5T3HA

Bovine trypsin soaked with selenourea for 5 min
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Selenourea: a convenient phasing vehicle for macromolecular X-ray crystal structures.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t3hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t3hA02
2SGEE 2AGGX 2G00A 2CV3A 4BXSA 3GCTG 1LO6A 4TWWA 1TNLA 2VIWA 3V12A 1QA7A 2F9NA 1ETRH 1V2LT 4ZKRU 2HRVA 3KEEA 1ZMLA 1G36A 4IN2A 2ODQA 1ZTLA 4I8HA 1ZRBA 4B75A 2CHAC 1XVOA 1UHBB 3EA7A 1IAUA 1DXPA 1LQEA 4JYTA 1CE5A 1D4PB 4YO9A 3NKKA 5FPSA 1CBWB 2G55A 2AERH 3BTQE 3SU6A 2UWPA 1AVGH 1HAZB 3QZQA 3VB6A 4MDSA 4DG4A 3NPSA 2P93A 3U8RH 2GX4A 5LPFA 1TB6H 5DP7A 5HM9A 3NK8A 4OGYA 2XRCA 4AFQA 1AE8H 3E3TA 4UEHH 1GMCG 2BDYA 1Z71A 1D9IA 1ZOMA 2Z9GA 1VCQA 1AWHB 3H7TA 3LKWA 2SFAA 3ZVGA 3A89A 4FUFA 1HUTH 1QFKH 2XBYA 1GMDG 1Y3WA 1HXEH 1MQ5A 2V6NA 3A87A 4A7IB 2JETB 4YLUA 3SNBA 3Q77A 4KTSA 2ZFPH 3SJIA 1PQ5A 3S9AA 1P2NA 4AG2A 2QA9E 3TH2H 1SGIB 1XX9A 4X1QU 2VWLA 3PWCA 2G5NA 4GVUA 2ZDNA 4D76A 1W14U 2OP9A 2G4TA 3PWBA 3QO6A 1TPAE 1ANEA 1CGJE 5C20A 1NU7B 2ODPA 2BXTH 1ZGVA 3MNBA 3RXOA 1UK2A 3A7WA 1Z8IB 2CJIA 3BSQA 1A0HB 2GV7A 2WINI 2SGFE 5HXFA 3P8GA 2YOLA 1UVOA 3JZ1B 1F92A 4DVAU 1BRBE 1S0RA 4ASHA 1L4ZA 3HKJB 1T8OA 4AB8A 2ZHQH 4MPUA 3GDUA 3DT0H 1CBWC 1SGTA 1W10U 1BTHH 3L33A 4DT7B 1Z7KA 4FU9A 2HOBA 1ZR0A 1BUIA 1DUAA 3PTNA 1QTFA 1A2CH 4CRCA 3V7TA 3ENSB 4ISLA 1ZPZA 4Y7AA 2WUBA 2A2XH 1FIWA 1JXPA 1H1BA 1O5DH 1TLDA 3EYDA 4ZROA 1O2KA 1ESTA 1D6WA 1GBCA 5PTPA 1O2WA 2ZFQH 1TBZH 2Y5FA 3GY2A 3TK5A 2BY8X 1GHVH 1L4DA 2J9NA 3LIWA 2BQ7B 1O2TA 4X6PA 3LJJA 1UTLM 4NCYA 1BHXF 2FIRH 2FLBH 1PQAA 2JETC 5C1YA 1SPJA 1C2JA 2GDDA 4O97A 3F9GA 2Y80A 3ITIA 3C1KA 3DUXH 3P95A 1O5CB 1TX8A 2LNCA 1GVLA 2HALA 3LGIA 1GG6B 1EJMA 2ZWLH 4GHTA 2ZPQA 3ZVCA 1YPLH 2AMPA 2B7DH 3KF2A 1LVOA 3C27B 1TGNA 2HNTE 1ACBE 5J4QA 1GVKB 2B9LA 1C2IA 1W11U 2BLVA 1IQNA 3UQVA 2ZPSA 2Y5HA 2ZTZA 3O8DA 5GCHG 1CQQA 4BTUB 4YESB 1C2FA 3SU3A 4ZHMU 3TGKE 1GCDA 4X1RU 3S9BA 2D1JA 2XCFA 1SGEE 1GHWH 1HIAB 2FWWA 2KAIA 8ESTE 1GHYH 1EZUC 3D49H 2F9OA 1EATA 5DP5A 1GBDA 1WUNH 2ZECA 2V35A 2NU3E 1L2EA 3SV6A 3RXPA 1OYQA 2XW9A 2SNVA 4JMYA 3TVJB 2ZHEH 2THFB 3BTWE 2ZFFH 4ZHAA 5T3HA 3GY5A 1V2JT 2BY9X 1Y3XA 2ALPA 2UWOA 7LPRA 4Y0ZE 3M3VA 3E16B 3K6ZA 1O37A 2H9TH 2C8YB 3QN7A 1C5UA 4OS7A 1GMCF 3GY7A 7GCHG 4DIHH 3K9XB 4ISIH 3RXQA 5A8ZA 1GG6C 3BV9B 2VH6A 5JPMH 1BTXA 2VIVA 1O35A 5A0CA 1GMDF 1AKSB 1P2MA 2ANWA 1G2MA 3GDVA 3UUZA 3VXEH 3M36A 3RXVA 1GDUA 4B2CA 1OP8A 3IWMA 4MVNA 1DVAH 5DGJA 4DCDA 2UWLA 3SV2H 1GJBB 1QL7A 4KKDA 1BJUA 3LJOA 1NPMA 3TH3H 4X1SU 5AFZH 1Y3UA 4I31A 4ABFA 1QQUA 3GISB 1Y59T 1SGQE 2A0QB 2P3UB 1SGYE 4K3JA 3TLOA 1HYLA 3LOXA 4GCHG 3P8NA 1E34B 2A4OA 2GTBA 4CRFA 3BTTE 1OX1A 1TRNA 4NIWA 1V2RT 1LHEH 1C4Y2 2XNIA 1OSSA 1SLVB 1C1PA 1YP9A 2P95A 1YGCH 4X8SH 1C5PA 1GWAA 3BTEE 3ZZ3A 4MPXA 2F9UA 3ZZ7A 2FI3E 2LPRA 3RXHA 2ZNKH 2PGBB 1BMLA 3KL6A 1O5AB 1RFNA 2H2ZA 1PPFE 2GCTC 1BTYA 1V3XA 4XSKU 2A4GA 3SUFA 5LGOA 1SL3A 3SJKA 3M7QA 3RP2A 1ARCA 1P2OA 2I6SA 5H4IB 2WYGA 3E8LA 4Y0YE 4YT7H 2NU4E 4UFGH 2PSYA 1SLUB 1VCWA 5LH8A 1OWEA 1C9PA 4OS1A 5FPTA 1IQMA 5LPRA 2W5EA 1EP5A 2FOMB 3PB1E 1JIMA 1P2JA 2GGVB 1UTPA 1Y3YA 1A0JA 1SQAA 2ANMH 1V2UT 1AUTC 4B71A 3FZDA 3HPTB 3URCA 6CHAB 1NT1A 1XKAC 3MH6A 2C3SA 2NWNA 1A5IA 1EASA 1JRSA 1XKBC 2PTNA 1G32B 1KLTA 2OC0A 1O3DA 2WPKS 2HLCA 4INLA 1O5FH 4X8TH 2G52A 2Z9JA 5E0JA 2Q6GA 1CSOE 3TGJE 1BMNH 1K1PA 1PPHE 1NO9H 2AIPA 2GZ9A 3TNTA 5GCHF 4O3UA 2ZU4A 5ESBA 1A1RA 1C5YB 1BRAA 3QWCH 1GI2A 1GDNA 3BTME 2ILNA 1TMUH 2O8UA 3TK9A 1O2HA 4H4FA 1C1QA 2G81E 1BQYA 1DS2E 4B2BA 4KTCA 3MU0A 1QY6A 4CH8B 2BLWA 1THPB 3RMOH 1EXFA 3KCGH 2F9VA 1BJVA 1THRH 2GT7A 1GI5A 2BD7A 1UHBA 1SVPA 4ESTE 1B0FA 1O3HA 2WPLS 1O3FA 5E2PA 3A85A 4ZHLU 4BTIB 1YYY1 3GY3A 4IS5A 4NIYA 5BRRE 2ZFSA 4XDEA 1S81A 1MKWK 1T7CA 1HAPH 5I46H 4D7FA 1LHFH 5TCAA 2P94A 1ANDA 1C5RA 2BZ6H 1DWCH 4ABEA 1FDPA 3T26A 4DW2U 3D23A 4X0WU 1NM6A 1QRXA 1ID5H 7GCHF 5GPIB 2FZZA 3RM0H 4A1VA 5DKMA 2AMDA 1ORFA 3MOCA 1LHDH 2AH4X 1SGDE 2OC8A 6CHAC 3TJNA 2VNTA 1EQ9A 1WCZA 1F5LA 4BAOB 3L3TA 8LPRA 4CR5A 1C5ZB 1GI6A 1HJ9A 3U1JB 1EZQA 1CGIE 3EDXB 3O8RA 2NU2E 1F0TA 1HXFH 4YTAA 1PYTD 1H9IE 1EKBB 3BIUH 4YLQH 2ZGBH 1Q3XA 1S6FA 5HMAA 1O2QA 2EI7A 1T4VH 3DA9B 3ZVFA 1AI8H 1EPTB 2BVRH 1TMTH 3T29A 1WQVH 2F83A 2OXSA 1Z1IA 4Y7BA 3F9HA 4E05H 2ZHFH 1G3DA 4NA8A 5DP4A 4K1EA 1NRNH 1DPOA 3LGUA 2OINA 5ABWA 5FPYA 3PLBA 1MU8B 4TY6A 3SU1A 2C90B 3PMAB 4XBDA 2VGCB 1P3EA 1QURH 2XWAA 2O8TA 4J1YA 2QF3A 3ZZ5A 1QB6A 3BTGE 2VVCA 3SZNA 3KIDU 1K1IA 4Y11E 1HAGE 4M7GA 1ZHPA 4YT6H 1ZSLA 2R0KA 2OTVA 4X6OA 2P59A 1GVZA 2C93B 4WMFA 1H8DH 4VGCB 3MH4A 1HV7A 1MTNB 2STAE 1FQ3A 1A0LA 1O30A 3GCOA 4WMEA 1EAXA 1UMAH 5GJ4B 3SBKA 5F6MA 1Y3VA 2A7JA 1GMHG 5L6NH 4WXVA 1XUGA 1OKXA 3SJOA 3RC4A 2PWXA 1QA0A 2RCEA 5L2ZH 1MQ6A 4AORA 4AFUA 2FLRH 4Y6DA 2ZDLA 2J95A 1LDTT 4NWLA 1CO7E 3A88A 3SUEA 3HATH 5I25A 1TGTA 2B5TB 2JH6D 1EPTC 2XC4A 4X2WA 4B1TA 1T8LA 1NN6A 1M9UA 1B5GH 3F6UH 1F0UA 1BTWA 5GWZA 1QBNA 1SGRE 2BD4A 3SOSA 2QN5T 1ELGA 4GLYA 1GBFA 1BTZA 3ESTA 1WTGH 1UJ1A 2PHBA 4JZEH 1FN6A 4KGAA 3SI3H 3NUMA 1C4V2 2ZO3H 2BDIA 4Y10E 1UVUH 2ZQ1A 4H42U 5A2MH 1OWIA 4CBNA 1A3BH 4XOJA 1HIAA 2Z94A 3HGPA 2SNWA 3QGJA 2P3FH 3CS7A 5FX5A 1C1RA 3LU9B 1TA6A 2OBOA 4D8NA 3MNXA 5L30H 2BOHB 1BMAA 4VGCC 1DFPA 1HJAB 1O2LA 4UD9H 1MTNC 1ABJH 2ZF0H 6GCHG 1F2SE 1KXEA 3SO3A 1QQ4A 2YNAA 1A3EH 1N8OB 1BRCE 1XXFA 2Y5GA 3SGAE 4XBCA 4DURA 5FBIA 4UE7H 3ZYEA 1J9CH 1DWBH 4I8LA 1TQ0B 3P8OA 4CRDA 2ODYB 1NTPA 1OWKA 1RRKA 3AAVA 4NA9H 3CENA 1NFXA 2BY6X 2VVVA 3ZYDA 1C5SA 3RLYH 1HGTH 1QJ7B 2QXGA 2BTCE 2WPMS 4RSPA 1AKSA 1Y5AT 1SG8B 1GJ4H 1C1TA 1VJ9U 3NXPA 4Z0KA 3UY9A 1C5OH 1L1JA 9LPRA 2J4IA 4ZKOU 1IQJA 4FUHA 4IGDA 2Q1JA 3MNCA 1NROH 1GHBG 1KXAA 1KXBA 1QJ1B 1HAHH 1PPGE 2RG3A 2ZFRH 1V2KT 5K0HA 3RU4T 3M3SA 1GI0A 1TNGA 4K5ZA 1C5TA 5GIBA 2RA3A 1TBQH 3CS0A 1MUEB 2PSXA 1HBTH 5F8XA 1O2OA 2FOFA 1HAVB 3F9EA 2QXJA 5F03A 1AN1E 4ZH8A 1VCPA 1ZRKA 1C5NH 1OP2A 1O3BA 1HJAC 3NWUA 1YPHE 3SNAA 3FP6E 1QJ6B 1N8OC 2J2UA 1DWEH 4X2XA 3S7HB 4X1NU 1QL9A 1UTOA 1WAYB 1ESBA 5IDKA 5T6GA 1O3CA 8GCHG 3GOVB 2ZG0H 1LVMA 1O2XA 3MFJA 3HGNA 2EA3A 3LGYA 3A80A 1GPZA 3H7OA 4B73A 1VITH 1GBJA 1O3KA 3OTJE 2PTCE 2GKVE 3K6YA 1RJXB 1BIOA 2OUAA 1Q2WA 4WVPE 1C2LA 1ETSH 3KGPA 4NZQA 1AE5A 1SOZA 1A46H 2FI5E 2FP7B 3MNSA 5CMXH 3MU4A 5LPEA 1P12E 3ZV9A 4D7GA 3BEIB 3A7ZA 1FNIA 1G3CA 1LTOA 3O8BA 3URDA 2ZI2H 5AVDA 8KME2 1EOLA 1EJNA 1P10A 1LPZB 3FVFB 1W13U 2A5AA 1K1NA 3E0PB 1E36B 1KXCA 1LHGH 4Z6AH 3TGIE 1MTWA 3SGBE 1DSUA 1ELDE 3RXGA 1K1OA 1O3JA 3A86A 4E06H 1NFYA 1AWFH 2A5IA 4YOIA 1AZZA 3P17H 3UQOA 3VPKA 5C1UA 1SHYA 2A4QA 4K8BA 1GBMA 1SBWA 4DJZB 1CGHA 1NC6A 1C9TA 4TPIZ 2FXRA 2GCHG 4BAHB 3M7TA 1BB0B 2W7SA 1C2KA 4Q7ZA 1YBWA 4Q80A 3RXKA 1TPPA 3ATMA 2ZCKP 1S84A 3RXUA 3GY8A 4NSYA 2BQWB 6GCHF 1EJAA 1SQOA 1WU1A 1QL8A 1TGCA 1GBTA 2I6QA 5DP8A 4AGJA 3GCTF 2QIQA 1H4WA 4CRBA 1TIOA 3Q3XA 1JOUB 3BG8A 4KTUA 1GJ8B 2Z9KA 3DFJA 2FOBA 3PO1B 4NG9H 5CE1A 1O33A 4KP0A 3VB5A 1XUHA 1RTFB 1ZLRA 2VB0A 3A8DA 5AF9H 3S7KB 3M37A 1O3IA 1GHXH 1GI1A 2BY7X 1ARBA 1TX6A 1P3CA 1AFEH 3RXIA 1YM0A 4ABJA 5HGGA 1FV9A 4I33A 1T4UH 3BF6H 1GJCB 2P16A 4H6SB 2ZEBA 3ZZ9A 3RMNH 5C3NA 2CN0H 2OBQA 4BANB 2M5TA 1OYTH 3T2NA 4AYYB 6ESTA 1TONA 2BD8A 2ZTXA 2Q6DA 1W7XH 1G30B 2A4RA 1GHBF 1P06A 2ZGJA 2ZU3A 1EPTA 4THNH 2OC7A 1E0FD 1TRMA 1TNHA 2BVXH 1KLJH 3MO3A 4X1PU 1C1MA 1T32A 2XC0A 3S9CA 3ATIA 2C4FH 1K1MA 3MH7A 4TWYA 1GJ5H 1QBVH 2J38A 3F68H 4AOQA 3A8BA 5EXLA 2OC1A 4LXBH 1C5VA 3BG4B 1PQ7A 4X8VH 2Y7ZA 2ZCLP 3FFGA 3LC3A 4INKA 5FHTA 3TH4H 1EX3A 4FXGH 2XC5A 1L1GA 1S82A 4ABBA 4RKOB 5DJ7A 5DP6A 2A5KA 3A84A 1CT4E 4YZUA 1ZHMA 2FMJA 1AVWA 3RDZA 4SGAE 4RN6A 4LK4A 2FOEA 1V2NT 3DD2H 2PUQH 2FI4E 1UVTH 1WTHD 4MLFB 4Q2KA 5JBAS 2VIOA 3GY4A 3HK6B 3RXLA 1DE7H 1SGCA 2BDHA 4I8KA 2ZHDA 5AFYH 4YM9A 3PO1C 2PR3A 3QDZB 1O3PB 4NFFA 2DE8A 1NRRH 2ZZUH 2Y7XA 3AW1A 2FX6A 3RM2H 3WY8A 1AY6H 1ESAA 3SV8A 1CU1A 1MU6B 2GVFA 1MTUA 1UTKA 3TJVA 2G4UA 1W8BH 3RXJA 3ZVDA 1LVYA 4FU7A 1GBKA 4K2YA 4NIXA 2ASUB 2A1DB 4Y76A 2PFEA 3B23B 3HKIB 3V13A 4WH8A 2ZP0H 1C2EA 2HNTC 1ZJKA 1SC8U 1NFWA 3L6PA 1V2VT 2XBXA 3PMJA 1C5LH 1MMJN 2WV5A 1Z8RA 3MHWU 1T8MA 3W95A 2G8TA 3SV7A 1GJ6A 2DUCA 1BOQA 1H9LB 4MQAA 1GGDB 1KY9A 2F9PA 5FCKA 1O5GH 3BTFE 3MTYA 1FPCH 1TRYA 2XXLA 1AD8H 3EE0B 2W3KA 2ANYA 1LKBA 2O8LA 3SQEE 4MNWA 1FAXA 2GCHF 2BM2A 1MAYA 4MNVA 3A83A 3QUMP 4ZAEA 4ABDA 5EQQA 3UPEA 2UUJB 2WPHS 5C5OA 1GBBA 2AS9A 4MNYA 1ZMNA 2PV9B 4B2AA 1V2MT 4Q7XA 4A92A 1BBRE 1TQ7B 1QRWA 4DGJA 1ZHRA 3ZZ4A 1KDQB 1CT2E 3M5NA 2NU1E 4NGAH 3UR6A 4K1TA 4RKJB 2FOCA 2FEQH 3MYWA 4GPGA 1T8NA 3GDSA 5BPEA 1G9IE 1GJAB 3R3GB 1DOJA 1H8IH 3U8OH 1F5KU 3TPIZ 1MKWH 1CHOG 1FJSA 4K60A 3T62A 4WY3A 1YC0A 2A32A 1FY1A 5EXNA 5JB9S 1HFDA 3ELAH 2FOGA 4AX9H 1ZYOA 4BXWA 1IQFA 1C1NA 2P8OB 3A7XA 3VB3A 2O8MA 4B74A 2BD9A 2JH0D 2GP9B 3LGVA 2BZAA 2BVSH 2TGPZ 1O2UA 3OYPA 3UWIA 3U69H 3ZV8A 2F9BH 1FLEE 4CREA 1SSXA 1X7AC 2OD3B 2XYAA 1O2VA 2BDCA 1RS0A 2ZTYA 3D62A 3PTBA 7ESTE 1WV7H 4K1SA 2HPPH 3FANA 2GT8A 2SGAA 3RUOA 3AW0A 1YPEH 1HAVA 2ZDVH 1EZSC 1ZTKA 3M3TA 1D3DB 5A8YA 1TX7A 2ZGCA 1XUIA 2A7HA 2ZHWH 1TA2A 2IOTA 1MD7A 2UUFB 3RLWH 1O2YA 2BDAA 1LQDB 1TFXA 2BQ6B 1O2SA 1P2KA 2XTTB 1TOMH 6LPRA 1PJPA 2R3UA 4JZ1A 1VGCB 4XE4A 1BZXE 1F0RA 1LVBA 1O3AA 1HAYB 1A5HA 2FOAA 1SQTA 4FUCA 4HGCA 4U01A 1NS3A 3RXAA 2FODA 2FTLE 1BTUA 1QGFA 2XCNA 1CHGA 1GI3A 2R9PA 4GCHF 3GYLB 1SGFG 2RDLA 1ELFA 2BHGA 3T5FH 4QT8C 3MWIU 1EAUA 3PMBB 2EEKA 2Z7FE 1AHTH 3UOUA 5JB8S 1Z8GA 2VIPA 4F49A 4A1TA 2ZDKA 2BD2A 2PUXB 4R0IA 4UFEH 3SU5A 3U9AH 1QIXB 1GDQA 1SR5C 3OY5U 1MBMA 1N6YA 3SQHE 4JK6A 2P8OC 1RXPA 4OGXA 1XUKA 4CHAB 3K2UA 1XUFA 3ZZ6A 4D9RA 5J4SA 3OSYA 1AB9B 1TYNA 1P9SA 5EOKA 1FXYA 1O3GA 3A82A 1S5SA 5FX6A 1P02A 1AMHA 4JYUH 2J34A 1VR1H 3S0NA 2H6MA 1V2TT 4U30A 2QCYA 1JIRA 1RIWB 2GMTB 3QX5H 3DHKH 3ODFA 1Z1JA 3P8FA 2P3TB 1C2GA 1DT2A 3I78A 3SW2B 1SI5H 2WV4A 4JZFH 1P0SH 4LZ4B 1ZPCA 1KTSB 4OS5A 1P04A 4TYDA 2C8WB 4IN1A 3UNRA 1BMMH 4FUDA 1MTVA 2BY5X 2ESTE 3ATWA 1D3PB 2BYAX 1O3LA 1P57B 3ZZBA 2QV1A 4AFZA 2J92A 3UFAA 3ZVEA 1GHAG 5CHAB 2XBVA 1J16A 1VGCC 3ZZDA 1V2OT 3I77A 5JBCS 3PYHA 1SGPE 2HGTH 1PYTC 1DX5M 3QGNB 2QGRA 1FMGA 4X2YA 1IQHA 3GICB 1PPBH 1O2JA 4I8JA 7KMEH 2H9HA 1O39A 1WOFA 4JZIA 5EQSA 1JMOH 1FN8A 1XVMA 2BLOA 2VGCC 4MG3A 2VIDA 1ANBA 2IJOB 5SGAE 1EZXC 1WSSH 1TE0A 2BD5A 1T31A 4AG1A 1LKAA 1A7SA 1V2PT 1AVXA 1ELEE 1MZAA 4CH2B 2O8WA 3Q3KA 4GHQA 1O2GH 1XUJA 1TAWA 4ABAA 4ZXXH 4CHAC 2R0LA 1CT0E 3UTUH 1CHOF 2ZGXH 1AB9C 3Q76A 5ESTE 3B9FH 5T6DA 3GY6A 1QHRB 3VGCB 1O31A 2SGDE 4U32A 2TGAA 2C8ZB 1RGQA 2FS8A 4FU8A 5DP3A 4WXIA 1K1JA 1F5RA 2YNBA 3LH1A 1XMNB 1RIWC 3SNCA 5DK1A 3N7OA 4K69A 1O38A 2PKSB 3UWJH 1S83A 3KN2A 3EA9A 1TPSA 3PM3A 3SUDA 1GJ7B 1FZZA 4O03A 1QR3E 3ZVBA 2K1QA 1PPEE 1QB9A 3Q00A 3U98H 1NESE 5HM2A 1LPGB 1SGFA 4Y8YA 3BIVH 5ETXA 1C5WB 3LONA 2A31A 3RXFA 2WPIS 5CHAC 5AHGH 1O2MA 4MTBA 1IQIA 4TPYA 3LDXH 1OWHA 2PKAB 2Y81A 3E1XB 4R8TB 4U2WA 2FDAA 4FUIA 4NZLA 1MD8A 4SGBE 4UONA 5JBTA 1CA0B 1ELVA 4A5TS 1O36A 1DSTA 2UUYA 1NRQH 1EUFA 5DG6A 1IQLA 1Y8TA 3F1SB 2HNTF 1AUJA 4I8GA 1C2DA 2G51A 4FUEA 1P05A 1V6DA 1OWJA 3RC6A 3V0XA 1E38B 3MH5A 3BTDE 4NWKA 4K8YA 1OP0A 2VIQA 1OPHB 3SJ9A 1FPHH 3BEFB 3VGCC 1P8VC 1MBQA 4CR9A 2BB4A 3O8CA 4JK5A 1KXDA 2FM2A 2EC9H 4X8UH 1THSH 3PROA 1AGJA 2GDEH 1BBRH 1F0SA 2VJ1A 1FY3A 3KHVA 2ULLA 1DICA 4X6NA 1BTPA 1VITG 1RD3B 2PKSC 1O2NA 2UUKB 1GBIA 1DWDH 1GI8B 3NCLA 3PLPA 4I7YH 3ZVAA 4HTCH 1BBRK 1HLTH 5EQRA 1LCYA 3PLKA 3TJOA 2Z3CA 1G3BA 2GZ8A 1OXGA 1GMHF 1S0QA 3RU4E 4A6LA 4D9QA 4GSOA 3M5LA 1K1LA 2VWOA 4KELA 2V3HH 3OY6U 1DM4B 1JWTA 1BCUH 3IITA 1SB1H 1GI4A 3PV4A 2AIQA 2W7UA 1TNJA 4O3TA 4MPWA 3LPRA 5DP9A 3ZZ8A 2AEIH 3SNDA 1CA0C 1EAWA 1GHAF 4WWYA 3EA8A 3A7VA 4AFSA 3B8JA 1UO6A 5EPNA 5FAHA 3M5MA 4UFDH 1C5MD 4CRAA 2ZFTA 4NIVA 4I32A 1B7XB 4Y71A 1IQKA 3S69A 2A2QH 3RU4D 4B76A 2RA0A 4YOGA 1UCYE 4A1XA 1O5BB 2ZCHP 2BDBA 3U8TH 4FVDA 5EG4A 1ZSKA 1AO5A 1W0YH 2NU0E 3MMGA 2CMYA 1MAXA 1DANH 3UOPA 2ZU2A 4JCNA 2JH5D 2D8WA 1BT7A 2JKHA 1KDQA 1L0ZA 5L2YH 1FY5A 1YCPM 4IW4E 1UTJA 1ABIH 4O9VA 1FY8E 5DPAA 5A09A 1GHZA 3GYMA 1O2ZA 2OQUA 2QYIA 2VWNA 5JDUB 1SHHB 1P11E 1ZTJA 3SHAH 4MNXA 5E0GA 1C2HA 2VU8E 1P9UA 1G2LA 1K28D 3CP7A 3QK1A 3F9FA 2AMQA 2OLGA 2BX4A 4NFEA 1J8AA 1AU8A 1SLXB 1W12U 1AFQB 5HYOA 2BLQA 1C2MA 1KIGH 1UVSH 3KQDA 1O2RA 1HAOH 1HAIH 1N6XA 1PPCE 3EAJA 4XBBA 1LPKB 4WJG2 3FP7E 1YPJH 2ZA5A 3UIRA 1WBGB 4Y79A 5A0AE 1Z8JB 4GUXA 1DLKB 4BOHA 1DXWA 1MTSA 2AYWA 1W0ZU 5F8TA 1YPHC 3GCHB 1DLEA 2C8XB 2VINA 2SGQE 1HRTH 2CF8H 2H5CA 2QC2A 1P01A 5TJXA 2TRMA 2EI6A 3TK6A 1EB1H 3FP8E 3RXTA 1A5GH 2D2DA 1GJ9B 4IC5A 5G4BA 3BTKE 1GBHA 2A45B 5EODA 4YOJA 4JYVH 1JBUH 2HVXA 5A8XA 5F8ZA 1AIXH 1YKTA 2TGDA 3RC5A 3AVZA 1P2QA 1WQSA 2OCVB 3RXBA 1IOEA 1Y5BT 3M5OA 1MZDA 3SN8A 2TIOA 2ZQ2A 3ZZAA 1ZZZA 1C5XB 1UTMA 3MI4A 2FOHA 2Q6FA 3UNQA 3UREA 1IHTH 2GCTB 3SNEA 1FAKH 4JZDH 1C1WH 1K9OE 1C1SA 1TGSZ 1FI8A 1YLDA 1Q31A 3RXMA 1F7ZA 1QBOA 1YPKH 1W3CA 1V2QT 3I29A 3T28A 3ATLA 1AFQC 1VITF 4ZUHA 3TIUA 1NY22 1ANCA 1GL0E 1OOKB 1HPGA 3STJA 8GCHF 2F3CE 1FIZA 1J15A 5EW2H 2ZIQH 3MO9A 1SMFE 1Y5UT 1J14A 2CF9H 1NRPH 1C1UH 3LC5A 3T27A 4J2YB 4WMDA 5EW1H 1P09A 1TBRH 1KXFA 1KYNA 3AAUA 3GCHC 2J94A 2FO9A 4DOQA 1U6QA 3KQCA 3NZIA 2IPHA 1YPMH 1G37A 2QF0A 3TNSA 3M7UA 1XM1A 1GJDB 1H9HE 2BDGA 1O3OA 2WYJA 2Z3DA 3SHCH 2CGAA 2AGEX 3A8CA 1YCPH 1INCA 3QZRA 2DE9A 3M61U 1XXDA 1WYKA 1D3QB 1SFIA 2VH0A 1PFXC 1YCPK 3U1IB 1S6HA 3K65B 1CVWH 1BDAA 1EB2A 1NU9A 3BG4C 4ZMAH 5JBBS 1ELTA 3BN9A 1YPGH 3W94A 1UVPA 5GXPA 3HK3B 4Y8XA 3OX7U 5B6OA 5EXMA 1O3EA 1ZGIA 2H1UA 1BHXB 2B0FA 2FYRA 4MPVA 1J17T 1OWDA 2ZDMA 4FUJA 3SUGA 5DO4H 1C1OA 1MKXH 1GI9B 3UNSA 1O3NA 4CBOA 3RXSA 2TGTA 3OU0A 4LOYH 1L1NA 3RXCA 2QXHA 2Y6TA 2BXUH 3MU5A 4ABGA 1MKXK 4AN7A 4H6TA 4DY7B 2Z6BD 5TCCA 1LMWB 2GZ7A 3ZZCA 3RXEA 4OS6A 1ETTH 3LT3A 2HWLB 3AASA 3A8AA 5EU8A 2VWMA 3SV9A 1MCTA 1NZQH 3STIA 5C1XA 2FYQA 2CXVA 2FS9A 4LZ1H 1O34A 2H5DA 1EAIA 1GCTB 4INHA 1ELAA 1AZ8A 1SLWB 4AGKA 1V2ST 1DDJA 1K22H 2BX3A 3JZ2B 1TWXB 1ZJDA 3A7TA 3M35A 9ESTA 2FX4A 1QB1A 1O3MA 3RMMH 4BTTB 1K2I1 1DY9A 2R2WU 2ZGHA 3ODDA 1S85A 3MU8A 2PKAA 3P92A 4OS4A 4Q7YA 1GL1A 2W26A 5FBEA 1E35B 3RMLH 1O2PA 2O9QA 4FUGA 4BNRA 3ATKA 2Z9LA 1FONA 2ALVA 1HAXB 4UFFH 1TGBA 1GGDC 1UK3A 1HB0B 2ZPRA 5E8EH 1A4WH 1DITH 3SU4A 3VB4A 1P2IA 1N1LA 4FUBA 2EI8A 1EP6A 2ANKH 1Z6JH 2QAAA 2ZU1A 1ELCA 4BAKB 2XWBI 3TITA 2KAIB 3KQEA 1BA8B 1BITA 5FCRA 4ZKSU 3BEUA 1DUEA 4NSVA 2R3YA 4ISOA 1TNKA 1LHCH 1UCYH 3IG6B 2G5VA 1TPOA 3SU0A 3VXFH 1CA8B 2H9EH 3UR9A 1GBLA 1HNEE 1C4U2 1UCYK 1HCGA 1NRSH 3SU2A 1E37B 1O2IA 1FY4A 1SOTA 3SORA 3Q3YA 1ZSJA 4BAQB 5EGMA 1GCTC 5A0BA 3RXDA 5C67A 3SI4H 5E2OA 1RTLA 1TALA 2QXIA 5EPYA 4E7NA 1VZQH 1RTKA 1BRUP 1O32A 2WPJS 1EOJA 5T6FA 3E91A 2ZU5A 3SGQE 4WF8A 4IC6A 2IN2A 4GAWA 3EQ0H 4ABIA 3QTOH 3FAOA 2ZDAH 4FVBA 5IYTA 4ZKNU 4NA7A 1IQEA 3GCNA 4ABHA 3MO6A 2FTMA 3QLPH 1JRTA 1UK4A 1IHSH 1GI7B 4HZHA 2GD4B 2PGQB 4ISNA 4UDWH 3H5CB 1QCPA 1W7GH 5GDSH 3P70B 1V2WT 2Y82A 2BOKA 2ZC9H 4DIIH 5FXLA 4CRGA 4ISHH 2Z3EA 2W3IA 1B0EA 1Z6EA 2AGIX 2PLXA 3RXRA 3QTVH 4AYVB 3LGTA 2XBWA 1D6RA 3LGWA 4AB9A 2FESH 1NFUA 3A81A 1UTQA 1SGNE 2A7CA 3E90B 1FUJA 4TY7A 2OQ5A 3V3MA 4X6MA 3VB7A 2STBE 1DY8A 2WUCA 1OS8A 2D26C 2R2MB 3TU7H 1IQGA 3MU1A 3PMHB 4HFPB 4IMQA 3TJUA 1TNIA 3SJ8A 1SFQB 2Z9IA 4X2VA 2F91A 2V3OH 3EGKH 2PW8H 1MH0A 2TBSA 4IMZA 3FZZA 3KNXA 2VVUA 2QY0B 1KTTB 3E6PH 2CHAB 1GBEA 1P03A 4Y8ZA 2TPIZ 3DFLA 4F4OC 1TOCB 4E7RG 3E0NB 4IBLH 2BMGB 1K21H 1QNJA 1ZPBA 1C1VH 5C2ZA 3KQBA 2SGPE 4WH6A 3D65E 4OS2A 3R0FA 1ZMJA 1PPZA 3VEQB 1HJ8A 5C5NA 3T25A 3BTHE 1D3TB 1HDTH 4XFQA 5K7RA 5JYIA 1VJAU 4HI3A 1UTNA 1GBAA 1MCVA 2V0BA 3G01A 1KSNA 5E0HA 3A7YA 1AQ7A 3VFEA 2B8OH 4ZXYH 1KLIH 1ELBA 3P6ZB 2AFQB 1TABE 1O5EH 4AZ2B 1C5QA 1O0DH 1PQ8A 2GMTC 1W2KH 1TMBH 1YLCA 2BD3A 2HPQH 2ZKSA 3LH3A 1A61H 4BAMB 4PROA 2GV6A 1QRZA 2FPZA 1G3EA 1YF4A
chains in the Genus database with same CATH superfamily
2SGEE 2AGGX 2JIZD 2EY4C 2G00A 2CV3A 4BXSA 3GCTG 1LO6A 4TWWA 1TNLA 2VIWA 3V12A 1QA7A 2F9NA 1ETRH 1V2LT 4ZKRU 2HRVA 3KEEA 1ZMLA 4XD7D 1G36A 4IN2A 2ODQA 1ZTLA 4I8HA 1ZRBA 4B75A 2CHAC 1XVOA 1UHBB 3EA7A 1IAUA 1DXPA 1LQEA 4JYTA 1CE5A 1D4PB 4YO9A 3NKKA 5FPSA 1CBWB 3WWBA 2G55A 2AERH 3BTQE 3SU6A 2UWPA 1AVGH 1HAZB 3QZQA 3VB6A 4MDSA 4DG4A 3NPSA 2P93A 3U8RH 1VKYA 2GX4A 5LPFA 1TB6H 5DP7A 5HM9A 3NK8A 4OGYA 2XRCA 4AFQA 1AE8H 3E3TA 4UEHH 1GMCG 2BDYA 1Z71A 1D9IA 1ZOMA 3WW7A 2Z9GA 1VCQA 1AWHB 3H7TA 3LKWA 2SFAA 3ZVGA 2LELA 3A89A 4FUFA 1HUTH 1QFKH 2J5UA 2XBYA 1GMDG 1Y3WA 1HXEH 1MQ5A 2V6NA 3A87A 4A7IB 2JETB 4YLUA 3SNBA 3Q77A 4KTSA 2ZFPH 3SJIA 1PQ5A 3S9AA 1P2NA 4AG2A 2QA9E 3TH2H 1SGIB 1XX9A 4X1QU 2VWLA 3PWCA 2G5NA 4GVUA 2ZDNA 4D76A 1W14U 2OP9A 2G4TA 3PWBA 3QO6A 1TPAE 1ANEA 1CGJE 5C20A 1NU7B 2ODPA 2BXTH 1ZGVA 3MNBA 3RXOA 1UK2A 3A7WA 1Z8IB 2CJIA 4RI0A 3BSQA 1A0HB 2GV7A 2WINI 2SGFE 5HXFA 3P8GA 2YOLA 1UVOA 3JZ1B 1F92A 4DVAU 1BRBE 2HLDD 1S0RA 1YY3A 4ASHA 1L4ZA 3HKJB 5CHBA 1T8OA 4AB8A 2ZHQH 4MPUA 3GDUA 3DT0H 1CBWC 1SGTA 1W10U 1BTHH 3L33A 4DT7B 1Z7KA 4FU9A 2HOBA 1ZR0A 1BUIA 1DUAA 3PTNA 1QTFA 1A2CH 4CRCA 3V7TA 3ENSB 4ISLA 1ZPZA 4Y7AA 2WUBA 2A2XH 1FIWA 1JXPA 1H1BA 1O5DH 1TLDA 3EYDA 4ZROA 1O2KA 1ESTA 1D6WA 1GBCA 5PTPA 1O2WA 2ZFQH 1TBZH 2Y5FA 3GY2A 3TK5A 2BY8X 1GHVH 1L4DA 2J9NA 1OHHD 3LIWA 2BQ7B 1O2TA 4X6PA 3LJJA 1UTLM 4NCYA 1BHXF 2FIRH 2FLBH 2L74A 1PQAA 2JETC 5C1YA 1SPJA 1C2JA 2GDDA 4O97A 3F9GA 2Y80A 3ITIA 3C1KA 3DUXH 3P95A 1O5CB 1TX8A 2LNCA 1GVLA 2HALA 3LGIA 1GG6B 1EJMA 2ZWLH 4GHTA 2ZPQA 3ZVCA 1YPLH 2AMPA 2B7DH 3KF2A 1LVOA 3C27B 1TGNA 2HNTE 1ACBE 5J4QA 1GVKB 2B9LA 1C2IA 1W11U 2BLVA 1IQNA 3OEED 3UQVA 2ZPSA 2Y5HA 2ZTZA 3O8DA 5GCHG 1CQQA 4BTUB 4YESB 1C2FA 3SU3A 1W0JD 4ZHMU 3TGKE 1GCDA 4X1RU 3S9BA 2D1JA 2XCFA 1SGEE 1GHWH 1HIAB 2FWWA 2KAIA 8ESTE 1GHYH 1EZUC 3D49H 2F9OA 1EATA 5DP5A 1GBDA 1WUNH 2ZECA 2V35A 2V7QD 2NU3E 3KQ5A 1L2EA 3SV6A 3RXPA 1OYQA 2XW9A 2SNVA 4JMYA 3TVJB 2ZHEH 2THFB 3BTWE 2ZFFH 4ZHAA 3NRLA 5T3HA 3GY5A 5EJZA 1V2JT 2BY9X 1Y3XA 2ALPA 2UWOA 7LPRA 4Y0ZE 3M3VA 3E16B 2KX4A 3K6ZA 1O37A 2H9TH 2C8YB 3QN7A 1C5UA 1SKYE 4OS7A 1GMCF 3GY7A 7GCHG 4DIHH 3K9XB 4ISIH 3RXQA 5A8ZA 1GG6C 3BV9B 2VH6A 5JPMH 1BTXA 2VIVA 1O35A 5A0CA 1GMDF 1AKSB 1P2MA 2ANWA 1G2MA 3GDVA 3UUZA 3VXEH 3PRDA 3M36A 3RXVA 1GDUA 4B2CA 1OP8A 3IWMA 4MVNA 1DVAH 5DGJA 4DCDA 5C0TA 2UWLA 3SV2H 1GJBB 1QL7A 4KKDA 1BJUA 3LJOA 1NPMA 3TH3H 4X1SU 5AFZH 1Y3UA 2WZQA 4I31A 4ABFA 1QQUA 2XOKD 1Y59T 1SGQE 2A0QB 2P3UB 2V3MA 3GISB 1SGYE 2WHXA 4K3JA 3TLOA 1HYLA 3LOXA 4GCHG 3P8NA 1E34B 2A4OA 2GTBA 4CRFA 3BTTE 1OX1A 1TRNA 4NIWA 1V2RT 1E1QD 5IK2D 1LHEH 2IJD1 1C4Y2 2XNIA 1OSSA 1SLVB 1C1PA 1YP9A 2P95A 1YGCH 4X8SH 4F48B 1C5PA 1GWAA 3BTEE 3ZZ3A 4MPXA 2F9UA 3ZZ7A 2FI3E 2LPRA 3RXHA 2ZNKH 2PGBB 1BMLA 3KL6A 1O5AB 1RFNA 1YWUA 2H2ZA 1PPFE 2GCTC 1BTYA 1V3XA 4XSKU 2QF4A 2A4GA 3SUFA 5LGOA 1SL3A 3SJKA 3M7QA 3RP2A 1ARCA 1P2OA 2I6SA 5H4IB 2WYGA 3E8LA 4Y0YE 4YT7H 2NU4E 4UFGH 2PSYA 1SLUB 1VCWA 5LH8A 4P00A 1OWEA 1C9PA 4OS1A 5FPTA 1IQMA 5LPRA 2W5EA 1EP5A 2FOMB 3PB1E 1JIMA 1P2JA 2GGVB 1UTPA 1Y3YA 1A0JA 1SQAA 2ANMH 1V2UT 1AUTC 4B71A 3FZDA 3HPTB 3URCA 6CHAB 1NT1A 1XKAC 3MH6A 2C3SA 2NWNA 1A5IA 1EASA 1JRSA 1XKBC 2PTNA 1G32B 1KLTA 2OC0A 1O3DA 2WPKS 2HLCA 4INLA 1O5FH 4X8TH 2G52A 2Z9JA 5E0JA 2Q6GA 2KM0A 1CSOE 3TGJE 1BMNH 1K1PA 1PPHE 1NO9H 2AIPA 2GZ9A 3TNTA 5GCHF 4O3UA 2ZU4A 5ESBA 1A1RA 1C5YB 1BRAA 3QWCH 1GI2A 1GDNA 3BTME 2ILNA 1TMUH 2O8UA 3TK9A 1O2HA 4H4FA 1C1QA 2G81E 1BQYA 1DS2E 4B2BA 4KTCA 3MU0A 1QY6A 4CH8B 2BLWA 2J98B 1THPB 5FL7D 3RMOH 1EXFA 3KCGH 2F9VA 1BJVA 1THRH 2GT7A 1GI5A 2BD7A 1UHBA 1SVPA 2JJ2D 4ESTE 1B0FA 1O3HA 2WPLS 1O3FA 5E2PA 3A85A 4ZHLU 4BTIB 2RFKC 1YYY1 3GY3A 4IS5A 4NIYA 5BRRE 2ZFSA 4XDEA 1S81A 1MKWK 1T7CA 1HAPH 2W6ID 5I46H 4D7FA 1LHFH 5TCAA 2P94A 3OFND 1ANDA 1C5RA 2BZ6H 1DWCH 4ABEA 1FDPA 3T26A 1FX0B 4DW2U 3D23A 4X0WU 1NM6A 1QRXA 1ID5H 7GCHF 5GPIB 2FZZA 3RM0H 3PV5A 5DKMA 3H09A 2AMDA 1ORFA 4A1VA 3MOCA 1LHDH 2AH4X 1SGDE 2OC8A 6CHAC 3TJNA 2VNTA 1EQ9A 1WCZA 1F5LA 4BAOB 3L3TA 8LPRA 4CR5A 1C5ZB 1GI6A 1HJ9A 3U1JB 1EZQA 1CGIE 3EDXB 3O8RA 1H8ED 2NU2E 3MQKC 1F0TA 1HXFH 1UW7A 1PYTD 4YTAA 1H9IE 1EKBB 3AK5A 3BIUH 4YLQH 2ZGBH 1Q3XA 1S6FA 5HMAA 1O2QA 2EI7A 1T4VH 3DA9B 3ZVFA 1AI8H 1EPTB 2BVRH 1TMTH 3T29A 1WQVH 2F83A 2OXSA 1Z1IA 4Y7BA 3F9HA 4E05H 2ZHFH 1G3DA 4NA8A 5DP4A 4K1EA 1NRNH 1DPOA 3LGUA 3DSOA 2OINA 5ABWA 5FPYA 3PLBA 1MU8B 4TY6A 3SU1A 2C90B 3PMAB 4XBDA 2VGCB 5EIYA 1P3EA 1QURH 2XWAA 2O8TA 4Q63A 4J1YA 2QF3A 3ZZ5A 1QB6A 3BTGE 2VVCA 3SZNA 3KIDU 1K1IA 4Y11E 1HAGE 4M7GA 1ZHPA 4YT6H 1ZSLA 2R0KA 2OTVA 4X6OA 2P59A 1GVZA 2C93B 4WMFA 1H8DH 4VGCB 3MH4A 1HV7A 1MTNB 2STAE 1FQ3A 1A0LA 1O30A 3GCOA 4WMEA 1EAXA 1UMAH 5GJ4B 3SBKA 5F6MA 1Y3VA 2A7JA 1GMHG 5L6NH 4WXVA 1XUGA 1OKXA 3SJOA 3VG8A 3RC4A 3GS9A 2PWXA 1QA0A 2RCEA 5L2ZH 1MQ6A 4AORA 1H8HD 4AFUA 2FLRH 4Y6DA 2ZDLA 2J95A 1LDTT 4NWLA 1CO7E 3A88A 3SUEA 3HATH 5I25A 1TGTA 2B5TB 2JH6D 1EPTC 2XC4A 4B6EA 4X2WA 4B1TA 1T8LA 1NN6A 1M9UA 1B5GH 3F6UH 1F0UA 1BTWA 5GWZA 1QBNA 1SGRE 2BD4A 4I86A 3SOSA 2QN5T 1ELGA 4GLYA 1GBFA 1BTZA 3ESTA 1WTGH 1UJ1A 2PHBA 4JZEH 1FN6A 4KGAA 3SI3H 3NUMA 1C4V2 2ZO3H 2BDIA 4Y10E 1UVUH 2YMSD 2ZQ1A 4H42U 5A2MH 1OWIA 4CBNA 1A3BH 4XOJA 1HIAA 2KR7A 2Z94A 3HGPA 2SNWA 3QGJA 2P3FH 3CS7A 5FX5A 1C1RA 3LU9B 1TA6A 2OBOA 4D8NA 3MNXA 4TSFD 5L30H 2BOHB 1BMAA 4VGCC 1DFPA 1HJAB 1O2LA 4UD9H 1MTNC 1ABJH 2ZF0H 6GCHG 1F2SE 1KXEA 3SO3A 1QQ4A 2YNAA 1A3EH 1N8OB 1BRCE 1XXFA 2Y5GA 3SGAE 4XBCA 4DURA 5FBIA 4UE7H 3ZYEA 1J9CH 1DWBH 4I8LA 1TQ0B 3P8OA 4CRDA 2ODYB 1NTPA 1OWKA 1RRKA 3AAVA 4NA9H 3CENA 5C94A 1NFXA 2BY6X 2VVVA 3ZYDA 1C5SA 3RLYH 1HGTH 1QJ7B 1S6LA 2QXGA 2BTCE 2WPMS 4RSPA 1AKSA 1Y5AT 1SG8B 1GJ4H 1C1TA 1VJ9U 3NXPA 4Z0KA 3UY9A 1C5OH 1L1JA 9LPRA 2J4IA 4ZKOU 1IQJA 4FUHA 4IGDA 2Q1JA 3MNCA 1NROH 1GHBG 1KXAA 1KXBA 1QJ1B 1HAHH 1PPGE 2RG3A 2ZFRH 1V2KT 5K0HA 3RU4T 3M3SA 3PV2A 1GI0A 1TNGA 4K5ZA 1C5TA 5GIBA 2RA3A 1TBQH 3CS0A 1MUEB 2PSXA 1HBTH 5F8XA 1O2OA 2FOFA 1HAVB 3F9EA 2QXJA 5F03A 1AN1E 4ZH8A 1VCPA 1ZRKA 1C5NH 1OP2A 1O3BA 1HJAC 3NWUA 1YPHE 3SNAA 3FP6E 1QJ6B 1N8OC 3DSPA 2J2UA 1DWEH 4X2XA 3FOAA 3S7HB 4X1NU 1QL9A 1UTOA 1WAYB 1ESBA 5IDKA 5T6GA 1O3CA 8GCHG 3GOVB 2ZG0H 1LVMA 1O2XA 3MFJA 3HGNA 2EA3A 3LGYA 3A80A 5KGOA 1GPZA 3H7OA 4B73A 1VITH 1GBJA 1O3KA 3OTJE 2PTCE 2GKVE 3K6YA 1RJXB 3F0PA 1BIOA 2OUAA 1Q2WA 4WVPE 1C2LA 1ETSH 3KGPA 4NZQA 1AE5A 1SOZA 1A46H 2FI5E 2FP7B 3MNSA 5CMXH 3MU4A 5LPEA 1P12E 3ZV9A 4D7GA 3BEIB 3A7ZA 1FNIA 1G3CA 1LTOA 3O8BA 3URDA 2KCPA 2ZI2H 3SZEA 5AVDA 8KME2 1EOLA 1EJNA 1P10A 1LPZB 3FVFB 1W13U 2A5AA 1K1NA 1E79D 3E0PB 1E36B 1KXCA 1LHGH 4Z6AH 3TGIE 1MTWA 3SGBE 1DSUA 1ELDE 3RXGA 3U28C 1K1OA 1O3JA 3A86A 4E06H 1NFYA 1AWFH 2A5IA 4YOIA 1AZZA 3P17H 3UQOA 3VPKA 5C1UA 1SHYA 2A4QA 4K8BA 1GBMA 1SBWA 4DJZB 1CGHA 1NC6A 1C9TA 4TPIZ 2FXRA 3SYJA 2GCHG 4BAHB 3M7TA 1BB0B 2J98A 2W7SA 1C2KA 4Q7ZA 1YBWA 4Q80A 3RXKA 1TPPA 3ATMA 2ZCKP 1S84A 3RXUA 3GY8A 4NSYA 2BQWB 2WV9A 6GCHF 1EJAA 4YXWD 1SQOA 1WU1A 1QL8A 3ZIAD 1TGCA 1GBTA 2I6QA 5DP8A 1BMFD 4AGJA 3GCTF 2QIQA 4ACAA 1H4WA 4CRBA 1TIOA 3Q3XA 1JOUB 3BG8A 4KTUA 1GJ8B 2Z9KA 3DFJA 2FOBA 3PO1B 4NG9H 5CE1A 1O33A 4KP0A 3VB5A 1XUHA 1RTFB 1ZLRA 2VB0A 3A8DA 5AF9H 3S7KB 3M37A 1O3IA 1GHXH 1GI1A 2BY7X 1ARBA 1TX6A 2K8IA 1P3CA 1AFEH 3RXIA 1YM0A 4ABJA 5HGGA 5HIYA 1FV9A 4I33A 1T4UH 3BF6H 1GJCB 2P16A 4H6SB 2ZEBA 3ZZ9A 3RMNH 5C3NA 2CN0H 2OBQA 4BANB 2M5TA 1OYTH 3T2NA 4AYYB 6ESTA 1TONA 5C0UA 2BD8A 2ZTXA 2Q6DA 3F2GA 1W7XH 1G30B 2A4RA 1GHBF 1P06A 2ZGJA 2ZU3A 1EPTA 4THNH 2OC7A 1E0FD 1TRMA 1TNHA 2BVXH 3W1EA 1KLJH 3MO3A 4X1PU 1C1MA 5KEDA 1T32A 2XC0A 3S9CA 3ATIA 2C4FH 1K1MA 3DSGA 3MH7A 3OEHD 1GJ5H 1QBVH 2J38A 3F68H 4TWYA 4AOQA 3A8BA 5EXLA 2EQNA 2OC1A 4LXBH 1C5VA 3BG4B 1PQ7A 4X8VH 2Y7ZA 2ZCLP 3FFGA 3LC3A 4INKA 5FHTA 3TH4H 1SQRA 1EX3A 4FXGH 2XC5A 1L1GA 1S82A 3PRBA 4ABBA 4RKOB 5DJ7A 5DP6A 2A5KA 3A84A 1CT4E 4F55A 4YZUA 1ZHMA 2FMJA 1AVWA 3RDZA 4SGAE 4RN6A 4LK4A 2FOEA 1V2NT 3DD2H 2PUQH 2FI4E 1UVTH 1WTHD 4MLFB 4Q2KA 5JBAS 2VIOA 3GY4A 2WPDD 1EFRD 3HK6B 3RXLA 1DE7H 1SGCA 2BDHA 4I8KA 2ZHDA 5AFYH 4YM9A 3CNRA 3PO1C 2PR3A 3QDZB 1O3PB 4NFFA 2DE8A 1NRRH 2ZZUH 2Y7XA 3AW1A 2FX6A 3RM2H 3WY8A 1AY6H 1ESAA 3SV8A 1W0KD 1CU1A 4RT0A 1MU6B 2GVFA 3F2HA 1MTUA 1UTKA 3TJVA 2G4UA 1W8BH 3RXJA 3ZVDA 1LVYA 4FU7A 1GBKA 4K2YA 4NIXA 2ASUB 2A1DB 4Y76A 2PFEA 3B23B 3HKIB 3V13A 4WH8A 2ZP0H 1C2EA 2HNTC 1ZJKA 1SC8U 1NFWA 3L6PA 1V2VT 2XBXA 3PMJA 1C5LH 1MMJN 2WV5A 1Z8RA 3MHWU 1T8MA 2JDID 1K0HA 3W95A 2G8TA 3SV7A 2KCYA 1GJ6A 2DUCA 1BOQA 1H9LB 4MQAA 1GGDB 1KY9A 2F9PA 5FCKA 1O5GH 3BTFE 3MTYA 1FPCH 1TRYA 2XXLA 3UAIC 1AD8H 3EE0B 2W3KA 2ANYA 1LKBA 2O8LA 3SQEE 4MNWA 1FAXA 2GCHF 2BM2A 1MAYA 4MNVA 3A83A 3QUMP 4ZAEA 4ABDA 5EQQA 3UPEA 2UUJB 2WPHS 5C5OA 2OK5A 1GBBA 2AS9A 4MNYA 1ZMNA 2PV9B 4B2AA 1V2MT 4Q7XA 4A92A 1BBRE 1TQ7B 1QRWA 4DGJA 1ZHRA 3ZZ4A 1KDQB 1CT2E 3M5NA 2NU1E 4NGAH 3UR6A 4K1TA 4RKJB 2FOCA 2FEQH 3MYWA 4GPGA 1T8NA 3GDSA 5BPEA 1G9IE 1GJAB 3R3GB 1DOJA 1H8IH 3U8OH 1F5KU 3TPIZ 1MKWH 1CHOG 1FJSA 1NBME 3DCLA 4K60A 3T62A 4WY3A 1YC0A 2A32A 1FY1A 5EXNA 5JB9S 1HFDA 3ELAH 2FOGA 4AX9H 1ZYOA 4BXWA 3N7DA 1IQFA 1C1NA 3OTPA 2P8OB 3A7XA 3VB3A 2O8MA 4B74A 2BD9A 2JH0D 2GP9B 3LGVA 2BZAA 2BVSH 2TGPZ 1O2UA 3OYPA 3UWIA 3U69H 3ZV8A 2F9BH 1FLEE 4CREA 1SSXA 1X7AC 2OD3B 2XYAA 1O2VA 2BDCA 1RS0A 2ZTYA 3D62A 3PTBA 7ESTE 1WV7H 4K1SA 2HPPH 3FANA 2GT8A 2SGAA 1NBMD 4ASUD 3RUOA 3AW0A 1YPEH 1HAVA 2ZDVH 1EZSC 1ZTKA 3M3TA 1D3DB 5A8YA 1TX7A 2ZGCA 1XUIA 2A7HA 2ZHWH 3EE7A 1TA2A 2IOTA 1MD7A 2UUFB 3RLWH 1O2YA 2BDAA 1LQDB 1TFXA 2BQ6B 1O2SA 1P2KA 2XTTB 1TOMH 6LPRA 1PJPA 2R3UA 4JZ1A 1VGCB 4XE4A 1BZXE 1F0RA 1LVBA 1O3AA 1HAYB 1A5HA 2FOAA 1QZ8A 1SQTA 4FUCA 4HGCA 4U01A 1NS3A 3RXAA 2FODA 2FTLE 1BTUA 1QGFA 2XCNA 1CHGA 1GI3A 2R9PA 4GCHF 3GYLB 1SGFG 2RDLA 1ELFA 2BHGA 3T5FH 4QT8C 3MWIU 1EAUA 3PMBB 2EEKA 2Z7FE 1AHTH 3UOUA 5JB8S 1Z8GA 2VIPA 4F49A 4A1TA 2ZDKA 2KCOA 2BD2A 2PUXB 4R0IA 4UFEH 3SU5A 3U9AH 1QIXB 1GDQA 1SR5C 3OY5U 1MBMA 1N6YA 3SQHE 4JK6A 2P8OC 1RXPA 4OGXA 1XUKA 4CHAB 3K2UA 1XUFA 3ZZ6A 4D9RA 5J4SA 3OSYA 1AB9B 1TYNA 1P9SA 5EOKA 1FXYA 1O3GA 3A82A 1S5SA 5FX6A 2KFWA 2LP6A 1P02A 1AMHA 4JYUH 2J34A 1VR1H 3S0NA 2H6MA 1V2TT 4U30A 2QCYA 1JIRA 1RIWB 2GMTB 3QX5H 3DHKH 3ODFA 1Z1JA 3P8FA 2P3TB 1C2GA 1DT2A 3I78A 3SW2B 1SI5H 2WV4A 4JZFH 1P0SH 4LZ4B 1ZPCA 1KTSB 2F4LA 4OS5A 3UB0A 1P04A 4TYDA 2C8WB 4IN1A 3UNRA 1BMMH 4FUDA 1MTVA 2BY5X 2ESTE 3ATWA 1D3PB 2BYAX 1O3LA 1P57B 3ZZBA 2QV1A 4AFZA 2J92A 3UFAA 3ZVEA 1GHAG 5CHAB 2XBVA 1J16A 1VGCC 3ZZDA 1V2OT 3I77A 5JBCS 3PYHA 1SGPE 2HGTH 1PYTC 3F2FA 1WXRA 1DX5M 3QGNB 2QGRA 1FMGA 3OAAD 1IQHA 3GICB 1PPBH 4X2YA 1O2JA 4I8JA 7KMEH 2H9HA 5HIZA 5B6LA 1O39A 1WOFA 2RDEA 4JZIA 5EQSA 1JMOH 1FN8A 1XVMA 2BLOA 2VGCC 4MG3A 2VIDA 1ANBA 2IJOB 5SGAE 1EZXC 1WSSH 1TE0A 2BD5A 1T31A 4AG1A 1LKAA 1A7SA 1V2PT 1AVXA 1ELEE 1MZAA 4CH2B 2O8WA 3Q3KA 4GHQA 1O2GH 3FN8A 1XUJA 1TAWA 5F53A 4ABAA 4ZXXH 4FOUC 4CHAC 2R0LA 1CT0E 3UTUH 2YMSB 1CHOF 2ZGXH 1AB9C 3Q76A 5ESTE 3B9FH 5T6DA 3GY6A 1QHRB 3VGCB 1O31A 2SGDE 4U32A 2TGAA 2C8ZB 1RGQA 2FS8A 4FU8A 5DP3A 4WXIA 1K1JA 1F5RA 2YNBA 3LH1A 1XMNB 1RIWC 3SNCA 5DK1A 3N7OA 4K69A 1O38A 2PKSB 3UWJH 1S83A 3KN2A 3EA9A 1TPSA 3PM3A 3SUDA 1GJ7B 1FZZA 4O03A 1QR3E 3ZVBA 2K1QA 1PPEE 1QB9A 3Q00A 3U98H 1NESE 5HM2A 1LPGB 1SGFA 4Y8YA 3BIVH 5ETXA 1C5WB 3LONA 2A31A 3RXFA 2WPIS 5CHAC 5AHGH 1O2MA 4MTBA 1IQIA 4TPYA 3LDXH 1OWHA 2PKAB 2Y81A 1KMHB 3E1XB 4R8TB 4U2WA 2FDAA 4FUIA 2QF5A 4NZLA 3N99A 1MD8A 1WDIA 4SGBE 4UONA 5JBTA 1CA0B 1ELVA 4A5TS 1O36A 1DSTA 2UUYA 1NRQH 1EUFA 2IPQX 1IQLA 1Y8TA 3F1SB 5DG6A 2HNTF 1AUJA 4I8GA 1C2DA 2G51A 4FUEA 1P05A 5EJ1A 1V6DA 1OWJA 3RC6A 2WSSD 3V0XA 1E38B 3MH5A 3BTDE 4NWKA 4K8YA 1OP0A 2VIQA 2YMSC 1OPHB 3SJ9A 1FPHH 3BEFB 3VGCC 1P8VC 1MBQA 4CR9A 2BB4A 3O8CA 5T1VA 4JK5A 1KXDA 2FM2A 2EC9H 4X8UH 1THSH 1E1RD 3PROA 1AGJA 2GDEH 1BBRH 1F0SA 2VJ1A 1FY3A 3KHVA 2ULLA 1DICA 4Q4LA 4X6NA 1BTPA 1VITG 1RD3B 2PKSC 1O2NA 2UUKB 1GBIA 2GJGA 1DWDH 1GI8B 3NCLA 3PLPA 4I7YH 3ZVAA 4HTCH 1BBRK 1HLTH 5EQRA 1LCYA 3PLKA 3TJOA 2Z3CA 4RT1A 1G3BA 2GZ8A 1OXGA 2JJ1D 1GMHF 1S0QA 3RU4E 4A6LA 4D9QA 4GSOA 3M5LA 1K1LA 2VWOA 4KELA 2K0QA 2V3HH 3OY6U 1DM4B 1JWTA 1BCUH 5DSFA 3IITA 1SB1H 1GI4A 3PV4A 2AIQA 2W7UA 1TNJA 4O3TA 4MPWA 3LPRA 5DP9A 3ZZ8A 2AEIH 3SNDA 1CA0C 1EAWA 1GHAF 4WWYA 3EA8A 3A7VA 4AFSA 3B8JA 1UO6A 5EPNA 5FAHA 3M5MA 4UFDH 1C5MD 4CRAA 2ZFTA 4NIVA 4I32A 1B7XB 4Y71A 1IQKA 3S69A 2A2QH 3RU4D 4B76A 2RA0A 4YOGA 1UCYE 4A1XA 1O5BB 2PP6A 2ZCHP 2BDBA 3U8TH 4FVDA 5EG4A 1ZSKA 1AO5A 1W0YH 2NU0E 3MMGA 2CMYA 1MAXA 1DANH 3UOPA 2ZU2A 4JCNA 2JH5D 2D8WA 1BT7A 2JKHA 1KDQA 1L0ZA 5L2YH 1FY5A 1YCPM 4IW4E 1UTJA 1ABIH 4O9VA 1FY8E 5DPAA 5A09A 1GHZA 3GYMA 4FETA 1O2ZA 2AHME 2OQUA 2QYIA 2VWNA 5JDUB 1SHHB 1P11E 1ZTJA 2L6OA 3SHAH 4MNXA 5E0GA 1C2HA 2VU8E 1P9UA 1G2LA 1K28D 3CP7A 3QK1A 3F9FA 2AMQA 2OLGA 2BX4A 4NFEA 1J8AA 1AU8A 1SLXB 1W12U 1AFQB 5HYOA 2BLQA 1C2MA 1KIGH 1UVSH 3KQDA 1O2RA 1HAOH 1HAIH 1N6XA 1PPCE 3EAJA 4XBBA 1LPKB 4WJG2 3FP7E 1YPJH 2ZA5A 3UIRA 1WBGB 4Y79A 3FO8D 5A0AE 1Z8JB 4GUXA 1DLKB 4BOHA 3KYFA 1DXWA 2CK3D 1MTSA 2AYWA 1W0ZU 5F8TA 1YPHC 3GCHB 1DLEA 2C8XB 2VINA 2SGQE 1HRTH 2CF8H 2H5CA 2QC2A 1P01A 5TJXA 2TRMA 2EI6A 3TK6A 1EB1H 3FP8E 3RXTA 1A5GH 2D2DA 1GJ9B 2W6JD 4IC5A 5G4BA 5KECA 3BTKE 1GBHA 2A45B 5EODA 4YOJA 4JYVH 1JBUH 2HVXA 5A8XA 5F8ZA 1AIXH 1YKTA 2TGDA 3RC5A 3AVZA 1P2QA 1WQSA 2OCVB 3RXBA 1IOEA 1Y5BT 3M5OA 1MZDA 3SN8A 2TIOA 2ZQ2A 3ZZAA 1ZZZA 1C5XB 1UTMA 3MI4A 2FOHA 2Q6FA 3UNQA 3UREA 1IHTH 2GCTB 3SNEA 1FAKH 3N7EA 4JZDH 1C1WH 1K9OE 1C1SA 1TGSZ 1FI8A 1YLNA 1YLDA 1Q31A 3RXMA 1F7ZA 5HKKD 1QBOA 1YPKH 1W3CA 1V2QT 3KYGA 3I29A 3T28A 3ATLA 1AFQC 1VITF 4ZUHA 3TIUA 1NY22 1ANCA 1GL0E 1OOKB 4TT3D 1HPGA 3STJA 8GCHF 2F3CE 1FIZA 1J15A 5EW2H 2ZIQH 3MO9A 1SMFE 1Y5UT 1J14A 2CF9H 1NRPH 1C1UH 3LC5A 3T27A 4J2YB 1COWD 4WMDA 5EW1H 1P09A 1TBRH 1KXFA 1KYNA 3AAUA 3GCHC 2J94A 2FO9A 4DOQA 1U6QA 3KQCA 3NZIA 4AC9A 2IPHA 1YPMH 1G37A 2QF0A 3TNSA 3M7UA 1XM1A 1GJDB 1H9HE 2BDGA 1O3OA 2WYJA 2Z3DA 3SHCH 2CGAA 2AGEX 3A8CA 1YCPH 2KCAA 1INCA 3QZRA 2DE9A 3M61U 1XXDA 1WYKA 1D3QB 1SFIA 2QE7D 2VH0A 1PFXC 1YCPK 3U1IB 1S6HA 3K65B 1CVWH 1BDAA 1EB2A 1NU9A 3BG4C 4ZMAH 5JBBS 1ELTA 3BN9A 1YPGH 3W94A 1UVPA 5GXPA 3HK3B 4Y8XA 3OX7U 5B6OA 5EXMA 1O3EA 1ZGIA 2H1UA 1BHXB 2B0FA 2FYRA 4MPVA 1J17T 1OWDA 2ZDMA 4FUJA 3SUGA 5DO4H 1C1OA 1MKXH 1GI9B 3UNSA 1O3NA 4CBOA 3RXSA 2TGTA 3OU0A 4LOYH 1L1NA 3RXCA 2M2AA 2QXHA 2Y6TA 2BXUH 3MU5A 4ABGA 1MKXK 4AN7A 4H6TA 4DY7B 2Z6BD 5TCCA 1LMWB 2GZ7A 3ZZCA 3RXEA 4OS6A 1ETTH 3LT3A 2HWLB 3AASA 3A8AA 5EU8A 2VWMA 3SV9A 1MCTA 1NZQH 3STIA 5C1XA 2FYQA 2CXVA 2FS9A 4LZ1H 1O34A 2H5DA 1EAIA 1GCTB 2XNDD 4INHA 5EJLA 1ELAA 1AZ8A 1SLWB 4AGKA 1V2ST 1DDJA 4XRNA 1K22H 2BX3A 3JZ2B 1TWXB 1ZJDA 3A7TA 3M35A 5CDFE 4ACBA 9ESTA 2FX4A 1QB1A 2VBCA 1O3MA 3RMMH 4BTTB 1K2I1 1DY9A 2R2WU 2ZGHA 3ODDA 1S85A 3MU8A 2PKAA 3P92A 4OS4A 4Q7YA 1GL1A 2W26A 5FBEA 1E35B 3RMLH 1O2PA 2O9QA 4FUGA 4BNRA 3ATKA 2Z9LA 5C17A 1FONA 2ALVA 1HAXB 4UFFH 1TGBA 1GGDC 1UK3A 1HB0B 2ZPRA 5E8EH 1A4WH 1DITH 3SU4A 3VB4A 1P2IA 1N1LA 4FUBA 2EI8A 1EP6A 2ANKH 1Z6JH 2F43B 2QAAA 2ZU1A 1ELCA 4BAKB 2XWBI 3TITA 2KAIB 3KQEA 1BA8B 1BITA 5FCRA 4ZKSU 3BEUA 1DUEA 4NSVA 2R3YA 4ISOA 1TNKA 1LHCH 1UCYH 3IG6B 2G5VA 1TPOA 3SU0A 3VXFH 4M9FA 1CA8B 2H9EH 3UR9A 4P02A 1GBLA 1HNEE 1C4U2 1UCYK 1HCGA 1NRSH 3SU2A 1E37B 1O2IA 1FY4A 1SOTA 3SORA 3Q3YA 1ZSJA 4BAQB 5EGMA 1GCTC 5A0BA 3RXDA 5C67A 3SI4H 5E2OA 1RTLA 1TALA 2QXIA 5EPYA 4E7NA 4B6FA 1VZQH 1RTKA 1BRUP 1O32A 2WPJS 1EOJA 5T6FA 3E91A 2HVYB 2ZU5A 3SGQE 4WF8A 4IC6A 2IN2A 4GAWA 3EQ0H 4ABIA 3QTOH 3FAOA 2ZDAH 3OE7D 4FVBA 5IYTA 4ZKNU 4NA7A 1IQEA 4ZCNA 3F3BA 3GCNA 4ABHA 3MO6A 2FTMA 3QLPH 1JRTA 1UK4A 1IHSH 1GI7B 4HZHA 2GD4B 2PGQB 2KZ4A 4ISNA 4UDWH 3H5CB 1QCPA 1W7GH 5GDSH 3P70B 1V2WT 2Y82A 2BOKA 2ZC9H 4HG6A 4DIIH 5FXLA 4CRGA 4ISHH 2Z3EA 2W3IA 1B0EA 1Z6EA 2AGIX 2PLXA 3RXRA 3QTVH 4AYVB 3LGTA 2XBWA 1D6RA 3LGWA 4AB9A 2FESH 1NFUA 3A81A 1UTQA 1SGNE 2A7CA 3E90B 4DT4A 1FUJA 4TY7A 2OQ5A 3V3MA 4X6MA 3VB7A 2STBE 1DY8A 2WUCA 1OS8A 2D26C 2R2MB 3WWFA 3TU7H 1IQGA 3MU1A 3PMHB 4HFPB 4IMQA 3TJUA 1TNIA 3SJ8A 1SFQB 2Z9IA 4X2VA 2F91A 2V3OH 3EGKH 2PW8H 1MH0A 2TBSA 4IMZA 3FZZA 3KNXA 2VVUA 2QY0B 1KTTB 1MABB 3E6PH 2CHAB 1GBEA 1P03A 4Y8ZA 2TPIZ 3DFLA 4F4OC 1TOCB 4E7RG 3E0NB 5DN6D 4IBLH 2BMGB 1K21H 1QNJA 1ZPBA 1C1VH 5C2ZA 2J97A 3KQBA 2SGPE 4WH6A 4Z1MD 3D65E 4OS2A 3R0FA 1ZMJA 1PPZA 4OM9A 3VEQB 1HJ8A 5C5NA 3FKSD 3T25A 3BTHE 1D3TB 1HDTH 4XFQA 5K7RA 5JYIA 1VJAU 4HI3A 1UTNA 1GBAA 1MCVA 5GNDA 2V0BA 3G01A 1KSNA 5E0HA 3A7YA 1AQ7A 3VFEA 2B8OH 4ZXYH 1KLIH 1ELBA 3P6ZB 2AFQB 3F0OA 1TABE 1O5EH 4AZ2B 1C5QA 1O0DH 1PQ8A 2GMTC 1W2KH 2HPQH 1TMBH 1YLCA 2BD3A 2ZKSA 3LH3A 1A61H 4BAMB 4PROA 2GV6A 1QRZA 2FPZA 1G3EA 1YF4A
chains in the Genus database with same CATH topology
2SGEE 2AGGX 2G00A 2CV3A 4BXSA 3GCTG 1LO6A 4TWWA 1TNLA 2VIWA 3V12A 1QA7A 2F9NA 1ETRH 1V2LT 4ZKRU 2HRVA 3KEEA 1ZMLA 1G36A 4IN2A 2ODQA 1ZTLA 4I8HA 1ZRBA 4B75A 2CHAC 1XVOA 1UHBB 3EA7A 1IAUA 1DXPA 1LQEA 4JYTA 1CE5A 1D4PB 4YO9A 3NKKA 5FPSA 1CBWB 2G55A 2AERH 3BTQE 3SU6A 2UWPA 1AVGH 1HAZB 3QZQA 3VB6A 4MDSA 4DG4A 3NPSA 2P93A 3U8RH 2GX4A 5LPFA 1TB6H 5DP7A 5HM9A 3NK8A 4OGYA 2XRCA 4AFQA 1AE8H 3E3TA 4UEHH 1GMCG 2BDYA 1Z71A 1D9IA 1ZOMA 2Z9GA 1VCQA 1AWHB 3H7TA 3LKWA 2SFAA 3ZVGA 3A89A 4FUFA 1HUTH 1QFKH 2XBYA 1GMDG 1Y3WA 1HXEH 1MQ5A 2V6NA 3A87A 4A7IB 2JETB 4YLUA 3SNBA 3Q77A 4KTSA 2ZFPH 3SJIA 1PQ5A 3S9AA 1P2NA 4AG2A 2QA9E 3TH2H 1SGIB 1XX9A 4X1QU 2VWLA 3PWCA 2G5NA 4GVUA 2ZDNA 4D76A 1W14U 2OP9A 2G4TA 3PWBA 3QO6A 1TPAE 1ANEA 1CGJE 5C20A 1NU7B 2ODPA 2BXTH 1ZGVA 3MNBA 3RXOA 1UK2A 3A7WA 1Z8IB 2CJIA 3BSQA 1A0HB 2GV7A 2WINI 2SGFE 5HXFA 3P8GA 2YOLA 1UVOA 3JZ1B 1F92A 4DVAU 1BRBE 1S0RA 4ASHA 1L4ZA 3HKJB 1T8OA 4AB8A 2ZHQH 4MPUA 3GDUA 3DT0H 1CBWC 1SGTA 1W10U 1BTHH 3L33A 4DT7B 1Z7KA 4FU9A 2HOBA 1ZR0A 1BUIA 1DUAA 3PTNA 1QTFA 1A2CH 4CRCA 3V7TA 3ENSB 4ISLA 1ZPZA 4Y7AA 2WUBA 2A2XH 1FIWA 1JXPA 1H1BA 1O5DH 1TLDA 3EYDA 4ZROA 1O2KA 1ESTA 1D6WA 1GBCA 5PTPA 1O2WA 2ZFQH 1TBZH 2Y5FA 3GY2A 3TK5A 2BY8X 1GHVH 1L4DA 2J9NA 3LIWA 2BQ7B 1O2TA 4X6PA 3LJJA 1UTLM 4NCYA 1BHXF 2FIRH 2FLBH 1PQAA 2JETC 5C1YA 1SPJA 1C2JA 2GDDA 4O97A 3F9GA 2Y80A 3ITIA 3C1KA 3DUXH 3P95A 1O5CB 1TX8A 2LNCA 1GVLA 2HALA 3LGIA 1GG6B 1EJMA 2ZWLH 4GHTA 2ZPQA 3ZVCA 1YPLH 2AMPA 2B7DH 3KF2A 1LVOA 3C27B 1TGNA 2HNTE 1ACBE 5J4QA 1GVKB 2B9LA 1C2IA 1W11U 2BLVA 1IQNA 3UQVA 2ZPSA 2Y5HA 2ZTZA 3O8DA 5GCHG 1CQQA 4BTUB 4YESB 1C2FA 3SU3A 4ZHMU 3TGKE 1GCDA 4X1RU 3S9BA 2D1JA 2XCFA 1SGEE 1GHWH 1HIAB 2FWWA 2KAIA 8ESTE 1GHYH 1EZUC 3D49H 2F9OA 1EATA 5DP5A 1GBDA 1WUNH 2ZECA 2V35A 2NU3E 1L2EA 3SV6A 3RXPA 1OYQA 2XW9A 2SNVA 4JMYA 3TVJB 2ZHEH 2THFB 3BTWE 2ZFFH 4ZHAA 5T3HA 3GY5A 1V2JT 2BY9X 1Y3XA 2ALPA 2UWOA 7LPRA 4Y0ZE 3M3VA 3E16B 3K6ZA 1O37A 2H9TH 2C8YB 3QN7A 1C5UA 4OS7A 1GMCF 3GY7A 7GCHG 4DIHH 3K9XB 4ISIH 3RXQA 5A8ZA 1GG6C 3BV9B 2VH6A 5JPMH 1BTXA 2VIVA 1O35A 5A0CA 1GMDF 1AKSB 1P2MA 2ANWA 1G2MA 3GDVA 3UUZA 3VXEH 3M36A 3RXVA 1GDUA 4B2CA 1OP8A 3IWMA 4MVNA 1DVAH 5DGJA 4DCDA 2UWLA 3SV2H 1GJBB 1QL7A 4KKDA 1BJUA 3LJOA 1NPMA 3TH3H 4X1SU 5AFZH 1Y3UA 4I31A 4ABFA 1QQUA 3GISB 1Y59T 1SGQE 2A0QB 2P3UB 1SGYE 4K3JA 3TLOA 1HYLA 3LOXA 4GCHG 3P8NA 1E34B 2A4OA 2GTBA 4CRFA 3BTTE 1OX1A 1TRNA 4NIWA 1V2RT 1LHEH 1C4Y2 2XNIA 1OSSA 1SLVB 1C1PA 1YP9A 2P95A 1YGCH 4X8SH 1C5PA 1GWAA 3BTEE 3ZZ3A 4MPXA 2F9UA 3ZZ7A 2FI3E 2LPRA 3RXHA 2ZNKH 2PGBB 1BMLA 3KL6A 1O5AB 1RFNA 2H2ZA 1PPFE 2GCTC 1BTYA 1V3XA 4XSKU 2A4GA 3SUFA 5LGOA 1SL3A 3SJKA 3M7QA 3RP2A 1ARCA 1P2OA 2I6SA 5H4IB 2WYGA 3E8LA 4Y0YE 4YT7H 2NU4E 4UFGH 2PSYA 1SLUB 1VCWA 5LH8A 1OWEA 1C9PA 4OS1A 5FPTA 1IQMA 5LPRA 2W5EA 1EP5A 2FOMB 3PB1E 1JIMA 1P2JA 2GGVB 1UTPA 1Y3YA 1A0JA 1SQAA 2ANMH 1V2UT 1AUTC 4B71A 3FZDA 3HPTB 3URCA 6CHAB 1NT1A 1XKAC 3MH6A 2C3SA 2NWNA 1A5IA 1EASA 1JRSA 1XKBC 2PTNA 1G32B 1KLTA 2OC0A 1O3DA 2WPKS 2HLCA 4INLA 1O5FH 4X8TH 2G52A 2Z9JA 5E0JA 2Q6GA 1CSOE 3TGJE 1BMNH 1K1PA 1PPHE 1NO9H 2AIPA 2GZ9A 3TNTA 5GCHF 4O3UA 2ZU4A 5ESBA 1A1RA 1C5YB 1BRAA 3QWCH 1GI2A 1GDNA 3BTME 2ILNA 1TMUH 2O8UA 3TK9A 1O2HA 4H4FA 1C1QA 2G81E 1BQYA 1DS2E 4B2BA 4KTCA 3MU0A 1QY6A 4CH8B 2BLWA 1THPB 3RMOH 1EXFA 3KCGH 2F9VA 1BJVA 1THRH 2GT7A 1GI5A 2BD7A 1UHBA 1SVPA 4ESTE 1B0FA 1O3HA 2WPLS 1O3FA 5E2PA 3A85A 4ZHLU 4BTIB 1YYY1 3GY3A 4IS5A 4NIYA 5BRRE 2ZFSA 4XDEA 1S81A 1MKWK 1T7CA 1HAPH 5I46H 4D7FA 1LHFH 5TCAA 2P94A 1ANDA 1C5RA 2BZ6H 1DWCH 4ABEA 1FDPA 3T26A 4DW2U 3D23A 4X0WU 1NM6A 1QRXA 1ID5H 7GCHF 5GPIB 2FZZA 3RM0H 4A1VA 5DKMA 2AMDA 1ORFA 3MOCA 1LHDH 2AH4X 1SGDE 2OC8A 6CHAC 3TJNA 2VNTA 1EQ9A 1WCZA 1F5LA 4BAOB 3L3TA 8LPRA 4CR5A 1C5ZB 1GI6A 1HJ9A 3U1JB 1EZQA 1CGIE 3EDXB 3O8RA 2NU2E 1F0TA 1HXFH 4YTAA 1PYTD 1H9IE 1EKBB 3BIUH 4YLQH 2ZGBH 1Q3XA 1S6FA 5HMAA 1O2QA 2EI7A 1T4VH 3DA9B 3ZVFA 1AI8H 1EPTB 2BVRH 1TMTH 3T29A 1WQVH 2F83A 2OXSA 1Z1IA 4Y7BA 3F9HA 4E05H 2ZHFH 1G3DA 4NA8A 5DP4A 4K1EA 1NRNH 1DPOA 3LGUA 2OINA 5ABWA 5FPYA 3PLBA 1MU8B 4TY6A 3SU1A 2C90B 3PMAB 4XBDA 2VGCB 1P3EA 1QURH 2XWAA 2O8TA 4J1YA 2QF3A 3ZZ5A 1QB6A 3BTGE 2VVCA 3SZNA 3KIDU 1K1IA 4Y11E 1HAGE 4M7GA 1ZHPA 4YT6H 1ZSLA 2R0KA 2OTVA 4X6OA 2P59A 1GVZA 2C93B 4WMFA 1H8DH 4VGCB 3MH4A 1HV7A 1MTNB 2STAE 1FQ3A 1A0LA 1O30A 3GCOA 4WMEA 1EAXA 1UMAH 5GJ4B 3SBKA 5F6MA 1Y3VA 2A7JA 1GMHG 5L6NH 4WXVA 1XUGA 1OKXA 3SJOA 3RC4A 2PWXA 1QA0A 2RCEA 5L2ZH 1MQ6A 4AORA 4AFUA 2FLRH 4Y6DA 2ZDLA 2J95A 1LDTT 4NWLA 1CO7E 3A88A 3SUEA 3HATH 5I25A 1TGTA 2B5TB 2JH6D 1EPTC 2XC4A 4X2WA 4B1TA 1T8LA 1NN6A 1M9UA 1B5GH 3F6UH 1F0UA 1BTWA 5GWZA 1QBNA 1SGRE 2BD4A 3SOSA 2QN5T 1ELGA 4GLYA 1GBFA 1BTZA 3ESTA 1WTGH 1UJ1A 2PHBA 4JZEH 1FN6A 4KGAA 3SI3H 3NUMA 1C4V2 2ZO3H 2BDIA 4Y10E 1UVUH 2ZQ1A 4H42U 5A2MH 1OWIA 4CBNA 1A3BH 4XOJA 1HIAA 2Z94A 3HGPA 2SNWA 3QGJA 2P3FH 3CS7A 5FX5A 1C1RA 3LU9B 1TA6A 2OBOA 4D8NA 3MNXA 5L30H 2BOHB 1BMAA 4VGCC 1DFPA 1HJAB 1O2LA 4UD9H 1MTNC 1ABJH 2ZF0H 6GCHG 1F2SE 1KXEA 3SO3A 1QQ4A 2YNAA 1A3EH 1N8OB 1BRCE 1XXFA 2Y5GA 3SGAE 4XBCA 4DURA 5FBIA 4UE7H 3ZYEA 1J9CH 1DWBH 4I8LA 1TQ0B 3P8OA 4CRDA 2ODYB 1NTPA 1OWKA 1RRKA 3AAVA 4NA9H 3CENA 1NFXA 2BY6X 2VVVA 3ZYDA 1C5SA 3RLYH 1HGTH 1QJ7B 2QXGA 2BTCE 2WPMS 4RSPA 1AKSA 1Y5AT 1SG8B 1GJ4H 1C1TA 1VJ9U 3NXPA 4Z0KA 3UY9A 1C5OH 1L1JA 9LPRA 2J4IA 4ZKOU 1IQJA 4FUHA 4IGDA 2Q1JA 3MNCA 1NROH 1GHBG 1KXAA 1KXBA 1QJ1B 1HAHH 1PPGE 2RG3A 2ZFRH 1V2KT 5K0HA 3RU4T 3M3SA 1GI0A 1TNGA 4K5ZA 1C5TA 5GIBA 2RA3A 1TBQH 3CS0A 1MUEB 2PSXA 1HBTH 5F8XA 1O2OA 2FOFA 1HAVB 3F9EA 2QXJA 5F03A 1AN1E 4ZH8A 1VCPA 1ZRKA 1C5NH 1OP2A 1O3BA 1HJAC 3NWUA 1YPHE 3SNAA 3FP6E 1QJ6B 1N8OC 2J2UA 1DWEH 4X2XA 3S7HB 4X1NU 1QL9A 1UTOA 1WAYB 1ESBA 5IDKA 5T6GA 1O3CA 8GCHG 3GOVB 2ZG0H 1LVMA 1O2XA 3MFJA 3HGNA 2EA3A 3LGYA 3A80A 1GPZA 3H7OA 4B73A 1VITH 1GBJA 1O3KA 3OTJE 2PTCE 2GKVE 3K6YA 1RJXB 1BIOA 2OUAA 1Q2WA 4WVPE 1C2LA 1ETSH 3KGPA 4NZQA 1AE5A 1SOZA 1A46H 2FI5E 2FP7B 3MNSA 5CMXH 3MU4A 5LPEA 1P12E 3ZV9A 4D7GA 3BEIB 3A7ZA 1FNIA 1G3CA 1LTOA 3O8BA 3URDA 2ZI2H 5AVDA 8KME2 1EOLA 1EJNA 1P10A 1LPZB 3FVFB 1W13U 2A5AA 1K1NA 3E0PB 1E36B 1KXCA 1LHGH 4Z6AH 3TGIE 1MTWA 3SGBE 1DSUA 1ELDE 3RXGA 1K1OA 1O3JA 3A86A 4E06H 1NFYA 1AWFH 2A5IA 4YOIA 1AZZA 3P17H 3UQOA 3VPKA 5C1UA 1SHYA 2A4QA 4K8BA 1GBMA 1SBWA 4DJZB 1CGHA 1NC6A 1C9TA 4TPIZ 2FXRA 2GCHG 4BAHB 3M7TA 1BB0B 2W7SA 1C2KA 4Q7ZA 1YBWA 4Q80A 3RXKA 1TPPA 3ATMA 2ZCKP 1S84A 3RXUA 3GY8A 4NSYA 2BQWB 6GCHF 1EJAA 1SQOA 1WU1A 1QL8A 1TGCA 1GBTA 2I6QA 5DP8A 4AGJA 3GCTF 2QIQA 1H4WA 4CRBA 1TIOA 3Q3XA 1JOUB 3BG8A 4KTUA 1GJ8B 2Z9KA 3DFJA 2FOBA 3PO1B 4NG9H 5CE1A 1O33A 4KP0A 3VB5A 1XUHA 1RTFB 1ZLRA 2VB0A 3A8DA 5AF9H 3S7KB 3M37A 1O3IA 1GHXH 1GI1A 2BY7X 1ARBA 1TX6A 1P3CA 1AFEH 3RXIA 1YM0A 4ABJA 5HGGA 1FV9A 4I33A 1T4UH 3BF6H 1GJCB 2P16A 4H6SB 2ZEBA 3ZZ9A 3RMNH 5C3NA 2CN0H 2OBQA 4BANB 2M5TA 1OYTH 3T2NA 4AYYB 6ESTA 1TONA 2BD8A 2ZTXA 2Q6DA 1W7XH 1G30B 2A4RA 1GHBF 1P06A 2ZGJA 2ZU3A 1EPTA 4THNH 2OC7A 1E0FD 1TRMA 1TNHA 2BVXH 1KLJH 3MO3A 4X1PU 1C1MA 1T32A 2XC0A 3S9CA 3ATIA 2C4FH 1K1MA 3MH7A 4TWYA 1GJ5H 1QBVH 2J38A 3F68H 4AOQA 3A8BA 5EXLA 2OC1A 4LXBH 1C5VA 3BG4B 1PQ7A 4X8VH 2Y7ZA 2ZCLP 3FFGA 3LC3A 4INKA 5FHTA 3TH4H 1EX3A 4FXGH 2XC5A 1L1GA 1S82A 4ABBA 4RKOB 5DJ7A 5DP6A 2A5KA 3A84A 1CT4E 4YZUA 1ZHMA 2FMJA 1AVWA 3RDZA 4SGAE 4RN6A 4LK4A 2FOEA 1V2NT 3DD2H 2PUQH 2FI4E 1UVTH 1WTHD 4MLFB 4Q2KA 5JBAS 2VIOA 3GY4A 3HK6B 3RXLA 1DE7H 1SGCA 2BDHA 4I8KA 2ZHDA 5AFYH 4YM9A 3PO1C 2PR3A 3QDZB 1O3PB 4NFFA 2DE8A 1NRRH 2ZZUH 2Y7XA 3AW1A 2FX6A 3RM2H 3WY8A 1AY6H 1ESAA 3SV8A 1CU1A 1MU6B 2GVFA 1MTUA 1UTKA 3TJVA 2G4UA 1W8BH 3RXJA 3ZVDA 1LVYA 4FU7A 1GBKA 4K2YA 4NIXA 2ASUB 2A1DB 4Y76A 2PFEA 3B23B 3HKIB 3V13A 4WH8A 2ZP0H 1C2EA 2HNTC 1ZJKA 1SC8U 1NFWA 3L6PA 1V2VT 2XBXA 3PMJA 1C5LH 1MMJN 2WV5A 1Z8RA 3MHWU 1T8MA 3W95A 2G8TA 3SV7A 1GJ6A 2DUCA 1BOQA 1H9LB 4MQAA 1GGDB 1KY9A 2F9PA 5FCKA 1O5GH 3BTFE 3MTYA