5T3JA

Histidinol phosphate phosphatase(hpp) soaked with selenourea for 10 min
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
268
structure length
257
Chain Sequence
PPHQLNHFSDVANKAANAAGDVIRKYFRKSPVTIADQSAEEAMVSVILDNFPSHAVYGEEKGWRCKQDSADYVWVLDPIDGTKSFITGKPLFGTLIALLQNGTPILGIIDQPVLKERWIGITGKRTTLNGQEVSTRTCADLSQAYLYTTSPHLFSGDAEEAFIRVRDKVKIPLYGCDCYAYALLSSGFVDLVVESGLKPYDFLALIPVIEGSGGVITDWKGHQLRWEASPLSIATSFNVVAAGDKQIHQQALDSLQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selenourea: a convenient phasing vehicle for macromolecular X-ray crystal structures.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Hydrolase
molecule keywords Inositol monophosphatase
total genus 81
structure length 257
sequence length 268
ec nomenclature
pdb deposition date 2016-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5t3jA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5t3jA02
1FPKA 3KC1A 5EQ8A 5T3JA 2Y5LA 4GWXA 1FPEA 1NUZA 3T0JA 3A29A 1FJ9A 1FPGA 5ET8A 2WBBA 2DDKA 1NV3A 4MJOA 3LUZA 3B8BA 5ESYA 1IMDA 5A5LA 1LEVA 1NUXA 4H45A 2CZHA 5ET7A 1INPA 1CNQA 1YXIA 2QVUA 1LBVA 1BK4A 3ROJA 4GBVA 1SPIA 4HXVA 4I3EA 1RDYA 4H46A 4GBWA 1G0IA 4HE2A 4IR8A 1IMFA 1NV4A 4G61A 2OWZA 1KZ8A 1RDZA 2FIEA 1K9ZA 2P3VA 1NI9A 1NUWA 1LBZA 1FBCA 1G0HA 2R8TA 4I40A 1FBFA 4O7IA 1AWBA 1FRPA 1FBEA 2Q8MA 5EQ7A 3IFCA 4KXPA 4N81A 5ET6A 1FPDA 2JJKA 1D9QA 2QVVA 1LBWA 1FBGA 4GX4A 1FPJA 1KA0A 1Q9DA 1FSAA 3FBPA 1IMEA 1XI6A 4AS5A 2FHYA 1LBYA 2PCRA 1EYJA 1YZ0A 1FTAA 5EQAA 5ET5A 1EYIA 1FPIA 1KA1A 2WEFA 4GWUA 1FJ6A 1NV5A 5I3SA 1FPBA 2BJIA 3RYDA 4HE1A 3KC0A 1QGXA 3D1RA 1NV1A 1DBZA 2CZKA 4GX6A 1FPLA 4QXDA 4GWSA 2Q74A 5IZ1A 1FBDA 1FPFA 4PTKA 4GWWA 1RDXA 1DK4A 4GX3A 2OX3A 5IZ3B 3QMFA 2FBPA 1JP4A 5FBPA 4FBPA 3LV0A 3IFAA 3KBZA 4I3YA 1NV6A 1NV2A 3BIGA 5DW8A 1IMCA 3RPLB 5IZ3A 2FIXA 5EYGA 5EYHA 2GQ1A 2QVRA 5F24A 1EYKA 1IMBA 1NUYA 1K9YA 1NV7A 4HE0A 1DCUA 1NV0A 1VDWA 2WBDA 2FVZA 2P3NA 2Y5KA 1YYZA 1LBXA 4GWYA 3RPLA 2CZIA 3BIHA 1IMAA 2F3BA 1FBHA 1FBPA 4GWZA 4AS4A 2QFLA 5LDZA 2VT5A 5J16A 2F3DA 5EQ9A 2HHMA
chains in the Genus database with same CATH superfamily
1A54A 1H3DA 1FQCA 1PEBA 2DDKA 3ILUB 1I6QA 4ND9A 1H44A 1SPIA 5LTCA 1IZ1A 1MPCA 4U22A 1RDZA 3W15C 3QUFA 1NI9A 1BKAA 3FVKA 1FRPA 4MMPA 1Y3PA 2AL4A 1PB7A 4KXPA 2DVCA 4YMBA 4HCYA 2JJKA 4OVQA 2Q9TA 1LB9A 4PGPA 1VR5A 1KA0A 4KQPA 2DE3A 4JVDA 1Z7NE 3MP8A 1B5HA 3FXRA 2R9JA 3TQLA 4KI0E 2Q2CA 3VLUA 1FQAA 5H8QB 4KR5A 1LAHE 2DXYA 4FE8A 1MXWA 5CMCA 2MKZA 3PUWE 2I49A 4IB2A 3KZGA 4NMYA 3OO6A 1BTJA 3PV0E 3Q25A 3UK4A 3TPAA 3ISPA 2RF1A 4BDLA 3IAZA 4MLQA 3HHGA 2ALUA 2O7UA 4EXLA 3VVFA 5EYHA 1MG1A 1MXYA 3TYHA 2THIA 3D4GA 4XTCQ 1N3WA 1H76A 5ICTA 1NL5A 2LAOA 4HCWA 1MY3A 2DQVA 1J1NA 5H8NB 1XT8A 2DP8A 2XX7A 3OEKA 3VE1B 2OWTA 2HHMA 4KPTA 4E0WA 3T9XB 3TTLA 2F7AA 1MXUA 5ESYA 2G93A 4P11A 3VV5A 3QUJA 4NX1A 1SYIA 3C34A 3USDA 1YXIA 3ROJA 4QSEA 1SVXB 5FHOA 1GR2A 2H25A 3ECRA 3UORA 1K9ZA 1XHYA 4I40A 1Y9UA 2F7BA 1AL3A 3RQTA 4LUBA 2ZNSA 5I57B 1VFDA 2W7YA 3B50A 2HQ0A 3BKIB 3FASA 4I62A 5DVIA 2F5XA 4G2ZA 1POTA 1MQIA 3K6XA 1YZ0A 3OSRA 2OCUA 5FHMA 5KCJB 3S4UA 4XIGQ 4KYSA 3TCFA 1OQHA 5ICQA 3D1RA 4OTEA 1M5EA 4MAGA 5I56B 1A40A 2XX8A 4PAKA 2QS3A 4YKPA 1DOTA 2NWJA 4ZEIA 3V83A 2H98A 2E1SA 3G3FA 3HPIA 3IFAA 1MRPA 4P56A 4RK2A 2UVHA 3IJXB 1YPNA 1MQGA 3HCQA 4MHFA 1IMBA 4PFRA 1NV7A 4C1UA 2XXPA 4IO2A 4N4UA 3MVZA 4OFOA 2Z8DA 3M3KA 1XC1A 4OFJA 3ZKKA 5A5XB 4H8JA 4K3FA 3UIFA 3LUZA 3KBRA 1NUXA 2IA4A 3WAEA 3MZ9A 3IORA 1ZBMA 1ZMGA 4F2QA 4F22A 1FQEA 5EHMA 2YJPA 4O7IA 3EPEA 4G68B 4MEVA 4NF6B 1US5A 4RK9A 4GL0A 3I5OA 1B3LA 4KCCA 3FVGA 1JVXA 2XWIA 1R9LA 4E0XA 4NF0A 4BDQA 2H99A 4JVCA 1N04A 1RKMA 1NV5A 3T96B 3K2DA 1FPBA 1P1UA 1UTHB 1EZOA 4LATA 1P1WA 4ELRA 4EQ9A 1JEUA 3HV1A 5DTBA 1US4A 4JWXA 1DPEA 1SW1A 2DVZA 4PE3A 4JWOA 4NEDA 3M3FA 3PPQA 1VSOA 1P1OA 3RTWB 3H3GA 3QMFA 3FJGA 1TT1A 4ZEDA 4PBHA 2F78A 3BIGA 3GXAA 3SETA 2O69A 4ZEKA 3SDFA 4DZ1A 3G3GA 2V3QA 1VDWA 2I4BA 5TPAB 4XKQA 4ELOA 1ANFA 1Y1MA 3C35A 2DWHA 4N07A 4QFPA 2Y7RA 3O28A 4DXCA 5EQ9A 3PTYA 2I0CA 3MZBA 5L9SA 3FVNA 1T0KA 4IY6A 4PF6A 4WKMA 3G3JA 1B6HA 3T66A 4GBVA 1AH5A 4GBWA 4HE2A 4GFRA 1PBPA 1IMFA 3KJ7A 2FIEA 3EHUA 2P3VA 1FBFA 1VE4A 3U94A 1VFEA 3GZGA 3FV2A 1RYXA 4H0WA 2YLNA 2NXOA 1FPJA 2HXWA 3RTFB 3LBSA 2NUVA 4QFNA 1I6BA 4GLIA 1KA1A 1NNKA 5L9OA 2QPQA 5M2VA 1TFAA 3T9UA 3RYDA 1B7ZA 3KOTA 3U65A 3LR1A 1MXZA 3FJMA 3THIA 2F35A 4LVQA 1S9TA 2FYIA 4EUOA 1QULA 4R74A 4DLDA 2O1MA 5EHSA 3FIRA 2CEYA 4OESA 1Y4CA 1OLAA 3F11A 2FA7A 4PDDA 2ONSA 3KG2A 4OERA 3CFXA 4PFWA 4PFTA 5DYHA 1OVTA 2I6EA 3PUVE 3PUZE 4OFLA 1IMAA 2QS1A 3T1BA 1R6ZA 1B7UA 5T3JA 2VP1A 5I7IA 3IO4A 3QSLA 4YB5A 4U4XA 2KLFA 4P47A 1NV3A 2XD3A 2KR0A 2PT1A 2UVJA 3TAJA 1CNQA 4GD5A 1MXVA 1Q35A 1A99A 3DP6A 3Q26A 1YCJA 4M1VA 4ONYA 2ONKE 2XXIA 1JEVA 2PBWA 3VVDA 1FPDA 3K6UA 2QVVA 4NF8B 5DVJA 3K1PA 3MQ9A 4TLLB 2PCRA 4NQ8A 5ET5A 2ONRA 2ZMBA 3BFTA 3EF7A 3LSFB 1NNPA 1B3GA 1DBZA 3KOSA 1A55A 4YKKA 4YZZA 4JB7A 4R2FA 3QXMA 1RDXA 2PX1A 4XXUA 3CFLA 1SI1A 5H8FA 5AA3A 3T22A 1FQDA 3KBZA 4OVTA 1B46A 5DW8A 1H45A 4PFUA 1IMCA 3RPLB 5IKBA 1UQWA 4XF5A 2XXXA 3MPLA 2F36A 1HSEA 4PAFA 2FVZA 4XKRA 3OD7A 3E79A 3N6UA 3K6WA 2OLBA 3R26A 3EHSA 5J16A 3VFJA 1FPKA 3KC1A 2O6AA 4QBAA 2PVUA 1FCKA 1B1HA 1FPEA 1LAGE 4PETA 1ZU0A 4QFKA 4JVIA 4TQUQ 1R9QA 5FTIA 3IB2A 2WX9A 4FAJA 4KYDA 2UYEA 4GQOA 4FJPA 3VDFA 2RCAA 3RGYA 2ZNUA 1HSJA 2X7PA 1B1XA 4LP2B 4R6YA 2XXHA 1FTKA 4PP0A 5AA2D 1JNFA 2I0BA 3KN8A 3MBPA 3BFUA 4P8BA 2B65A 1QW0A 4UA8A 1FSAA 3FBPA 5I5PA 3ILTB 4TOZA 2OJTA 4IGTA 1FQBA 1N0TA 3VLVA 4FEBA 1SW4A 2ZYKA 3P7IA 4QXDA 2Q74A 1EZ9A 2XXKA 4NWDA 3QK6A 1MDQA 3K1MA 4KFQA 3IR1A 3JYRA 4PCDA 1B9JA 1N3XA 1QVSA 3IOTA 3TFLA 1I6AA 2Z8EA 3QAXA 3SERA 1UIVA 2F34A 2F6GA 4BDNA 2BJJX 1P1QA 4YB6A 3ZSFA 2P3NA 3S2VA 4GWYA 1Q1KA 2A5SA 2M8CA 4KD5A 1FBPA 3MUQA 1GGGA 4NE4A 4PFBA 3EHTA 4RA1A 1SW5A 4I1DA 5EQ8A 5F1QA 3DP8A 2AL5A 2D5WA 3MVYA 4DE8A 3SZPA 1NFTA 4I8CA 1LEVA 4F2OA 1UTHA 3O9PA 1AOVA 4F1YA 4RJZA 4DIGA 1OMPA 1KZ8A 3SESA 4G8HA 3FUZA 1G0HA 2R8TA 4WEDA 3ODBA 1SW2A 1H43A 4ELPA 3IFCA 3R7XA 1ZJLA 4G8MA 1USYE 4L17A 1WDNA 2DWJA 5AA4B 1A7LA 1XOCA 1FBGA 1PDAA 1QKAA 3V8XB 3SKPA 4NN3A 5ITOA 4F1UA 4X1DA 2ZYMA 2B3BA 2HAUA 3ONMA 5EQAA 1EH3A 2WEFA 2O84X 4H67A 5I3SA 1MPDA 3A3UA 4FORA 3PGFA 3V5AA 4HE1A 3C4MA 3ZKLA 1QGXA 1JW5A 2CZKA 3A3CA 1LCFA 2OPDA 3E13X 1MQHA 3VLWA 3U93A 5AA4A 2QMXA 5I56A 2ZXTA 2B4LA 4ELQA 4F1VA 3MW0A 1Y1ZA 1B0LA 3OELA 2GH9A 3TEPA 4OYVA 2YPNA 3C36A 4BLAA 1DSNA 2QMWA 1B51A 3CG1A 1YAEA 3TTKA 4OWDA 1M5DA 3TTNA 4BDMA 3PMXA 2UVIA 4MNIA 3PPOA 2V3TA 4R73A 4HS7A 2B3FA 1NUZA 3B8BA 4NHBA 3OENA 3S9EA 2PT2A 2GRVA 1BK4A 2XXQA 3K00A 4P1LA 3Q29A 3SEYA 3IOVA 1AIVA 1G0IA 2R71A 4P9KA 3RLFE 2DYXA 3PUYE 2V84A 1B7HA 1FBCA 3LUYA 1B58A 2XWKA 4PF8A 4FEDA 4EXKA 5ET6A 4NF4A 4U4SA 1R1NA 2Q2AA 1LFIA 5I57A 2VD2A 4QFOA 2OZZA 4RYAA 2RKMA 4P0GA 1FPIA 2VOZA 3IO6A 1BP5A 1FJ6A 4OEUA 5DVFA 2HXRA 1II5A 3O29A 2A5TA 2F6PA 4AB6A 4BDRA 3V89B 1LCTA 4GIZA 4GWWA 1B05A 2B4MA 2DE2A 4NF4B 3S9MC 3MWBA 2OK2A 4DCXA 2DWAA 1IITA 5H8HB 1SBPA 4YB7A 3WAFA 1LAXA 5CBSA 1S7YA 2O7IA 3IX1A 2XWVA 1YTVA 1CE2A 2IEEA 4F3PA 1PC3A 3U72A 3OEMA 4G77A 3JV9A 5AE4A 4OZ9A 5JEIA 4YICA 3S9LC 2KQZA 5BUUA 1TXFA 2WBBA 3C32A 1FW0A 3MSTA 2L5VA 3TZAA 4LZ7A 3L6GA 2ZZVA 2Y84A 4IO4A 4RY1A 2X7QA 2PFYA 3SEXA 1ZIUA 3TODA 3I3VA 4KHZE 2PYYA 3N26A 1UTBA 4UACA 2O68A 1IXHA 1OIBA 4C1TA 4P1EA 3PD8A 2FHYA 3PD9A 4PC9A 1IXGA 1QJMA 2E0SA 1FPLA 3EKIA 3OMBA 2DXRA 1FBDA 4OVJA 5LOMA 5J1DA 3OOAA 4Z7EA 3CR9A 4JSDA 4JBZA 4LONB 1MY2A 5BWJA 1AMFA 5ELVA 1NV2A 4N6DA 1IXCA 4OMBA 4POWA 3MP6A 4PQJA 1S50A 5K2YA 5KDTB 5F24A 4Q5TA 3A09A 1JQFA 5FHNA 2NVUB 4RNSA 1Y3NA 5I2KA 4IY5A 4U23A 3T9HB 5DEXB 1Y20A 3RT6B 3K6VA 3T93B 5TPAA 2D21A 3GBBA 2XXUA 2I3VA 1FTLA 2GHBA 4RPNA 2CZLA 5H8SA 5ET8A 2I3WA 4GWOA 2REGA 4DI4B 1DMBA 2OPEA 1B0HA 3B6TA 1MM6A 3N6TA 4ZZEA 3UN6A 4F3SA 1LFHA 1NUWA 1ATGA 2Q8MA 4R2BA 5DEXA 1TFDA 2D3IA 2VPNA 2XXVA 1D3KA 5H8NA 3OO8A 3G3KA 3ZS6A 1O63A 4Q0CA 3KGCA 3CVGA 2ZZWA 4LQ2A 1B4ZA 1Q9DA 2VD3A 1XI6A 4F3BA 4X1BA 1MQDA 4IO7A 4ZE8A 4F18A 1FTAA 4DCYA 2HZLA 4GWUA 4H5GA 4FECA 3CHGA 2BJIA 3HO7A 3KC0A 5I59A 4GOTA 1KWHA 4EF2A 1D9YA 3E9XA 4YU0A 3TTMA 3MVWA 1JP4A 1RYOA 3LV0A 5TU0A 4NGUA 2Q89A 3FD3A 4EF1A 4LN5A 3VXCA 3B7DA 2UXAA 3TMGA 5HM4B 3H4ZA 5H8HA 5ITPA 3FGSA 1EYKA 2I4CA 5KCJA 5I59B 2XXYA 2CZIA 4U1OA 3TCGA 4ISUA 3C33A 4NTLA 2WYPA 4ZEFA 5AA2B 4ZDMA 4N91A 4MH5A 1NH7A 1FJ9A 1B3FA 2Z22A 4KCDA 1JW1A 2VHAA 4DDDA 4DXBA 4O3BA 2QSXA 3KSXA 5CMKA 2O1LA 3PMVA 3DP4A 3CFZA 2P2AA 4N8YA 4QRZA 4ZECA 1B32A 3MZ1A 4H6DA 2VGQA 3HHFA 1SYHA 3PU5A 4AS5A 3K4UA 4N17A 3LSLA 3IOUA 1QUJA 3MAMA 4ZE9A 4U1ZA 4X04A 5CRYA 4NF8A 1OQGA 1UTBB 3G7WA 4AB5A 2XD2A 3R6UA 4O94A 1NH8A 2X26A 3TTRA 2FNCA 3DLNA 3K02A 3FXQA 1Z7ME 4MX6A 4OANA 4HW8A 3KJTA 2OX3A 4Q8RA 3IB0A 4FBPA 4G68A 4F29A 4R9GA 3CSBA 5FTHA 3RPWA 3O6GA 1WVJA 2PFZA 3KFMA 4OQOA 2H4IA 2GQ1A 2QVRA 2I48A 1CB6A 1K9YA 5CM6A 2WBDA 3RPLA 2HCAA 4GWZA 4YMAA 5I58B 5CMMA 2VT5A 2ESNA 4LA9A 4P0IA 3U92A 5DT6A 3Q28A 2Y5LA 3PPRA 3CRBA 1LLSA 4F19A 5A5LA 1B5JA 5L8DA 3RN8A 3HN0A 1DPPA 1LBBA 4PBQA 4R72A 3PPNA 1A8EA 4DI3D 1M5FA 1INPA 3FJ7A 1P99A 3B6QA 2I58A 4IO3A 4EDPA 5HBCA 1GVCA 4GL8A 4ESXA 1NNTA 4F31B 3GLBA 3IB1A 3O97A 3MVXA 3UGWA 4XKNA 3H6UA 1D9QA 1XVYA 1GV8A 4R9FA 4DXUA 1UIUA 5CMBA 3I6VA 3K01A 3LSXA 4PE5B 4NAPA 3OO7A 1L5TA 1D9VA 2GFEA 4PFIA 2Y7PA 4FIMA 4GXAA 1URGA 4H8IA 1QUKA 4GX6A 4OA4A 4U2RA 3FXBA 1N7WA 3RUMA 3RY3A 4PTKA 2ZZXA 3O6IA 5IZ3B 4OVPA 2FBPA 1NNFA 2AYSA 4U21A 1PB9A 4X9TA 4N15A 1ZKBA 4IGRA 4O3CA 4F39A 1Y4TA 3JZJA 2HZKA 3FXUA 3KSJA 2UYFA 1NUYA 1DCUA 1N84A 4IO6A 4OVSA 3G3IA 3K0VA 5JK4A 1B3HA 5LDZA 2P1SA 2RCBA 3TUSA 1LGBC 2P0SA 1O7TA 1SD3A 2ZYNA 1IIWA 1IUDA 3M8UA 4ECFA 3IJOB 3A29A 1GTKA 2CZHA 3IL1B 2QVUA 5EYFA 4X8RA 2H5YA 2ZYOA 4HXVA 2DOJA 4MLVA 3OO9A 5AA1A 1MXXA 1NV4A 4NG7A 5I84A 3L6HA 4LQ5A 4G68C 4MFIA 3CI8A 1WODA 5TP9B 3B6WA 5F7VA 4XEQA 2DE4A 2DS9A 1MY1A 4O3AA 1LFGA 1BLFA 1IMEA 1FTOA 1QKBA 1JETA 1EYJA 3LC8A 4KYEA 4N13A 5KZTA 2WYKA 3TDJA 3AXFA 4GF8A 1OVBA 4MCOA 5HPQA 4C0RA 5I2NA 4O8MA 4GXSB 4R75A 1FPFA 1B5IA 1PB8A 4EQ7A 3VXBA 5TP9A 1B52A 4YKIA 1ELJA 1P1NA 2G29A 5CI5A 4N8GA 3FVOA 1SI0A 4I3YA 3RT8A 1LSTA 3SEWA 3E78A 2V93A 4O7MA 4N6KA 5IZ3A 2FIXA 3PMWA 2Y7KA 2RC9A 5IZZA 3U8QA 1QUIA 4PFYA 1NMUA 4NF5A 1B2HA 1IQ7A 1FBHA 4Q30B 3CSGA 5I2NB 1NKXA 3GYYA 5CC2A 2PMSA 4NWCA 4OEVA 3SEUA 5CBRA 3UA8A 4IO5A 2V3UA 2H9BA 3E3KA 2XXTA 2HPGA 4MJOA 5H8FB 4QFLA 1LAFE 1SQYA 2CEXA 3U1OA 1URDA 1B40A 4ZS9A 4H46A 3FATA 4IR8A 5ISUA 4NF6A 3T9VA 3PPPA 5K2XA 1O64A 1FBEA 1SDXA 5EQ7A 4N81A 1EU8A 4H5FA 3TCHA 3N94A 4AQ4A 3E4RA 4GX4A 4RXLA 1LBYA 2XWOA 4Z0IA 1EYIA 1MY0A 2NOOA 1F9BA 2O51A 3K1NA 3OSQA 4MBPA 1ZTYA 1XS5A 4GWSA 2XX9A 3EQ1A 3CIJA 4P3LA 2Q88A 2Z8FA 5AA2A 4UABA 4OVRA 1DK4A 2QRYA 4QF9A 4TLMB 1M5CA 3DM0A 2OBGA 3FV1A 4G4PA 1NV6A 2QJEA 5L9MA 3BBRA 3DELB 3W9WA 3H7MA 2REJA 3QIMA 4PAIA 3H06B 2GHAA 4ZEBA 2ZNTA 4ZZAA 3BIHA 2F3BA 1BIYA 1DTGA 2ABHA 1DTZA 4MNCA 5KDTA 2HFBA 4EQBA 4POXA 3UP9A 3TQWA 4ESWA 4GVOA 3CG3A 3MYUA 1XVXA 3C9HA 2QL3A 2XXRA 3O2AA 5I2KB 1ZLQA 1IMDA 4H65A 3S9NC 2RC7A 4H45A 4HTGA 3H6TA 1MS7A 1RDYA 2XXWA 1M5BA 4G61A 1I69A 2OWZA 3W9VA 3O66A 3Q27A 2F7CA 3RNNA 3GBAA 2F8DA 1MPBA 4QHQA 4JWYA 5IM2A 3MJNA 5B70A 1LBWA 4XFEA 4G8NA 3G3HA 5A5XA 1USYH 5IGAA 1IXIA 4OXVA 3NOHA 4YKJA 5H8QA 1A8FA 3KN3A 4GRKA 4JDFA 4QSDA 1NV1A 3SEVA 2HEUA 5I58A 4JXIA 5IZ1A 4THIA 3MP1A 1MY4A 4XKPA 2QS4A 1HSLA 4GX3A 3MPKA 3QYTA 5FBPA 2OWSA 2XA5A 4H1XA 1PBQA 1B3EA 4QSCA 5EYGA 4MNPA 2Y7IA 2VPOA 4HE0A 3LSWA 1NV0A 1FQFA 1MM7A 1N7XA 1N76A 4AS4A 4LZ5A 2V4CA 4X48A 2Z23A 2HAVA 2F3DA 1MQJA 4FATA 4NF5B 2QS2A 4GWXA 3H6WA 3H6VA 5JTYB 3T0JA 3FZVA 4PGNA 3TKDA 1FPGA 1LBCA 1OLCA 3PUXE 3O6HA 5ET7A 2RINA 1LBVA 4I3EA 1JW4A 1EZPA 4MIJA 2WKYA 2XHDA 4OENA 3C31A 5IAIA 2Y7WA 4OETA 1LBZA 1TWYA 1AWBA 1MH3A 1MH4A 3IOWA 2CMOA 1JVYA 2AIXA 1LB8A 2ANJA 3HSTA 3MC2A 5JTYA 1Y3QA 3TELA 2V25A 3VVEA 1FTJA 2RC8A 3D4CA 4WXJA 1FTMA 3EN3A 5B7DA 1IEJA 3M3LA 4R6HA 4LZ8A 4WEPA 4OHNA 3KN7A 4N6PA 2F97A 4F3GA 2DWIA 4I9DA 3KEIA 4M4GA 2DSFA 2R6GE 4PDHA 1D4NA 4BDOA 3IK6B 3OXNA 2Q8JA 1POY1 1URSA 2UVGA 3HFUA 1MDP1 1B4HA 3H03A 4JSOA 4RPOA 2Y5KA 1YYZA 1LBXA 4R6KA 3N5LA 4YAHX 2QFLA 4MF3A 2A5TB
chains in the Genus database with same CATH topology
1FPKA 3KC1A 5EQ8A 5T3JA 2Y5LA 4QBAA 4GWXA 5I7IA 2KQZA 4N91A 1FPEA 3MYUA 1NUZA 3T0JA 4PGNA 3SZPA 3A29A 1FJ9A 1FPGA 5ET8A 4P47A 2WBBA 4PETA 2DDKA 1NV3A 4MJOA 2HPGA 4F19A 3LUZA 3B8BA 5ESYA 1IMDA 5A5LA 2KR0A 1LEVA 4NHBA 4JVIA 4NX1A 1NUXA 2CEXA 4PBQA 4H45A 4PF6A 4DI4B 2CZHA 4DI3D 5ET7A 1INPA 1CNQA 1YXIA 2QVUA 4X8RA 1LBVA 1BK4A 3ROJA 4GBVA 1SPIA 4HXVA 4I3EA 2L5VA 1RDYA 4H46A 2WX9A 3MSTA 4MIJA 4GBWA 1G0IA 5LTCA 4HE2A 4IR8A 4P9KA 1IMFA 1NV4A 4G61A 2OWZA 1KZ8A 1RDZA 2FIEA 1K9ZA 3W9VA 4NG7A 2P3VA 2ZZVA 1NI9A 1NUWA 1LBZA 1FBCA 1G0HA 2R8TA 4I40A 1FBFA 2XWKA 4M1VA 4O7IA 4PF8A 1AWBA 1FRPA 4MMPA 1FBEA 2Q8MA 5EQ7A 4PFRA 3IFCA 4KXPA 4N81A 5ET6A 2PFYA 1FPDA 2VPNA 4HCYA 4MEVA 4N8YA 3B50A 4XEQA 2JJKA 4OVQA 4P8BA 5IM2A 1D9QA 2QVVA 1LBWA 2Q9TA 4XFEA 1FBGA 2DE4A 2ZZWA 4GX4A 2XWIA 4PGPA 1FPJA 1KA0A 2F5XA 4NF0A 1Q9DA 1FSAA 3FBPA 1IMEA 1XI6A 4AS5A 2DE3A 4N17A 4NN3A 4P1EA 4F1UA 5IGAA 2FHYA 5I5PA 1LBYA 2XWOA 2PCRA 4P1LA 1EYJA 1YZ0A 4JVDA 4NQ8A 4F18A 1FTAA 5EQAA 5ET5A 3NOHA 1EYIA 1FPIA 1KA1A 4JVCA 2HZLA 4X04A 2WEFA 4GWUA 2QPQA 1FJ6A 1NV5A 2WYKA 4NAPA 4PC9A 5I3SA 4O94A 1FPBA 3CHGA 2BJIA 3RYDA 4HE1A 3KC0A 2HXRA 4PFIA 3U65A 1QGXA 3D1RA 1NV1A 1DBZA 2CZKA 4MAGA 4MCOA 4OA4A 4GX6A 1FPLA 4QXDA 4GWSA 2Q74A 3FXBA 4P3LA 4PAKA 2DVZA 3EKIA 5IZ1A 2XXKA 4O8MA 4MX6A 4PE3A 1FBDA 1FPFA 4PTKA 4YZZA 2ZZXA 4OANA 4GWWA 1RDXA 5J1DA 2MKZA 4OVRA 1DK4A 4GX3A 2OX3A 5IZ3B 3QMFA 2B4MA 2DE2A 2FBPA 4OVPA 4UABA 1JP4A 5FBPA 4FBPA 4PCDA 3LV0A 4N8GA 4PBHA 4NGUA 4X9TA 3IFAA 3KBZA 4I3YA 4N15A 1NV6A 4OVTA 4P56A 1NV2A 3BIGA 2XA5A 4N6DA 3E78A 5DW8A 2CEYA 4LN5A 2B4LA 4PDHA 4F1VA 3ISPA 2PFZA 1IMCA 4O7MA 3W9WA 2HZKA 3RPLB 4N6KA 5IZ3A 2FIXA 5EYGA 4MNPA 5EYHA 4PDDA 2GQ1A 2VPOA 4XF5A 2QVRA 5F24A 4PAIA 2XWVA 1EYKA 1IMBA 1NUYA 2V3QA 1K9YA 1NV7A 4HE0A 1DCUA 1NV0A 4MHFA 1VDWA 5IZZA 5CM6A 3HFUA 2WBDA 4N4UA 4PAFA 2FVZA 2P3NA 2Y5KA 1YYZA 1LBXA 4GWYA 3RPLA 3E79A 2CZIA 3BIHA 4HCWA 4OVSA 1IMAA 2F3BA 1FBHA 1FBPA 4GWZA 4AS4A 3T1BA 5JK4A 2QFLA 2WYPA 2V4CA 5LDZA 4MNIA 2VT5A 4MNCA 4PFBA 5J16A 3GYYA 2F3DA 4YICA 5EQ9A 2HHMA 3PTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPK A;  3KC1 A;  5EQ8 A;  5T3J A;  2Y5L A;  4GWX A;  1FPE A;  1NUZ A;  3T0J A;  3A29 A;  1FJ9 A;  1FPG A;  5ET8 A;  2WBB A;  2DDK A;  1NV3 A;  4MJO A;  3LUZ A;  3B8B A;  5ESY A;  1IMD A;  5A5L A;  1LEV A;  1NUX A;  4H45 A;  2CZH A;  5ET7 A;  1INP A;  1CNQ A;  1YXI A;  2QVU A;  1LBV A;  1BK4 A;  3ROJ A;  4GBV A;  1SPI A;  4HXV A;  4I3E A;  1RDY A;  4H46 A;  4GBW A;  1G0I A;  4HE2 A;  4IR8 A;  1IMF A;  1NV4 A;  4G61 A;  2OWZ A;  1KZ8 A;  1RDZ A;  2FIE A;  1K9Z A;  2P3V A;  1NI9 A;  1NUW A;  1LBZ A;  1FBC A;  1G0H A;  2R8T A;  4I40 A;  1FBF A;  4O7I A;  1AWB A;  1FRP A;  1FBE A;  2Q8M A;  5EQ7 A;  3IFC A;  4KXP A;  4N81 A;  5ET6 A;  1FPD A;  2JJK A;  1D9Q A;  2QVV A;  1LBW A;  1FBG A;  4GX4 A;  1FPJ A;  1KA0 A;  1Q9D A;  1FSA A;  3FBP A;  1IME A;  1XI6 A;  4AS5 A;  2FHY A;  1LBY A;  2PCR A;  1EYJ A;  1YZ0 A;  1FTA A;  5EQA A;  5ET5 A;  1EYI A;  1FPI A;  1KA1 A;  2WEF A;  4GWU A;  1FJ6 A;  1NV5 A;  5I3S A;  1FPB A;  2BJI A;  3RYD A;  4HE1 A;  3KC0 A;  1QGX A;  3D1R A;  1NV1 A;  1DBZ A;  2CZK A;  4GX6 A;  1FPL A;  4QXD A;  4GWS A;  2Q74 A;  5IZ1 A;  1FBD A;  1FPF A;  4PTK A;  4GWW A;  1RDX A;  1DK4 A;  4GX3 A;  2OX3 A;  5IZ3 B;  3QMF A;  2FBP A;  1JP4 A;  5FBP A;  4FBP A;  3LV0 A;  3IFA A;  3KBZ A;  4I3Y A;  1NV6 A;  1NV2 A;  3BIG A;  5DW8 A;  1IMC A;  3RPL B;  5IZ3 A;  2FIX A;  5EYG A;  5EYH A;  2GQ1 A;  2QVR A;  5F24 A;  1EYK A;  1IMB A;  1NUY A;  1K9Y A;  1NV7 A;  4HE0 A;  1DCU A;  1NV0 A;  1VDW A;  2WBD A;  2FVZ A;  2P3N A;  2Y5K A;  1YYZ A;  1LBX A;  4GWY A;  3RPL A;  2CZI A;  3BIH A;  1IMA A;  2F3B A;  1FBH A;  1FBP A;  4GWZ A;  4AS4 A;  2QFL A;  5LDZ A;  2VT5 A;  5J16 A;  2F3D A;  5EQ9 A;  2HHM A; 
#chains in the Genus database with same CATH topology
 1A54 A;  1H3D A;  1FQC A;  1PEB A;  2DDK A;  3ILU B;  1I6Q A;  4ND9 A;  1H44 A;  1SPI A;  5LTC A;  1IZ1 A;  1MPC A;  4U22 A;  1RDZ A;  3W15 C;  3QUF A;  1NI9 A;  1BKA A;  3FVK A;  1FRP A;  4MMP A;  1Y3P A;  2AL4 A;  1PB7 A;  4KXP A;  2DVC A;  4YMB A;  4HCY A;  2JJK A;  4OVQ A;  2Q9T A;  1LB9 A;  4PGP A;  1VR5 A;  1KA0 A;  4KQP A;  2DE3 A;  4JVD A;  1Z7N E;  3MP8 A;  1B5H A;  3FXR A;  2R9J A;  3TQL A;  4KI0 E;  2Q2C A;  3VLU A;  1FQA A;  5H8Q B;  4KR5 A;  1LAH E;  2DXY A;  4FE8 A;  1MXW A;  5CMC A;  2MKZ A;  3PUW E;  2I49 A;  4IB2 A;  3KZG A;  4NMY A;  3OO6 A;  1BTJ A;  3PV0 E;  3Q25 A;  3UK4 A;  3TPA A;  3ISP A;  2RF1 A;  4BDL A;  3IAZ A;  4MLQ A;  3HHG A;  2ALU A;  2O7U A;  4EXL A;  3VVF A;  5EYH A;  1MG1 A;  1MXY A;  3TYH A;  2THI A;  3D4G A;  4XTC Q;  1N3W A;  1H76 A;  5ICT A;  1NL5 A;  2LAO A;  4HCW A;  1MY3 A;  2DQV A;  1J1N A;  5H8N B;  1XT8 A;  2DP8 A;  2XX7 A;  3OEK A;  3VE1 B;  2OWT A;  2HHM A;  4KPT A;  4E0W A;  3T9X B;  3TTL A;  2F7A A;  1MXU A;  5ESY A;  2G93 A;  4P11 A;  3VV5 A;  3QUJ A;  4NX1 A;  1SYI A;  3C34 A;  3USD A;  1YXI A;  3ROJ A;  4QSE A;  1SVX B;  5FHO A;  1GR2 A;  2H25 A;  3ECR A;  3UOR A;  1K9Z A;  1XHY A;  4I40 A;  1Y9U A;  2F7B A;  1AL3 A;  3RQT A;  4LUB A;  2ZNS A;  5I57 B;  1VFD A;  2W7Y A;  3B50 A;  2HQ0 A;  3BKI B;  3FAS A;  4I62 A;  5DVI A;  2F5X A;  4G2Z A;  1POT A;  1MQI A;  3K6X A;  1YZ0 A;  3OSR A;  2OCU A;  5FHM A;  5KCJ B;  3S4U A;  4XIG Q;  4KYS A;  3TCF A;  1OQH A;  5ICQ A;  3D1R A;  4OTE A;  1M5E A;  4MAG A;  5I56 B;  1A40 A;  2XX8 A;  4PAK A;  2QS3 A;  4YKP A;  1DOT A;  2NWJ A;  4ZEI A;  3V83 A;  2H98 A;  2E1S A;  3G3F A;  3HPI A;  3IFA A;  1MRP A;  4P56 A;  4RK2 A;  2UVH A;  3IJX B;  1YPN A;  1MQG A;  3HCQ A;  4MHF A;  1IMB A;  4PFR A;  1NV7 A;  4C1U A;  2XXP A;  4IO2 A;  4N4U A;  3MVZ A;  4OFO A;  2Z8D A;  3M3K A;  1XC1 A;  4OFJ A;  3ZKK A;  5A5X B;  4H8J A;  4K3F A;  3UIF A;  3LUZ A;  3KBR A;  1NUX A;  2IA4 A;  3WAE A;  3MZ9 A;  3IOR A;  1ZBM A;  1ZMG A;  4F2Q A;  4F22 A;  1FQE A;  5EHM A;  2YJP A;  4O7I A;  3EPE A;  4G68 B;  4MEV A;  4NF6 B;  1US5 A;  4RK9 A;  4GL0 A;  3I5O A;  1B3L A;  4KCC A;  3FVG A;  1JVX A;  2XWI A;  1R9L A;  4E0X A;  4NF0 A;  4BDQ A;  2H99 A;  4JVC A;  1N04 A;  1RKM A;  1NV5 A;  3T96 B;  3K2D A;  1FPB A;  1P1U A;  1UTH B;  1EZO A;  4LAT A;  1P1W A;  4ELR A;  4EQ9 A;  1JEU A;  3HV1 A;  5DTB A;  1US4 A;  4JWX A;  1DPE A;  1SW1 A;  2DVZ A;  4PE3 A;  4JWO A;  4NED A;  3M3F A;  3PPQ A;  1VSO A;  1P1O A;  3RTW B;  3H3G A;  3QMF A;  3FJG A;  1TT1 A;  4ZED A;  4PBH A;  2F78 A;  3BIG A;  3GXA A;  3SET A;  2O69 A;  4ZEK A;  3SDF A;  4DZ1 A;  3G3G A;  2V3Q A;  1VDW A;  2I4B A;  5TPA B;  4XKQ A;  4ELO A;  1ANF A;  1Y1M A;  3C35 A;  2DWH A;  4N07 A;  4QFP A;  2Y7R A;  3O28 A;  4DXC A;  5EQ9 A;  3PTY A;  2I0C A;  3MZB A;  5L9S A;  3FVN A;  1T0K A;  4IY6 A;  4PF6 A;  4WKM A;  3G3J A;  1B6H A;  3T66 A;  4GBV A;  1AH5 A;  4GBW A;  4HE2 A;  4GFR A;  1PBP A;  1IMF A;  3KJ7 A;  2FIE A;  3EHU A;  2P3V A;  1FBF A;  1VE4 A;  3U94 A;  1VFE A;  3GZG A;  3FV2 A;  1RYX A;  4H0W A;  2YLN A;  2NXO A;  1FPJ A;  2HXW A;  3RTF B;  3LBS A;  2NUV A;  4QFN A;  1I6B A;  4GLI A;  1KA1 A;  1NNK A;  5L9O A;  2QPQ A;  5M2V A;  1TFA A;  3T9U A;  3RYD A;  1B7Z A;  3KOT A;  3U65 A;  3LR1 A;  1MXZ A;  3FJM A;  3THI A;  2F35 A;  4LVQ A;  1S9T A;  2FYI A;  4EUO A;  1QUL A;  4R74 A;  4DLD A;  2O1M A;  5EHS A;  3FIR A;  2CEY A;  4OES A;  1Y4C A;  1OLA A;  3F11 A;  2FA7 A;  4PDD A;  2ONS A;  3KG2 A;  4OER A;  3CFX A;  4PFW A;  4PFT A;  5DYH A;  1OVT A;  2I6E A;  3PUV E;  3PUZ E;  4OFL A;  1IMA A;  2QS1 A;  3T1B A;  1R6Z A;  1B7U A;  5T3J A;  2VP1 A;  5I7I A;  3IO4 A;  3QSL A;  4YB5 A;  4U4X A;  2KLF A;  4P47 A;  1NV3 A;  2XD3 A;  2KR0 A;  2PT1 A;  2UVJ A;  3TAJ A;  1CNQ A;  4GD5 A;  1MXV A;  1Q35 A;  1A99 A;  3DP6 A;  3Q26 A;  1YCJ A;  4M1V A;  4ONY A;  2ONK E;  2XXI A;  1JEV A;  2PBW A;  3VVD A;  1FPD A;  3K6U A;  2QVV A;  4NF8 B;  5DVJ A;  3K1P A;  3MQ9 A;  4TLL B;  2PCR A;  4NQ8 A;  5ET5 A;  2ONR A;  2ZMB A;  3BFT A;  3EF7 A;  3LSF B;  1NNP A;  1B3G A;  1DBZ A;  3KOS A;  1A55 A;  4YKK A;  4YZZ A;  4JB7 A;  4R2F A;  3QXM A;  1RDX A;  2PX1 A;  4XXU A;  3CFL A;  1SI1 A;  5H8F A;  5AA3 A;  3T22 A;  1FQD A;  3KBZ A;  4OVT A;  1B46 A;  5DW8 A;  1H45 A;  4PFU A;  1IMC A;  3RPL B;  5IKB A;  1UQW A;  4XF5 A;  2XXX A;  3MPL A;  2F36 A;  1HSE A;  4PAF A;  2FVZ A;  4XKR A;  3OD7 A;  3E79 A;  3N6U A;  3K6W A;  2OLB A;  3R26 A;  3EHS A;  5J16 A;  3VFJ A;  1FPK A;  3KC1 A;  2O6A A;  4QBA A;  2PVU A;  1FCK A;  1B1H A;  1FPE A;  1LAG E;  4PET A;  1ZU0 A;  4QFK A;  4JVI A;  4TQU Q;  1R9Q A;  5FTI A;  3IB2 A;  2WX9 A;  4FAJ A;  4KYD A;  2UYE A;  4GQO A;  4FJP A;  3VDF A;  2RCA A;  3RGY A;  2ZNU A;  1HSJ A;  2X7P A;  1B1X A;  4LP2 B;  4R6Y A;  2XXH A;  1FTK A;  4PP0 A;  5AA2 D;  1JNF A;  2I0B A;  3KN8 A;  3MBP A;  3BFU A;  4P8B A;  2B65 A;  1QW0 A;  4UA8 A;  1FSA A;  3FBP A;  5I5P A;  3ILT B;  4TOZ A;  2OJT A;  4IGT A;  1FQB A;  1N0T A;  3VLV A;  4FEB A;  1SW4 A;  2ZYK A;  3P7I A;  4QXD A;  2Q74 A;  1EZ9 A;  2XXK A;  4NWD A;  3QK6 A;  1MDQ A;  3K1M A;  4KFQ A;  3IR1 A;  3JYR A;  4PCD A;  1B9J A;  1N3X A;  1QVS A;  3IOT A;  3TFL A;  1I6A A;  2Z8E A;  3QAX A;  3SER A;  1UIV A;  2F34 A;  2F6G A;  4BDN A;  2BJJ X;  1P1Q A;  4YB6 A;  3ZSF A;  2P3N A;  3S2V A;  4GWY A;  1Q1K A;  2A5S A;  2M8C A;  4KD5 A;  1FBP A;  3MUQ A;  1GGG A;  4NE4 A;  4PFB A;  3EHT A;  4RA1 A;  1SW5 A;  4I1D A;  5EQ8 A;  5F1Q A;  3DP8 A;  2AL5 A;  2D5W A;  3MVY A;  4DE8 A;  3SZP A;  1NFT A;  4I8C A;  1LEV A;  4F2O A;  1UTH A;  3O9P A;  1AOV A;  4F1Y A;  4RJZ A;  4DIG A;  1OMP A;  1KZ8 A;  3SES A;  4G8H A;  3FUZ A;  1G0H A;  2R8T A;  4WED A;  3ODB A;  1SW2 A;  1H43 A;  4ELP A;  3IFC A;  3R7X A;  1ZJL A;  4G8M A;  1USY E;  4L17 A;  1WDN A;  2DWJ A;  5AA4 B;  1A7L A;  1XOC A;  1FBG A;  1PDA A;  1QKA A;  3V8X B;  3SKP A;  4NN3 A;  5ITO A;  4F1U A;  4X1D A;  2ZYM A;  2B3B A;  2HAU A;  3ONM A;  5EQA A;  1EH3 A;  2WEF A;  2O84 X;  4H67 A;  5I3S A;  1MPD A;  3A3U A;  4FOR A;  3PGF A;  3V5A A;  4HE1 A;  3C4M A;  3ZKL A;  1QGX A;  1JW5 A;  2CZK A;  3A3C A;  1LCF A;  2OPD A;  3E13 X;  1MQH A;  3VLW A;  3U93 A;  5AA4 A;  2QMX A;  5I56 A;  2ZXT A;  2B4L A;  4ELQ A;  4F1V A;  3MW0 A;  1Y1Z A;  1B0L A;  3OEL A;  2GH9 A;  3TEP A;  4OYV A;  2YPN A;  3C36 A;  4BLA A;  1DSN A;  2QMW A;  1B51 A;  3CG1 A;  1YAE A;  3TTK A;  4OWD A;  1M5D A;  3TTN A;  4BDM A;  3PMX A;  2UVI A;  4MNI A;  3PPO A;  2V3T A;  4R73 A;  4HS7 A;  2B3F A;  1NUZ A;  3B8B A;  4NHB A;  3OEN A;  3S9E A;  2PT2 A;  2GRV A;  1BK4 A;  2XXQ A;  3K00 A;  4P1L A;  3Q29 A;  3SEY A;  3IOV A;  1AIV A;  1G0I A;  2R71 A;  4P9K A;  3RLF E;  2DYX A;  3PUY E;  2V84 A;  1B7H A;  1FBC A;  3LUY A;  1B58 A;  2XWK A;  4PF8 A;  4FED A;  4EXK A;  5ET6 A;  4NF4 A;  4U4S A;  1R1N A;  2Q2A A;  1LFI A;  5I57 A;  2VD2 A;  4QFO A;  2OZZ A;  4RYA A;  2RKM A;  4P0G A;  1FPI A;  2VOZ A;  3IO6 A;  1BP5 A;  1FJ6 A;  4OEU A;  5DVF A;  2HXR A;  1II5 A;  3O29 A;  2A5T A;  2F6P A;  4AB6 A;  4BDR A;  3V89 B;  1LCT A;  4GIZ A;  4GWW A;  1B05 A;  2B4M A;  2DE2 A;  4NF4 B;  3S9M C;  3MWB A;  2OK2 A;  4DCX A;  2DWA A;  1IIT A;  5H8H B;  1SBP A;  4YB7 A;  3WAF A;  1LAX A;  5CBS A;  1S7Y A;  2O7I A;  3IX1 A;  2XWV A;  1YTV A;  1CE2 A;  2IEE A;  4F3P A;  1PC3 A;  3U72 A;  3OEM A;  4G77 A;  3JV9 A;  5AE4 A;  4OZ9 A;  5JEI A;  4YIC A;  3S9L C;  2KQZ A;  5BUU A;  1TXF A;  2WBB A;  3C32 A;  1FW0 A;  3MST A;  2L5V A;  3TZA A;  4LZ7 A;  3L6G A;  2ZZV A;  2Y84 A;  4IO4 A;  4RY1 A;  2X7Q A;  2PFY A;  3SEX A;  1ZIU A;  3TOD A;  3I3V A;  4KHZ E;  2PYY A;  3N26 A;  1UTB A;  4UAC A;  2O68 A;  1IXH A;  1OIB A;  4C1T A;  4P1E A;  3PD8 A;  2FHY A;  3PD9 A;  4PC9 A;  1IXG A;  1QJM A;  2E0S A;  1FPL A;  3EKI A;  3OMB A;  2DXR A;  1FBD A;  4OVJ A;  5LOM A;  5J1D A;  3OOA A;  4Z7E A;  3CR9 A;  4JSD A;  4JBZ A;  4LON B;  1MY2 A;  5BWJ A;  1AMF A;  5ELV A;  1NV2 A;  4N6D A;  1IXC A;  4OMB A;  4POW A;  3MP6 A;  4PQJ A;  1S50 A;  5K2Y A;  5KDT B;  5F24 A;  4Q5T A;  3A09 A;  1JQF A;  5FHN A;  2NVU B;  4RNS A;  1Y3N A;  5I2K A;  4IY5 A;  4U23 A;  3T9H B;  5DEX B;  1Y20 A;  3RT6 B;  3K6V A;  3T93 B;  5TPA A;  2D21 A;  3GBB A;  2XXU A;  2I3V A;  1FTL A;  2GHB A;  4RPN A;  2CZL A;  5H8S A;  5ET8 A;  2I3W A;  4GWO A;  2REG A;  4DI4 B;  1DMB A;  2OPE A;  1B0H A;  3B6T A;  1MM6 A;  3N6T A;  4ZZE A;  3UN6 A;  4F3S A;  1LFH A;  1NUW A;  1ATG A;  2Q8M A;  4R2B A;  5DEX A;  1TFD A;  2D3I A;  2VPN A;  2XXV A;  1D3K A;  5H8N A;  3OO8 A;  3G3K A;  3ZS6 A;  1O63 A;  4Q0C A;  3KGC A;  3CVG A;  2ZZW A;  4LQ2 A;  1B4Z A;  1Q9D A;  2VD3 A;  1XI6 A;  4F3B A;  4X1B A;  1MQD A;  4IO7 A;  4ZE8 A;  4F18 A;  1FTA A;  4DCY A;  2HZL A;  4GWU A;  4H5G A;  4FEC A;  3CHG A;  2BJI A;  3HO7 A;  3KC0 A;  5I59 A;  4GOT A;  1KWH A;  4EF2 A;  1D9Y A;  3E9X A;  4YU0 A;  3TTM A;  3MVW A;  1JP4 A;  1RYO A;  3LV0 A;  5TU0 A;  4NGU A;  2Q89 A;  3FD3 A;  4EF1 A;  4LN5 A;  3VXC A;  3B7D A;  2UXA A;  3TMG A;  5HM4 B;  3H4Z A;  5H8H A;  5ITP A;  3FGS A;  1EYK A;  2I4C A;  5KCJ A;  5I59 B;  2XXY A;  2CZI A;  4U1O A;  3TCG A;  4ISU A;  3C33 A;  4NTL A;  2WYP A;  4ZEF A;  5AA2 B;  4ZDM A;  4N91 A;  4MH5 A;  1NH7 A;  1FJ9 A;  1B3F A;  2Z22 A;  4KCD A;  1JW1 A;  2VHA A;  4DDD A;  4DXB A;  4O3B A;  2QSX A;  3KSX A;  5CMK A;  2O1L A;  3PMV A;  3DP4 A;  3CFZ A;  2P2A A;  4N8Y A;  4QRZ A;  4ZEC A;  1B32 A;  3MZ1 A;  4H6D A;  2VGQ A;  3HHF A;  1SYH A;  3PU5 A;  4AS5 A;  3K4U A;  4N17 A;  3LSL A;  3IOU A;  1QUJ A;  3MAM A;  4ZE9 A;  4U1Z A;  4X04 A;  5CRY A;  4NF8 A;  1OQG A;  1UTB B;  3G7W A;  4AB5 A;  2XD2 A;  3R6U A;  4O94 A;  1NH8 A;  2X26 A;  3TTR A;  2FNC A;  3DLN A;  3K02 A;  3FXQ A;  1Z7M E;  4MX6 A;  4OAN A;  4HW8 A;  3KJT A;  2OX3 A;  4Q8R A;  3IB0 A;  4FBP A;  4G68 A;  4F29 A;  4R9G A;  3CSB A;  5FTH A;  3RPW A;  3O6G A;  1WVJ A;  2PFZ A;  3KFM A;  4OQO A;  2H4I A;  2GQ1 A;  2QVR A;  2I48 A;  1CB6 A;  1K9Y A;  5CM6 A;  2WBD A;  3RPL A;  2HCA A;  4GWZ A;  4YMA A;  5I58 B;  5CMM A;  2VT5 A;  2ESN A;  4LA9 A;  4P0I A;  3U92 A;  5DT6 A;  3Q28 A;  2Y5L A;  3PPR A;  3CRB A;  1LLS A;  4F19 A;  5A5L A;  1B5J A;  5L8D A;  3RN8 A;  3HN0 A;  1DPP A;  1LBB A;  4PBQ A;  4R72 A;  3PPN A;  1A8E A;  4DI3 D;  1M5F A;  1INP A;  3FJ7 A;  1P99 A;  3B6Q A;  2I58 A;  4IO3 A;  4EDP A;  5HBC A;  1GVC A;  4GL8 A;  4ESX A;  1NNT A;  4F31 B;  3GLB A;  3IB1 A;  3O97 A;  3MVX A;  3UGW A;  4XKN A;  3H6U A;  1D9Q A;  1XVY A;  1GV8 A;  4R9F A;  4DXU A;  1UIU A;  5CMB A;  3I6V A;  3K01 A;  3LSX A;  4PE5 B;  4NAP A;  3OO7 A;  1L5T A;  1D9V A;  2GFE A;  4PFI A;  2Y7P A;  4FIM A;  4GXA A;  1URG A;  4H8I A;  1QUK A;  4GX6 A;  4OA4 A;  4U2R A;  3FXB A;  1N7W A;  3RUM A;  3RY3 A;  4PTK A;  2ZZX A;  3O6I A;  5IZ3 B;  4OVP A;  2FBP A;  1NNF A;  2AYS A;  4U21 A;  1PB9 A;  4X9T A;  4N15 A;  1ZKB A;  4IGR A;  4O3C A;  4F39 A;  1Y4T A;  3JZJ A;  2HZK A;  3FXU A;  3KSJ A;  2UYF A;  1NUY A;  1DCU A;  1N84 A;  4IO6 A;  4OVS A;  3G3I A;  3K0V A;  5JK4 A;  1B3H A;  5LDZ A;  2P1S A;  2RCB A;  3TUS A;  1LGB C;  2P0S A;  1O7T A;  1SD3 A;  2ZYN A;  1IIW A;  1IUD A;  3M8U A;  4ECF A;  3IJO B;  3A29 A;  1GTK A;  2CZH A;  3IL1 B;  2QVU A;  5EYF A;  4X8R A;  2H5Y A;  2ZYO A;  4HXV A;  2DOJ A;  4MLV A;  3OO9 A;  5AA1 A;  1MXX A;  1NV4 A;  4NG7 A;  5I84 A;  3L6H A;  4LQ5 A;  4G68 C;  4MFI A;  3CI8 A;  1WOD A;  5TP9 B;  3B6W A;  5F7V A;  4XEQ A;  2DE4 A;  2DS9 A;  1MY1 A;  4O3A A;  1LFG A;  1BLF A;  1IME A;  1FTO A;  1QKB A;  1JET A;  1EYJ A;  3LC8 A;  4KYE A;  4N13 A;  5KZT A;  2WYK A;  3TDJ A;  3AXF A;  4GF8 A;  1OVB A;  4MCO A;  5HPQ A;  4C0R A;  5I2N A;  4O8M A;  4GXS B;  4R75 A;  1FPF A;  1B5I A;  1PB8 A;  4EQ7 A;  3VXB A;  5TP9 A;  1B52 A;  4YKI A;  1ELJ A;  1P1N A;  2G29 A;  5CI5 A;  4N8G A;  3FVO A;  1SI0 A;  4I3Y A;  3RT8 A;  1LST A;  3SEW A;  3E78 A;  2V93 A;  4O7M A;  4N6K A;  5IZ3 A;  2FIX A;  3PMW A;  2Y7K A;  2RC9 A;  5IZZ A;  3U8Q A;  1QUI A;  4PFY A;  1NMU A;  4NF5 A;  1B2H A;  1IQ7 A;  1FBH A;  4Q30 B;  3CSG A;  5I2N B;  1NKX A;  3GYY A;  5CC2 A;  2PMS A;  4NWC A;  4OEV A;  3SEU A;  5CBR A;  3UA8 A;  4IO5 A;  2V3U A;  2H9B A;  3E3K A;  2XXT A;  2HPG A;  4MJO A;  5H8F B;  4QFL A;  1LAF E;  1SQY A;  2CEX A;  3U1O A;  1URD A;  1B40 A;  4ZS9 A;  4H46 A;  3FAT A;  4IR8 A;  5ISU A;  4NF6 A;  3T9V A;  3PPP A;  5K2X A;  1O64 A;  1FBE A;  1SDX A;  5EQ7 A;  4N81 A;  1EU8 A;  4H5F A;  3TCH A;  3N94 A;  4AQ4 A;  3E4R A;  4GX4 A;  4RXL A;  1LBY A;  2XWO A;  4Z0I A;  1EYI A;  1MY0 A;  2NOO A;  1F9B A;  2O51 A;  3K1N A;  3OSQ A;  4MBP A;  1ZTY A;  1XS5 A;  4GWS A;  2XX9 A;  3EQ1 A;  3CIJ A;  4P3L A;  2Q88 A;  2Z8F A;  5AA2 A;  4UAB A;  4OVR A;  1DK4 A;  2QRY A;  4QF9 A;  4TLM B;  1M5C A;  3DM0 A;  2OBG A;  3FV1 A;  4G4P A;  1NV6 A;  2QJE A;  5L9M A;  3BBR A;  3DEL B;  3W9W A;  3H7M A;  2REJ A;  3QIM A;  4PAI A;  3H06 B;  2GHA A;  4ZEB A;  2ZNT A;  4ZZA A;  3BIH A;  2F3B A;  1BIY A;  1DTG A;  2ABH A;  1DTZ A;  4MNC A;  5KDT A;  2HFB A;  4EQB A;  4POX A;  3UP9 A;  3TQW A;  4ESW A;  4GVO A;  3CG3 A;  3MYU A;  1XVX A;  3C9H A;  2QL3 A;  2XXR A;  3O2A A;  5I2K B;  1ZLQ A;  1IMD A;  4H65 A;  3S9N C;  2RC7 A;  4H45 A;  4HTG A;  3H6T A;  1MS7 A;  1RDY A;  2XXW A;  1M5B A;  4G61 A;  1I69 A;  2OWZ A;  3W9V A;  3O66 A;  3Q27 A;  2F7C A;  3RNN A;  3GBA A;  2F8D A;  1MPB A;  4QHQ A;  4JWY A;  5IM2 A;  3MJN A;  5B70 A;  1LBW A;  4XFE A;  4G8N A;  3G3H A;  5A5X A;  1USY H;  5IGA A;  1IXI A;  4OXV A;  3NOH A;  4YKJ A;  5H8Q A;  1A8F A;  3KN3 A;  4GRK A;  4JDF A;  4QSD A;  1NV1 A;  3SEV A;  2HEU A;  5I58 A;  4JXI A;  5IZ1 A;  4THI A;  3MP1 A;  1MY4 A;  4XKP A;  2QS4 A;  1HSL A;  4GX3 A;  3MPK A;  3QYT A;  5FBP A;  2OWS A;  2XA5 A;  4H1X A;  1PBQ A;  1B3E A;  4QSC A;  5EYG A;  4MNP A;  2Y7I A;  2VPO A;  4HE0 A;  3LSW A;  1NV0 A;  1FQF A;  1MM7 A;  1N7X A;  1N76 A;  4AS4 A;  4LZ5 A;  2V4C A;  4X48 A;  2Z23 A;  2HAV A;  2F3D A;  1MQJ A;  4FAT A;  4NF5 B;  2QS2 A;  4GWX A;  3H6W A;  3H6V A;  5JTY B;  3T0J A;  3FZV A;  4PGN A;  3TKD A;  1FPG A;  1LBC A;  1OLC A;  3PUX E;  3O6H A;  5ET7 A;  2RIN A;  1LBV A;  4I3E A;  1JW4 A;  1EZP A;  4MIJ A;  2WKY A;  2XHD A;  4OEN A;  3C31 A;  5IAI A;  2Y7W A;  4OET A;  1LBZ A;  1TWY A;  1AWB A;  1MH3 A;  1MH4 A;  3IOW A;  2CMO A;  1JVY A;  2AIX A;  1LB8 A;  2ANJ A;  3HST A;  3MC2 A;  5JTY A;  1Y3Q A;  3TEL A;  2V25 A;  3VVE A;  1FTJ A;  2RC8 A;  3D4C A;  4WXJ A;  1FTM A;  3EN3 A;  5B7D A;  1IEJ A;  3M3L A;  4R6H A;  4LZ8 A;  4WEP A;  4OHN A;  3KN7 A;  4N6P A;  2F97 A;  4F3G A;  2DWI A;  4I9D A;  3KEI A;  4M4G A;  2DSF A;  2R6G E;  4PDH A;  1D4N A;  4BDO A;  3IK6 B;  3OXN A;  2Q8J A;  1POY 1;  1URS A;  2UVG A;  3HFU A;  1MDP 1;  1B4H A;  3H03 A;  4JSO A;  4RPO A;  2Y5K A;  1YYZ A;  1LBX A;  4R6K A;  3N5L A;  4YAH X;  2QFL A;  4MF3 A;  2A5T B; 
#chains in the Genus database with same CATH homology
 1FPK A;  3KC1 A;  5EQ8 A;  5T3J A;  2Y5L A;  4QBA A;  4GWX A;  5I7I A;  2KQZ A;  4N91 A;  1FPE A;  3MYU A;  1NUZ A;  3T0J A;  4PGN A;  3SZP A;  3A29 A;  1FJ9 A;  1FPG A;  5ET8 A;  4P47 A;  2WBB A;  4PET A;  2DDK A;  1NV3 A;  4MJO A;  2HPG A;  4F19 A;  3LUZ A;  3B8B A;  5ESY A;  1IMD A;  5A5L A;  2KR0 A;  1LEV A;  4NHB A;  4JVI A;  4NX1 A;  1NUX A;  2CEX A;  4PBQ A;  4H45 A;  4PF6 A;  4DI4 B;  2CZH A;  4DI3 D;  5ET7 A;  1INP A;  1CNQ A;  1YXI A;  2QVU A;  4X8R A;  1LBV A;  1BK4 A;  3ROJ A;  4GBV A;  1SPI A;  4HXV A;  4I3E A;  2L5V A;  1RDY A;  4H46 A;  2WX9 A;  3MST A;  4MIJ A;  4GBW A;  1G0I A;  5LTC A;  4HE2 A;  4IR8 A;  4P9K A;  1IMF A;  1NV4 A;  4G61 A;  2OWZ A;  1KZ8 A;  1RDZ A;  2FIE A;  1K9Z A;  3W9V A;  4NG7 A;  2P3V A;  2ZZV A;  1NI9 A;  1NUW A;  1LBZ A;  1FBC A;  1G0H A;  2R8T A;  4I40 A;  1FBF A;  2XWK A;  4M1V A;  4O7I A;  4PF8 A;  1AWB A;  1FRP A;  4MMP A;  1FBE A;  2Q8M A;  5EQ7 A;  4PFR A;  3IFC A;  4KXP A;  4N81 A;  5ET6 A;  2PFY A;  1FPD A;  2VPN A;  4HCY A;  4MEV A;  4N8Y A;  3B50 A;  4XEQ A;  2JJK A;  4OVQ A;  4P8B A;  5IM2 A;  1D9Q A;  2QVV A;  1LBW A;  2Q9T A;  4XFE A;  1FBG A;  2DE4 A;  2ZZW A;  4GX4 A;  2XWI A;  4PGP A;  1FPJ A;  1KA0 A;  2F5X A;  4NF0 A;  1Q9D A;  1FSA A;  3FBP A;  1IME A;  1XI6 A;  4AS5 A;  2DE3 A;  4N17 A;  4NN3 A;  4P1E A;  4F1U A;  5IGA A;  2FHY A;  5I5P A;  1LBY A;  2XWO A;  2PCR A;  4P1L A;  1EYJ A;  1YZ0 A;  4JVD A;  4NQ8 A;  4F18 A;  1FTA A;  5EQA A;  5ET5 A;  3NOH A;  1EYI A;  1FPI A;  1KA1 A;  4JVC A;  2HZL A;  4X04 A;  2WEF A;  4GWU A;  2QPQ A;  1FJ6 A;  1NV5 A;  2WYK A;  4NAP A;  4PC9 A;  5I3S A;  4O94 A;  1FPB A;  3CHG A;  2BJI A;  3RYD A;  4HE1 A;  3KC0 A;  2HXR A;  4PFI A;  3U65 A;  1QGX A;  3D1R A;  1NV1 A;  1DBZ A;  2CZK A;  4MAG A;  4MCO A;  4OA4 A;  4GX6 A;  1FPL A;  4QXD A;  4GWS A;  2Q74 A;  3FXB A;  4P3L A;  4PAK A;  2DVZ A;  3EKI A;  5IZ1 A;  2XXK A;  4O8M A;  4MX6 A;  4PE3 A;  1FBD A;  1FPF A;  4PTK A;  4YZZ A;  2ZZX A;  4OAN A;  4GWW A;  1RDX A;  5J1D A;  2MKZ A;  4OVR A;  1DK4 A;  4GX3 A;  2OX3 A;  5IZ3 B;  3QMF A;  2B4M A;  2DE2 A;  2FBP A;  4OVP A;  4UAB A;  1JP4 A;  5FBP A;  4FBP A;  4PCD A;  3LV0 A;  4N8G A;  4PBH A;  4NGU A;  4X9T A;  3IFA A;  3KBZ A;  4I3Y A;  4N15 A;  1NV6 A;  4OVT A;  4P56 A;  1NV2 A;  3BIG A;  2XA5 A;  4N6D A;  3E78 A;  5DW8 A;  2CEY A;  4LN5 A;  2B4L A;  4PDH A;  4F1V A;  3ISP A;  2PFZ A;  1IMC A;  4O7M A;  3W9W A;  2HZK A;  3RPL B;  4N6K A;  5IZ3 A;  2FIX A;  5EYG A;  4MNP A;  5EYH A;  4PDD A;  2GQ1 A;  2VPO A;  4XF5 A;  2QVR A;  5F24 A;  4PAI A;  2XWV A;  1EYK A;  1IMB A;  1NUY A;  2V3Q A;  1K9Y A;  1NV7 A;  4HE0 A;  1DCU A;  1NV0 A;  4MHF A;  1VDW A;  5IZZ A;  5CM6 A;  3HFU A;  2WBD A;  4N4U A;  4PAF A;  2FVZ A;  2P3N A;  2Y5K A;  1YYZ A;  1LBX A;  4GWY A;  3RPL A;  3E79 A;  2CZI A;  3BIH A;  4HCW A;  4OVS A;  1IMA A;  2F3B A;  1FBH A;  1FBP A;  4GWZ A;  4AS4 A;  3T1B A;  5JK4 A;  2QFL A;  2WYP A;  2V4C A;  5LDZ A;  4MNI A;  2VT5 A;  4MNC A;  4PFB A;  5J16 A;  3GYY A;  2F3D A;  4YIC A;  5EQ9 A;  2HHM A;  3PTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...