5T3IA

Cyan fluorescence protein soaked with selenourea for 5 min
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
228
Chain Sequence
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Selenourea: a convenient phasing vehicle for macromolecular X-ray crystal structures.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein
total genus 64
structure length 228
sequence length 229
ec nomenclature
pdb deposition date 2016-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 5t3iA00
3CB9A 5EXCI 4KGFA 2A53B 2Z6XA 4ZB1A 2A54B 4N3DA 3O78A 1F0BA 2H6VA 1YHHA 5EHUA 5HZUA 3M24A 3CBEA 4JGEA 3A8SA 1Q4BA 5EB6A 3CFFA 3P28A 1EMBA 2DUEA 2O2BA 2GX0A 3GL4A 3GJ1A 2OTBA 2B3QA 3DQ2A 3EVVA 3NT3A 5FVIA 4ORNA 2VAEA 3LF3A 3WCKA 3CGLA 4AR7A 2EMDA 2HGDA 3SG6A 2WSOA 4I2YA 4IK8A 2A56B 4ZF5A 4IK4A 4IZNA 4W7FA 5EXBA 3DQLA 2DUGA 2DUHA 2Q6PA 3LSAA 2VVHA 2OJKA 3DQJA 1MYWA 2O24A 5EB7A 4Q7RA 3ZTFA 2OGRA 2V4EC 4DXNA 3LVCA 3U8AA 4OQWA 4W72A 4RYSA 2G3DB 4NWSA 2RH7A 1S6ZA 3NF0A 4LQTA 1ZGQA 4JEOA 3EKHA 4JFGA 4R6BA 3DQFA 5AQBB 4TZGA 1EMMA 2GX2A 3U0MA 4LJBA 5T3IA 3AI5A 1EMKA 4EDOA 1XAEA 4PPLA 3UFZA 1KYRA 4OHSA 4W75A 2AWKA 1Z1PA 1Q4EA 4P1QA 4HQ8A 3M22A 4H3LA 2HFCA 4OJ0A 4TZAA 4DXQA 5DPJA 5HZTA 4LJDC 4IK5A 3PJ5A 2IB6A 3LA1A 3NEDA 3SG5A 3H1RA 3SVBA 4OGSA 4PPJA 3LVAA 4ZIOA 3U0KA 3MGFA 2YDZA 4L1IA 5H89A 3TMRA 3SVDA 1B9CA 3DQ1A 4GOBA 3E5VA 3U0LA 1HUYA 3GEXA 2VZXA 3SVRA 1RMPA 3NEZA 3SRYA 3EK4A 3NT9A 1YJ2A 4KGEA 2EMNA 2VVJA 4OY4A 3I19A 2OKYA 4W6NA 1W7UA 4EDSA 5LTQA 2DUFA 1W7SA 4W6MA 4KF5C 1MOVA 4J88A 3SVOA 1ZGPA 2HQKA 1KYPA 3DPXA 4AS8A 4ZFSA 4W6UA 2QU1A 1H4UA 5H87A 4XGYA 2DD9A 4W6DA 3SG2A 4EULA 4Q9WA 3WLCA 4RYWA 3CD1A 1UISA 4GF6B 3SSVA 3DQ8A 2A47A 2G5ZB 3VICA 4W73A 5DPIA 5DY6A 2WIQA 4PPKA 1QYQA 4Q7UA 4IK3A 4W6GA 3GJ2A 4KW4A 1YZWA 3K1KA 1EMLA 2BTJA 4DXIA 4J8AA 2PXWA 4Z4MA 4H3NA 1XMZA 3DQCA 2IE2A 5EJUA 2YFPA 2H8QA 3VK1A 3WLDA 4DXPA 5FVFA 2Z1OA 2AH8A 4GESB 3SVSA 3SSLA 4W6OA 3BXAA 2HCGA 3LS3A 1RM9A 1YHGA 3U0NA 3ST0A 4JF9A 3V3DA 2YE0A 3IP2A 4LJCA 2WHTA 3W1DA 2A46A 3DPZA 5DQBA 1XA9A 2PXSA 3KCSA 4U2VA 4W6LA 3EK8A 4IK9A 2AWMA 4Q9XA 4J89A 3EVUA 3ZUJA 1YFPA 3IR8A 2V4EB 3DQIA 2QT2A 1ZUXA 4W77A 3LF4B 3ZULA 1OXFA 2QLEA 3W1CA 3DQMA 3U8PA 2C9JA 4W6FA 4XOWA 4W6HA 3OGOA 3SSYA 4W6BA 1MOUA 4Q7TA 1Q4CA 4W6AA 2WHUA 5DQMA 5EXUA 3DQNA 4DXOA 2IOVA 3DQAA 4DKMA 1YHIA 2HQZA 2P4MA 4ZF3A 3EK7A 1EMFA 4R6DA 1YJFA 4L12A 3LVDA 5LTRA 3GB3A 2AWJA 5DTZA 3O77A 4W6KA 2DDDA 1EMGA 3SVUA 2V4EA 3SVEA 4DKNA 1EMAA 5F9GA 3CFAA 3SVNA 5KTGA 3EVRA 4W6SA 3ED8A 2HJOA 2GW3A 4KAGA 3RWAA 2FZUA 1F09A 2ZMWA 2WSNA 3BXBA 5BQLA 2QLHA 2WISA 3DQDA 5HZSA 5FVGA 2ARLA 3DQ4A 2Q57A 1EMEA 2FWQA 3DQEA 4ZF4A 2A50B 5HGEA 1JC1A 2G6EA 3AI4A 4KA9A 1HCJA 3E5TA 3H1OA 1RRXA 2H5RA 2QZ0A 4W7CA 3EKJA 2HRSA 4LQUA 2WHSA 4W7AA 2AHAA 2VVIA 3BX9A 4LW5A 2C9IA 3U8CA 4DXMA 3DQKA 4Z4KA 2QLGB 1QYFA 2H5OA 1Q73A 2FL1A 4RTCA 3PJBA 4HVFA 3ST2A 3VHTB 1Z1QA 2WURA 3EVPA 3CFHA 1H6RA 2A48A 4W7EA 1QYOA 1JBYA 4HQCA 5EBJA 3DQUA 2AWLA 3SSHA 2ZO7A 1OXDA 5J2OA 2ZO6A 3DQHA 4KF4A 5DTXA 2G6XA 4W6CA 4KF5A 1GFLA 2B3PA 2QLIA 4EN1A 3DQ9A 3SSKA 2QLGA 3S05A 3VHTA 4JC2A 1XSSA 4W7DA 2G16B 3DPWA 2HPWA 1BFPA 5DTYA 4ANJA 2H5QA 4ZINA 5FHVA 2DD7A 1JC0A 5HZOA 2Y0GA 2ZMUA 5BTTB 3OSRA 2H9WA 2OKWA 3DQ6A 4UTSA 1QXTA 2QRFA 3RWTA 2G6YA 5LK4A 4B30B 2POXA 2G2SB 1RMMA 5H88A 2Z6YA 4W76A 2OTEA 3ADFA 3DQ3A 1Q4AA 4BDUA 1JBZA 2IB5A 3TMTA 4W6TA 1W7TA 3P8UA 2VADA 3BXCA 1ZGOA 4HE4A 3AKOA 3E5WA 4HQ9A 4W6RA 1CV7A 5DPGA 4KW8A 3SG7A 5DPHA 5BTTA 1KYSA 2DDCA 1GGXA 4JRBA 2ICRA 2DUIA 3SSTA 3UG0A 1C4FA 1Q4DA 5DTLA 3ST4A 4W6IA 1RMOA 4ZBLA 1QY3A 2G3OA 1GL4A 4PFEA 4B30A 4P76A 3G9AA 4W7RA 1KP5A 1XQMA 2EMOA 5HW9A 3DQOA 4KEXA 4W69A 4XL5A 4L13A 4B5YA 3KCTA 4KPIA 4W74A 4H47A 4H3MA 5DU0A 4W6JA 1OXEA 2O29A 5DRGA 2Z6ZA 3SS0A 3ST3A 1EMCA 3SSPA 4EMQA 4LJDA 2GW4B 3ZUFA 3PIBA 3CD9A 3PJ7A 4XOVA 5DRFA 2YE1A 3DQ7A 5HBDA 2HGYA 3SG3A 3SV5A 4W7XA 4H48A 1G7KA 3DQ5A 4IK1A 5BT0A 2H5PA 4XVPA 3OSQA 2JADA 2A52B 5LTPA 3SVCA 4KW9A 4W6PA 3SG4A
chains in the Genus database with same CATH superfamily
3CB9A 5EXCI 4KGFA 2A53B 2Z6XA 4ZB1A 2A54B 4N3DA 3O78A 1F0BA 2H6VA 1YHHA 5EHUA 5HZUA 3M24A 3CBEA 4JGEA 3A8SA 1Q4BA 5EB6A 3CFFA 3P28A 1EMBA 2DUEA 2O2BA 2GX0A 3GL4A 3GJ1A 2OTBA 2B3QA 3DQ2A 3EVVA 3NT3A 5FVIA 4ORNA 2VAEA 3LF3A 3WCKA 3CGLA 4AR7A 2EMDA 2HGDA 3SG6A 2WSOA 4I2YA 4IK8A 2A56B 4ZF5A 4IK4A 4IZNA 4W7FA 5EXBA 3DQLA 2DUGA 2DUHA 2Q6PA 3LSAA 2VVHA 2OJKA 3DQJA 1MYWA 2O24A 5EB7A 4Q7RA 3ZTFA 2OGRA 2V4EC 4DXNA 3LVCA 3U8AA 4OQWA 4W72A 4RYSA 2G3DB 4NWSA 2RH7A 1S6ZA 3NF0A 4LQTA 1ZGQA 4JEOA 3EKHA 4JFGA 4R6BA 3DQFA 5AQBB 4TZGA 1EMMA 2GX2A 3U0MA 4LJBA 5T3IA 3AI5A 1EMKA 4EDOA 1XAEA 4PPLA 3UFZA 1KYRA 4OHSA 4W75A 2AWKA 1Z1PA 1Q4EA 4P1QA 4HQ8A 3M22A 4H3LA 2HFCA 4OJ0A 4TZAA 4DXQA 5DPJA 5HZTA 4LJDC 4IK5A 3PJ5A 2IB6A 3LA1A 3NEDA 3SG5A 3H1RA 3SVBA 4OGSA 4PPJA 3LVAA 4ZIOA 3U0KA 3MGFA 2YDZA 4L1IA 5H89A 3TMRA 3SVDA 1B9CA 3DQ1A 4GOBA 3E5VA 3U0LA 1HUYA 3GEXA 2VZXA 3SVRA 1RMPA 3NEZA 3SRYA 3EK4A 3NT9A 1YJ2A 4KGEA 2EMNA 2VVJA 4OY4A 3I19A 2OKYA 4W6NA 1W7UA 4EDSA 5LTQA 2DUFA 1W7SA 4W6MA 4KF5C 1MOVA 4J88A 3SVOA 1ZGPA 2HQKA 1KYPA 3DPXA 4AS8A 4ZFSA 4W6UA 2QU1A 1H4UA 5H87A 4XGYA 2DD9A 4W6DA 3SG2A 4EULA 4Q9WA 3WLCA 4RYWA 3CD1A 1UISA 4GF6B 3SSVA 3DQ8A 2A47A 2G5ZB 3VICA 4W73A 5DPIA 5DY6A 2WIQA 4PPKA 1QYQA 4Q7UA 4IK3A 4W6GA 3GJ2A 4KW4A 1YZWA 3K1KA 1EMLA 2BTJA 4DXIA 4J8AA 2PXWA 4Z4MA 4H3NA 1XMZA 3DQCA 2IE2A 5EJUA 2YFPA 2H8QA 3VK1A 3WLDA 4DXPA 5FVFA 2Z1OA 2AH8A 4GESB 3SVSA 3SSLA 4W6OA 3BXAA 2HCGA 3LS3A 1RM9A 1YHGA 3U0NA 3ST0A 4JF9A 3V3DA 2YE0A 3IP2A 4LJCA 2WHTA 3W1DA 2A46A 3DPZA 5DQBA 1XA9A 2PXSA 3KCSA 4U2VA 4W6LA 3EK8A 4IK9A 2AWMA 4Q9XA 4J89A 3EVUA 3ZUJA 1YFPA 3IR8A 2V4EB 3DQIA 2QT2A 1ZUXA 4W77A 3LF4B 3ZULA 1OXFA 2QLEA 3W1CA 3DQMA 3U8PA 2C9JA 4W6FA 4XOWA 4W6HA 3OGOA 3SSYA 4W6BA 1MOUA 4Q7TA 1Q4CA 4W6AA 2WHUA 5DQMA 5EXUA 3DQNA 4DXOA 2IOVA 3DQAA 4DKMA 1YHIA 2HQZA 2P4MA 4ZF3A 3EK7A 1EMFA 4R6DA 1YJFA 4L12A 3LVDA 5LTRA 3GB3A 2AWJA 5DTZA 3O77A 4W6KA 2DDDA 1EMGA 3SVUA 2V4EA 3SVEA 4DKNA 1EMAA 5F9GA 3CFAA 3SVNA 5KTGA 3EVRA 4W6SA 3ED8A 2HJOA 2GW3A 4KAGA 3RWAA 2FZUA 1F09A 2ZMWA 2WSNA 3BXBA 5BQLA 2QLHA 2WISA 3DQDA 5HZSA 5FVGA 2ARLA 3DQ4A 2Q57A 1EMEA 2FWQA 3DQEA 4ZF4A 2A50B 5HGEA 1JC1A 2G6EA 3AI4A 4KA9A 1HCJA 3E5TA 3H1OA 1RRXA 2H5RA 2QZ0A 4W7CA 3EKJA 2HRSA 4LQUA 2WHSA 4W7AA 2AHAA 2VVIA 3BX9A 4LW5A 2C9IA 3U8CA 4DXMA 3DQKA 4Z4KA 2QLGB 1QYFA 2H5OA 1Q73A 2FL1A 4RTCA 3PJBA 4HVFA 3ST2A 3VHTB 1Z1QA 2WURA 3EVPA 3CFHA 1H6RA 2A48A 4W7EA 1QYOA 1JBYA 4HQCA 5EBJA 3DQUA 2AWLA 3SSHA 2ZO7A 1OXDA 5J2OA 2ZO6A 3DQHA 4KF4A 5DTXA 2G6XA 4W6CA 4KF5A 1GFLA 2B3PA 2QLIA 4EN1A 3DQ9A 3SSKA 2QLGA 3S05A 3VHTA 4JC2A 1XSSA 4W7DA 2G16B 3DPWA 2HPWA 1BFPA 5DTYA 4ANJA 2H5QA 4ZINA 5FHVA 2DD7A 1JC0A 5HZOA 2Y0GA 2ZMUA 5BTTB 3OSRA 2H9WA 2OKWA 3DQ6A 4UTSA 1QXTA 2QRFA 3RWTA 2G6YA 5LK4A 4B30B 2POXA 2G2SB 1RMMA 5H88A 2Z6YA 4W76A 2OTEA 3ADFA 3DQ3A 1Q4AA 4BDUA 1JBZA 2IB5A 3TMTA 4W6TA 1W7TA 3P8UA 2VADA 3BXCA 1ZGOA 4HE4A 3AKOA 3E5WA 4HQ9A 4W6RA 1CV7A 5DPGA 4KW8A 3SG7A 5DPHA 5BTTA 1KYSA 2DDCA 1GGXA 4JRBA 2ICRA 2DUIA 3SSTA 3UG0A 1C4FA 1Q4DA 5DTLA 3ST4A 4W6IA 1RMOA 4ZBLA 1QY3A 2G3OA 1GL4A 4PFEA 4B30A 4P76A 3G9AA 4W7RA 1KP5A 1XQMA 2EMOA 5HW9A 3DQOA 4KEXA 4W69A 4XL5A 4L13A 4B5YA 3KCTA 4KPIA 4W74A 4H47A 4H3MA 5DU0A 4W6JA 1OXEA 2O29A 5DRGA 2Z6ZA 3SS0A 3ST3A 1EMCA 3SSPA 4EMQA 4LJDA 2GW4B 3ZUFA 3PIBA 3CD9A 3PJ7A 4XOVA 5DRFA 2YE1A 3DQ7A 5HBDA 2HGYA 3SG3A 3SV5A 4W7XA 4H48A 1G7KA 3DQ5A 4IK1A 5BT0A 2H5PA 4XVPA 3OSQA 2JADA 2A52B 5LTPA 3SVCA 4KW9A 4W6PA 3SG4A
chains in the Genus database with same CATH topology
3CB9A 5EXCI 4KGFA 2A53B 2Z6XA 4ZB1A 2A54B 4N3DA 3O78A 1F0BA 2H6VA 1YHHA 5EHUA 5HZUA 3M24A 3CBEA 4JGEA 3A8SA 1Q4BA 5EB6A 3CFFA 3P28A 1EMBA 2DUEA 2O2BA 2GX0A 3GL4A 3GJ1A 2OTBA 2B3QA 3DQ2A 3EVVA 3NT3A 5FVIA 4ORNA 2VAEA 3LF3A 3WCKA 3CGLA 4AR7A 2EMDA 2HGDA 3SG6A 2WSOA 4I2YA 4IK8A 2A56B 4ZF5A 4IK4A 4IZNA 4W7FA 5EXBA 3DQLA 2DUGA 2DUHA 2Q6PA 3LSAA 2VVHA 2OJKA 3DQJA 1MYWA 2O24A 5EB7A 4Q7RA 3ZTFA 2OGRA 2V4EC 4DXNA 3LVCA 3U8AA 4OQWA 4W72A 4RYSA 2G3DB 4NWSA 2RH7A 1S6ZA 3NF0A 4LQTA 1ZGQA 4JEOA 3EKHA 4JFGA 4R6BA 3DQFA 5AQBB 4TZGA 1EMMA 2GX2A 3U0MA 4LJBA 5T3IA 3AI5A 1EMKA 4EDOA 1XAEA 4PPLA 3UFZA 1KYRA 4OHSA 4W75A 2AWKA 1Z1PA 1Q4EA 4P1QA 4HQ8A 3M22A 4H3LA 2HFCA 4OJ0A 4TZAA 4DXQA 5DPJA 5HZTA 4LJDC 4IK5A 3PJ5A 2IB6A 3LA1A 3NEDA 3SG5A 3H1RA 3SVBA 4OGSA 4PPJA 3LVAA 4ZIOA 3U0KA 3MGFA 2YDZA 4L1IA 5H89A 3TMRA 3SVDA 1B9CA 3DQ1A 4GOBA 3E5VA 3U0LA 1HUYA 3GEXA 2VZXA 3SVRA 1RMPA 3NEZA 3SRYA 3EK4A 3NT9A 1YJ2A 4KGEA 2EMNA 2VVJA 4OY4A 3I19A 2OKYA 4W6NA 1W7UA 4EDSA 5LTQA 2DUFA 1W7SA 4W6MA 4KF5C 1MOVA 4J88A 3SVOA 1ZGPA 2HQKA 1KYPA 3DPXA 4AS8A 4ZFSA 4W6UA 2QU1A 1H4UA 5H87A 4XGYA 2DD9A 4W6DA 3SG2A 4EULA 4Q9WA 3WLCA 4RYWA 3CD1A 1UISA 4GF6B 3SSVA 3DQ8A 2A47A 2G5ZB 3VICA 4W73A 5DPIA 5DY6A 2WIQA 4PPKA 1QYQA 4Q7UA 4IK3A 4W6GA 3GJ2A 4KW4A 1YZWA 3K1KA 1EMLA 2BTJA 4DXIA 4J8AA 2PXWA 4Z4MA 4H3NA 1XMZA 3DQCA 2IE2A 5EJUA 2YFPA 2H8QA 3VK1A 3WLDA 4DXPA 5FVFA 2Z1OA 2AH8A 4GESB 3SVSA 3SSLA 4W6OA 3BXAA 2HCGA 3LS3A 1RM9A 1YHGA 3U0NA 3ST0A 4JF9A 3V3DA 2YE0A 3IP2A 4LJCA 2WHTA 3W1DA 2A46A 3DPZA 5DQBA 1XA9A 2PXSA 3KCSA 4U2VA 4W6LA 3EK8A 4IK9A 2AWMA 4Q9XA 4J89A 3EVUA 3ZUJA 1YFPA 3IR8A 2V4EB 3DQIA 2QT2A 1ZUXA 4W77A 3LF4B 3ZULA 1OXFA 2QLEA 3W1CA 3DQMA 3U8PA 2C9JA 4W6FA 4XOWA 4W6HA 3OGOA 3SSYA 4W6BA 1MOUA 4Q7TA 1Q4CA 4W6AA 2WHUA 5DQMA 5EXUA 3DQNA 4DXOA 2IOVA 3DQAA 4DKMA 1YHIA 2HQZA 2P4MA 4ZF3A 3EK7A 1EMFA 4R6DA 1YJFA 4L12A 3LVDA 5LTRA 3GB3A 2AWJA 5DTZA 3O77A 4W6KA 2DDDA 1EMGA 3SVUA 2V4EA 3SVEA 4DKNA 1EMAA 5F9GA 3CFAA 3SVNA 5KTGA 3EVRA 4W6SA 3ED8A 2HJOA 2GW3A 4KAGA 3RWAA 2FZUA 1F09A 2ZMWA 2WSNA 3BXBA 5BQLA 2QLHA 2WISA 3DQDA 5HZSA 5FVGA 2ARLA 3DQ4A 2Q57A 1EMEA 2FWQA 3DQEA 4ZF4A 2A50B 5HGEA 1JC1A 2G6EA 3AI4A 4KA9A 1HCJA 3E5TA 3H1OA 1RRXA 2H5RA 2QZ0A 4W7CA 3EKJA 2HRSA 4LQUA 2WHSA 4W7AA 2AHAA 2VVIA 3BX9A 4LW5A 2C9IA 3U8CA 4DXMA 3DQKA 4Z4KA 2QLGB 1QYFA 2H5OA 1Q73A 2FL1A 4RTCA 3PJBA 4HVFA 3ST2A 3VHTB 1Z1QA 2WURA 3EVPA 3CFHA 1H6RA 2A48A 4W7EA 1QYOA 1JBYA 4HQCA 5EBJA 3DQUA 2AWLA 3SSHA 2ZO7A 1OXDA 5J2OA 2ZO6A 3DQHA 4KF4A 5DTXA 2G6XA 4W6CA 4KF5A 1GFLA 2B3PA 2QLIA 4EN1A 3DQ9A 3SSKA 2QLGA 3S05A 3VHTA 4JC2A 1XSSA 4W7DA 2G16B 3DPWA 2HPWA 1BFPA 5DTYA 4ANJA 2H5QA 4ZINA 5FHVA 2DD7A 1JC0A 5HZOA 2Y0GA 2ZMUA 5BTTB 3OSRA 2H9WA 2OKWA 3DQ6A 4UTSA 1QXTA 2QRFA 3RWTA 2G6YA 5LK4A 4B30B 2POXA 2G2SB 1RMMA 5H88A 2Z6YA 4W76A 2OTEA 3ADFA 3DQ3A 1Q4AA 4BDUA 1JBZA 2IB5A 3TMTA 4W6TA 1W7TA 3P8UA 2VADA 3BXCA 1ZGOA 4HE4A 3AKOA 3E5WA 4HQ9A 4W6RA 1CV7A 5DPGA 4KW8A 3SG7A 5DPHA 5BTTA 1KYSA 2DDCA 1GGXA 4JRBA 2ICRA 2DUIA 3SSTA 3UG0A 1C4FA 1Q4DA 5DTLA 3ST4A 4W6IA 1RMOA 4ZBLA 1QY3A 2G3OA 1GL4A 4PFEA 4B30A 4P76A 3G9AA 4W7RA 1KP5A 1XQMA 2EMOA 5HW9A 3DQOA 4KEXA 4W69A 4XL5A 4L13A 4B5YA 3KCTA 4KPIA 4W74A 4H47A 4H3MA 5DU0A 4W6JA 1OXEA 2O29A 5DRGA 2Z6ZA 3SS0A 3ST3A 1EMCA 3SSPA 4EMQA 4LJDA 2GW4B 3ZUFA 3PIBA 3CD9A 3PJ7A 4XOVA 5DRFA 2YE1A 3DQ7A 5HBDA 2HGYA 3SG3A 3SV5A 4W7XA 4H48A 1G7KA 3DQ5A 4IK1A 5BT0A 2H5PA 4XVPA 3OSQA 2JADA 2A52B 5LTPA 3SVCA 4KW9A 4W6PA 3SG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CB9 A;  5EXC I;  4KGF A;  2A53 B;  2Z6X A;  4ZB1 A;  2A54 B;  4N3D A;  3O78 A;  1F0B A;  2H6V A;  1YHH A;  5EHU A;  5HZU A;  3M24 A;  3CBE A;  4JGE A;  3A8S A;  1Q4B A;  5EB6 A;  3CFF A;  3P28 A;  1EMB A;  2DUE A;  2O2B A;  2GX0 A;  3GL4 A;  3GJ1 A;  2OTB A;  2B3Q A;  3DQ2 A;  3EVV A;  3NT3 A;  5FVI A;  4ORN A;  2VAE A;  3LF3 A;  3WCK A;  3CGL A;  4AR7 A;  2EMD A;  2HGD A;  3SG6 A;  2WSO A;  4I2Y A;  4IK8 A;  2A56 B;  4ZF5 A;  4IK4 A;  4IZN A;  4W7F A;  5EXB A;  3DQL A;  2DUG A;  2DUH A;  2Q6P A;  3LSA A;  2VVH A;  2OJK A;  3DQJ A;  1MYW A;  2O24 A;  5EB7 A;  4Q7R A;  3ZTF A;  2OGR A;  2V4E C;  4DXN A;  3LVC A;  3U8A A;  4OQW A;  4W72 A;  4RYS A;  2G3D B;  4NWS A;  2RH7 A;  1S6Z A;  3NF0 A;  4LQT A;  1ZGQ A;  4JEO A;  3EKH A;  4JFG A;  4R6B A;  3DQF A;  5AQB B;  4TZG A;  1EMM A;  2GX2 A;  3U0M A;  4LJB A;  5T3I A;  3AI5 A;  1EMK A;  4EDO A;  1XAE A;  4PPL A;  3UFZ A;  1KYR A;  4OHS A;  4W75 A;  2AWK A;  1Z1P A;  1Q4E A;  4P1Q A;  4HQ8 A;  3M22 A;  4H3L A;  2HFC A;  4OJ0 A;  4TZA A;  4DXQ A;  5DPJ A;  5HZT A;  4LJD C;  4IK5 A;  3PJ5 A;  2IB6 A;  3LA1 A;  3NED A;  3SG5 A;  3H1R A;  3SVB A;  4OGS A;  4PPJ A;  3LVA A;  4ZIO A;  3U0K A;  3MGF A;  2YDZ A;  4L1I A;  5H89 A;  3TMR A;  3SVD A;  1B9C A;  3DQ1 A;  4GOB A;  3E5V A;  3U0L A;  1HUY A;  3GEX A;  2VZX A;  3SVR A;  1RMP A;  3NEZ A;  3SRY A;  3EK4 A;  3NT9 A;  1YJ2 A;  4KGE A;  2EMN A;  2VVJ A;  4OY4 A;  3I19 A;  2OKY A;  4W6N A;  1W7U A;  4EDS A;  5LTQ A;  2DUF A;  1W7S A;  4W6M A;  4KF5 C;  1MOV A;  4J88 A;  3SVO A;  1ZGP A;  2HQK A;  1KYP A;  3DPX A;  4AS8 A;  4ZFS A;  4W6U A;  2QU1 A;  1H4U A;  5H87 A;  4XGY A;  2DD9 A;  4W6D A;  3SG2 A;  4EUL A;  4Q9W A;  3WLC A;  4RYW A;  3CD1 A;  1UIS A;  4GF6 B;  3SSV A;  3DQ8 A;  2A47 A;  2G5Z B;  3VIC A;  4W73 A;  5DPI A;  5DY6 A;  2WIQ A;  4PPK A;  1QYQ A;  4Q7U A;  4IK3 A;  4W6G A;  3GJ2 A;  4KW4 A;  1YZW A;  3K1K A;  1EML A;  2BTJ A;  4DXI A;  4J8A A;  2PXW A;  4Z4M A;  4H3N A;  1XMZ A;  3DQC A;  2IE2 A;  5EJU A;  2YFP A;  2H8Q A;  3VK1 A;  3WLD A;  4DXP A;  5FVF A;  2Z1O A;  2AH8 A;  4GES B;  3SVS A;  3SSL A;  4W6O A;  3BXA A;  2HCG A;  3LS3 A;  1RM9 A;  1YHG A;  3U0N A;  3ST0 A;  4JF9 A;  3V3D A;  2YE0 A;  3IP2 A;  4LJC A;  2WHT A;  3W1D A;  2A46 A;  3DPZ A;  5DQB A;  1XA9 A;  2PXS A;  3KCS A;  4U2V A;  4W6L A;  3EK8 A;  4IK9 A;  2AWM A;  4Q9X A;  4J89 A;  3EVU A;  3ZUJ A;  1YFP A;  3IR8 A;  2V4E B;  3DQI A;  2QT2 A;  1ZUX A;  4W77 A;  3LF4 B;  3ZUL A;  1OXF A;  2QLE A;  3W1C A;  3DQM A;  3U8P A;  2C9J A;  4W6F A;  4XOW A;  4W6H A;  3OGO A;  3SSY A;  4W6B A;  1MOU A;  4Q7T A;  1Q4C A;  4W6A A;  2WHU A;  5DQM A;  5EXU A;  3DQN A;  4DXO A;  2IOV A;  3DQA A;  4DKM A;  1YHI A;  2HQZ A;  2P4M A;  4ZF3 A;  3EK7 A;  1EMF A;  4R6D A;  1YJF A;  4L12 A;  3LVD A;  5LTR A;  3GB3 A;  2AWJ A;  5DTZ A;  3O77 A;  4W6K A;  2DDD A;  1EMG A;  3SVU A;  2V4E A;  3SVE A;  4DKN A;  1EMA A;  5F9G A;  3CFA A;  3SVN A;  5KTG A;  3EVR A;  4W6S A;  3ED8 A;  2HJO A;  2GW3 A;  4KAG A;  3RWA A;  2FZU A;  1F09 A;  2ZMW A;  2WSN A;  3BXB A;  5BQL A;  2QLH A;  2WIS A;  3DQD A;  5HZS A;  5FVG A;  2ARL A;  3DQ4 A;  2Q57 A;  1EME A;  2FWQ A;  3DQE A;  4ZF4 A;  2A50 B;  5HGE A;  1JC1 A;  2G6E A;  3AI4 A;  4KA9 A;  1HCJ A;  3E5T A;  3H1O A;  1RRX A;  2H5R A;  2QZ0 A;  4W7C A;  3EKJ A;  2HRS A;  4LQU A;  2WHS A;  4W7A A;  2AHA A;  2VVI A;  3BX9 A;  4LW5 A;  2C9I A;  3U8C A;  4DXM A;  3DQK A;  4Z4K A;  2QLG B;  1QYF A;  2H5O A;  1Q73 A;  2FL1 A;  4RTC A;  3PJB A;  4HVF A;  3ST2 A;  3VHT B;  1Z1Q A;  2WUR A;  3EVP A;  3CFH A;  1H6R A;  2A48 A;  4W7E A;  1QYO A;  1JBY A;  4HQC A;  5EBJ A;  3DQU A;  2AWL A;  3SSH A;  2ZO7 A;  1OXD A;  5J2O A;  2ZO6 A;  3DQH A;  4KF4 A;  5DTX A;  2G6X A;  4W6C A;  4KF5 A;  1GFL A;  2B3P A;  2QLI A;  4EN1 A;  3DQ9 A;  3SSK A;  2QLG A;  3S05 A;  3VHT A;  4JC2 A;  1XSS A;  4W7D A;  2G16 B;  3DPW A;  2HPW A;  1BFP A;  5DTY A;  4ANJ A;  2H5Q A;  4ZIN A;  5FHV A;  2DD7 A;  1JC0 A;  5HZO A;  2Y0G A;  2ZMU A;  5BTT B;  3OSR A;  2H9W A;  2OKW A;  3DQ6 A;  4UTS A;  1QXT A;  2QRF A;  3RWT A;  2G6Y A;  5LK4 A;  4B30 B;  2POX A;  2G2S B;  1RMM A;  5H88 A;  2Z6Y A;  4W76 A;  2OTE A;  3ADF A;  3DQ3 A;  1Q4A A;  4BDU A;  1JBZ A;  2IB5 A;  3TMT A;  4W6T A;  1W7T A;  3P8U A;  2VAD A;  3BXC A;  1ZGO A;  4HE4 A;  3AKO A;  3E5W A;  4HQ9 A;  4W6R A;  1CV7 A;  5DPG A;  4KW8 A;  3SG7 A;  5DPH A;  5BTT A;  1KYS A;  2DDC A;  1GGX A;  4JRB A;  2ICR A;  2DUI A;  3SST A;  3UG0 A;  1C4F A;  1Q4D A;  5DTL A;  3ST4 A;  4W6I A;  1RMO A;  4ZBL A;  1QY3 A;  2G3O A;  1GL4 A;  4PFE A;  4B30 A;  4P76 A;  3G9A A;  4W7R A;  1KP5 A;  1XQM A;  2EMO A;  5HW9 A;  3DQO A;  4KEX A;  4W69 A;  4XL5 A;  4L13 A;  4B5Y A;  3KCT A;  4KPI A;  4W74 A;  4H47 A;  4H3M A;  5DU0 A;  4W6J A;  1OXE A;  2O29 A;  5DRG A;  2Z6Z A;  3SS0 A;  3ST3 A;  1EMC A;  3SSP A;  4EMQ A;  4LJD A;  2GW4 B;  3ZUF A;  3PIB A;  3CD9 A;  3PJ7 A;  4XOV A;  5DRF A;  2YE1 A;  3DQ7 A;  5HBD A;  2HGY A;  3SG3 A;  3SV5 A;  4W7X A;  4H48 A;  1G7K A;  3DQ5 A;  4IK1 A;  5BT0 A;  2H5P A;  4XVP A;  3OSQ A;  2JAD A;  2A52 B;  5LTP A;  3SVC A;  4KW9 A;  4W6P A;  3SG4 A; 
#chains in the Genus database with same CATH topology
 3CB9 A;  5EXC I;  4KGF A;  2A53 B;  2Z6X A;  4ZB1 A;  2A54 B;  4N3D A;  3O78 A;  1F0B A;  2H6V A;  1YHH A;  5EHU A;  5HZU A;  3M24 A;  3CBE A;  4JGE A;  3A8S A;  1Q4B A;  5EB6 A;  3CFF A;  3P28 A;  1EMB A;  2DUE A;  2O2B A;  2GX0 A;  3GL4 A;  3GJ1 A;  2OTB A;  2B3Q A;  3DQ2 A;  3EVV A;  3NT3 A;  5FVI A;  4ORN A;  2VAE A;  3LF3 A;  3WCK A;  3CGL A;  4AR7 A;  2EMD A;  2HGD A;  3SG6 A;  2WSO A;  4I2Y A;  4IK8 A;  2A56 B;  4ZF5 A;  4IK4 A;  4IZN A;  4W7F A;  5EXB A;  3DQL A;  2DUG A;  2DUH A;  2Q6P A;  3LSA A;  2VVH A;  2OJK A;  3DQJ A;  1MYW A;  2O24 A;  5EB7 A;  4Q7R A;  3ZTF A;  2OGR A;  2V4E C;  4DXN A;  3LVC A;  3U8A A;  4OQW A;  4W72 A;  4RYS A;  2G3D B;  4NWS A;  2RH7 A;  1S6Z A;  3NF0 A;  4LQT A;  1ZGQ A;  4JEO A;  3EKH A;  4JFG A;  4R6B A;  3DQF A;  5AQB B;  4TZG A;  1EMM A;  2GX2 A;  3U0M A;  4LJB A;  5T3I A;  3AI5 A;  1EMK A;  4EDO A;  1XAE A;  4PPL A;  3UFZ A;  1KYR A;  4OHS A;  4W75 A;  2AWK A;  1Z1P A;  1Q4E A;  4P1Q A;  4HQ8 A;  3M22 A;  4H3L A;  2HFC A;  4OJ0 A;  4TZA A;  4DXQ A;  5DPJ A;  5HZT A;  4LJD C;  4IK5 A;  3PJ5 A;  2IB6 A;  3LA1 A;  3NED A;  3SG5 A;  3H1R A;  3SVB A;  4OGS A;  4PPJ A;  3LVA A;  4ZIO A;  3U0K A;  3MGF A;  2YDZ A;  4L1I A;  5H89 A;  3TMR A;  3SVD A;  1B9C A;  3DQ1 A;  4GOB A;  3E5V A;  3U0L A;  1HUY A;  3GEX A;  2VZX A;  3SVR A;  1RMP A;  3NEZ A;  3SRY A;  3EK4 A;  3NT9 A;  1YJ2 A;  4KGE A;  2EMN A;  2VVJ A;  4OY4 A;  3I19 A;  2OKY A;  4W6N A;  1W7U A;  4EDS A;  5LTQ A;  2DUF A;  1W7S A;  4W6M A;  4KF5 C;  1MOV A;  4J88 A;  3SVO A;  1ZGP A;  2HQK A;  1KYP A;  3DPX A;  4AS8 A;  4ZFS A;  4W6U A;  2QU1 A;  1H4U A;  5H87 A;  4XGY A;  2DD9 A;  4W6D A;  3SG2 A;  4EUL A;  4Q9W A;  3WLC A;  4RYW A;  3CD1 A;  1UIS A;  4GF6 B;  3SSV A;  3DQ8 A;  2A47 A;  2G5Z B;  3VIC A;  4W73 A;  5DPI A;  5DY6 A;  2WIQ A;  4PPK A;  1QYQ A;  4Q7U A;  4IK3 A;  4W6G A;  3GJ2 A;  4KW4 A;  1YZW A;  3K1K A;  1EML A;  2BTJ A;  4DXI A;  4J8A A;  2PXW A;  4Z4M A;  4H3N A;  1XMZ A;  3DQC A;  2IE2 A;  5EJU A;  2YFP A;  2H8Q A;  3VK1 A;  3WLD A;  4DXP A;  5FVF A;  2Z1O A;  2AH8 A;  4GES B;  3SVS A;  3SSL A;  4W6O A;  3BXA A;  2HCG A;  3LS3 A;  1RM9 A;  1YHG A;  3U0N A;  3ST0 A;  4JF9 A;  3V3D A;  2YE0 A;  3IP2 A;  4LJC A;  2WHT A;  3W1D A;  2A46 A;  3DPZ A;  5DQB A;  1XA9 A;  2PXS A;  3KCS A;  4U2V A;  4W6L A;  3EK8 A;  4IK9 A;  2AWM A;  4Q9X A;  4J89 A;  3EVU A;  3ZUJ A;  1YFP A;  3IR8 A;  2V4E B;  3DQI A;  2QT2 A;  1ZUX A;  4W77 A;  3LF4 B;  3ZUL A;  1OXF A;  2QLE A;  3W1C A;  3DQM A;  3U8P A;  2C9J A;  4W6F A;  4XOW A;  4W6H A;  3OGO A;  3SSY A;  4W6B A;  1MOU A;  4Q7T A;  1Q4C A;  4W6A A;  2WHU A;  5DQM A;  5EXU A;  3DQN A;  4DXO A;  2IOV A;  3DQA A;  4DKM A;  1YHI A;  2HQZ A;  2P4M A;  4ZF3 A;  3EK7 A;  1EMF A;  4R6D A;  1YJF A;  4L12 A;  3LVD A;  5LTR A;  3GB3 A;  2AWJ A;  5DTZ A;  3O77 A;  4W6K A;  2DDD A;  1EMG A;  3SVU A;  2V4E A;  3SVE A;  4DKN A;  1EMA A;  5F9G A;  3CFA A;  3SVN A;  5KTG A;  3EVR A;  4W6S A;  3ED8 A;  2HJO A;  2GW3 A;  4KAG A;  3RWA A;  2FZU A;  1F09 A;  2ZMW A;  2WSN A;  3BXB A;  5BQL A;  2QLH A;  2WIS A;  3DQD A;  5HZS A;  5FVG A;  2ARL A;  3DQ4 A;  2Q57 A;  1EME A;  2FWQ A;  3DQE A;  4ZF4 A;  2A50 B;  5HGE A;  1JC1 A;  2G6E A;  3AI4 A;  4KA9 A;  1HCJ A;  3E5T A;  3H1O A;  1RRX A;  2H5R A;  2QZ0 A;  4W7C A;  3EKJ A;  2HRS A;  4LQU A;  2WHS A;  4W7A A;  2AHA A;  2VVI A;  3BX9 A;  4LW5 A;  2C9I A;  3U8C A;  4DXM A;  3DQK A;  4Z4K A;  2QLG B;  1QYF A;  2H5O A;  1Q73 A;  2FL1 A;  4RTC A;  3PJB A;  4HVF A;  3ST2 A;  3VHT B;  1Z1Q A;  2WUR A;  3EVP A;  3CFH A;  1H6R A;  2A48 A;  4W7E A;  1QYO A;  1JBY A;  4HQC A;  5EBJ A;  3DQU A;  2AWL A;  3SSH A;  2ZO7 A;  1OXD A;  5J2O A;  2ZO6 A;  3DQH A;  4KF4 A;  5DTX A;  2G6X A;  4W6C A;  4KF5 A;  1GFL A;  2B3P A;  2QLI A;  4EN1 A;  3DQ9 A;  3SSK A;  2QLG A;  3S05 A;  3VHT A;  4JC2 A;  1XSS A;  4W7D A;  2G16 B;  3DPW A;  2HPW A;  1BFP A;  5DTY A;  4ANJ A;  2H5Q A;  4ZIN A;  5FHV A;  2DD7 A;  1JC0 A;  5HZO A;  2Y0G A;  2ZMU A;  5BTT B;  3OSR A;  2H9W A;  2OKW A;  3DQ6 A;  4UTS A;  1QXT A;  2QRF A;  3RWT A;  2G6Y A;  5LK4 A;  4B30 B;  2POX A;  2G2S B;  1RMM A;  5H88 A;  2Z6Y A;  4W76 A;  2OTE A;  3ADF A;  3DQ3 A;  1Q4A A;  4BDU A;  1JBZ A;  2IB5 A;  3TMT A;  4W6T A;  1W7T A;  3P8U A;  2VAD A;  3BXC A;  1ZGO A;  4HE4 A;  3AKO A;  3E5W A;  4HQ9 A;  4W6R A;  1CV7 A;  5DPG A;  4KW8 A;  3SG7 A;  5DPH A;  5BTT A;  1KYS A;  2DDC A;  1GGX A;  4JRB A;  2ICR A;  2DUI A;  3SST A;  3UG0 A;  1C4F A;  1Q4D A;  5DTL A;  3ST4 A;  4W6I A;  1RMO A;  4ZBL A;  1QY3 A;  2G3O A;  1GL4 A;  4PFE A;  4B30 A;  4P76 A;  3G9A A;  4W7R A;  1KP5 A;  1XQM A;  2EMO A;  5HW9 A;  3DQO A;  4KEX A;  4W69 A;  4XL5 A;  4L13 A;  4B5Y A;  3KCT A;  4KPI A;  4W74 A;  4H47 A;  4H3M A;  5DU0 A;  4W6J A;  1OXE A;  2O29 A;  5DRG A;  2Z6Z A;  3SS0 A;  3ST3 A;  1EMC A;  3SSP A;  4EMQ A;  4LJD A;  2GW4 B;  3ZUF A;  3PIB A;  3CD9 A;  3PJ7 A;  4XOV A;  5DRF A;  2YE1 A;  3DQ7 A;  5HBD A;  2HGY A;  3SG3 A;  3SV5 A;  4W7X A;  4H48 A;  1G7K A;  3DQ5 A;  4IK1 A;  5BT0 A;  2H5P A;  4XVP A;  3OSQ A;  2JAD A;  2A52 B;  5LTP A;  3SVC A;  4KW9 A;  4W6P A;  3SG4 A; 
#chains in the Genus database with same CATH homology
 3CB9 A;  5EXC I;  4KGF A;  2A53 B;  2Z6X A;  4ZB1 A;  2A54 B;  4N3D A;  3O78 A;  1F0B A;  2H6V A;  1YHH A;  5EHU A;  5HZU A;  3M24 A;  3CBE A;  4JGE A;  3A8S A;  1Q4B A;  5EB6 A;  3CFF A;  3P28 A;  1EMB A;  2DUE A;  2O2B A;  2GX0 A;  3GL4 A;  3GJ1 A;  2OTB A;  2B3Q A;  3DQ2 A;  3EVV A;  3NT3 A;  5FVI A;  4ORN A;  2VAE A;  3LF3 A;  3WCK A;  3CGL A;  4AR7 A;  2EMD A;  2HGD A;  3SG6 A;  2WSO A;  4I2Y A;  4IK8 A;  2A56 B;  4ZF5 A;  4IK4 A;  4IZN A;  4W7F A;  5EXB A;  3DQL A;  2DUG A;  2DUH A;  2Q6P A;  3LSA A;  2VVH A;  2OJK A;  3DQJ A;  1MYW A;  2O24 A;  5EB7 A;  4Q7R A;  3ZTF A;  2OGR A;  2V4E C;  4DXN A;  3LVC A;  3U8A A;  4OQW A;  4W72 A;  4RYS A;  2G3D B;  4NWS A;  2RH7 A;  1S6Z A;  3NF0 A;  4LQT A;  1ZGQ A;  4JEO A;  3EKH A;  4JFG A;  4R6B A;  3DQF A;  5AQB B;  4TZG A;  1EMM A;  2GX2 A;  3U0M A;  4LJB A;  5T3I A;  3AI5 A;  1EMK A;  4EDO A;  1XAE A;  4PPL A;  3UFZ A;  1KYR A;  4OHS A;  4W75 A;  2AWK A;  1Z1P A;  1Q4E A;  4P1Q A;  4HQ8 A;  3M22 A;  4H3L A;  2HFC A;  4OJ0 A;  4TZA A;  4DXQ A;  5DPJ A;  5HZT A;  4LJD C;  4IK5 A;  3PJ5 A;  2IB6 A;  3LA1 A;  3NED A;  3SG5 A;  3H1R A;  3SVB A;  4OGS A;  4PPJ A;  3LVA A;  4ZIO A;  3U0K A;  3MGF A;  2YDZ A;  4L1I A;  5H89 A;  3TMR A;  3SVD A;  1B9C A;  3DQ1 A;  4GOB A;  3E5V A;  3U0L A;  1HUY A;  3GEX A;  2VZX A;  3SVR A;  1RMP A;  3NEZ A;  3SRY A;  3EK4 A;  3NT9 A;  1YJ2 A;  4KGE A;  2EMN A;  2VVJ A;  4OY4 A;  3I19 A;  2OKY A;  4W6N A;  1W7U A;  4EDS A;  5LTQ A;  2DUF A;  1W7S A;  4W6M A;  4KF5 C;  1MOV A;  4J88 A;  3SVO A;  1ZGP A;  2HQK A;  1KYP A;  3DPX A;  4AS8 A;  4ZFS A;  4W6U A;  2QU1 A;  1H4U A;  5H87 A;  4XGY A;  2DD9 A;  4W6D A;  3SG2 A;  4EUL A;  4Q9W A;  3WLC A;  4RYW A;  3CD1 A;  1UIS A;  4GF6 B;  3SSV A;  3DQ8 A;  2A47 A;  2G5Z B;  3VIC A;  4W73 A;  5DPI A;  5DY6 A;  2WIQ A;  4PPK A;  1QYQ A;  4Q7U A;  4IK3 A;  4W6G A;  3GJ2 A;  4KW4 A;  1YZW A;  3K1K A;  1EML A;  2BTJ A;  4DXI A;  4J8A A;  2PXW A;  4Z4M A;  4H3N A;  1XMZ A;  3DQC A;  2IE2 A;  5EJU A;  2YFP A;  2H8Q A;  3VK1 A;  3WLD A;  4DXP A;  5FVF A;  2Z1O A;  2AH8 A;  4GES B;  3SVS A;  3SSL A;  4W6O A;  3BXA A;  2HCG A;  3LS3 A;  1RM9 A;  1YHG A;  3U0N A;  3ST0 A;  4JF9 A;  3V3D A;  2YE0 A;  3IP2 A;  4LJC A;  2WHT A;  3W1D A;  2A46 A;  3DPZ A;  5DQB A;  1XA9 A;  2PXS A;  3KCS A;  4U2V A;  4W6L A;  3EK8 A;  4IK9 A;  2AWM A;  4Q9X A;  4J89 A;  3EVU A;  3ZUJ A;  1YFP A;  3IR8 A;  2V4E B;  3DQI A;  2QT2 A;  1ZUX A;  4W77 A;  3LF4 B;  3ZUL A;  1OXF A;  2QLE A;  3W1C A;  3DQM A;  3U8P A;  2C9J A;  4W6F A;  4XOW A;  4W6H A;  3OGO A;  3SSY A;  4W6B A;  1MOU A;  4Q7T A;  1Q4C A;  4W6A A;  2WHU A;  5DQM A;  5EXU A;  3DQN A;  4DXO A;  2IOV A;  3DQA A;  4DKM A;  1YHI A;  2HQZ A;  2P4M A;  4ZF3 A;  3EK7 A;  1EMF A;  4R6D A;  1YJF A;  4L12 A;  3LVD A;  5LTR A;  3GB3 A;  2AWJ A;  5DTZ A;  3O77 A;  4W6K A;  2DDD A;  1EMG A;  3SVU A;  2V4E A;  3SVE A;  4DKN A;  1EMA A;  5F9G A;  3CFA A;  3SVN A;  5KTG A;  3EVR A;  4W6S A;  3ED8 A;  2HJO A;  2GW3 A;  4KAG A;  3RWA A;  2FZU A;  1F09 A;  2ZMW A;  2WSN A;  3BXB A;  5BQL A;  2QLH A;  2WIS A;  3DQD A;  5HZS A;  5FVG A;  2ARL A;  3DQ4 A;  2Q57 A;  1EME A;  2FWQ A;  3DQE A;  4ZF4 A;  2A50 B;  5HGE A;  1JC1 A;  2G6E A;  3AI4 A;  4KA9 A;  1HCJ A;  3E5T A;  3H1O A;  1RRX A;  2H5R A;  2QZ0 A;  4W7C A;  3EKJ A;  2HRS A;  4LQU A;  2WHS A;  4W7A A;  2AHA A;  2VVI A;  3BX9 A;  4LW5 A;  2C9I A;  3U8C A;  4DXM A;  3DQK A;  4Z4K A;  2QLG B;  1QYF A;  2H5O A;  1Q73 A;  2FL1 A;  4RTC A;  3PJB A;  4HVF A;  3ST2 A;  3VHT B;  1Z1Q A;  2WUR A;  3EVP A;  3CFH A;  1H6R A;  2A48 A;  4W7E A;  1QYO A;  1JBY A;  4HQC A;  5EBJ A;  3DQU A;  2AWL A;  3SSH A;  2ZO7 A;  1OXD A;  5J2O A;  2ZO6 A;  3DQH A;  4KF4 A;  5DTX A;  2G6X A;  4W6C A;  4KF5 A;  1GFL A;  2B3P A;  2QLI A;  4EN1 A;  3DQ9 A;  3SSK A;  2QLG A;  3S05 A;  3VHT A;  4JC2 A;  1XSS A;  4W7D A;  2G16 B;  3DPW A;  2HPW A;  1BFP A;  5DTY A;  4ANJ A;  2H5Q A;  4ZIN A;  5FHV A;  2DD7 A;  1JC0 A;  5HZO A;  2Y0G A;  2ZMU A;  5BTT B;  3OSR A;  2H9W A;  2OKW A;  3DQ6 A;  4UTS A;  1QXT A;  2QRF A;  3RWT A;  2G6Y A;  5LK4 A;  4B30 B;  2POX A;  2G2S B;  1RMM A;  5H88 A;  2Z6Y A;  4W76 A;  2OTE A;  3ADF A;  3DQ3 A;  1Q4A A;  4BDU A;  1JBZ A;  2IB5 A;  3TMT A;  4W6T A;  1W7T A;  3P8U A;  2VAD A;  3BXC A;  1ZGO A;  4HE4 A;  3AKO A;  3E5W A;  4HQ9 A;  4W6R A;  1CV7 A;  5DPG A;  4KW8 A;  3SG7 A;  5DPH A;  5BTT A;  1KYS A;  2DDC A;  1GGX A;  4JRB A;  2ICR A;  2DUI A;  3SST A;  3UG0 A;  1C4F A;  1Q4D A;  5DTL A;  3ST4 A;  4W6I A;  1RMO A;  4ZBL A;  1QY3 A;  2G3O A;  1GL4 A;  4PFE A;  4B30 A;  4P76 A;  3G9A A;  4W7R A;  1KP5 A;  1XQM A;  2EMO A;  5HW9 A;  3DQO A;  4KEX A;  4W69 A;  4XL5 A;  4L13 A;  4B5Y A;  3KCT A;  4KPI A;  4W74 A;  4H47 A;  4H3M A;  5DU0 A;  4W6J A;  1OXE A;  2O29 A;  5DRG A;  2Z6Z A;  3SS0 A;  3ST3 A;  1EMC A;  3SSP A;  4EMQ A;  4LJD A;  2GW4 B;  3ZUF A;  3PIB A;  3CD9 A;  3PJ7 A;  4XOV A;  5DRF A;  2YE1 A;  3DQ7 A;  5HBD A;  2HGY A;  3SG3 A;  3SV5 A;  4W7X A;  4H48 A;  1G7K A;  3DQ5 A;  4IK1 A;  5BT0 A;  2H5P A;  4XVP A;  3OSQ A;  2JAD A;  2A52 B;  5LTP A;  3SVC A;  4KW9 A;  4W6P A;  3SG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...