 1O2IA 2OQ5A 3A80A 4THNH 2NU2E 2O8UA 2PKSC 4MTBA 4O3UA 1AVGH 2FTMA 3LH1A 4Y10E 1TPOA 2BD9A 3UIRA 1W7XH 2VVUA 4A5TS 1KYNA 3VFEA 1Q31A 1SSXA 1AKSA 1GBCA 4K1SA 3URDA 1O2SA 4ZHLU 4E06H 3BTME 3P8GA 1VGCC 1Y5BT 1ANBA 2GDDA 4JK6A 4MPWA 1MQ5A 1D3QB 1VZQH 4WY3A 5DPAA 1BUIA 2TGPZ 4XOJA 3SBKA 2JH6D 4Q2KA 1C2EA 4X2WA 4JZIA 2J34A 1CHOG 1W11U 1YP9A 1YF4A 4VGCC 4GVUA 1K28D 1LO6A 4FU7A 3RU4E 3BF6H 1J14A 1O2TA 4A1XA 1PPHE 3A8DA 3QZQA 4FU9A 4JZDH 2QF3A 1GI6A 3AW1A 4CBNA 3SU3A 1ELEE 2BDBA 4K69A 5T6GA 2XC0A 1LHFH 3PMJA 1DSUA 2ANWA 4HGCA 1O5GH 1J8AA 2VWLA 3UR9A 3SN8A 1FZZA 2PSXA 2Z6BD 1C2MA 1ZYOA 1KXCA 2BD3A 2HNTC 1JRSA 2GT7A 5BRRE 4SGAE 1GHXH 3KF2A 4AFSA 1BQYA 1O35A 1W2KH 1O3CA 3KQDA 3KCGH 1GMCG 1FLEE 4KTSA 4RKOB 2R2MB 5LPRA 1FDPA 3SI4H 1AWHB 1CHGA 5F8XA 1Q3XA 2VNTA 3A83A 3GDVA 1GBDA 3UY9A 2ALVA 1G3CA 1P2MA 1O2LA 1LHGH 2TIOA 1DXWA 1O5FH 1T31A 2ZHDA 4Y8XA 3ZYDA 4TYDA 4ASHA 2WPHS 4CH8B 3RXVA 2SGQE 2FTLE 4UDWH 2JKHA 1UTNA 1FIZA 1O3AA 2BD8A 5DP5A 3W95A 3KHVA 1TGBA 1EAXA 1C2KA 4I32A 1NN6A 3AW0A 1BTPA 1NY22 4DOQA 1FY3A 5C1XA 2FYRA 3HGPA 4FUJA 4B73A 2THFB 5LPEA 1O3PB 1QA7A 1YLCA 1XUHA 1SLUB 1FIWA 2F9OA 4AX9H 5F6MA 2RA0A 1A5HA 1AUTC 1GJCB 1SL3A 2UWPA 4GCHF 1CT4E 1RTFB 5HMAA 1BTXA 1QRXA 3FFGA 4HTCH 2PSYA 4TWYA 4F4OC 2VIOA 3K2UA 2G51A 4X8TH 1BHXB 5EG4A 1P06A 1V2KT 2G81E 1QIXB 3ATLA 3QO6A 4X1SU 3Q3YA 1A5GH 4ZKNU 3A7YA 5B6OA 3URCA 1XUIA 4NSVA 3SV6A 5C20A 1F5RA 1PPBH 2J4IA 2OD3B 3BG4C 1TA2A 2V35A 2I6SA 3MU5A 3QWCH 1YLDA 1DS2E 5AFYH 2RG3A 1E36B 2ANKH 1BMNH 1G3EA 1BITA 2XXLA 1YCPK 2ZIQH 2BXUH 3AASA 5LH8A 1UTJA 1ZTJA 2ZO3H 4KTUA 1UHBA 1HB0B 3TJVA 4I33A 1K2I1 1T7CA 2CMYA 5LPFA 1O2OA 4J2YB 1O5AB 4CHAB 1HLTH 1EQ9A 2ZPQA 2ZQ1A 1VJAU 3RXLA 3UUZA 3ESTA 1DLEA 4GSOA 1O2KA 4INKA 1VR1H 7LPRA 1E35B 3DFLA 3K65B 4DW2U 3M7TA 2DE8A 9LPRA 2BOKA 1K1OA 4TWWA 1BBRK 2BY9X 3BTEE 3FZZA 1HYLA 5EQQA 2IJOB 5CE1A 1EZQA 1TONA 1V2PT 3VB7A 2ZGXH 1FI8A 1C5LH 2KAIB 5JDUB 3V0XA 4DVAU 1IQJA 3GCHC 2BXTH 1P8VC 1C1TA 1GCTC 1SHHB 3SNEA 1GVZA 4X6NA 4XSKU 3LGVA 2ZPRA 2ZDMA 2BVXH 1BT7A 3TLOA 2R0LA 2Y81A 5HXFA 2XBWA 1NZQH 3VB5A 1EP5A 3BG4B 1AD8H