5T3HA

Bovine trypsin soaked with selenourea for 5 min
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selenourea: a convenient phasing vehicle for macromolecular X-ray crystal structures.
pubmed doi rcsb
molecule keywords Cationic trypsin
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t3hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t3hA02
4SGBE 1SLXB 1DS2E 1UCYK 4D9RA 4IMZA 4X8VH 3V12A 1SLUB 2Z9GA 4DIIH 1GI0A 1O2TA 1FIWA 4ZAEA 3V0XA 4A92A 1Z8IB 3PO1B 1HJ8A 2ZDLA 3MNCA 4NZLA 1TX6A 4GVUA 2Y5FA 4FU8A 1J9CH 1E38B 4BTUB 1VZQH 1XXFA 2ZU2A 5ABWA 6ESTA 1YLCA 5JB8S 2HGTH 4I33A 3STIA 1CA0C 3PLBA 2DE8A 1RFNA 1KIGH 2F91A 1INCA 2J92A 3RXDA 2XTTB 1AN1E 1UHBA 3CENA 3QK1A 4ZMAH 3LJJA 1DPOA 1ESTA 1AVGH 1TRMA 1EJMA 2ANYA 2BDIA 2GTBA 3PLKA 1BMAA 4D9QA 1BMLA 3BTGE 3RXVA 3UOUA 1X7AC 1SC8U 1YPLH 2FM2A 2VWOA 3BG4C 3TPIZ 4CRFA 1CA8B 3AAUA 5GWZA 1UK3A 1TX7A 3S0NA 2OC0A 2XW9A 2YNAA 3VB7A 1EJAA 1IHTH 3ZZCA 2ZHDA 1ACBE 4IGDA 1TBZH 4MPWA 1Y5BT 2Y80A 1SR5C 1SQTA 5JYIA 1YPMH 4CREA 3RU4T 1GVLA 3U1JB 4LZ1H 3M36A 4IW4E 2WINI 3TU7H 1F0UA 4CH8B 5EODA 2BMGB 3A88A 1T8OA 2ESTE 3PWCA 1PPHE 3QTOH 4BAOB 1THPB 1DWCH 1MBMA 2XYAA 4X1RU 1Z8JB 1GDNA 1A5IA 2BD4A 1SI5H 3SJOA 1ZPBA 1UCYH 2SNVA 4UE7H 2ZPRA 1AZZA 2B5TB 1N1LA 3LGVA 3QTVH 4KP0A 5EQQA 4JYTA 1O2MA 1EB2A 2XBWA 4Q80A 3M7QA 4CBNA 4OGYA 4XFQA 5C67A 1TGNA 1B5GH 1HAGE 4E05H 1S84A 2TPIZ 1AB9B 1T8NA 4FUHA 3GCNA 4TWWA 1TBQH 1WTGH 2P95A 1OWKA 1A2CH 3RXHA 1TE0A 4KTCA 1P12E 2OBOA 3KHVA 2H6MA 5F8XA 3KNXA 1OKXA 1GHZA 4KTUA 1C2GA 2VIVA 4IBLH 1O2JA 1BTXA 3K6YA 3NWUA 3FP8E 2AIQA 1HAOH 1JIMA 3VB6A 1GL0E 1BT7A 2BZ6H 1MZDA 3S69A 1ELAA 2QGRA 1C1SA 4AZ2B 1WV7H 2BLQA 4FVDA 2FTLE 1DANH 2J38A 1ELVA 3SQHE 4YLUA 2W3KA 1UCYE 1C2JA 2GMTB 2IJOB 4NFFA 3A82A 5EXMA 1SGEE 4BAKB 2GT8A 1DLEA 3RXEA 3RXLA 1TGSZ 4MPVA 4OS5A 1BUIA 1JOUB 1ZOMA 1P3CA 4B73A 1P2NA 5L2YH 2A5KA 3A81A 2FYRA 3D62A 1NO9H 2WUCA 1QA0A 1C2MA 3U69H 2PW8H 2QXIA 1ESBA 4ZHLU 5F03A 1C5NH 2ZGCA 1TNGA 1UTOA 1XUGA 1O5DH 3LC5A 2Z9LA 1EJNA 3FFGA 3HK6B 1KXEA 2TBSA 1Y3YA 1RGQA 1KTTB 1TX8A 2FOEA 5E0HA 1GJ9B 1F0TA 1C9PA 5E8EH 2F9OA 1V2JT 1MTVA 4NWKA 1RS0A 5GCHF 3SI4H 5CMXH 2QN5T 1YCPK 2XBXA 2P59A 3MU5A 4ABAA 1W13U 1C2EA 4KELA 1QB6A 1C2HA 3T27A 2GZ7A 2TGTA 1GMCG 3E6PH 2Y81A 1GI9B 3M7UA 2PKAA 4YT6H 1A3EH 1XXDA 1D6RA 1VJAU 3C1KA 1F7ZA 1XM1A 1PQAA 3MI4A 4CRBA 2TGPZ 1Y3VA 3TK5A 3BV9B 1YPHC 1FY1A 2GX4A 6CHAB 1C5YB 5HGGA 1BDAA 3TJVA 1O3NA 4X1NU 1D3DB 1FDPA 5CHAB 1QBVH 1QQ4A 3ATMA 1C1VH 1GJ7B 5BRRE 5HXFA 1BRUP 1MKWK 3BG8A 1NT1A 1O2GH 5J4SA 4AYYB 4RKOB 1LVYA 3IITA 2ZGJA 1P2KA 5AF9H 1IHSH 4FU7A 1K1OA 3OTJE 1C2DA 3GY5A 1FONA 1FAXA 3MO6A 1CO7E 2ODYB 1O33A 2CV3A 1C5TA 1GMHG 3TNTA 1YM0A 3NZIA 3R3GB 1J17T 1XUJA 3IWMA 3S9BA 1C2KA 2BDCA 4KKDA 4O3TA 2BLVA 1ZHMA 1HLTH 2C8ZB 3PMHB 3VB4A 2SFAA 2VGCB 1GGDC 1TYNA 2C93B 1DX5M 3FAOA 3RXSA 4HFPB 1XUIA 1FN8A 4MPXA 1TNHA 1NRPH 3U8RH 1SOTA 5LPRA 2GV7A 1Z71A 1CBWC 2FODA 3T25A 4AORA 3PMJA 1IQMA 1K1NA 1NC6A 2HALA 2HNTF 3RC6A 4B2CA 2VB0A 5HM9A 1JXPA 5L6NH 1A0JA 1D3QB 2FOHA 3RUOA 4BTTB 1ID5H 3TLOA 1O32A 2IOTA 2TIOA 3SNBA 1TPSA 1H8IH 1W7XH 4CRDA 2H9TH 1MBQA 1A46H 1B0EA 3ITIA 3ZV8A 1GI4A 1O3FA 2FS9A 2UUJB 3UIRA 3MWIU 2OD3B 6GCHG 4WMFA 1G3CA 1RIWB 7KMEH 1G2MA 4ZHAA 1C5SA 1SL3A 5LPEA 3SO3A 2SNWA 2GV6A 3BTME 4X8TH 1AVXA 2ZQ2A 4D7GA 3GCHB 3SN8A 3LJOA 1O39A 1QURH 2OINA 4NFEA 3QWCH 1A3BH 1FY3A 2BY8X 2PTCE 1T7CA 1V2VT 4CHAB 2ZGXH 4JZFH 2FI4E 2WPJS 3LGTA 2VINA 3BTEE 3UTUH 1O2WA 2FOGA 2ZCLP 4KTSA 4RKJB 1NU7B 4B2AA 2CJIA 1GVKB 3ZYEA 1HAIH 3F9GA 1PYTD 4D8NA 4MQAA 1V2TT 3BTWE 3UNRA 4B71A 4Y7BA 1E35B 2BD5A 5HMAA 2Z9KA 3R0FA 1GBLA 1MTNC 4NA7A 1QA7A 3Q3XA 1LKAA 1P9UA 2ZFTA 1C5WB 1AFQB 3TGJE 5A2MH 4NGAH 3SU1A 1OPHB 1A61H 2ZDKA 1GCDA 1TMBH 1ANEA 2AH4X 4I8KA 5EW2H 5JBTA 1H8DH 1TLDA 1O3IA 4FUJA 1C2IA 4UD9H 4A5TS 2PV9B 4WXVA 2B7DH 3RC5A 2ZFRH 3MO3A 1MTWA 2BDBA 2JETC 3LGUA 2HPQH 2R2MB 3RP2A 3E0PB 3KQDA 2DE9A 4AB9A 2C3SA 1NESE 1LPKB 2SGPE 1DT2A 1GHAG 1ANDA 2NU2E 4Q7YA 3SU4A 1OWJA 1TMUH 1W12U 1GI3A 1KYNA 1LHFH 1SLVB 3P92A 1ELCA 3FP7E 4K1SA 3SNAA 1DLKB 4DVAU 4MPUA 1P03A 2PGBB 3F9EA 2BD9A 3GDUA 1FPHH 4H6TA 2C90B 1OYTH 1YGCH 3JZ1B 2Q6FA 4AN7A 3DD2H 2NWNA 3Q77A 4ISHH 1BRCE 2ANKH 2FTMA 1BRAA 4ZKOU 2V3OH 1BHXF 1SVPA 5FPSA 1T32A 1SGRE 3ZZ8A 3HATH 1GI1A 1EPTA 1C1PA 4IC5A 1G30B 2Y82A 2VVUA 4OS7A 2FI3E 3NUMA 2A7JA 2ULLA 3BIVH 2QV1A 2R0LA 2ZU4A 1FI8A 3A89A 3ZV9A 2ZO3H 1D3TB 4DIHH 1WSSH 2XCFA 2ZPQA 2ZCHP 2WPMS 4R8TB 1TNLA 4A7IB 2O9QA 1ZZZA 1W10U 2PKSC 1XKBC 2GGVB 1ABJH 1BITA 2QYIA 1KSNA 1DE7H 3TNSA 1MZAA 3I29A 1S6FA 2B8OH 1H9LB 2Q6DA 2RDLA 1G36A 2PUXB 4X8UH 8KME2 1LCYA 4BNRA 3VXFH 1MMJN 4Y7AA 5EQSA 2GZ8A 1OWHA 1DICA 3RC4A 3AVZA 1BTUA 3MOCA 4VGCB 1BOQA 2FS8A 1LTOA 3E8LA 5A0CA 5EW1H 1C5ZB 2GDEH 1O5GH 1L4ZA 1BJUA 2RA3A 3LKWA 2V0BA 2ZEBA 1OXGA 3PO1C 3KIDU 4I8HA 1EP5A 1ARCA 2VH0A 3A80A 3BTDE 5E2PA 2ZP0H 4FUFA 1AE5A 1HAVA 1C5PA 4YESB 1SMFE 1HIAA 4WY3A 5DKMA 1GBCA 1LVBA 2G52A 1MTSA 3M3TA 3SUFA 1UTMA 3AW1A 1ELGA 1ANBA 1HXFH 1O3AA 3KN2A 1V2LT 1YLDA 3GDVA 1LHGH 3KF2A 3U8OH 3GY4A 5FX6A 2O8LA 1GJBB 2FI5E 3SU2A 2VU8E 3D49H 4UFDH 3ELAH 3RXRA 4D76A 2VVCA 5A09A 2PSXA 1SFQB 4K3JA 4X6OA 2Z9IA 1HFDA 3A7XA 1TQ0B 4BOHA 4X2XA 1SSXA 2FIRH 3QUMP 1BBRK 1AKSB 3ZZ7A 1GBHA 1UVPA 4BAQB 4MLFB 1A5HA 2BQWB 3E91A 3VPKA 1TNKA 4FUIA 2ZHEH 2BLWA 4INHA 3GYLB 5CE1A 4OGXA 2O8MA 1SGDE 5C20A 1HJAB 2EI8A 3BTFE 4Z0KA 1Y3UA 3U1IB 2QAAA 3P8FA 5I46H 1T8MA 5GDSH 2FWWA 3GYMA 1LPZB 4Y71A 4KGAA 1H9IE 1HIAB 4A1XA 4UONA 3MU1A 1GI7B 4HI3A 1TMTH 1AWHB 2FOAA 3AASA 3B8JA 4NIYA 3M3SA 1SGYE 2ASUB 5GJ4B 3ZZDA 2ILNA 3MH6A 1O3GA 1HAPH 1BA8B 3T5FH 2BQ6B 1Y8TA 2QXHA 2UUKB 3DFJA 2EA3A 3SOSA 3M5NA 4GCHF 1TB6H 1LO6A 1T4UH 1EATA 1ZGVA 5T6GA 2Y7XA 3RXQA 4BANB 4INLA 1AB9C 4TPYA 2FLBH 3M61U 1D6WA 5EGMA 1SGFG 1MU8B 2F9BH 2AFQB 4A1TA 3E0NB 1QTFA 3K6ZA 3SV9A 3ZVBA 4O3UA 1QIXB 3MH7A 2Z3DA 4U01A 2PFEA 1VITH 1GHWH 1TFXA 4X0WU 1NFUA 3RM0H 3EA8A 1RD3B 1ORFA 3RXPA 2PTNA 3BTKE 1O2LA 1O2YA 1TOCB 4AB8A 1CHOF 2BX4A 1C1MA 1LQEA 5PTPA 3RLWH 7LPRA 3NPSA 2ZU1A 1O3BA 5DGJA 1RRKA 2GMTC 3SGAE 4AOQA 1NRSH 1SGIB 2BD7A 4A6LA 3NXPA 2F3CE 3E1XB 1O5BB 2WV4A 1H4WA 4AG2A 1BBRH 2R9PA 2BDAA 2BZAA 4BAMB 2GP9B 1ELEE 4HZHA 2DUCA 3ATWA 3K9XB 4Q2KA 1CT0E 4YOJA 2VIDA 1HBTH 5EPNA 1GVZA 1GL1A 1BCUH 2GCTC 4WF8A 1B0FA 3A86A 4CR9A 1UHBB 2F83A 1GMDF 4AFUA 4CH2B 2GVFA 3LOXA 5T6FA 5FAHA 4FU9A 4RN6A 1ETTH 2A45B 4CBOA 4WVPE 1HNEE 2VIWA 5IDKA 1O2XA 1MD8A 2BQ7B 1PPGE 1DXWA 4ABEA 3GY2A 3SUDA 1C5QA 5JPMH 2AGIX 3UREA 2ZDVH 2A7HA 1C5MD 2XXLA 3GISB 3SZNA 1G3DA 1P06A 3P6ZB 3ODFA 3SHAH 3E16B 1GI2A 1YC0A 4J1YA 1O38A 3Q3KA 1QB1A 4RSPA 1BBRE 5DG6A 1DWDH 1O35A 1TALA 2BVSH 1P2MA 2NU0E 1O2SA 1HV7A 1AGJA 6CHAC 2ZTXA 3DA9B 4AGKA 1HAHH 1TGCA 2PHBA 3GICB 3P70B 1AVWA 3UY9A 2BY5X 2VJ1A 1ARBA 1ELDE 3NK8A 1TGBA 8LPRA 5CHAC 1GBEA 3PM3A 2SGAA 4TYDA 1ELFA 2EC9H 1YPHE 2VIOA 2CF9H 1AI8H 1L4DA 5GXPA 5DP8A 1W0ZU 1T4VH 4I8GA 3M3VA 2FX4A 3DT0H 2JH5D 1K28D 4NSYA 1CGHA 4M7GA 2EI7A 1AO5A 1LKBA 2FO9A 1KXDA 2G00A 3Q76A 4MNWA 4FUBA 4U32A 1P2JA 3O8CA 3UQVA 1QR3E 4A1VA 1LVMA 3RLYH 1O2NA 1HUTH 1P2QA 1FPCH 2C8XB 1F5LA 1JBUH 3MO9A 3RXUA 1HXEH 2XNIA 1TIOA 3T28A 1FLEE 5B6OA 1ELBA 5IYTA 1VGCC 3MH5A 2UWPA 1J14A 3HK3B 4I32A 1C2LA 1UMAH 3UWJH 1P02A 2P93A 4ZKSU 1AHTH 3D23A 1K1IA 3K2UA 1F5KU 4LZ4B 3GCTF 2B0FA 1MCTA 2G5NA 2NU1E 1VR1H 3RXBA 4I8JA 1P11E 2A2QH 1KTSB 1RIWC 1QJ7B 5G4BA 1P2OA 2FX6A 1GJ4H 4I31A 4NCYA 4JZEH 4DT7B 1AE8H 4U30A 1W8BH 2SGFE 1TONA 1QHRB 3LU9B 2QF3A 2ZG0H 2I6QA 4XBCA 2OQUA 2D26C 3TITA 1XUFA 3NCLA 1E34B 1UVUH 1HYLA 3EQ0H 1O5AB 1ZPZA 5DP4A 4CHAC 2SGEE 1VJ9U 4ZH8A 3RMLH 3VXEH 3RU4D 1KY9A 4LXBH 3ZZ3A 1SGPE 2OTVA 3A7VA 2P3FH 3M7TA 2A0QB 3SJIA 1S6HA 1WU1A 2PKAB 3A8AA 3UFAA 2J95A 4U2WA 2KAIA 2VWMA 4GHQA 2G55A 3L3TA 1TA2A 4INKA 3TJUA 5FPTA 3GY6A 1YBWA 2C8YB 1A7SA 3D65E 3RMNH 4YM9A 4DY7B 4ABDA 2BD8A 2H9EH 1JIRA 1V2UT 4YZUA 3SNCA 5DO4H 4X6NA 1O2KA 1A1RA 1C1UH 4UDWH 4JYUH 1W0YH 2XRCA 1OYQA 2D2DA 5A8ZA 1G32B 3MTYA 1AFQC 1TBRH 7GCHG 4NWLA 1UTQA 3SU0A 2BY9X 3U9AH 1S85A 3BEIB 1AY6H 1THRH 1YCPH 3LONA 5J4QA 1BHXB 1SGNE 1ZLRA 4ISOA 2A5IA 2W7SA 2ZQ1A 2QCYA 1XUKA 4CRCA 3ZZAA 1FMGA 1IQEA 3BEFB 6LPRA 4XE4A 4BXSA 4O9VA 1D9IA 3KGPA 3ZZ9A 3DUXH 4X2YA 1T31A 3RXTA 1G2LA 1HPGA 1LVOA 1OWDA 2B9LA 4FUDA 4ZKNU 2ZIQH 3SUEA 4Y11E 4E7RG 4Y8YA 5A8XA 1GCTB 1QL9A 3SGQE 1O30A 1GDUA 1ZTJA 4UFEH 2BD3A 3MNSA 1GJCB 1Z6JH 3MHWU 1LDTT 4LK4A 3AAVA 2IN2A 1MKWH 1GBKA 1OX1A 3CS7A 4YOGA 1ZMJA 1O34A 1PPBH 1GG6B 1DY9A 3PMBB 4GCHG 2GKVE 2EEKA 3A87A 4ABBA 3VGCB 1PPFE 4K1TA 2H5CA 2Z7FE 1EZSC 3SV7A 3Q00A 1Z8GA 3SV8A 3BIUH 2OCVB 1S0QA 3TK6A 5GIBA 3SU5A 1S82A 1N8OB 1ZJDA 3MU4A 1C4V2 1C5VA 2FOMB 3Q3YA 1V2ST 5E2OA 4E7NA 1TPPA 4JZIA 1QRWA 1WQSA 3SI3H 1Y59T 1N6YA 1ETSH 1UK4A 4ZROA 3RMOH 3U98H 1O3PB 3ZVEA 1WAYB 1BJVA 3KL6A 2XCNA 1G3BA 1CHOG 3ENSB 3T29A 2HVXA 2PUQH 2YNBA 1B7XB 1BTWA 3F9FA 1FJSA 3KCGH 1EQ9A 2FXRA 1UTNA 4AFZA 4X6MA 5JB9S 4NIVA 2BYAX 2BD2A 1IQFA 1NS3A 1P3EA 3A8DA 5DP6A 1P05A 2H9HA 2UWLA 2BX3A 1C4U2 4CR5A 3GCOA 1CU1A 2VNTA 5DP3A 3SJ8A 1GBBA 1L2EA 2PSYA 1IQGA 3ODDA 3VB3A 4OS1A 5DP7A 2STAE 2ZDAH 1G3EA 3A83A 3F1SB 4D7FA 2P8OB 2FP7B 1VITF 1K1PA 1V2QT 3PTNA 3T62A 1SG8B 5C1UA 2OUAA 3EA9A 4F4OC 1S83A 1Q3XA 1HJ9A 3PLPA 1GI5A 4XOJA 4H42U 3ZYDA 4WMDA 5TCCA 5ESBA 2IPHA 1BQYA 3OY6U 3UNSA 2VVVA 3RXIA 2BOHB 3UPEA 2VWLA 1IQNA 1KDQA 1OSSA 2WYJA 3QX5H 1ETRH 1FIZA 1QNJA 2FOBA 3PWBA 3ZZBA 2ZHQH 3QLPH 1Z8RA 1EAIA 1DSUA 3P8GA 1O2QA 1UVOA 1V2WT 3KQEA 3QGNB 4H6SB 3OY5U 4IMQA 5L30H 3JZ2B 4J2YB 3EE0B 5HM2A 1LMWB 1O2RA 1O2UA 3G01A 2ZFQH 5E0JA 4TPIZ 4Y8XA 3AW0A 2R0KA 4X1QU 1PYTC 2BXTH 1UTJA 1NZQH 3HGPA 1CGJE 1DSTA 1BB0B 3T26A 5EXLA 1HJAC 1BMNH 1JRTA 1SGCA 2G81E 1WYKA 3P8OA 1TPOA 1GJ5H 1L1JA 1O3KA 1IQJA 2OC1A 4ZHMU 4ABHA 3E3TA 5FHTA 1GHXH 1DY8A 3TH3H 1ZTLA 2WPHS 1V2OT 2A5AA 3PROA 3RXCA 2PLXA 4JK5A 1W2KH 1HDTH 3BN9A 3V7TA 4BAHB 2P94A 5FCRA 1Y3XA 4GUXA 2P3UB 1ZMLA 3RXGA 5F6MA 3VEQB 1CT2E 1HCGA 1HB0B 1FN6A 1GJ6A 1EPTB 5L2ZH 2LNCA 1DM4B 3RXFA 3ZVDA 4JCNA 3A85A 1IAUA 5SGAE 1YPJH 1O3DA 3M5LA 1P10A 2OC7A 3LH3A 3DHKH 4ESTE 5GCHG 2BHGA 2ZFPH 1TOMH 3SNEA 1VCWA 3CS0A 1MTUA 2F9UA 4GPGA 3MMGA 5F8TA 2J34A 1V2NT 2QC2A 2O8WA 5GPIB 2G51A 4NG9H 3H7TA 1Y3WA 1PPZA 3UR6A 1AIXH 1VCPA 2AMPA 2GCHF 2A1DB 3ATLA 1NU9A 1GMHF 1WBGB 2XBVA 3ZVGA 1QL8A 3LPRA 4E06H 2XWAA 2ZI2H 4XDEA 5A0BA 1NROH 1OP2A 1TQ7B 1GBAA 1PQ5A 1AMHA 2ANWA 4FUCA 3BTTE 2OP9A 4BTIB 1Y5UT 3FZZA 1MQ5A 3S7KB 2QF0A 2XC0A 3ESTA 3GY3A 1E36B 2WPKS 1W7GH 4PROA 1GBTA 3RDZA 1GBFA 5C5NA 5AFZH 1ZSKA 3KQCA 2HRVA 2ZCKP 1U6QA 1LHEH 2ZECA 2ALPA 2TRMA 4O03A 4FXGH 3UR9A 1HAVB 2RG3A 1CSOE 4UFGH 3I77A 1MKXK 2OBQA 1JWTA 1P09A 1QL7A 2ZC9H 3A84A 2BM2A 1O2OA 3ZVAA 1CE5A 1DDJA 4CRGA 1BMMH 2Z3CA 2YOLA 1MH0A 1PFXC 2BTCE 2G5VA 2OQ5A 3FVFB 1P9SA 3FZDA 4YTAA 3SU6A 5LPFA 3F6UH 1O31A 1C9TA 4ZXXH 6GCHF 2BOKA 1S0RA 1LHCH 3RMMH 5T3HA 3ATIA 4MG3A 1F0SA 1TA6A 3S9AA 2HWLB 1YF4A 3GY8A 1TAWA 5T6DA 5EU8A 2M5TA 1QCPA 2THFB 2FDAA 1ZYOA 4K2YA 2ZTZA 3U8TH 1O0DH 4ABIA 1FAKH 4CRAA 4R0IA 2ZU3A 2V6NA 2ALVA 1DXPA 1YYY1 3TJOA 2CGAA 1W11U 2WV5A 3RXOA 1EASA 2ANMH 4I7YH 2HNTC 4X1SU 4TY7A 3UWIA 1PJPA 2STBE 3S9CA 3SJ9A 3GDSA 1P01A 1D4PB 3M5MA 1BTPA 1V2PT 3QO6A 4FVBA 1TABE 1T8LA 2A31A 1O5EH 5C3NA 2J2UA 1V2RT 3SW2B 2WYGA 1IQKA 2F9NA 4K5ZA 1SQOA 1ZMNA 4NIXA 4GSOA 2OXSA 1YCPM 3IG6B 1Z1JA 1BIOA 1EZUC 1SHHB 4UEHH 1F0RA 1Z7KA 1UVTH 1ZRBA 3O8RA 3A8CA 1QY6A 2O8UA 4Y0YE 1CQQA 5DP5A 3LGYA 1DITH 2HLCA 4ISIH 1MKXH 3TGKE 3V13A 4DGJA 2TGAA 1FUJA 1UJ1A 2A4GA 5F8ZA 4ZUHA 2P3TB 3BF6H 3BTHE 3PMAB 3LGWA 4MDSA 4ZKRU 4HTCH 1NTPA 2AS9A 2BDYA 2CHAB 1GHAF 1SGFA 1GPZA 1GJ8B 1EUFA 3BEUA 1W3CA 2AYWA 4GAWA 2QA9E 1DVAH 2ZKSA 1NPMA 1DWEH 1L1NA 2Y5GA 1XUHA 2G4UA 2XWBI 2H2ZA 4AX9H 1QGFA 4OS4A 1KXBA 1UTPA 1PQ8A 1FQ3A 4ABJA 4MVNA 1VCQA 1GJAB 2R3UA 4X8SH 1YP9A 5K7RA 2V3HH 1P57B 1NRNH 1THSH 2Y7ZA 2BY7X 2EI6A 1C5XB 3P17H 4QT8C 4WH6A 1Y5AT 3SHCH 1PPEE 1TNIA 1EOJA 1FZZA 2R2WU 1GHBF 2A4QA 3TH2H 2G8TA 3TK9A 1CA0B 2A2XH 1GHYH 2GD4B 4JK6A 2ZA5A 3BTQE 1SPJA 3B9FH 1XX9A 4NZQA 4YO9A 1IQLA 2F9PA 2O8TA 1CVWH 1G9IE 2BVXH 1K1LA 2ZU5A 2W26A 4NSVA 1Z6EA 3M37A 1DFPA 1VITG 1MUEB 3PB1E 3SNDA 1KXCA 2ZGBH 4F49A 5AHGH 3ZVFA 4ZXYH 3RXJA 1GBJA 1QRZA 5FCKA 1GWAA 2C8WB 4DCDA 4K1EA 4K69A 3H5CB 1QJ6B 3BG4B 5TCAA 2FLRH 3EYDA 1O3MA 5FX5A 3N7OA 3MFJA 1LQDB 3HGNA 1GI6A 2VGCC 3VFEA 3ZZ4A 1JRSA 1XMNB 3PTBA 1O36A 4AGJA 2ZWLH 3QZRA 4IN2A 3K65B 5FXLA 1DUAA 1ZJKA 2ZFSA 1OS8A 1QBNA 2P16A 3P95A 1GBIA 4DG4A 1GHVH 1O3EA 2FOFA 2ZTYA 3NKKA 1C1QA 4FUGA 3V3MA 1NFYA 4OS6A 8ESTE 1LPGB 2VIQA 1EKBB 1GDQA 4B76A 2GCTB 3LIWA 1AUTC 3EDXB 9LPRA 2ZPSA 1O2IA 2V35A 4UFFH 2PR3A 2H1UA 1SFIA 1ELTA 1CGIE 1HAYB 3ZZ6A 1DUEA 1O5CB 1GJDB 3P8NA 3OYPA 1TGTA 1FXYA 3SQEE 3QGJA 4ABFA 4YOIA 1P2IA 2ZZUH 2Z6BD 2AGGX 1GCTC 4FUEA 4Z6AH 2ZDMA 4IC6A 4XBBA 2JH0D 1ESAA 3RM2H 1RXPA 3GCHC 2XC5A 3GY7A 2Y5HA 2D1JA 4B2BA 1XKAC 3L6PA 3PV4A 4GHTA 1MAYA 2FOCA 1C2FA 1FV9A 8GCHF 1GG6C 2C4FH 1BRBE 1NN6A 1SHYA 3VGCC 1NRQH 2SGDE 2AERH 1K21H 1OOKB 1SGTA 3URCA 1A4WH 1DWBH 4H4FA 3LT3A 4Y8ZA 1O2HA 1L1GA 1NY22 1N8OC 1K9OE 4BXWA 1J16A 1UTKA 3TVJB 4NIWA 2GCHG 1BTYA 1NFXA 3EA7A 1J8AA 1G37A 1SGQE 2ODQA 1S81A 4X2VA 1V3XA 1BZXE 3TH4H 4MNXA 1P8VC 3MH4A 2WUBA 2W7UA 2GDDA 3I78A 2ZGHA 3RU4E 1QBOA 2H5DA 4WMEA 1BTZA 4Y6DA 3M35A 3HKIB 4K60A 1F92A 1A0LA 1OWEA 1CHGA 3FANA 1IQIA 3ZVCA 4IN1A 1S5SA 4XSKU 1FY8E 1VGCB 1RJXB 4WXIA 4B75A 4WJG2 4JMYA 5BPEA 1WOFA 2F9VA 1TNJA 2P8OC 5EXNA 1C1WH 3UOPA 3HKJB 4MNYA 1AUJA 1C1NA 1O37A 1EAUA 1YPEH 2UUFB 5FPYA 3VB5A 3O8BA 2A32A 2KAIB 1XVOA 2XC4A 1C5LH 3H7OA 1C1OA 3LDXH 1KLTA 5DPAA 3A7ZA 3TIUA 4IS5A 1KXFA 3RXMA 2QY0B 2LPRA 4Y10E 2UWOA 1O2PA 1NM6A 5JBCS 1AD8H 1MQ6A 1GBMA 1O5FH 1MU6B 4X1PU 4Q7ZA 1Z1IA 5TJXA 1YPKH 1AZ8A 4ISNA 1GBDA 1F2SE 3UQOA 3ZZ5A 2BVRH 3UNQA 2ZHFH 2A7CA 2QIQA 1C1TA 3WY8A 2NU3E 1EOLA 1ZSLA 1C5RA 3F9HA 4JYVH 4SGAE 3E90B 3SV6A 3EGKH 2XBYA 1FY5A 3SGBE 4WWYA 2J94A 3LGIA 2SGQE 2Z9JA 5A0AE 1W14U 1UO6A 3A8BA 3OU0A 1QB9A 1C5OH 2WPLS 4Y79A 1SOZA 5A8YA 1GGDB 2VIPA 2BLOA 2CF8H 3ATKA 5AVDA 5EPYA 2OC8A 1CBWB 2BXUH 1L0ZA 1QFKH 2GT7A 3T2NA 4VGCC 1EZXC 1AU8A 5C5OA 1SB1H 1ZRKA 1A0HB 1O2VA 1WTHD 1AWFH 1SBWA 2I6SA 1EPTC 2OLGA 3MYWA 1C4Y2 2K1QA 1GMDG 5EQRA 3MNXA 3FP6E 2BB4A 1ZGIA 3W94A 3W95A 4NA9H 5E0GA 1KLJH 1TRNA 4JZDH 1KXAA 2QXJA 1O3LA 1E37B 1ZR0A 3URDA 7ESTE 2JH6D 4ASHA 1QJ1B 4TWYA 3M5OA 3TGIE 2QXGA 3QDZB 1WQVH 1O3JA 1P04A 1ZHPA 1D3PB 1M9UA 4K8BA 2FESH 2D8WA 5ETXA 4OS2A 3B23B 4Q7XA 4O97A 3RXAA 1OP8A 4ISLA 2ODPA 2PWXA 3HPTB 4ABGA 3BSQA 1P0SH 5HYOA 2J4IA 5DJ7A 2BDGA 2R3YA 2NU4E 4NA8A 1GHBG 1K2I1 3QZQA 4K8YA 3MNBA 1IOEA 2W3IA 1TWXB 1HAZB 1HGTH 1QRXA 1LHDH 5FBIA 3SV2H 1Q2WA 1HRTH 2FPZA 4YLQH 1C5UA 1MCVA 2Q1JA 1EP6A 3S7HB 1EB1H 3GOVB 3LH1A 5C1YA 2FEQH 1MD7A 2A4OA 2FMJA 5K0HA 3DFLA 1WCZA 1QQUA 2AIPA 4THNH 5ESTE 1ANCA 2TGDA 5FBEA 3SBKA 9ESTA 4HGCA 3QN7A 5LGOA 4AG1A 1GMCF 1K1MA 1NFWA 1MTNB 1GI8B 3CP7A 1HAXB 4X2WA 4MTBA 3SJKA 3SORA 1UVSH 5EG4A 2RCEA 1KDQB 4XBDA 2CN0H 3MU8A 5JBAS 1O3CA 4TY6A 5DP9A 3C27B 5EOKA 2A4RA 2Y6TA 1ZSJA 1ZHRA 1RTKA 1K22H 2HPPH 2JETB 2BDHA 1FY4A 4Y0ZE 4X6PA 3OX7U 1DOJA 1ZTKA 1E0FD 2GZ9A 1AKSA 2AMDA 1KLIH 1V6DA 4YT7H 2VH6A 5JBBS 2RA0A 1EAWA 1V2MT 5I25A 3LC3A 2Z3EA 3EAJA 1RTFB 3PYHA 4AFSA 2JKHA 1NRRH 2Q6GA 2ZF0H 1ZPCA 1SLWB 4DW2U 5DK1A 4AYVB 5LH8A 1UTLM 1SQAA 4AFQA 3RXKA 4WH8A 1PPCE 1OWIA 2J9NA 3STJA 3GCTG 1H9HE 3A7TA 3A7WA 1TPAE 4GLYA 1OP0A 1TRYA 4I8LA 2AMQA 5JDUB 2PGQB 1F5RA 2UUYA 4DURA 2CMYA 1FNIA 1MAXA 1V2KT 1XVMA 2ZDNA 1WUNH 1EX3A 4B1TA 1K1JA 3UUZA 1JMOH 1PQ7A 1EAXA 1O3HA 4DJZB 4B74A 1BTHH 1A5GH 3A7YA 1EZQA 4LOYH 2HNTE 5H4IB 5C1XA 1O2ZA 8GCHG 2G4TA 1AQ7A 1YKTA 2WPIS 7GCHF 1UK2A 2AEIH 5C2ZA 3SUGA 1C1RA 3SU3A 4MNVA 1H1BA 3KQBA 1CT4E 2PKSB 2CXVA 1N6XA 1IQHA 2ZHWH 4DOQA 2ZFFH 3L33A 1O3OA 2HOBA 1YPGH 2W5EA 4JZ1A 2ZNKH 3KEEA 5AFYH 1ABIH 3OSYA 2FZZA 2BY6X 2AGEX 1RTLA 3TJNA 3F68H 4Y76A 3O8DA 2VWNA 1J15A 3MU0A 1EXFA 1Q31A 2Z94A 2FYQA 2CHAC 1AFEH
chains in the Genus database with same CATH superfamily
4SGBE 1SLXB 1DS2E 1UCYK 3OEED 4D9RA 4IMZA 4X8VH 3V12A 1SLUB 2Z9GA 4DIIH 1GI0A 1O2TA 1FIWA 4ZAEA 3V0XA 4A92A 1Z8IB 3PO1B 1HJ8A 2ZDLA 1COWD 3MNCA 4NZLA 1TX6A 4GVUA 2Y5FA 4FU8A 1J9CH 1E38B 4BTUB 1VZQH 1XXFA 2ZU2A 5ABWA 6ESTA 1YLCA 5JB8S 2HGTH 4I33A 3STIA 1CA0C 3PLBA 2DE8A 1RFNA 1KIGH 2F91A 1INCA 2J92A 3RXDA 2XTTB 1AN1E 1UHBA 3CENA 3QK1A 4ZMAH 3LJJA 1DPOA 1ESTA 1AVGH 1TRMA 2JJ2D 1EJMA 2ANYA 2RFKC 2BDIA 2GTBA 3PLKA 2KCOA 1BMAA 3OFND 4D9QA 1BMLA 3BTGE 3RXVA 3UOUA 1X7AC 2QE7D 2KCPA 3F0PA 1SC8U 1YPLH 1E1QD 2FM2A 2VWOA 3BG4C 3TPIZ 4CRFA 1CA8B 3AAUA 5GWZA 1UK3A 1TX7A 4P00A 3S0NA 2OC0A 2XW9A 2YNAA 3VB7A 1EJAA 1IHTH 3ZZCA 2ZHDA 1ACBE 4IGDA 1TBZH 4MPWA 1Y5BT 2Y80A 1SR5C 1SQTA 5JYIA 1YPMH 4CREA 3RU4T 1GVLA 3U1JB 4LZ1H 3M36A 4IW4E 2WINI 3TU7H 1F0UA 4CH8B 5EODA 2BMGB 3A88A 1T8OA 2ESTE 3PWCA 1PPHE 3QTOH 4BAOB 1THPB 1DWCH 1MBMA 2XYAA 4X1RU 1QZ8A 1Z8JB 1GDNA 1A5IA 2BD4A 1SI5H 3SJOA 1ZPBA 1UCYH 2SNVA 4UE7H 2ZPRA 1AZZA 2B5TB 1N1LA 3LGVA 3QTVH 4KP0A 5EQQA 4JYTA 1O2MA 1EB2A 2XBWA 4Q80A 3M7QA 4CBNA 4OGYA 4XFQA 5C67A 1TGNA 1B5GH 1HAGE 4E05H 1S84A 2TPIZ 1AB9B 1T8NA 4FUHA 3GCNA 4TWWA 1TBQH 1WTGH 2P95A 1OWKA 1A2CH 3RXHA 1TE0A 4KTCA 1P12E 2OBOA 3KHVA 2H6MA 5F8XA 3KNXA 2J5UA 1OKXA 1GHZA 5EJLA 4KTUA 3OAAD 1C2GA 2VIVA 4IBLH 1O2JA 1BTXA 3K6YA 3NWUA 3FP8E 2AIQA 1HAOH 1JIMA 3VB6A 1GL0E 1BT7A 2BZ6H 1MZDA 3S69A 1ELAA 2QGRA 1C1SA 4AZ2B 1WV7H 2BLQA 4FVDA 2FTLE 1DANH 5F53A 2J38A 1ELVA 3SQHE 4YLUA 2W3KA 1UCYE 1C2JA 2GMTB 2IJOB 4NFFA 3A82A 5EXMA 1SGEE 4BAKB 2GT8A 1DLEA 3RXEA 3RXLA 1TGSZ 4MPVA 4OS5A 1BUIA 1JOUB 1ZOMA 1P3CA 4B73A 1P2NA 5L2YH 2A5KA 3A81A 2FYRA 3D62A 1NO9H 2WUCA 1QA0A 1C2MA 3U69H 2PW8H 2QXIA 1ESBA 4ZHLU 5F03A 1C5NH 2ZGCA 1TNGA 1UTOA 1XUGA 1O5DH 3LC5A 2Z9LA 1EJNA 3FFGA 3HK6B 1KXEA 2TBSA 1Y3YA 1RGQA 1KTTB 1TX8A 2FOEA 5E0HA 1GJ9B 1F0TA 1C9PA 5E8EH 2F9OA 1V2JT 1MTVA 4NWKA 1RS0A 5GCHF 3SI4H 5CMXH 2QN5T 1YCPK 2XBXA 2P59A 3MU5A 4ABAA 1W13U 1C2EA 1WXRA 4KELA 1QB6A 1C2HA 3T27A 2GZ7A 2TGTA 1GMCG 3E6PH 2Y81A 1GI9B 3M7UA 2PKAA 4YT6H 1A3EH 1XXDA 1D6RA 1VJAU 3C1KA 1F7ZA 1XM1A 1PQAA 3MI4A 4CRBA 2JIZD 2TGPZ 1Y3VA 3TK5A 3BV9B 1YPHC 1FY1A 2KM0A 2GX4A 6CHAB 1C5YB 5HGGA 1BDAA 3TJVA 1O3NA 4X1NU 1D3DB 1FDPA 5CHAB 1QBVH 1QQ4A 3ATMA 1C1VH 1GJ7B 5BRRE 5HXFA 1BRUP 1MKWK 2W6ID 3BG8A 4RT0A 1NT1A 1O2GH 5J4SA 4AYYB 4RKOB 1LVYA 3IITA 2ZGJA 1P2KA 5AF9H 1IHSH 4FU7A 1K1OA 2F4LA 3OTJE 1C2DA 3GY5A 1FONA 1FAXA 3MO6A 1CO7E 2ODYB 1O33A 2CV3A 1C5TA 1GMHG 3TNTA 1YM0A 3NZIA 3R3GB 1J17T 1XUJA 3IWMA 3S9BA 1C2KA 2BDCA 4KKDA 4O3TA 2BLVA 1ZHMA 3U28C 1HLTH 2C8ZB 3PMHB 3VB4A 2SFAA 2VGCB 1GGDC 1TYNA 2C93B 1DX5M 3FAOA 3RXSA 4HFPB 1XUIA 1FN8A 4MPXA 1TNHA 1NRPH 3U8RH 1SOTA 5LPRA 2GV7A 1Z71A 1CBWC 2FODA 4TSFD 1EFRD 3T25A 4AORA 3PMJA 1IQMA 1K1NA 1NC6A 2HALA 2HNTF 3RC6A 4B2CA 2VB0A 5HM9A 1JXPA 5L6NH 1A0JA 1D3QB 2FOHA 3RUOA 4BTTB 1ID5H 3TLOA 1O32A 2IOTA 2TIOA 3SNBA 1TPSA 1H8IH 1W7XH 4CRDA 2H9TH 1MBQA 1A46H 1B0EA 3ITIA 3ZV8A 1GI4A 1O3FA 2FS9A 2UUJB 3UIRA 3MWIU 2OD3B 6GCHG 4WMFA 1G3CA 1RIWB 7KMEH 1G2MA 4XRNA 4ZHAA 1C5SA 1SL3A 5LPEA 3SO3A 2SNWA 2GV6A 3BTME 4X8TH 1AVXA 2ZQ2A 4D7GA 3GCHB 3SN8A 3LJOA 1O39A 1QURH 2OINA 4NFEA 3QWCH 1A3BH 1FY3A 5DN6D 2BY8X 2PTCE 1T7CA 1V2VT 4CHAB 2ZGXH 4JZFH 2FI4E 2WPJS 1NBMD 3LGTA 2VINA 3N99A 3BTEE 5EJZA 3UTUH 1O2WA 2FOGA 2ZCLP 4KTSA 4RKJB 1NU7B 4B2AA 2CJIA 1GVKB 3H09A 3ZYEA 1HAIH 3F9GA 1PYTD 4D8NA 4MQAA 5C94A 1V2TT 3BTWE 3UNRA 4B71A 4Y7BA 1E35B 2BD5A 5HMAA 2Z9KA 3R0FA 1GBLA 1MTNC 4NA7A 1QA7A 3Q3XA 1LKAA 1P9UA 2ZFTA 1C5WB 1AFQB 3TGJE 5A2MH 4NGAH 3SU1A 1OPHB 1A61H 2ZDKA 1GCDA 1TMBH 1ANEA 2AH4X 4I8KA 5EW2H 1UW7A 1H8DH 5JBTA 1TLDA 1O3IA 4FUJA 1C2IA 4UD9H 4A5TS 2PV9B 4WXVA 2HVYB 2B7DH 3RC5A 2ZFRH 3MO3A 1MTWA 2BDBA 2JETC 3NRLA 3LGUA 2HPQH 2R2MB 3RP2A 3E0PB 3KQDA 2DE9A 4AB9A 2C3SA 1NESE 1LPKB 2SGPE 1DT2A 1GHAG 1ANDA 2NU2E 4Q7YA 4ZCNA 3SU4A 1OWJA 1TMUH 1W12U 1GI3A 1KYNA 1LHFH 1SLVB 3P92A 1ELCA 3FP7E 4K1SA 3SNAA 1DLKB 4DVAU 4MPUA 1P03A 2PGBB 3F9EA 2BD9A 3GDUA 1FPHH 4H6TA 2C90B 1OYTH 1YGCH 3JZ1B 2Q6FA 4AN7A 3DD2H 2NWNA 3Q77A 4ISHH 1BRCE 2ANKH 2FTMA 1BRAA 4ZKOU 2V3OH 1BHXF 1SVPA 5FPSA 2RDEA 1T32A 1SGRE 2LELA 3HATH 3ZZ8A 1GI1A 1EPTA 3KYGA 1C1PA 4IC5A 1G30B 2Y82A 2VVUA 4OS7A 2FI3E 3NUMA 2A7JA 2ULLA 3BIVH 2QV1A 2R0LA 2ZU4A 1FI8A 3A89A 3ZV9A 2ZO3H 1D3TB 4DIHH 1WSSH 2XCFA 2ZPQA 2ZCHP 2WPMS 4R8TB 1TNLA 4RI0A 4A7IB 1S6LA 2O9QA 1ZZZA 1W10U 2PKSC 1XKBC 2GGVB 1ABJH 1BITA 2QYIA 1KSNA 1DE7H 3TNSA 1MZAA 3I29A 1S6FA 2B8OH 1H9LB 2Q6DA 2RDLA 1G36A 2PUXB 4X8UH 8KME2 1LCYA 4BNRA 3VXFH 1MMJN 4Y7AA 5EQSA 2GZ8A 1OWHA 1DICA 3RC4A 3AVZA 1BTUA 3MOCA 4VGCB 1BOQA 2FS8A 1LTOA 3E8LA 5A0CA 5EW1H 1C5ZB 2GDEH 1O5GH 1L4ZA 1BJUA 2RA3A 3LKWA 2V0BA 2ZEBA 1OXGA 3PO1C 3KIDU 4I8HA 1EP5A 1ARCA 2VH0A 3A80A 3BTDE 5E2PA 2ZP0H 4FUFA 1AE5A 1HAVA 1C5PA 4YESB 1SMFE 1HIAA 5T1VA 4WY3A 5DKMA 1GBCA 1LVBA 2G52A 1MTSA 3KYFA 3M3TA 3SUFA 3DSOA 1UTMA 3AW1A 1ELGA 1ANBA 1HXFH 1O3AA 3KN2A 1V2LT 5C17A 1YLDA 3GDVA 1LHGH 3KF2A 3U8OH 3GY4A 5FX6A 2O8LA 1GJBB 2FI5E 3SU2A 2VU8E 1MABB 3D49H 4UFDH 3ELAH 3RXRA 4D76A 2VVCA 5A09A 2PSXA 1SFQB 4K3JA 4X6OA 2Z9IA 1HFDA 3A7XA 1TQ0B 4BOHA 4X2XA 1SSXA 2FIRH 3QUMP 1BBRK 1AKSB 3ZZ7A 1GBHA 1UVPA 4BAQB 4MLFB 1A5HA 2BQWB 3E91A 3VPKA 1TNKA 4FUIA 2ZHEH 2BLWA 4INHA 3GYLB 5KECA 5CE1A 4OGXA 2O8MA 1SGDE 5C20A 1HJAB 2EI8A 3BTFE 4Z0KA 1Y3UA 3U1IB 2QAAA 3P8FA 5I46H 1T8MA 5GDSH 2FWWA 3GYMA 1LPZB 4Y71A 4KGAA 1H9IE 1HIAB 4A1XA 4UONA 3MU1A 1GI7B 4HI3A 1TMTH 1AWHB 2FOAA 3AASA 3B8JA 4NIYA 3M3SA 1SGYE 2ASUB 5GJ4B 3ZZDA 2ILNA 3MH6A 1O3GA 1HAPH 1BA8B 3T5FH 2BQ6B 4Q4LA 1Y8TA 2QXHA 2UUKB 3DFJA 2EA3A 3SOSA 3M5NA 4GCHF 1TB6H 1LO6A 1T4UH 1EATA 1ZGVA 5T6GA 2Y7XA 3RXQA 4BANB 4INLA 4B6FA 1AB9C 4TPYA 2FLBH 3M61U 1D6WA 5EGMA 1SGFG 1MU8B 2F9BH 4OM9A 2AFQB 4A1TA 3E0NB 1QTFA 3K6ZA 3SV9A 3ZVBA 4O3UA 1QIXB 3MH7A 2Z3DA 4U01A 2PFEA 1VITH 1GHWH 2KCAA 1TFXA 4X0WU 1NFUA 3RM0H 3EA8A 1RD3B 4ACBA 1ORFA 3RXPA 2PTNA 3BTKE 1O2LA 1O2YA 1TOCB 4AB8A 1CHOF 2BX4A 1C1MA 1LQEA 5PTPA 3RLWH 7LPRA 3NPSA 2ZU1A 1O3BA 5DGJA 1RRKA 2GMTC 3SGAE 4AOQA 4YXWD 1NRSH 1SGIB 2BD7A 4A6LA 3NXPA 2F3CE 3E1XB 1O5BB 2WV4A 2GJGA 1H4WA 4AG2A 1BBRH 2R9PA 2BDAA 2BZAA 4BAMB 2GP9B 1ELEE 4HZHA 2DUCA 3ATWA 3K9XB 4Q2KA 3N7EA 1CT0E 4YOJA 2VIDA 1HBTH 5EPNA 1GVZA 1GL1A 1BCUH 2GCTC 4WF8A 1B0FA 3GS9A 3A86A 4CR9A 1UHBB 2F83A 1GMDF 4AFUA 4CH2B 2GVFA 3LOXA 5T6FA 5FAHA 2QF4A 4FU9A 4RN6A 2YMSD 1ETTH 2A45B 4CBOA 2F43B 4WVPE 1HNEE 1SKYE 2VIWA 5IDKA 1O2XA 1MD8A 2BQ7B 1PPGE 1DXWA 4ABEA 3GY2A 3SUDA 1C5QA 5JPMH 2AGIX 3UREA 2ZDVH 2A7HA 1C5MD 2XXLA 3GISB 3SZNA 2WSSD 1G3DA 1P06A 3P6ZB 3ODFA 3SHAH 3E16B 1GI2A 1YC0A 4J1YA 1O38A 3Q3KA 1QB1A 4RSPA 1BBRE 5DG6A 1DWDH 1O35A 1TALA 2BVSH 1P2MA 2NU0E 1O2SA 1HV7A 1AGJA 6CHAC 2ZTXA 3DA9B 4AGKA 1HAHH 1TGCA 2PHBA 3GICB 3P70B 1AVWA 3UY9A 2BY5X 2VJ1A 1ARBA 1ELDE 3NK8A 1TGBA 8LPRA 5CHAC 1GBEA 3PM3A 2SGAA 4TYDA 1ELFA 2EC9H 3AK5A 1YPHE 2VIOA 2CF9H 1AI8H 1L4DA 5GXPA 5DP8A 1W0ZU 1T4VH 2V3MA 4I8GA 3M3VA 5KEDA 2FX4A 3DT0H 2JH5D 1K28D 4NSYA 1CGHA 4M7GA 2EI7A 1AO5A 1LKBA 2FO9A 1KXDA 2IJD1 2KR7A 2G00A 3Q76A 4MNWA 5CDFE 4FUBA 4U32A 1P2JA 3O8CA 3UQVA 1QR3E 4A1VA 1LVMA 3RLYH 1O2NA 1HUTH 1P2QA 1FPCH 2C8XB 1F5LA 1JBUH 3MO9A 3RXUA 1HXEH 2XNIA 1TIOA 3T28A 1FLEE 5B6OA 1ELBA 5IYTA 1VGCC 3MH5A 2UWPA 1J14A 3HK3B 4I32A 1C2LA 1UMAH 3UWJH 1P02A 2P93A 4ZKSU 1AHTH 3D23A 1K1IA 3K2UA 1F5KU 4F48B 4LZ4B 3PRDA 3GCTF 2B0FA 1MCTA 2G5NA 2NU1E 1VR1H 3RXBA 4I8JA 1P11E 2A2QH 1KTSB 1RIWC 1QJ7B 5G4BA 4ACAA 1P2OA 2FX6A 1GJ4H 4I31A 4NCYA 4JZEH 4DT7B 1AE8H 4U30A 1W8BH 2SGFE 1TONA 1QHRB 3LU9B 2L6OA 2QF3A 2ZG0H 2I6QA 4XBCA 2OQUA 3WWFA 2D26C 3TITA 1XUFA 3NCLA 1E34B 1UVUH 1HYLA 3EQ0H 1O5AB 1ZPZA 5DP4A 4CHAC 2SGEE 1VJ9U 4ZH8A 3RMLH 3VXEH 3RU4D 1KY9A 4LXBH 3ZZ3A 1SGPE 2OTVA 3A7VA 2P3FH 3M7TA 2A0QB 3SJIA 1S6HA 1WU1A 2PKAB 3A8AA 5HKKD 3UFAA 2J95A 4U2WA 2KAIA 2VWMA 4GHQA 2G55A 3L3TA 1TA2A 4INKA 3TJUA 5FPTA 3GY6A 1YBWA 2C8YB 1A7SA 3D65E 3RMNH 4YM9A 4DY7B 4ABDA 2BD8A 2H9EH 1JIRA 1V2UT 4YZUA 3SNCA 5DO4H 4X6NA 1O2KA 1A1RA 1C1UH 4UDWH 4JYUH 1W0YH 2XRCA 1OYQA 2D2DA 5A8ZA 1G32B 3MTYA 1AFQC 1TBRH 7GCHG 3DSGA 4NWLA 1UTQA 3SU0A 2BY9X 3U9AH 1S85A 3BEIB 1AY6H 1THRH 1YCPH 3LONA 5J4QA 1BHXB 1SGNE 1ZLRA 4ISOA 2YMSB 2A5IA 2HLDD 2W7SA 2ZQ1A 2QCYA 1XUKA 4CRCA 3ZZAA 1FMGA 1IQEA 3BEFB 6LPRA 4XE4A 4BXSA 4O9VA 1D9IA 3KGPA 3ZZ9A 3DUXH 4X2YA 1T31A 3RXTA 1G2LA 1HPGA 1LVOA 1OWDA 2B9LA 2KX4A 4FUDA 4ZKNU 2ZIQH 3SUEA 4Y11E 4E7RG 4Y8YA 5A8XA 1GCTB 1QL9A 2J97A 3SGQE 1O30A 1GDUA 1ZTJA 4UFEH 2BD3A 3MNSA 1GJCB 1Z6JH 3MHWU 1LDTT 4LK4A 3AAVA 2IN2A 1MKWH 1GBKA 1OX1A 3CS7A 4YOGA 1ZMJA 1O34A 1PPBH 1GG6B 1DY9A 3PMBB 4GCHG 2GKVE 2EEKA 3A87A 4ABBA 3VGCB 5C0TA 1PPFE 4K1TA 2H5CA 2Z7FE 1EZSC 3SV7A 3Q00A 1Z8GA 3SV8A 3UAIC 3BIUH 2OCVB 1S0QA 3TK6A 5GIBA 3SU5A 1S82A 1N8OB 1ZJDA 3MU4A 1C4V2 1C5VA 2FOMB 3Q3YA 1V2ST 5E2OA 2XOKD 4E7NA 1TPPA 4JZIA 1QRWA 1WQSA 3SI3H 1Y59T 1N6YA 1ETSH 1UK4A 4ZROA 3RMOH 3U98H 1O3PB 3ZVEA 1WAYB 1BJVA 3KL6A 2XCNA 1G3BA 1CHOG 3ENSB 3T29A 2HVXA 2PUQH 1NBME 2YNBA 1B7XB 1BTWA 3F9FA 1FJSA 3KCGH 1EQ9A 2FXRA 1UTNA 4AFZA 4X6MA 5JB9S 4NIVA 2BYAX 2BD2A 1IQFA 1NS3A 1P3EA 3A8DA 5DP6A 1P05A 2H9HA 2UWLA 2BX3A 1C4U2 4CR5A 1KMHB 3GCOA 1CU1A 2VNTA 5DP3A 3SJ8A 1GBBA 1L2EA 2PSYA 1IQGA 3ODDA 3VB3A 4OS1A 5DP7A 2STAE 2ZDAH 1G3EA 2K0QA 3A83A 3F1SB 4D7FA 2P8OB 2FP7B 1VITF 1K1PA 1V2QT 3PTNA 3T62A 1SG8B 5C1UA 2OUAA 4ASUD 3EA9A 4F4OC 3PRBA 1S83A 1Q3XA 1HJ9A 3PLPA 1GI5A 4XOJA 4H42U 3ZYDA 1K0HA 4WMDA 5TCCA 5ESBA 2IPHA 1BQYA 3OY6U 3UNSA 2VVVA 3RXIA 2BOHB 3UPEA 2VWLA 4XD7D 1IQNA 1KDQA 1OSSA 2WYJA 2LP6A 3QX5H 1ETRH 1FIZA 1QNJA 2FOBA 3PWBA 3ZZBA 2KFWA 2ZHQH 3QLPH 1Z8RA 1EAIA 1DSUA 3P8GA 1O2QA 1UVOA 1V2WT 3KQEA 3QGNB 4H6SB 3OY5U 4IMQA 5L30H 3JZ2B 4J2YB 3EE0B 5HM2A 1LMWB 1O2RA 2WPDD 4TT3D 1O2UA 3G01A 2ZFQH 5E0JA 4TPIZ 4Y8XA 3WWBA 3AW0A 2R0KA 4X1QU 1PYTC 2BXTH 1UTJA 1NZQH 3HGPA 1CGJE 1DSTA 1BB0B 3T26A 2IPQX 5EXLA 1HJAC 1BMNH 1JRTA 1SGCA 2G81E 1WYKA 3P8OA 1TPOA 1GJ5H 1L1JA 1O3KA 1IQJA 2OC1A 4ZHMU 4ABHA 3E3TA 5FHTA 1GHXH 1DY8A 3TH3H 1ZTLA 2WPHS 1V2OT 2A5AA 3PROA 3RXCA 2PLXA 4JK5A 1W2KH 3PV2A 1HDTH 3BN9A 3V7TA 4BAHB 2P94A 4HG6A 5HIYA 5FCRA 1Y3XA 4GUXA 2P3UB 1ZMLA 3RXGA 5F6MA 3VEQB 2V7QD 1H8HD 3KQ5A 1CT2E 1HCGA 1HB0B 1FN6A 1GJ6A 1EPTB 5L2ZH 2LNCA 1DM4B 3RXFA 3ZVDA 4JCNA 3A85A 1IAUA 1WDIA 5SGAE 1YPJH 1O3DA 3M5LA 1P10A 2OC7A 3LH3A 3DHKH 4ESTE 5GCHG 2BHGA 2ZFPH 1TOMH 3SNEA 1VCWA 3CS0A 1MTUA 2F9UA 4GPGA 3MMGA 5F8TA 2J34A 1V2NT 2QC2A 4Q63A 2O8WA 5GPIB 2G51A 4NG9H 3H7TA 1Y3WA 1PPZA 3UR6A 1AIXH 1VCPA 2AMPA 2GCHF 2A1DB 3ATLA 1NU9A 1GMHF 1WBGB 2J98A 2XBVA 3ZVGA 1QL8A 1E1RD 3LPRA 4E06H 1FX0B 2XWAA 2ZI2H 4XDEA 5A0BA 1NROH 1OP2A 1TQ7B 1GBAA 1PQ5A 1AMHA 2ANWA 4FUCA 3BTTE 2OP9A 4BTIB 2JJ1D 1Y5UT 3FZZA 4B6EA 1MQ5A 3S7KB 2QF0A 2XC0A 3ESTA 3GY3A 1E36B 2WPKS 1W7GH 4PROA 1GBTA 3RDZA 1GBFA 5C5NA 5AFZH 1ZSKA 3KQCA 2HRVA 2ZCKP 1U6QA 1LHEH 2ZECA 2ALPA 2TRMA 4O03A 4FXGH 3UR9A 3W1EA 1HAVB 2RG3A 1CSOE 2QF5A 4UFGH 3I77A 1MKXK 2OBQA 1JWTA 3OE7D 1P09A 1QL7A 5CHBA 2ZC9H 3A84A 2BM2A 1O2OA 3ZVAA 1CE5A 1DDJA 4CRGA 1BMMH 2Z3CA 2YOLA 1MH0A 1PFXC 2BTCE 2G5VA 2OQ5A 1E79D 3FVFB 1P9SA 3FZDA 4YTAA 3SU6A 5LPFA 3F6UH 1O31A 1C9TA 4ZXXH 6GCHF 2BOKA 1S0RA 1LHCH 3RMMH 5T3HA 3ATIA 4MG3A 1F0SA 1TA6A 3S9AA 2HWLB 1YF4A 3GY8A 1TAWA 5T6DA 5EU8A 2M5TA 1QCPA 2THFB 2FDAA 1ZYOA 1VKYA 4K2YA 2ZTZA 3U8TH 1O0DH 4ABIA 1FAKH 4CRAA 4R0IA 2ZU3A 3FO8D 2V6NA 2ALVA 5DSFA 1DXPA 1YYY1 3TJOA 3DSPA 2CGAA 3F3BA 3SYJA 1W11U 2WV5A 3RXOA 1EASA 2ANMH 4I7YH 2HNTC 4X1SU 4TY7A 3UWIA 1PJPA 2STBE 3S9CA 3SJ9A 3GDSA 1P01A 1D4PB 2PP6A 3M5MA 1BTPA 1V2PT 3QO6A 4FVBA 1TABE 1T8LA 2A31A 1O5EH 5C3NA 2J2UA 1V2RT 3SW2B 1H8ED 2WYGA 1IQKA 2F9NA 4K5ZA 1SQOA 1ZMNA 4NIXA 4GSOA 2OXSA 1YCPM 3IG6B 1Z1JA 1BIOA 1EZUC 1SHHB 4UEHH 1F0RA 1Z7KA 1UVTH 1ZRBA 3O8RA 3A8CA 1QY6A 2O8UA 4Y0YE 4F55A 1CQQA 5DP5A 3LGYA 1DITH 2HLCA 4ISIH 1MKXH 3TGKE 3V13A 4DGJA 3WW7A 2TGAA 1FUJA 1UJ1A 2A4GA 5F8ZA 4ZUHA 2P3TB 3BF6H 3BTHE 3PMAB 3LGWA 4MDSA 4ZKRU 4HTCH 1NTPA 2AS9A 2BDYA 2CHAB 1GHAF 1SGFA 1GPZA 1GJ8B 1EUFA 3BEUA 1W3CA 2AYWA 4GAWA 2QA9E 1DVAH 2ZKSA 1NPMA 4DT4A 1DWEH 1L1NA 2Y5GA 1XUHA 2G4UA 2WZQA 2XWBI 1YLNA 3MQKC 2H2ZA 4AX9H 1QGFA 4OS4A 1KXBA 1UTPA 2EQNA 1PQ8A 1FQ3A 4ABJA 4MVNA 1VCQA 1GJAB 2R3UA 5FL7D 4X8SH 1YP9A 5K7RA 2V3HH 1P57B 1NRNH 1THSH 2Y7ZA 2BY7X 2EI6A 1C5XB 3P17H 4QT8C 4WH6A 1Y5AT 3SHCH 1PPEE 1TNIA 1EOJA 1FZZA 2R2WU 5EIYA 1GHBF 2A4QA 3TH2H 2G8TA 3TK9A 1CA0B 2A2XH 1GHYH 2GD4B 4JK6A 2ZA5A 3BTQE 1SPJA 3B9FH 1XX9A 4NZQA 4YO9A 2W6JD 1IQLA 2F9PA 2O8TA 1CVWH 1G9IE 2BVXH 1K1LA 2ZU5A 2W26A 4NSVA 1Z6EA 3M37A 1DFPA 1VITG 1MUEB 3PB1E 3SNDA 1KXCA 2ZGBH 4F49A 5AHGH 3ZVFA 4ZXYH 3RXJA 1GBJA 1QRZA 2EY4C 5FCKA 1GWAA 2C8WB 4DCDA 4K1EA 3F2FA 4K69A 3H5CB 1QJ6B 3BG4B 5TCAA 2FLRH 3EYDA 1O3MA 5FX5A 3N7OA 3F2HA 3MFJA 1LQDB 3HGNA 1GI6A 2VGCC 3VFEA 3ZZ4A 1JRSA 1XMNB 3PTBA 1O36A 4AGJA 2ZWLH 3QZRA 4IN2A 2WV9A 3K65B 5FXLA 1DUAA 1ZJKA 2ZFSA 1OS8A 1QBNA 3FKSD 2P16A 3P95A 1GBIA 4DG4A 1GHVH 1O3EA 2FOFA 2ZTYA 3NKKA 1C1QA 4FUGA 3V3MA 1NFYA 4OS6A 8ESTE 1LPGB 2VIQA 1EKBB 1GDQA 4B76A 2GCTB 3LIWA 1AUTC 3EDXB 9LPRA 2ZPSA 2YMSC 1O2IA 2V35A 4UFFH 2PR3A 2H1UA 1SFIA 2M2AA 1ELTA 1CGIE 1HAYB 3ZZ6A 1DUEA 1O5CB 1GJDB 3P8NA 3OYPA 1TGTA 1FXYA 3SQEE 3QGJA 4ABFA 4YOIA 1P2IA 2ZZUH 5EJ1A 2Z6BD 2AGGX 1GCTC 4FUEA 4Z6AH 2ZDMA 4IC6A 4XBBA 2JH0D 1ESAA 3RM2H 1RXPA 3GCHC 2XC5A 3GY7A 2Y5HA 2D1JA 4B2BA 1XKAC 3L6PA 3PV4A 4GHTA 1MAYA 2FOCA 1C2FA 1FV9A 8GCHF 1GG6C 2C4FH 1BRBE 1NN6A 1SHYA 3VGCC 1NRQH 2SGDE 2AERH 1K21H 1OOKB 1SGTA 3URCA 1A4WH 1DWBH 4H4FA 3LT3A 4Y8ZA 1O2HA 1L1GA 1NY22 2JDID 1N8OC 1K9OE 4BXWA 3OTPA 1J16A 1UTKA 3TVJB 5KGOA 4NIWA 3OEHD 2GCHG 1BTYA 1NFXA 3EA7A 1J8AA 1G37A 1SGQE 2ODQA 1S81A 4X2VA 1V3XA 1BZXE 3TH4H 4FETA 4M9FA 4MNXA 1P8VC 3MH4A 2WUBA 2W7UA 2GDDA 3I78A 2ZGHA 3RU4E 1SQRA 1QBOA 2H5DA 4WMEA 1BTZA 4Y6DA 3M35A 2KCYA 3HKIB 4K60A 5IK2D 1YY3A 1F92A 4I86A 1A0LA 1OWEA 5B6LA 1CHGA 3FANA 1IQIA 3ZVCA 4IN1A 1S5SA 4XSKU 1FY8E 1BMFD 1VGCB 1RJXB 4WXIA 4B75A 4WJG2 4JMYA 3UB0A 3F2GA 5BPEA 1WOFA 4FOUC 2F9VA 1TNJA 2P8OC 5GNDA 5EXNA 1C1WH 3UOPA 3HKJB 2AHME 4MNYA 1AUJA 1C1NA 1O37A 1EAUA 1YPEH 2UUFB 5FPYA 3VB5A 3O8BA 2A32A 2KAIB 1XVOA 2XC4A 1C5LH 3H7OA 1C1OA 3LDXH 1KLTA 5DPAA 3A7ZA 2XNDD 3TIUA 3N7DA 4IS5A 1KXFA 3RXMA 2QY0B 2LPRA 4Y10E 2UWOA 1O2PA 1NM6A 5JBCS 1AD8H 1MQ6A 1GBMA 1O5FH 1MU6B 4X1PU 4Q7ZA 1Z1IA 5TJXA 1YPKH 1AZ8A 4ISNA 1GBDA 1F2SE 3UQOA 3ZZ5A 2BVRH 3UNQA 2ZHFH 2A7CA 2QIQA 3DCLA 1C1TA 3WY8A 2NU3E 1EOLA 1ZSLA 1C5RA 3F9HA 4JYVH 1W0KD 4SGAE 3E90B 3SV6A 3EGKH 2XBYA 1FY5A 3SGBE 3FN8A 4WWYA 2J94A 3LGIA 2SGQE 2Z9JA 5A0AE 1W14U 1UO6A 3A8BA 3OU0A 1QB9A 1C5OH 2WPLS 4Y79A 1SOZA 5A8YA 1GGDB 2VIPA 2BLOA 2CF8H 5HIZA 3ATKA 5AVDA 5EPYA 2OC8A 1CBWB 2BXUH 1L0ZA 1QFKH 2GT7A 3T2NA 4VGCC 1EZXC 1AU8A 5C5OA 1SB1H 1ZRKA 1A0HB 1O2VA 4AC9A 1WTHD 3CNRA 1AWFH 1SBWA 2I6SA 1EPTC 2OLGA 3MYWA 1C4Y2 2K1QA 1GMDG 5EQRA 3MNXA 3FP6E 2BB4A 1ZGIA 3W94A 3W95A 4NA9H 5E0GA 1KLJH 1TRNA 4JZDH 1KXAA 2QXJA 1O3LA 1E37B 1ZR0A 3URDA 7ESTE 2JH6D 4ASHA 1QJ1B 4TWYA 3M5OA 3TGIE 2QXGA 3QDZB 1WQVH 5C0UA 1O3JA 1P04A 1ZHPA 1D3PB 1M9UA 4K8BA 2FESH 2D8WA 5ETXA 4OS2A 3B23B 4Q7XA 4O97A 3RXAA 1OP8A 4ISLA 2ODPA 2PWXA 3HPTB 4ABGA 3BSQA 1P0SH 5HYOA 2J4IA 5DJ7A 2BDGA 2R3YA 2NU4E 4NA8A 1GHBG 1K2I1 3QZQA 4K8YA 3MNBA 1IOEA 2W3IA 1TWXB 1HAZB 1HGTH 1QRXA 1LHDH 5FBIA 3PV5A 3EE7A 3SV2H 2L74A 1Q2WA 1HRTH 2FPZA 4YLQH 1C5UA 1MCVA 2Q1JA 1EP6A 3S7HB 1EB1H 3GOVB 3LH1A 5C1YA 2OK5A 3VG8A 2FEQH 1MD7A 2A4OA 2FMJA 5K0HA 3DFLA 1WCZA 1QQUA 2AIPA 4P02A 4THNH 5ESTE 1ANCA 2TGDA 5FBEA 3SBKA 9ESTA 4HGCA 3QN7A 5LGOA 4AG1A 1GMCF 1K1MA 1NFWA 1MTNB 2WHXA 1GI8B 3CP7A 1HAXB 4X2WA 4MTBA 3SJKA 3SORA 1UVSH 5EG4A 2RCEA 1KDQB 4XBDA 2CN0H 3MU8A 5JBAS 1O3CA 4TY6A 1W0JD 5DP9A 3C27B 5EOKA 1YWUA 2A4RA 2Y6TA 1ZSJA 1ZHRA 1RTKA 1K22H 2HPPH 2JETB 2BDHA 1FY4A 4Y0ZE 4X6PA 3OX7U 1DOJA 1ZTKA 1E0FD 2GZ9A 1AKSA 2AMDA 1KLIH 1V6DA 4YT7H 2VH6A 5JBBS 2RA0A 1EAWA 1V2MT 5I25A 3LC3A 2Z3EA 3EAJA 1RTFB 3PYHA 3F0OA 4AFSA 2JKHA 1NRRH 2Q6GA 2ZF0H 1ZPCA 1SLWB 4DW2U 5DK1A 4AYVB 5LH8A 1UTLM 1SQAA 4AFQA 3RXKA 4WH8A 1PPCE 1OWIA 2J9NA 3FOAA 4Z1MD 3STJA 3GCTG 1H9HE 3A7TA 3A7WA 1TPAE 4GLYA 1OP0A 1TRYA 4I8LA 2AMQA 5JDUB 2PGQB 1F5RA 2UUYA 4DURA 2CMYA 1FNIA 1MAXA 1V2KT 1XVMA 2ZDNA 1WUNH 3ZIAD 1EX3A 4B1TA 1K1JA 3UUZA 1JMOH 1PQ7A 1EAXA 2KZ4A 1O3HA 4DJZB 4B74A 1BTHH 1OHHD 1A5GH 3A7YA 2VBCA 1EZQA 4LOYH 2HNTE 5H4IB 5C1XA 1O2ZA 8GCHG 2G4TA 1AQ7A 1YKTA 2WPIS 4RT1A 7GCHF 1UK2A 2AEIH 5C2ZA 3SUGA 1C1RA 3SU3A 3SZEA 4MNVA 1H1BA 3KQBA 1CT4E 2PKSB 2CXVA 1N6XA 1IQHA 2ZHWH 2CK3D 4DOQA 2ZFFH 3L33A 1O3OA 2K8IA 2HOBA 1YPGH 2W5EA 4JZ1A 2ZNKH 3KEEA 5AFYH 1ABIH 3OSYA 2FZZA 2BY6X 2AGEX 1RTLA 3TJNA 3F68H 4Y76A 3O8DA 2VWNA 1J15A 3MU0A 1EXFA 1Q31A 2Z94A 2FYQA 2CHAC 1AFEH 2J98B
chains in the Genus database with same CATH topology
4SGBE 1SLXB 1DS2E 1UCYK 4D9RA 4IMZA 4X8VH 3V12A 1SLUB 2Z9GA 4DIIH 1GI0A 1O2TA 1FIWA 4ZAEA 3V0XA 4A92A 1Z8IB 3PO1B 1HJ8A 2ZDLA 3MNCA 4NZLA 1TX6A 4GVUA 2Y5FA 4FU8A 1J9CH 1E38B 4BTUB 1VZQH 1XXFA 2ZU2A 5ABWA 6ESTA 1YLCA 5JB8S 2HGTH 4I33A 3STIA 1CA0C 3PLBA 2DE8A 1RFNA 1KIGH 2F91A 1INCA 2J92A 3RXDA 2XTTB 1AN1E 1UHBA 3CENA 3QK1A 4ZMAH 3LJJA 1DPOA 1ESTA 1AVGH 1TRMA 1EJMA 2ANYA 2BDIA 2GTBA 3PLKA 1BMAA 4D9QA 1BMLA 3BTGE 3RXVA 3UOUA 1X7AC 1SC8U 1YPLH 2FM2A 2VWOA 3BG4C 3TPIZ 4CRFA 1CA8B 3AAUA 5GWZA 1UK3A 1TX7A 3S0NA 2OC0A 2XW9A 2YNAA 3VB7A 1EJAA 1IHTH 3ZZCA 2ZHDA 1ACBE 4IGDA 1TBZH 4MPWA 1Y5BT 2Y80A 1SR5C 1SQTA 5JYIA 1YPMH 4CREA 3RU4T 1GVLA 3U1JB 4LZ1H 3M36A 4IW4E 2WINI 3TU7H 1F0UA 4CH8B 5EODA 2BMGB 3A88A 1T8OA 2ESTE 3PWCA 1PPHE 3QTOH 4BAOB 1THPB 1DWCH 1MBMA 2XYAA 4X1RU 1Z8JB 1GDNA 1A5IA 2BD4A 1SI5H 3SJOA 1ZPBA 1UCYH 2SNVA 4UE7H 2ZPRA 1AZZA 2B5TB 1N1LA 3LGVA 3QTVH 4KP0A 5EQQA 4JYTA 1O2MA 1EB2A 2XBWA 4Q80A 3M7QA 4CBNA 4OGYA 4XFQA 5C67A 1TGNA 1B5GH 1HAGE 4E05H 1S84A 2TPIZ 1AB9B 1T8NA 4FUHA 3GCNA 4TWWA 1TBQH 1WTGH 2P95A 1OWKA 1A2CH 3RXHA 1TE0A 4KTCA 1P12E 2OBOA 3KHVA 2H6MA 5F8XA 3KNXA 1OKXA 1GHZA 4KTUA 1C2GA 2VIVA 4IBLH 1O2JA 1BTXA 3K6YA 3NWUA 3FP8E 2AIQA 1HAOH 1JIMA 3VB6A 1GL0E 1BT7A 2BZ6H 1MZDA 3S69A 1ELAA 2QGRA 1C1SA 4AZ2B 1WV7H 2BLQA 4FVDA 2FTLE 1DANH 2J38A 1ELVA 3SQHE 4YLUA 2W3KA 1UCYE 1C2JA 2GMTB 2IJOB 4NFFA 3A82A 5EXMA 1SGEE 4BAKB 2GT8A 1DLEA 3RXEA 3RXLA 1TGSZ 4MPVA 4OS5A 1BUIA 1JOUB 1ZOMA 1P3CA 4B73A 1P2NA 5L2YH 2A5KA 3A81A 2FYRA 3D62A 1NO9H 2WUCA 1QA0A 1C2MA 3U69H 2PW8H 2QXIA 1ESBA 4ZHLU 5F03A 1C5NH 2ZGCA 1TNGA 1UTOA 1XUGA 1O5DH 3LC5A 2Z9LA 1EJNA 3FFGA 3HK6B 1KXEA 2TBSA 1Y3YA 1RGQA 1KTTB 1TX8A 2FOEA 5E0HA 1GJ9B 1F0TA 1C9PA 5E8EH 2F9OA 1V2JT 1MTVA 4NWKA 1RS0A 5GCHF 3SI4H 5CMXH 2QN5T 1YCPK 2XBXA 2P59A 3MU5A 4ABAA 1W13U 1C2EA 4KELA 1QB6A 1C2HA 3T27A 2GZ7A 2TGTA 1GMCG 3E6PH 2Y81A 1GI9B 3M7UA 2PKAA 4YT6H 1A3EH 1XXDA 1D6RA 1VJAU 3C1KA 1F7ZA 1XM1A 1PQAA 3MI4A 4CRBA 2TGPZ 1Y3VA 3TK5A 3BV9B 1YPHC 1FY1A 2GX4A 6CHAB 1C5YB 5HGGA 1BDAA 3TJVA 1O3NA 4X1NU 1D3DB 1FDPA 5CHAB 1QBVH 1QQ4A 3ATMA 1C1VH 1GJ7B 5BRRE 5HXFA 1BRUP 1MKWK 3BG8A 1NT1A 1O2GH 5J4SA 4AYYB 4RKOB 1LVYA 3IITA 2ZGJA 1P2KA 5AF9H 1IHSH 4FU7A 1K1OA 3OTJE 1C2DA 3GY5A 1FONA 1FAXA 3MO6A 1CO7E 2ODYB 1O33A 2CV3A 1C5TA 1GMHG 3TNTA 1YM0A 3NZIA 3R3GB 1J17T 1XUJA 3IWMA 3S9BA 1C2KA 2BDCA 4KKDA 4O3TA 2BLVA 1ZHMA 1HLTH 2C8ZB 3PMHB 3VB4A 2SFAA 2VGCB 1GGDC 1TYNA 2C93B 1DX5M 3FAOA 3RXSA 4HFPB 1XUIA 1FN8A 4MPXA 1TNHA 1NRPH 3U8RH 1SOTA 5LPRA 2GV7A 1Z71A 1CBWC 2FODA 3T25A 4AORA 3PMJA 1IQMA 1K1NA 1NC6A 2HALA 2HNTF 3RC6A 4B2CA 2VB0A 5HM9A 1JXPA 5L6NH 1A0JA 1D3QB 2FOHA 3RUOA 4BTTB 1ID5H 3TLOA 1O32A 2IOTA 2TIOA 3SNBA 1TPSA 1H8IH 1W7XH 4CRDA 2H9TH 1MBQA 1A46H 1B0EA 3ITIA 3ZV8A 1GI4A 1O3FA 2FS9A 2UUJB 3UIRA 3MWIU 2OD3B 6GCHG 4WMFA 1G3CA 1RIWB 7KMEH 1G2MA 4ZHAA 1C5SA 1SL3A 5LPEA 3SO3A 2SNWA 2GV6A 3BTME 4X8TH 1AVXA 2ZQ2A 4D7GA 3GCHB 3SN8A 3LJOA 1O39A 1QURH 2OINA 4NFEA 3QWCH 1A3BH 1FY3A 2BY8X 2PTCE 1T7CA 1V2VT 4CHAB 2ZGXH 4JZFH 2FI4E 2WPJS 3LGTA 2VINA 3BTEE 3UTUH 1O2WA 2FOGA 2ZCLP 4KTSA 4RKJB 1NU7B 4B2AA 2CJIA 1GVKB 3ZYEA 1HAIH 3F9GA 1PYTD 4D8NA 4MQAA 1V2TT 3BTWE 3UNRA 4B71A 4Y7BA 1E35B 2BD5A 5HMAA 2Z9KA 3R0FA 1GBLA 1MTNC 4NA7A 1QA7A 3Q3XA 1LKAA 1P9UA 2ZFTA 1C5WB 1AFQB 3TGJE 5A2MH 4NGAH 3SU1A 1OPHB 1A61H 2ZDKA 1GCDA 1TMBH 1ANEA 2AH4X 4I8KA 5EW2H 5JBTA 1H8DH 1TLDA 1O3IA 4FUJA 1C2IA 4UD9H 4A5TS 2PV9B 4WXVA 2B7DH 3RC5A 2ZFRH 3MO3A 1MTWA 2BDBA 2JETC 3LGUA 2HPQH 2R2MB 3RP2A 3E0PB 3KQDA 2DE9A 4AB9A 2C3SA 1NESE 1LPKB 2SGPE 1DT2A 1GHAG 1ANDA 2NU2E 4Q7YA 3SU4A 1OWJA 1TMUH 1W12U 1GI3A 1KYNA 1LHFH 1SLVB 3P92A 1ELCA 3FP7E 4K1SA 3SNAA 1DLKB 4DVAU 4MPUA 1P03A 2PGBB 3F9EA 2BD9A 3GDUA 1FPHH 4H6TA 2C90B 1OYTH 1YGCH 3JZ1B 2Q6FA 4AN7A 3DD2H 2NWNA 3Q77A 4ISHH 1BRCE 2ANKH 2FTMA 1BRAA 4ZKOU 2V3OH 1BHXF 1SVPA 5FPSA 1T32A 1SGRE 3ZZ8A 3HATH 1GI1A 1EPTA 1C1PA 4IC5A 1G30B 2Y82A 2VVUA 4OS7A 2FI3E 3NUMA 2A7JA 2ULLA 3BIVH 2QV1A 2R0LA 2ZU4A 1FI8A 3A89A 3ZV9A 2ZO3H 1D3TB 4DIHH 1WSSH 2XCFA 2ZPQA 2ZCHP 2WPMS 4R8TB 1TNLA 4A7IB 2O9QA 1ZZZA 1W10U 2PKSC 1XKBC 2GGVB 1ABJH 1BITA 2QYIA 1KSNA 1DE7H 3TNSA 1MZAA 3I29A 1S6FA 2B8OH 1H9LB 2Q6DA 2RDLA 1G36A 2PUXB 4X8UH 8KME2 1LCYA 4BNRA 3VXFH 1MMJN 4Y7AA 5EQSA 2GZ8A 1OWHA 1DICA 3RC4A 3AVZA 1BTUA 3MOCA 4VGCB 1BOQA 2FS8A 1LTOA 3E8LA 5A0CA 5EW1H 1C5ZB 2GDEH 1O5GH 1L4ZA 1BJUA 2RA3A 3LKWA 2V0BA 2ZEBA 1OXGA 3PO1C 3KIDU 4I8HA 1EP5A 1ARCA 2VH0A 3A80A 3BTDE 5E2PA 2ZP0H 4FUFA 1AE5A 1HAVA 1C5PA 4YESB 1SMFE 1HIAA 4WY3A 5DKMA 1GBCA 1LVBA 2G52A 1MTSA 3M3TA 3SUFA 1UTMA 3AW1A 1ELGA 1ANBA 1HXFH 1O3AA 3KN2A 1V2LT 1YLDA 3GDVA 1LHGH 3KF2A 3U8OH 3GY4A 5FX6A 2O8LA 1GJBB 2FI5E 3SU2A 2VU8E 3D49H 4UFDH 3ELAH 3RXRA 4D76A 2VVCA 5A09A 2PSXA 1SFQB 4K3JA 4X6OA 2Z9IA 1HFDA 3A7XA 1TQ0B 4BOHA 4X2XA 1SSXA 2FIRH 3QUMP 1BBRK 1AKSB 3ZZ7A 1GBHA 1UVPA 4BAQB 4MLFB 1A5HA 2BQWB 3E91A 3VPKA 1TNKA 4FUIA 2ZHEH 2BLWA 4INHA 3GYLB 5CE1A 4OGXA 2O8MA 1SGDE 5C20A 1HJAB 2EI8A 3BTFE 4Z0KA 1Y3UA 3U1IB 2QAAA 3P8FA 5I46H 1T8MA 5GDSH 2FWWA 3GYMA 1LPZB 4Y71A 4KGAA 1H9IE 1HIAB 4A1XA 4UONA 3MU1A 1GI7B 4HI3A 1TMTH 1AWHB 2FOAA 3AASA 3B8JA 4NIYA 3M3SA 1SGYE 2ASUB 5GJ4B 3ZZDA 2ILNA 3MH6A 1O3GA 1HAPH 1BA8B 3T5FH 2BQ6B 1Y8TA 2QXHA 2UUKB 3DFJA 2EA3A 3SOSA 3M5NA 4GCHF 1TB6H 1LO6A 1T4UH 1EATA 1ZGVA 5T6GA 2Y7XA 3RXQA 4BANB 4INLA 1AB9C 4TPYA 2FLBH 3M61U 1D6WA 5EGMA 1SGFG 1MU8B 2F9BH 2AFQB 4A1TA 3E0NB 1QTFA 3K6ZA 3SV9A 3ZVBA 4O3UA 1QIXB 3MH7A 2Z3DA 4U01A 2PFEA 1VITH 1GHWH 1TFXA 4X0WU 1NFUA 3RM0H 3EA8A 1RD3B 1ORFA 3RXPA 2PTNA 3BTKE 1O2LA 1O2YA 1TOCB 4AB8A 1CHOF 2BX4A 1C1MA 1LQEA 5PTPA 3RLWH 7LPRA 3NPSA 2ZU1A 1O3BA 5DGJA 1RRKA 2GMTC 3SGAE 4AOQA 1NRSH 1SGIB 2BD7A 4A6LA 3NXPA 2F3CE 3E1XB 1O5BB 2WV4A 1H4WA 4AG2A 1BBRH 2R9PA 2BDAA 2BZAA 4BAMB 2GP9B 1ELEE 4HZHA 2DUCA 3ATWA 3K9XB 4Q2KA 1CT0E 4YOJA 2VIDA 1HBTH 5EPNA 1GVZA 1GL1A 1BCUH 2GCTC 4WF8A 1B0FA 3A86A 4CR9A 1UHBB 2F83A 1GMDF 4AFUA 4CH2B 2GVFA 3LOXA 5T6FA 5FAHA 4FU9A 4RN6A 1ETTH 2A45B 4CBOA 4WVPE 1HNEE 2VIWA 5IDKA 1O2XA 1MD8A 2BQ7B 1PPGE 1DXWA 4ABEA 3GY2A 3SUDA 1C5QA 5JPMH 2AGIX 3UREA 2ZDVH 2A7HA 1C5MD 2XXLA 3GISB 3SZNA 1G3DA 1P06A 3P6ZB 3ODFA 3SHAH 3E16B 1GI2A 1YC0A 4J1YA 1O38A 3Q3KA 1QB1A 4RSPA 1BBRE 5DG6A 1DWDH 1O35A 1TALA 2BVSH 1P2MA 2NU0E 1O2SA 1HV7A 1AGJA 6CHAC 2ZTXA 3DA9B 4AGKA 1HAHH 1TGCA 2PHBA 3GICB 3P70B 1AVWA 3UY9A 2BY5X 2VJ1A 1ARBA 1ELDE 3NK8A 1TGBA 8LPRA 5CHAC 1GBEA 3PM3A 2SGAA 4TYDA 1ELFA 2EC9H 1YPHE 2VIOA 2CF9H 1AI8H 1L4DA 5GXPA 5DP8A 1W0ZU 1T4VH 4I8GA 3M3VA 2FX4A 3DT0H 2JH5D 1K28D 4NSYA 1CGHA 4M7GA 2EI7A 1AO5A 1LKBA 2FO9A 1KXDA 2G00A 3Q76A 4MNWA 4FUBA 4U32A 1P2JA 3O8CA 3UQVA 1QR3E 4A1VA 1LVMA 3RLYH 1O2NA 1HUTH 1P2QA 1FPCH 2C8XB 1F5LA 1JBUH 3MO9A 3RXUA 1HXEH 2XNIA 1TIOA 3T28A 1FLEE 5B6OA 1ELBA 5IYTA 1VGCC 3MH5A 2UWPA 1J14A 3HK3B 4I32A 1C2LA 1UMAH 3UWJH 1P02A 2P93A 4ZKSU 1AHTH 3D23A 1K1IA 3K2UA 1F5KU 4LZ4B 3GCTF 2B0FA 1MCTA 2G5NA 2NU1E 1VR1H 3RXBA 4I8JA 1P11E 2A2QH 1KTSB 1RIWC 1QJ7B 5G4BA 1P2OA 2FX6A 1GJ4H 4I31A 4NCYA 4JZEH 4DT7B 1AE8H 4U30A 1W8BH 2SGFE 1TONA 1QHRB 3LU9B 2QF3A 2ZG0H 2I6QA 4XBCA 2OQUA 2D26C 3TITA 1XUFA 3NCLA 1E34B 1UVUH 1HYLA 3EQ0H 1O5AB 1ZPZA 5DP4A 4CHAC 2SGEE 1VJ9U 4ZH8A 3RMLH 3VXEH 3RU4D 1KY9A 4LXBH 3ZZ3A 1SGPE 2OTVA 3A7VA 2P3FH 3M7TA 2A0QB 3SJIA 1S6HA 1WU1A 2PKAB 3A8AA 3UFAA 2J95A 4U2WA 2KAIA 2VWMA 4GHQA 2G55A 3L3TA 1TA2A 4INKA 3TJUA 5FPTA 3GY6A 1YBWA 2C8YB 1A7SA 3D65E 3RMNH 4YM9A 4DY7B 4ABDA 2BD8A 2H9EH 1JIRA 1V2UT 4YZUA 3SNCA 5DO4H 4X6NA 1O2KA 1A1RA 1C1UH 4UDWH 4JYUH 1W0YH 2XRCA 1OYQA 2D2DA 5A8ZA 1G32B 3MTYA 1AFQC 1TBRH 7GCHG 4NWLA 1UTQA 3SU0A 2BY9X 3U9AH 1S85A 3BEIB 1AY6H 1THRH 1YCPH 3LONA 5J4QA 1BHXB 1SGNE 1ZLRA 4ISOA 2A5IA 2W7SA 2ZQ1A 2QCYA 1XUKA 4CRCA 3ZZAA 1FMGA 1IQEA 3BEFB 6LPRA 4XE4A 4BXSA 4O9VA 1D9IA 3KGPA 3ZZ9A 3DUXH 4X2YA 1T31A 3RXTA 1G2LA 1HPGA 1LVOA 1OWDA 2B9LA 4FUDA 4ZKNU 2ZIQH 3SUEA 4Y11E 4E7RG 4Y8YA 5A8XA 1GCTB 1QL9A 3SGQE