5T3XD

3.9 angstrom crystal structure of a fully and natively glycosylated bg505 sosip.664 hiv-1 env trimer in complex with the broadly neutralizing antibodies ioma and 10-1074.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
229
structure length
229
Chain Sequence
EVQLVESGAQVKKPGASVTVSCTASGYKFTGYHMHWVRQAPGRGLEWMGWINPFRGAVKYPQNFRGRVSMTRDTSMEIFYMELSRLTSDDTAVYYCAREMFDSSADWSPWRGMVAWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Natively glycosylated HIV-1 Env structure reveals new mode for antibody recognition of the CD4-binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
total genus 29
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2016-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t3xD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t3xD01
3CVHB 4U1IA 1WWWX 2ATPA 1WZLA 1MRCH 3GIZL 4KTYA 1VFAA 1LE9A 5H2BA 4P4KC 4OCYH 4J4PC 3L95A 5T1LD 5T1MB 2L7UA 4QY8A 2GJ6B 5C09B 2FHBA 4BH8A 1LK3L 3BXNA 5KG9B 2B7DT 4G80B 1H3PH 1FGNL 5BVJB 1RHHA 1H3GA 5F7DA 2XXCB 3GFUA 4MDJA 2DQGH 2J6EA 2DJUA 2Z31B 3QDGA 4L4VA 6FABH 5HDQL 3V5DA 2DMCA 4KI5C 4BSWA 4XBEH 3ZE2F 2O26U 1EEZA 2C26A 3WNKA 2FR4B 4CADA 4WUKL 3QR2A 1OP5K 1IGCH 2YHGA 4UTBL 3IVKA 1JMXA 4UBDC 3T1FA 3S5LB 3HFML 2MNUA 1RZIA 4EN3C 4PUBH 1KLFA 4X6DA 3LQMA 2BVUA 5DVMA 5FM4A 3FO2B 2O5XH 1KTLA 1NLDH 3O11A 1BJ1J 5JO5B 2G60L 1M05B 4CW1A 4XAKD 4UB0L 1A5FH 3U4AA 1HXYB 5J3HD 1ZWIA 4R2GC 3L1OL 1RIUH 2Z4QA 5E6ZA 1DBAL 1N3NB 3AMKA 2ZKHL 3S98A 4AEHL 1E28A 4BSWB 1JN6A 5HHOE 4XP5H 4ONGL 5DRZA 4Y16C 4AM0A 5DMKA 4AZ8A 5I19H 1CG9A 5IG7A 2MQCA 5K33A 3SDAD 3ARUA 4Y4FC 1QR1A 5C92A 3KXFB 3MJ6A 2JCCE 5KVGH 4L29B 1QEWB 3BRGC 1N6UA 1MF2L 1ODAA 2VDQL 3D3VB 1JPSH 3W39A 3MRGA 3OR7B 3IDMA 5TE7L 1CGSL 3V4PL 2NY6B 5C8JB 1MFAL 1WZKA 2HFGL 3OXRA 1G6RH 2VOTA 1UACL 4X6CF 4PJCB 2B0SL 3UBXG 3QFDA 1QSED 1V7NH 2DIAA 4G6JH 1R3HB 4AIZB 4KROD 4OFVA 5L8JB 3ARZA 1AKJB 1GYAA 4OLWL 2OQJA 3WLWC 1IAIH 3P77A 4R0LA 5HSFA 1KGCE 1FN4A 5A16B 3VG9C 5KTEH 2R1YB 4O51A 1A4JA 4K8RL 3BKML 5C0GA 4WIQA 1TQCB 2FHFA 1P4BL 4MA3B 1G6RB 4BKLA 1U8HB 1XR9A 2FYYB 2VDKL 3V4UH 4WFEE 3HC4H 1OGAE 3W9EB 4GMTL 4Z7UE 3P9MB 4K8RC 3ZYJA 1CU4H 1NUFA 4Y1AB 3UTOA 3OKDB 4NHUA 2E7LC 3AROA 3VWKB 3DJ9A 4Y4KA 3DARA 3RWHA 4HUVB 4NT6B 2J4WH 3CFJA 4RQQB 2P43B 4JJHA 3C5ZD 3ARBD 3OKKB 3JSSA 2HAZA 3DUUA 5EN2B 1BQSA 4JZJA 2FATL 2OZ4L 3LB6D 3DI2B 1VPOL 1IC4L 2Z9TA 4OFIA 4C54A 1CK0L 3S4SB 4RRPG 4HCRA 3OF6A 3QNXB 1CDUA 5DR5L 1G6RL 5SWSE 3CU1A 2VC2L 3MLYL 1CLOL 2HG5A 2QQNL 4PRIB 4Y1AA 4XVTL 2R0LL 4YBQC 3ZKQD 4CN4A 2W59A 4X6BA 4NJ9H 2CUHA 1CIUA 4M7ZC 1OTSC 1F5WA 2C3VB 2HTKC 4JG0H 1WF5A 3DUUB 2XACC 2ICCA 5DGRA 3RUGB 3MRQA 2DQTL 5FYJL 5E1AB 1IKFH 1SYSA 3LD8B 1TTGA 4LEOA 4PJ5A 2NY1D 5IWLC 2E6JA 3O6KL 1JGLL 2GUOB 3HN3A 2VISB 4MJ5A 2EZ0D 5GGSB 2A38A 2ESVE 2ZWLT 4HT1L 4YHIB 3B9AA 4NNXB 4PJFB 5FYLE 5HHME 1S9YB 2X4RB 4LHUB 5GS1A 2VLRD 4JG0L 2AEQL 1DQDL 5DD0H 4GXUM 1N8ZA 2CRMA 2DM3A 4ODBD 3KPLA 5KVEH 3GRWA 5CWSA 4OQTL 3U30B 1KLGB 1IAOA 4RIRB 3SCMB 5JOFB 4LQFH 4WEUD 2WWKT 3E2HB 3LEXA 2R29L 5GGRB 1AO7E 2ZPKH 4QCIA 4LBEB 1Z6JT 1T22A 4MJIE 3VG0L 1CFNA 1OWRM 4OCWL 3MUJA 4M43L 1T04A 2EC9U 4L5FL 3DX6B 2H32A 4P59L 1FIGL 4U6YB 4M6NL 1RZJL 3H42H 2R0WL 5E56A 2FECI 3MRGB 1BQLH 1KULA 1NCDL 5DMIH 2J8UE 3MLXH 1IM3B 2VR9A 2N56A 4OGYL 2BMKB 2VLKA 4HZLA 3TPKA 3KYKH 3RWJB 3D39A 3IDNB 4QOKB 3KJ4C 1KN4L 4P0DA 4N9GB 3S36H 3SCMD 1OB1A 4RAVA 1PZUB 1T5XA 3SDXE 4Q9RL 1YJDH 4LP4A 1N6VA 5JORA 1C08A 1F42A 4PTTA 3PL6D 4OZIB 1XF2A 4NOFA 1NBQA 4Y5XB 4L1HA 3BT2L 3GMLB 3LKNA 3TFKC 1UWGL 3OXSA 5BMFL 4HWNA 5I1JH 3BAEH 5ERWA 5B8CB 4QOKD 4X8XA 1FSKB 3AM8C 2IH3B 3D2UD 3S35H 3EZ8A 3HAEA 3EOYG 5JUEL 2AKRA 3P40A 1BZ7A 3UZEA 4HX1B 3ZLQC 3TJHC 1FG2B 3ZDZE 5LGHL 3QQ3A 1M7XA 1H15B 1Q1JL 2Q8AH 4MB4A 3BPNC 4PGZA 3VMOA 4JHWL 3VGBA 5CGMA 1FZJB 1JP5A 3DROB 3X11B 3I6LE 4M93C 5E94B 1KCRH 2LTQC 4LCIH 4NUGH 3ARGD 4HD9A 4JDZA 4TSCH 3P11H 3WDHA 2FJHA 4HIXL 4X6CE 5E4IA 5ITFA 4IMKC 3VGEA 5HHMB 1CXHA 1MQKL 4M1DL 5I73B 4E0RA 5L88L 5EUOF 4QRSA 2YD1A 2DLEA 3GSRA 3MFFA 1TTFA 1G7IA 5DJCB 4ZXBA 3PDOA 3SHSA 4M48L 4XXDA 3EOTH 3BIAX 1HKLH 1B0GB 4NKIH 1XGRB 5T5FL 3WFZA 5JHDB 5J1AB 4WVRA 2WBJC 3DTXB 5JR1H 3VXPB 4MCZA 4MXQC 1PQZA 1FNEB 1RZIB 3L5IA 3MGTA 1TETH 3I85A 4YHOH 3GI8H 5FO7A 2BRRH 3FB5A 3CJJA 2X4RA 4LHUA 3MLPA 3QI9B 3CDCA 4LCCB 5EU5A 3DUHA 1PG7H 4ZD3L 3A67H 4OZGA 3KJ6L 2A6KA 1CFTA 3F7YA 2WNGA 3UO1H 4TPRH 1FNSL 1YEDB 2EXYC 1HNGA 2OTWB 2W38A 2PXYD 1MQ8A 1QNZH 3BGFC 4K71B 3B8YA 4HKBA 4MD5B 1ZT4B 4YDIL 2FWOA 4TSCL 5MEOB 2QL1A 1UZ8B 4X99B 5HGHB 3MCLL 1K3ZA 4TUOA 1U8OB 1IGMH 2UWEB 4A6YB 4ZNEE 2VLKD 3EDFA 1U8NB 2VE6B 3EGSA 1NMCC 3HLAA 3EZJB 2BVOA 3RTQB 4S10A 3JV4B 3Q1SL 1GHFL 3LKQA 3NACH 3D85D 3PNWB 4QHMA 4BELD 4HDIB 3LKPB 1W0YT 3RZCB 1Q9WA 4Y89A 2PR4L 2E6QA 1OP5H 1YMMA 3HI1A 2N7BA 3Q3GB 2Z8VC 5T5NF 3WFBH 1WBXB 3O3AB 1EGJA 1UH3A 5ESQB 2IGFL 4PLJC 3VG0H 5JQHC 5DXWA 1NC2D 4OD1H 1U3ZA 3TIDA 3ZYIA 1XCTB 4R9HA 1TVHA 1IAMA 1A6VH 2D7QA 3STLB 5K59E 1JK8A 4BFEA 3DGGB 5F44A 4Y1AE 3WFCL 4U1HA 2I5YH 4U1KB 3ZKMC 5IOPB 1WZ1H 1S9WA 3O2DA 1KPUB 2FEDC 4QHNA 4L3EB 3O9WC 3ARGC 3BKMH 3CVIL 1IFHH 3QZWG 5JDSA 3DOSA 3VFPB 4IRJC 4HH9A 5I1DB 1JPGA 4PTUA 5FYJD 5JPNB 4PY7A 2C1OA 3QDHA 1FFQA 4X9BA 4EDXB 3IDYB 4WFHE 1J9CT 5DVLA 2AJYL 2XZQH 1U41A 1JPST 1RQ5A 3DURB 4LHJB 1QBBA 3S3PA 3PJSA 3VXME 1E4JA 1UB6A 4EQ2A 3DHJA 3U7WH 5AG8A 3C5ZB 1LEGA 4M9OA 1KENH 1VFUA 5FOBB 2XOTA 2CKNA 1ZLSL 4OCLC 4HJGB 3GJEA 4JRXE 1I8LA 4JCMA 1TIUA 4PJBF 5IBLD 2VIRA 4ZUWB 2PO6D 2VLLA 4S2SB 4IJ3B 4WWID 5FUZL 2UWEE 4JFFD 1A7NH 3G04B 5D1ZD 1DTUA 5DR5H 1PW3A 1KPVA 5IB3A 1X5AA 4O2CB 5DURD 1BFOB 1HH6B 5I1HH 2ADFH 4LIQL 2IANB 4MCZB 4MHHG 4ZPTA 5DT1H 1FYTB 3FOMA 7FABL 4D3CH 4WI6A 5C0DA 1CFBA 1ERNA 1UJTA 2ARJQ 1FSKC 4ELME 2VDLH 3B5TA 2C5DC 1BOGB 3GK8L 4LFHG 4NZUL 4APQC 4KK9C 2YSSB 5CILL 4GW4A 3T4AB 3N1MC 3QIWA 2YXFA 2DQCL 1F45A 1OL0A 3WEXB 4AG4L 5E2JA 5JOEA 1I7TA 5I16B 3MRLA 4WUKH 1A7QH 3RGVB 4LOUC 4ERSH 2YD3A 4UTBH 4XTRC 3MLYH 1M4KA 1NGPH 4ZAKD 3JWDL 3MV8A 2B4CL 4NQEA 2E9BA 3FO2A 4LSQH 4PB9L 1RUMH 2CDFA 5CZVL 1IEHA 5ACZB 3GDBA 2V17L 3ARFC 3GMQB 4MJ6B 5CD5D 2BCKA 4Y4KD 3KG5A 3QFJD 5HYFA 4H1LA 1NDMB 4XP4H 1A4JB 5AYUL 3REWB 1LK3H 1E6OH 3FB7A 2ITCB 4CJ0A 2EE6A 3MBEB 3BN9C 3MUZ1 5HD8C 3PUCA 2ZPKL 3E8UL 3RL2B 3K2UH 4NKMB 4JVPA 1K5NB 3JWDH 1W72B 2H3NA 5IVXA 4HIHB 3SQBA 4JCLA 4ODWA 3MYJA 3TP4A 1IQDB 4X5XB 2EDNA 3X3GL 3HNTH 1ZT1B 1CXEA 4UTAH 3WJJA 1CBVL 5D5MB 3BDXA 2IMMA 1GPOH 2F19L 2FX9H 3U4EA 1ZOXA 1A9BA 3VRLE 3IDMB 4OUUB 2YR3A 4QXTA 1A7PH 1RSFA 1KCKA 1N64L 1I1AB 2RJMA 1H5BB 3CZFA 1I3GL 3B4NA 3QEQE 2KKQA 4LIQH 1V7NL 5TH2B 1WIUA 3KWWB 3NPSC 4JFPB 4OZFH 4I8DA 1AR2A 1LE9B 1DN0A 3O41A 5IVZA 1EXUB 3C08H 4O02H 2DI8A 1KT2A 4P4KA 4WFFD 3KJ4B 4ZUTA 1F02I 5IQ7H 1YYLL 3MC0A 1U42A 5GGQH 3DV6A 1N6QL 2OSLB 3BP5B 2EDYA 5FYKH 5IMOB 4IRJB 1U58B 4QRRA 3S8WA 5T3XH 1N59B 3GJFA 4OZFB 1T0MB 5C0BE 1V3MA 2VISA 4MAYA 2EKJA 5C6TH 5IR1B 2EXYD 1I1AD 1LK2A 3HZYB 4WFGD 5DFTA 3FJTA 1FIGH 4J4PD 1A6WL 2MMXA 4MD4B 3T77B 4BFGA 4L4VD 4NQDE 4QXUL 4X7EC 4UOW1 5ILTL 3LIZL 1C12B 4NQCE 4NQUA 4UV4L 1D5XA 4JKKA 5JA8B 5CSZB 1IC7L 4MAUL 5IB3B 1AC6A 5I1KL 1ZKAA 1T66D 5LGJB 3T0EB 3W0WE 4YX2H 4FP8L 1NMAL 1DBKL 4JEGB 4L8SC 1DCLA 1VKXB 4WW2A 2IAMC 3PGCA 4XNQA 3FN9A 1EEUA 4BZ2L 4KJPD 4W6YB 4MD0B 1DE4B 4U1LA 2NW3B 3QCVH 5FFLA 2YSSA 1TPXB 1DVFD 1A3LH 5L9DL 1B0RB 3MSPA 4GQPH 1K9TA 1G84A 4OLEA 4EI6A 1BD2E 5D9SA 4YBQD 2YD8A 2A1WH 4LLMB 3MCKA 4ZOBA 3T0WA 5I1EL 5CAYB 5DWUH 4Z7NF 5C0AB 3DO3A 3TZVC 1ZS8A 2D03L 4CVXA 4AK1A 1U8PA 4XCNA 4P5KA 5DVNA 4WJ5B 4YR6B 1I3GH 2DQDH 1S9VB 1A14H 3UMTA 5HDOA 1ROWA 3MZGB 3BJLA 5I76A 1AC0A 4R7NA 1Z5LB 3HB3D 3KS0J 3MRCA 4C59B 3N06B 3WSQL 2DWEB 1S9KC 2G5BB 4JR9L 4L8SB 5KSAC 1PLGL 4RFEA 1LP9E 4I48B 4PD4J 1CT8B 4RZCA 4PJ5E 4LCCC 2XWBA 4PGEB 2FJFA 2R1WA 2A9NL 4HS8H 4NHUB 5SWSB 3EOAA 2MPAL 4KJYB 4L5FH 1LO4L 1MCCA 4Y5YC 1CLYL 3IU3A 3MV11 2A6DB 4FQ2H 5A2FA 1N2RB 1AQDA 2HKHL 2VL4A 1QQDB 4G8EB 1FL6B 4F7PA 3LKSA 1JHLL 1QFWH 4WDIB 5GRJH 1C1EH 5EC1B 4QYOB 1UJ3A 4HWEL 3OQ3B 3RWJA 5T3XE 3MRKB 4I48A 1IM9B 5GRWA 1CT8A 3JV6A 3UXFA 3WUWG 3F7VB 3A6CH 2FZ3A 5KVMC 4CN1A 4RX4D 1BIHA 4NM8H 2XN9B 4OD1L 1OSZB 3AS0A 4GFTB 3WYRA 3ROLA 5IVXF 3NCMA 1SM3L 5DO2D 2WQRA 2DTMH 1E4KA 5KVFL 3MFFB 3MXVL 5C07A 4MAYD 3G5XB 4UT9H 4XC1L 2JTDA 1WISA 4IRSA 3ABZA 5I1LB 4Y4FD 3OGCA 7FABH 3HE6C 2BSRB 1ZE3C 5I1IL 4MYWB 4ZS6D 4IEFB 4WEBH 3WXVH 3BEWA 1H0DA 2JB6B 5IR1A 1MFNA 4QY8B 1FG2A 2QQQA 2DM7A 4WW2F 5GRUL 3HZYA 3NIGE 3ZT5A 4HPYL 4JQXA 1D5ZB 5TQ2L 1ZHKA 4Y88A 4WUUB 1JNNH 5JXAH 4JPIB 5D7JA 4MNGA 2DI7A 3BE1L 4I3RH 2F58H 4Z9KB 3P0GB 3NZ8A 4KDVA 4X7TA 2ORBH 1AGCB 3W82A 1NSNH 3O8XC 5ALCL 5GRVK 3BGAA 4H0HB 3W0WB 2NY4C 1J8HA 3BAEL 5GSVB 3E6FA 3PQYD 3WN5C 4GUPB 1A7PL 3I6LD 5IP4A 4YDKL 5EFIA 2E9JA 1SBSL 4Y2DB 1LO4H 1CDCA 4NQCD 4NQVA 1WLHA 3ARTA 2DWDB 5INCB 5IESH 3RWFB 1YPZF 4W81A 5HHVH 3S37H 4GKSA 4N1HB 4JO4L 2WINA 4YK4C 1R3LB 5GS3A 4OCNC 1MCPL 4LSUH 5EO0B 2AJSH 4LLYB 3CSBA 1M7DB 4GQ9H 3BP4A 2PW2A 5LBSL 3TNMB 3IKKA 4EBQH 5I1KH 4Y5YA 3DVNB 1H8OA 5I1IH 2VUYA 4KK6D 2F74A 4DTGL 1KSRA 1W0WA 2P7TB 1NGWA 2J5LB 1Q94B 5DSCA 1Y18A 2XY1A 1ES0B 5C6WH 5IEHA 4OZIA 4YHPB 1MQKH 3TIDB 3K81A 5L2JB 1WAAA 1WWCA 2ITCA 3EJYC 3G6JF 2BNQA 2B4CH 3V8CA 5F70A 2LVCA 1GGIH 4LSVL 2JK5A 3J7HA 4D3CL 5E2VL 3AAZB 3KPNA 5TDOA 4U1HB 5C0FB 3O2VH 1GGBL 2Z31C 1L7TL 4PGDB 3SKOA 1JPSL 5JORB 3TV3L 3F7PC 3WIFB 3BKJL 2OQJB 1ZLWH 4MQXC 2CDGB 4NQEE 2FLRT 1S7VB 2Q6WA 3MACH 1FIEA 2W9LA 1FZMA 3PDGA 4LPXA 3FOLA 2D9QB 5E6ID 1INQB 3BGMB 4PY8J 4Z7NE 1QLRA 4R2GB 3JV6B 3UAJD 4MXVE 2NNAB 3WKML 5I8CA 4JZNA 3HZMA 4EEEA 2R15A 1BAFH 1QKZH 1K8IA 2WBJB 3OR6B 4JY6A 1CE6B 5ILTH 1WBXA 1XGUA 4V1DE 1AGBB 5F9JB 5IVOA 1T20B 4F37K 5FUOH 5E5MB 1IVLA 5DD6B 4OBSA 1MSPA 3X14B 4LARL 3PWJB 1J0ZA 2P8MB 4OIBA 5IMOA 5D7SH 4HEME 4P3CH 5CMAB 2R2HB 3K0WA 3D0LB 4R26H 4R8WL 4FXKA 3G6AB 4LCIL 4NUGL 5HYEA 3MGTB 4P2CG 4HUXB 1J1XL 3I9GH 1A1MA 3SDCB 1LILA 4RGOH 1P2CA 4XAKE 4RAUB 2J8OA 3T4AA 4MQXD 5C07D 1UB5A 4PJXF 5C09E 3GHBH 3BIKA 1VACA 1WTGT 3VFTB 4F2MA 1TZIA 1A6ZA 3ZKXC 4MWFB 2Z8WC 2VDNL 1HOCA 4FFWD 5AYQA 2GFBA 4DGYH 4OF6A 1AR1C 3KPRE 4N0RA 3T2PA 4HXAL 1RULH 5HGHA 1QEWA 2YK1L 4P57B 4DEPC 1IC7H 5A2JH 4JN1H 2V2TA 3W9DB 4HEPG 3U4BL 3WN5B 4PJ8D 1JUFA 4DKFL 3E6HB 4NP4H 5I1AB 4ZOAA 4P5TC 2EO1A 3I6GB 4POYA 4YAQB 5DT1L 5BZWA 4ZFOA 4U1JA 4AEIH 3C8KA 3LQAC 4KFZC 1FAIL 1MAJA 2D7TH 4RCAA 1JBJA 2F74B 4Q2ZB 4JPKH 4YUEL 5DJAB 1CZ8L 5I76B 5DHVH 1E0OB 5C0AD 5JO5A 3MNWB 5AD0A 1N0XH 3NCCB 5IIEB 1F4YH 2Y72A 4NN6C 3QXDA 2BNRD 1FJ1A 2MHAB 2KQMA 2VB5A 3RNQB 5ESVB 3VXRD 4WI3A 1WEJL 1OAXL 1UH4A 3RIAF 5IB2B 4KK5D 3CDGB 2MOVA 3GHEH 1I7ZA 5T3ZH 3P4MB 4Q0XH 3VU2A 2OJZL 4MMZC 1EZVY 4POZC 2VDNH 4L9LB 3IFLL 1NANH 1IAIM 3LH2H 4QT5A 5DUMH 4X80H 4LVOB 2R4SL 4EXPX 4PBWD 1F00I 4HPOL 4R4FL 4WEMB 3CFJB 1JE6A 3O4LA 4J7RA 1CR9H 4LNVA 5F9WB 2QTEA 2PR4H 4G5ZL 2AXFA 1OP3K 1FLRL 1D3CA 4GLRH 4LQFL 3ZE1E 4HV8A 4ORGB 2C3WA 4WGWB 5J6HB 3GMPB 3I2CL 2X7LB 4J6RL 3P4MA 4HWBH 4JREB 4OTXL 2BY0A 4PRAB 1E4KC 3U1SL 3OV6A 5KANG 2HG5B 4D9LL 5KSBE 3RBGA 3O6FC 4JY6B 3MO1A 3B2VH 1LK2B 3MLWH 2BK8A 3D85B 4KRPB 5EZJB 3DUSA 3REVA 4N0UE 3LN5B 2OM5A 5DQDH 4KUZL 4LLDB 2A6JA 2WBWB 3IAQA 3OKNB 3K7UA 3C5SA 1FGNH 1S3KH 1MH5B 3DPBA 5AZEH 1K4CA 3SGEH 1UQSB 3WJJC 1A14L 5E9DA 4QHLB 3RVXD 3UEZA 4LAJH 3ARWA 3DHMA 4O58H 2AV7B 4K7PL 5C0DB 5GSRA 4Y19E 3LS4H 1EX0A 4YIQA 3OKEB 2WLYA 2ZCLH 5GS2H 4IRZH 1KCRL 4JO3L 4BZYA 2W9DH 1MFBH 1JFQL 3LH2L 3MV8D 5EOQH 4XNYH 1HQ4B 4YHLH 1OF2B 1RU9L 1CTOA 4RA0C 4PJ9D 1U8MB 1BX2A 4Z7VE 2VLRA 3VXOA 3RVVC 5EOCL 3ULSA 3JWNC 5J3HC 1L6XA 4AM0B 3NH7H 1IC4H 4KKBC 1ZANH 3SPVB 2DDQL 5IROA 1HILA 4O5LL 1IZKA 2H2PD 4XBPB 1S9XB 1NMBH 5GGTH 4R7NB 5FF6B 4Z95L 3RVUD 2BJMH 5F6HI 1CXFA 1L9NA 2ZUQC 5D72H 2X41A 4K71C 4NJ9L 1U3HC 3EFDL 5BXFB 3EOBB 4JPVH 4ISVA 3KPQA 3MOQA 3VFUB 1YEFH 4YDVB 5EO0A 4J3OC 4KVCL 5CBEA 5C0BB 1SYSB 5L0QC 5MENA 5HBBA 5C0CA 1KEMH 4OZHB 1MIMH 2EIBA 3T2OA 5T33H 1FAKT 3BDBA 3SPVA 3CMOL 3VW3L 2XA8H 2ICWA 2X5PA 2CDFB 2BNRA 3C9NA 1BWWA 4NZJA 1U8KB 3GMOB 2ZCHL 5F7UA 1A47A 2NY3D 4JO4H 1KACB 2G9HB 1FL5B 2ZCLL 3QULB 4PGCA 4OI7A 3B9VA 2Z35A 2AJZA 4MX7B 1C8PA 3QJFA 3SDAA 1OGTB 2WW8A 5C0GB 3T2NH 3TJEH 4LLMA 4CU8A 3IGAA 5D2NB 5SWQB 4J2XA 1ZVSA 4K23H 4P2OC 5E6IB 5DFVD 5GS0D 1B6UA 3HAEB 4ZAKA 3P9MA 2VXVL 1CGSH 3ZKXB 2IPKA 1CFNB 3ZE0E 4UDTB 4OKDA 1H3WM 4J8RB 3G5ZB 3IDXH 4Y19B 3O3AA 1Z5LA 3SJVB 5F1KC 1I8MA 1S7VA 4O2EB 2Z35B 4YNYA 3G6JB 2X70A 4Y4HC 1KCUL 2CUMA 1GGUA 1QA9A 4OGAD 2BNUB 2B1AH 2EC9T 2YBRA 4OLWH 2R39A 4HV8B 4X4ZA 4XXCC 3BP6A 1L7TH 2Z92B 4X4XB 4IRJA 4PP1C 1KJ2L 1H3XA 5JIIA 1P4BH 3BPOC 5F7KC 1C5CL 2NY0B 1IGJB 3G08B 3D48R 2FB4L 2D03H 1ZA6A 4PJAF 4LKXB 1K8DB 4IIQA 1IKNC 1OTUC 5DHVB 1MCOL 4FQJL 4LLDA 5F3HA 4S1RH 1SJXA 1D9KA 3DV6B 4OZ4B 2W1NA 1KJVA 4JQVC 4P2RD 3FQXA 2FSEA 1KB5B 2H1PH 5BS0E 4CU7A 2HT3D 2CXKA 4EZMA 1KEML 4NJAH 3TIEB 3O3EB 3ULUL 1LEKA 5FUOL 4Z7WA 4RBPH 4PBXA 1T21B 4KRMB 5KG9A 3LDBB 5JTWA 1GGTA 1MWAH 2VDML 5F1SA 5HPMB 4HBCH 3FL7A 2Z8SA 2XNAB 3N50A 1DUZB 3RWDA 3BRFA 2VDLL 3OAUL 4O00A 5C0EA 3K74B 4NSKA 3HMXA 1EMTL 4U7SA 5D2LE 1J0YA 3CLFL 4OI8A 4MD5A 5AZEL 4XP1H 2Y7QB 4WW2B 3LEXB 5FGRA 4GBXB 5FYKL 2V2XB 3N85H 2ICWI 2XZZA 3LMJH 4GAFB 4PJFE 5A2KH 2XWJB 4XGZB 3QDME 4IRZL 4XCYB 4NBXB 5FHBH 3SGKA 2R8SH 1AY1H 2AXGA 2BVOB 1E28B 5EU4A 1KENL 3S4SG 4Y4HA 3T0XA 3IETA 2IG2H 4OLZL 3PWUB 3X12A 1R3IL 1Y6NR 4U3CA 1IAII 2IPTL 1NCUA 4XVSL 2OCFD 2NXYC 4OZIE 2IC2A 3VFVA 1XR8A 4IM8A 5SWSA 4HKXB 4PPTA 3UBXI 3LKRA 5ISZE 5FV1L 3M8OL 3KPRA 1NC4A 2W9EL 4MA1B 4ZUSB 5JIHA 4ZO7A 5KS9E 3WFHA 4L8SA 5CJBA 4BQ8A 4F33B 2XKNB 5CBAA 4XPBL 4LLYA 2GK2A 2GTWA 4MA7H 5F3BA 1CD8A 5E5RB 3ZO0A 2DIJA 4JPWL 1RK0A 3TBTB 4X7SH 4L3CB 2HLAB 4PJDB 4MAUH 2UZYB 4A6YH 2E8ZA 5CEYB 3ROLB 4ACPA 5A16A 4H0IA 3NCJL 1A9BB 3KLHC 2B2XL 2A9NH 1B88A 4IS6B 5DK0B 4DJMA 4PB9H 5BVPL 1GHFH 3NACL 4AYFA 1XIWB 4V1DA 5E8DH 43CAA 4P46A 2GK0A 5C9JA 1A3QA 5GRXG 3SDCA 1MCQA 4LLUB 5CEYA 4FA8A 3CSGA 3PHSA 3LZFH 3A6BH 3A6CL 2N7AA 4URTB 5LWYH 3ZKMD 2CRZA 5E8PA 4U1NA 5FYLH 2V2WB 1OCWL 5HYSG 1NC2B 4JB9H 2GSIB 1HCVA 4ZXBC 1KJ2H 4PS4H 4PJDE 1S9WB 5CJQH 5E6IC 5C09A 1S78C 1ORQB 4P2QD 3MOBH 4BQ6A 4GXUN 3SGJA 4WO4D 3MRPB 1J18A 3JV0A 4TN9A 4FNLL 3RP1A 4BZ2H 2HMIC 4KK9D 1OOAA 5KW9H 5EIVA 4J6RH 4UNTA 3VGGA 3KPOB 2HT2D 4KROB 1UYWL 1VGKB 3U7WL 5DRNB 3SE3A 3MZTA 2YUWA 5C2BL 4C56B 1J7VR 4UV4H 1RFDL 3ARDA 1FO0H 1J10A 2XWTA 3QDJD 1HHHA 3P9LB 4KWUA 5CEXB 3QFJE 4S2SA 4NFDA 5BCAA 2VZSA 1AGEA 4XPGL 3EYSH 4M1DH 1TZIB 1FFNB 1T7ZA 4ENEC 4NQSA 4NDMB 4WTXA 5GIRB 4NBYB 2ZJSH 1UACH 3BP4B 5JNYB 4APQB 2GEEA 4ODUB 4F3FB 4OBRA 4AJ0A 4UQ2B 1R3KA 4TUJA 3FB8A 4JN1L 5TPWL 5DHYB 4QO1A 1X44A 2W07A 5DLMH 5MEQB 1GOFA 1HSBB 1PYWB 1YEJL 4QXTB 3C60D 5BV7B 3QA3A 1CDGA 4D0CB 5L8KB 3RX5A 2I60L 4U05A 4YH6A 1F4XH 5AWNH 3WXWL 3KPNB 4JFEE 4ONGH 2BVEA 3GB7A 1QSEA 4ODTH 3S3SA 3T1WA 3V7AG 2XWBB 4PGEA 4XMLH 5C08D 2VNCA 5SWZD 2P4AB 4PJAA 5ACZA 4ODHH 1FC1A 2CLZA 3FCTB 3MLRL 4R0LB 3QXAB 2Y4SA 3C6SA 2OXGA 3AREC 2OL3A 1A2YA 2Y07L 2HVKA 3QBTB 2GY5A 4JG1H 3U9UB 1P9MC 4HXAH 2V5MA 4DQOL 1VHPA 1FZMB 1JZ4A 2RIKA 3KYMB 4TVPD 2HLFC 3H9HB 5CCKL 4IRJD 5DEGA 3P0YH 3QO0B 3FQTB 2BOCA 4G6FD 1HNFA 5B21A 1X3DA 4IOFD 4BFBD 4F7TB 3RRQA 4RSVA 1WGOA 3AS2A 1AGBA 1MUJA 1NGZB 1ZT1A 5D7IB 3VWKD 2ILLA 2F9BT 1RUML 4GSDH 4QOKE 2LABA 3MJ8A 8CGTA 2EYSB 1RZKL 1QUNA 4OZGF 4IOIB 3DMMC 4JQIH 4JKLA 1IRAY 1IEAA 1KB9K 1SEBB 1FPTL 4H5SA 4OTXH 2X4TB 2YKLL 3UTSB 3NFSL 3U6RB 1SJHB 2X4OB 4PG9B 2OYPA 1KCUH 1MY5A 4G42B 4G9DB 5D1QB 1M05A 2GJ6E 4CW1B 3FQNB 2ZUVA 4ODHL 5B38G 2DKSA 4GW4B 2WMPA 3MLRH 4YGVB 3T3PE 2RCSL 3TN0B 3O2VL 3QQNA 3VRIB 1A6ZB 3MGAA 1XGQA 1MJJA 5B39A 3RGVA 4XB8A 2ED8A 4HIXH 2B0SH 1FNEA 1AJ7H 5I1HL 2O61B 2EKSB 4NO0D 2IAND 4C56A 4MJID 3PIQA 3U0PA 3QUXD 4PRNA 4CVZA 2JJTA 4P5MB 5DEFB 1ZHNB 5EOQL 1QYGH 2VYRE 5GS1B 1ETZB 2GITB 1XF4B 3B5GA 4MHHI 3SDAB 5ADPH 5HHPA 1I7UB 1G7JB 2NPLX 1IM3A 1DVFA 5E8DL 3GMRA 2WUCL 3H7BB 4YO0B 3KYKL 2NTFB 2Y06H 1HHJA 5DK2B 3G6DH 2Q8BL 2IFFL 2OK0H 3HNVH 2GJZB 32C2A 5GGRA 1XGYH 2H2SC 1TJGL 3VD4A 5DD3H 5LWYL 3L3HB 5FYKD 3FB8B 1S9YA 3PV7A 2FL5B 3VXRA 4Z8FL 4ZD3H 3ILPB 4OFDA 3MBXL 5CIPA 2BSED 1QA9B 1CICC 2AABH 3P30L 2OR9L 4W4OC 5DYOB 5C0AA 2GSGB 1R5VA 3V6FA 3R06A 5F21B 1SVCP 5DURB 5I8OL 1OAUH 1QFOA 3V6ZB 4YDIH 2ZOKB 3E1F1 5ANMB 3LN9A 5HDBE 1NEZB 2FZ3B 1WEJH 2Q76B 4HWZA 5SV3A 3VRJB 3O41B 3WIFA 4WHTB 3GMOA 1BFSA 4IIQB 3NA9L 3ULUF 4F7CB 3VH8G 1CVRA 4PYGA 2W0FA 3QIUD 5DC4B 4XX1G 1OGTA 4X4YA 1CZ8H 1OCWH 2B1HH 2YD2A 1EFXB 4JE4B 3T65A 2WUCH 4OZFA 5MENE 2EDHA 4LK4A 5D71H 1WV7T 3ZT6A 5ESAB 4RAVB 4BUHA 3MV7A 1I8IA 2AEPH 3QPXH 3TA3D 3ULVD 3AY4C 1CE6A 1PEZA 4ODSL 1G9NL 1XCQB 4Z77B 1IGYB 1OAQH 1QBML 2PF6A 2DQGL 3MV8E 4FNLH 3GSNH 2QSCH 1QYGL 3UTTB 3C08L 3TH3T 1KJ2A 4NO2B 4LLQA 4FG6C 4WU7B 2YUZA 3OZ9H 5B8CA 2NXZC 2R1XA 2EDWA 2PETA 4LEOB 2UUDK 1UB6B 4PJ5B 3S7GA 3OX8B 2R2HA 4TSAL 4K3DL 1CLCA 3Q6GH 1RUKL 3CSYB 2JF1A 4QHKI 2J8HA 1SBBA 2DJSA 5HI5D 3L5WA 2B2XH 4BJLA 1ZEAH 4NWUL 5BVJA 3X11A 2BVQA 3O9WD 3FMGH 5LCVH 1BGXL 2RFXB 4K9EL 4XXDB 1KJ3H 2ZG1A 3MCKB 1K2DB 4R3SA 5CBEB 4P2QB 4ESKA 1HYSD 2PW2B 4FQXA 3TNMA 4JRXA 3ZKND 4LPYA 4GRMA 3S36L 4PRPB 1VSCA 2O61A 3V0WL 4LNRA 2A77H 3MCG1 1OPGH 5IB1B 4JY4B 3UDWC 2XYCA 5L88H 1EEYB 2X9XA 3V79C 3H9SD 2EEDA 4LSQL 1JHTA 1MAMH 3GMNA 2V17H 1EBAA 5CD3A 5DRZB 1RJLB 3ILQD 2MCPL 5C2BH 4TTDC 5I2IB 1RUAH 3G5VA 1UWXK 1YEIH 1W72H 4ZO9A 5HGGS 4ZFOL 5D7IF 4XPAL 2IBZY 1TJIL 5E1HB 4FFYH 4N1EA 3QRGL 5KVEL 2YA0A 1DZBA 4WU5B 4YLQT 5FB8B 4DZBA 4F15C 2IPKB 3F65A 5IMMB 1YMMD 3IDJB 1F6LL 5JPMA 35C8L 4JFFA 1F58H 5GJTL 5JDJA 2AI0L 4F8QA 4MQSB 4LASL 2XICA 3NFSH 1JGUL 2E3VA 4NQDA 5D2NA 5SWQA 1UJ3B 4LVOC 1DLFH 1CGXA 1IGIL 5I17A 1M7DA 1A7RL 1OP9A 1YYMH 2ATPB 2C9AA 1S8DA 1MCSA 4K3DH 3WO4B 4X98B 2X4QB 2F53B 3IDGA 4OCXL 1PAMA 4G80A 4KUCD 3LRHA 5F9JA 1MCEA 1YDPB 3O3DB 1YNLL 3QP3A 2ZUYA 4I4WB 5JW3L 3EGSB 2R0KH 4ZFZA 4NO5A 1VEPA 1J05A 5A1AA 4OUUA 4XCCL 4M8VA 4YHML 1U0QA 1I3RA 3FFCB 5BW7C 3L3OB 3AVEA 1J86A 4WO4A 3LSOA 12E8L 3HI1B 3Q3GA 4JFEA 4ZDHB 3FN0H 3FO0L 1MCHA 4P4KB 1U91B 3K2MC 4N5ED 5LGHH 4HH9B 3NCJH 3UTTA 1Y6MR 3VFWB 3WD5H 1J05B 4R4ND 4GW5A 3G6DL 3MJ8B 3RDTC 3BN3B 3M17A 4UIKL 3PL6A 1KJMA 4LSRL 4XWGH 1L6ZA 3U0TA 3HI5L 9CGTA 1FYTA 4PJFF 1HH9B 4PRBB 4QHKJ 2C4FT 3VFGL 3CH8A 5GSVA 5FOBA 2GK0B 2EDQA 3OKEA 3FQUA 1X5KA 1C7SA 4JFOB 4LOUD 5KSAA 2APWA 1NBYA 4HPYH 3SGDH 3HE7A 1HIMH 3HKFA 3ZKNC 1FBIL 2HP4A 3FTGB 8FABB 5C8JA 5F9OL 5C0EB 2P8MA 3SQOH 2X9YA 3E3QC 3HC3L 3ARGA 4XNUL 1J1OH 2V2WA 2ZSWA 4JB9L 3TVMA 4UOW0 4HKZB 1ZLUH 5B39G 3SKMA 1BPVA 5BRZA 4Y4HD 1TZHA 4NQCA 2HFFB 2KL6A 1J0HA 1QD0A 2DF3A 3ZSTA 1ZV5A 4KDWA 2YMXL 4Y4FB 4P9HC 1FJ1B 1B0RA 3B9KA 4LPWA 1X5XA 3PABA 3VXTA 1IGML 1J8HD 2NR6D 3CMOH 4GG6E 2YD9A 3RNKB 4NPYA 5CP7A 1FPTH 3Q6FA 4PJIA 4IOSD 2VITB 3MRLB 4GAYA 1OP3H 2BOBB 4FZ8H 4JFDE 5TDPA 1BEYH 1QFUH 4YBLC 5D7JD 3HE6B 4YXHL 2JJUA 3T0DA 1Q9WB 3EO9H 1RZJH 2P5WE 5FGBA 4QTHB 3GBLA 3WJLA 1Z0MA 3VGDA 3MOAL 3QG7H 4XP6L 2AJVH 1IFHL 1FQ9C 2C7UA 5HTSA 2R2EB 3D1MC 5FA4B 3ARDC 5TGBA 5DMYA 3BWAB 3S96A 4YHKH 1J88A 5ANME 3GMMB 3LS5H 3UDWA 3GIVA 2FEEL 2LAGB 2DL9A 4GMTH 4J23A 3FQTA 4KI1A 5JW4N 1ZVYA 1CLZH 4HKJB 5IB4A 4AIZA 2AK1L 1YY9C 5JW4Q 3OG6B 3M07A 4BQ9A 4ODWB 1OTSD 4ZOCA 4JFZH 2CMRH 3G5ZA 2EXWC 2ITDA 1UEYA 4PJCF 5CGTA 5EIIB 3X3GH 3N0PB 1AGDB 5FDWB 3WNOA 3MUGA 5KTEL 2AJUL 5E5UB 3ZDZF 4HJ0C 3TN0D 3QFJA 3LQAL 4JZJB 2R69L 3ZTNH 1MJ8H 1G0YR 4JFDD 1CK0H 1AD0B 2FYYA 1FGVH 2E9IA 3S97C 3QDGE 4KAQH 1ZTXL 4D9RD 1QSEB 1NAMB 3UTSA 3D0LA 3GHEL 2XN9E 1KN2H 3QQ9D 1VESA 2ESVD 3P9WB 1JCKA 4D9QE 4NRYA 5FYLD 4LSSL 1AY1L 2XXMB 1WC7B 5EA0L 3KLAA 5D6CA 1JI1A 3U4EB 4KK8C 4EI5C 4GBXD 3VXSE 2VABB 3MROB 3CFDA 3V6OA 3L3IA 2VQ1A 3GNMH 1I1AA 3EBAA 1YEHH 5I8OH 2FB4H 2A9MH 5FHAL 4AL8L 4LDEB 5EUOA 2IF7A 4H88H 4XC3H 4NQXB 4MD0A 1H9VA 3OAUH 1GC1H 3DUSB 3BP7B 2F53D 4PB0L 5I8EA 4E41A 2QKIB 4NBZB 1MI5D 4ODXB 4TYUA 3BYYA 4RGOL 2V5TA 1YN6A 4K8RD 4HS3B 2VH5H 2W0KA 1JGDA 2VLME 2A9ML 5T5NG 4YR6A 4ETYA 1S5HB 4FP8H 3VDCA 4N9GA 2QEJA 5DJXB 5FHBL 3DMMD 2GJZA 32C2B 4LARH 1QR1B 5FAAA 5D7LB 3WIIH 1CFQA 3TLRA 2OP4L 4XNMA 3L3GB 3AFLA 4BM7A 3RWGB 3ZSSA 4P59H 2LVEA 3HG1A 5CINH 1MJUH 1YPZE 2R0WH 1NKOA 3ORJA 4ZUUB 4NQSB 1SJVA 1OHQA 1GH7A 2H8PA 3R06B 5LGJA 4U3XA 1X4YA 2LU4A 3MNVA 4ODUA 3H2WA 3K8MA 4XZUB 2VSCA 4ERSL 4MZ3A 2P24A 5SWZE 4HBCL 2P46B 2WV3A 3ARED 5J6GB 4PJAB 4O4YL 4R97C 4Y19D 3VFMA 3ROOB 5EO1B 1I8MB 1BGXH 2N1KA 3QUYC 4Y5XA 1FZOB 3HPLA 2OR7A 4FQ2L 4O2FA 3QSKB 3U30C 3RAJH 4I3SL 5GS2D 5HGBB 4B50A 3EYVB 5HYIA 4ORGA 2QV2A 3H7BA 4YO0A 1EFXA 1VPOH 5T3XD 1KN4H 1XF3B 3MGOA 3MRDB 4JDTH 3C6LA 2HT4C 1IGJA 1PG7X 4HCRH 4AT6B 4S1SH 3WNNA 4GKZB 1INEL 1BQHB 4HLJA 4XNZB 1A1NB 3MV9D 2P5WD 3VWKA 2NY3B 4MNHA 1Q0XL 3BD5A 4LAQL 5CEZH 5EZOL 5CEZD 1FL3A 4QRPB 4NGHH 3SDYL 3UYPA 5KAQG 4KDTA 4KJPC 1RAMA 3GMLA 5B3JF 2EYSA 3OXSB 2HJFA 1IT9L 4LVHB 3U7YL 2DB8A 4RWYH 2KUTA 1FNFA 2LTQB 2ED7A 2BC4B 3WXVL 1MCNA 3UTSD 3QEQB 4PV8B 1NFDE 2BVYA 2KPNA 4XPGH 5C9JB 3VRJA 2HT3C 1Q0XH 1N26A 4KJQC 3ZTJH 3O2DL 4Y2OA 1G7IB 1RVFH 1UZ6F 5E9DD 2JJSC 2VR4A 4B7IA 1EBPA 4HXBL 2H45A 3CXHJ 3CVHA 3CMGA 4EOWL 1A7RH 1SEBA 3QDGD 4H8WL 1HHKA 3NCBB 5LJYH 2NR6C 3O4OB 3INUH 4FFVD 3TBVA 5E2UL 1HH9A 3G08A 3HRZB 3FB5B 4UOJA 4P4RA 1SHMA 4J3SA 4K7PX 4L9LC 4X0KB 4MJIA 5JHLH 2DTSA 2OTUB 4P3DA 5EDXA 3L7EA 2W9DL 4M6AA 4C4KT 3E2HC 5ID1B 4I18C 5JHDA 1NKRA 3MLVL 3OX8A 4TSAH 1CIDA 2IMNA 1TXKA 1RPQA 3FQRB 2B1HL 1NBZB 1RV6X 2EDKA 4ZPVB 4MJ4A 5D96C 4KKAC 4DW2L 3IS0X 5DTFA 5IEHB 4G9FB 4JZOA 3QJFB 1DQLH 1AGEB 2R29H 3QCVL 5HDBF 1RURH 2P47B 3MR9A 5AUMA 2Y9RT 2UY7A 3F58L 2P8LB 2OL3H 4APQD 5DYOA 4J3UA 5DZNA 1FZKB 3WFCH 4HHAA 5DD1L 4WENB 3BZ4B 4GXVH 4PJ7B 1OB1B 4M93B 4H8WH 3HZKB 1J8HB 3MRHB 3F7RA 1T83C 1LVEA 3MLXL 3FONB 5DJAA 4JM2B 1DFBH 2HLAA 1X5JA 4KTDH 4L29A 1TJHH 1OTTC 4X6FB 1NCNA 4Y19A 5EO1A 3GSXA 2EEBA 2BSTB 4R6UA 5AZ2H 2VRAA 5HHQA 1KBGL 1AQKH 4ZNCD 2DTML 3I84A 4X83A 4YDJB 1MI5B 3KYNB 1W0VB 3BYTA 1XGPA 2R23A 3FOLB 2XQBL 1MHHA 3VRLF 3H0TB 2Y36H 3OKMA 3Q5YA 2CGRH 3LRSA 1E27A 4DOHB 4FFZH 2H3NB 3GSNB 2V7NA 1PZ5B 1T4KA 2IFGA 2VZOA 3CNKA 4L4TA 1ZK9A 2MJWA 4J12A 5AYUH 5JW5B 3SDDB 3HZVB 1CLOH 2QQNH 1IEBB 4UDUA 2YPKB 1YMHB 4OZ4A 3GUTA 1H5BA 3CZFB 1EJOL 2X1QA 1FO0A 4HIJA 2R1XB 4DK6A 4MVBD 3KR3H 2BOCB 3NBNA 5EU7C 3O4LE 3O45B 1S7QB 3BSZH 1O7VA 2VIRB 1RJYA 1N4XL 3FHQA 5K93A 3RKPA 3GSRB 4YPJA 1KCSH 3MROA 4MXWL 3D39E 4JPIA 1UFUA 2AEPL 4LKCB 5KSVB 4KJWD 3QI9D 1ORSB 1KXTB 4IJ3C 5IM7B 3CX5J 3QCTL 4P2QA 1CGUA 2CKBB 1NJ9B 1XIWD 1XFPA 1YJDC 4BK5A 4NM4L 5BRZB 4KGJA 1JF1A 4GSDL 1DQQA 2XWTB 3VD7A 3QDJE 4H26A 1D5MB 3LPFA 4LF3A 3TBYA 3BHBB 1BM3H 1RHHB 5E5MA 1G1YA 1Y0LB 3B6SB 2IQAA 5E9DE 1T03L 4ZYKB 2HVJA 1UM5H 4PJCE 3FB6B 3K3QA 4ODSH 4Q9RH 4N1CA 5EC2B 3VXSA 3PP3H 3T4YA 3AREB 2YEZA 3SBWA 1NAKH 3OXRB 2OTWA 5BZWB 4PJXB 4NHCL 3BISA 2VXSH 4XPTH 3MV01 1KXVC 2GFBB 4X6DB 1VEOA 3TZVB 1JF1B 2Z93A 1BOGA 1LNUA 2Q7NA 2V2TB 2VLRE 5D1XC 1NFIA 4O51B 1QHOA 1SBSH 5ESVA 3FN0L 5ETUA 5DS8B 4U6HA 2DQDL 5L2JA 4YDVA 3QA3B 3GMNB 3T0EE 1Z9OA 3ARGB 4P5KB 1I1RA 2ZUWA 1P6FA 4I77H 1VGKA 3QUZB 2N4IA 4OFKA 3BQUD 1KIPB 5F96H 2OLDA 3GSVB 3KNBA 1EIBA 2Z93B 4NRZB 2DAVA 4PGCB 2MTPA 2MFNA 2R0ZL 3I6KA 4P23C 4NKQB 5CIPB 1LO3H 3R0NA 1JMZA 4U6HB 4XNXL 3FB7B 3CDGA 4GAYB 1XGYL 4UT6H 5SWSD 3ZDYE 3MRDA 4I77L 4RX4A 4PRAA 2A83B 3OKOB 1CL7H 4HJJL 1DN0B 5SX4H 3OSKA 3MBXH 3FFDB 3MNWA 5AD0B 4KJYA 3LIZH 2MSPA 4XC1H 1UCBH 5KOMC 3ARPA 1GPOL 2PCPA 2FIKB 1RMFH 5ID0B 1BQUA 3OWEA 3GSWA 1P6AB 2WANA 6CGTA 1QSZA 2EDEA 5CJOL 4U1IB 2I25N 1N59A 1FVEA 2ESVB 3SDDC 4M62L 4ZO6A 3PGCB 2W65B 3QDJB 2AK4E 1DVFC 2XZQL 4XH2A 5AAMA 2GHWB 2AEQH 1UCBL 4ELMA 3WS6A 1KT2B 2P5WA 1I1AC 1Z0NA 2GW5A 2HKHH 4Z78B 3ILQC 1N7ML 1MHCB 5IFJA 3EYFB 1DN2A 4HMCA 1YN6B 3GO1L 2EC8A 1KPVB 2VLRB 4HAGA 3VXOB 4DFHA 4YXLL 1DLHB 4UQ3A 5DO2C 2BRRL 3QXVA 4JDZB 5D8JH 4ENED 2YA1A 5F7FA 5KS9A 2ZKHH 3X3FH 4JN2A 1A6TA 3MLSL 4HKZA 5J9PA 1X5GA 2X40A 3MJGX 1EGJL 3T3ME 4Z5RA 1JL8A 5EO9B 1P5VA 4M8QB 4OD3L 3VXQA 3WSQH 1RURL 2H32B 3IKCB 5CIPH 1AD9B 2NX5E 3RWEB 1XF4A 2R2BB 5F7HA 2HA1A 3PGDA 2NY1B 3L3IB 3MRQB 4GRWH 5BS0B 5JA9A 4GQ9L 5C0JB 5CP7B 3ARFB 1DLHA 4UQ3B 1QSFD 4LU5L 5D8JL 5MI0B 1T1ZB 1BJ1H 3IDUA 3WHE0 5KJRH 1QRKA 2ADGB 2RB8A 5C0NC 4POUB 1QLFB 1CICA 2D31A 4TVPH 3A0OA 1NCTA 4G42A 5E24E 1VB9A 4Y8AA 5I6XB 4BQCA 4K7FA 3TO4A 4PTTB 1WCBB 4WY7H 1IMHC 3BH9B 1AD9A 5I75C 2ATKB 2F19H 4LRNL 3E3QE 5LBSH 1QSFB 1EERB 4M3KB 4TVPE 1FYHB 2FX8L 3MBEA 4TULH 1LD9A 3H9SB 2EDXA 4ETQB 1I7ZB 1RIVL 1DSFH 1I85C 3QFDB 4K9EC 1DDHB 5IVXB 5IB4B 1MCWW 1H5BC 3HUJA 4L4TE 1V05A 3EOTL 3TN0C 3IDXL 4N8CL 4DVRH 1WTLA 4NWTL 1SY6L 3MUGB 3MRCB 1DQTA 4PJ8B 3M45A 5IHZB 3IJHB 2DL2A 2A73B 2QADD 5F89A 4RMSA 1PG7W 4OZHA 4X6EA 1AD0A 1Z9SA 3QHFL 4DVBA 4N0FA 5DK2A 3L7FB 4RFNC 4MNQB 3S37X 3GKWL 2E7BA 3NABL 4J8RA 1IGYA 5ESQA 1SVZA 4YC2B 5FK9B 3QUMA 1G9MC 3V9FA 2E5EA 3OKNA 2HN7B 3JZ7A 4IS6A 1A1OA 5C3TA 3EYVA 1NFDA 4Z7VF 1V5JA 1WT5A 5D1XB 3SGDI 1IM9A 5D1ZA 1S7TB 2E9WA 5LVEA 1UT9A 2WSKA 3MRNA 4LEXH 3F5WA 3QDJA 4HGWA 2K7PA 5IBUB 4Z7WB 3RDTB 3V0AC 4LLUA 1XMWA 1RIHL 4LLWB 4UMGA 1BVKA 4MQTB 3DROA 4KMTL 1WAAF 3UZVB 2F5BL 1QACA 3LEYL 3G5XA 4YHYC 1A3RH 5GGVL 1P7QA 3C5ZC 5DVOA 4NZDA 3NIGF 2I24N 1KJVB 2BXZA 3MJ9H 4FS0A 3BD4A 5DD5L 3LB6C 1X4ZA 3PWNB 2C4FU 3STZA 2P48B 3TWCH 2GSIA 4PRPA 2R2CA 2EKSA 3CC5A 2NX5D 1D6EB 2BERA 1RIHH 1WIOA 4PJHE 3TPUA 5GHWH 2ARJB 4XRCA 2VDMH 1A6UH 3O2DH 3B3IB 4V2BA 4PFEA 3VI4E 1OD9A 3P0VH 4L4VB 1KNOA 3L3KA 2AXGB 4WWKC 1JVKA 5CD5C 3QQ4A 4LRIA 1JPFA 2VKWA 1CFVL 3EYQC 2Z31D 3PNWA 5IHBA 4WJ5A 5DMKB 5EPMA 1WCQA 3JUZA 4C56E 2FX7L 5TDOB 4EBQL 4F58L 1PEWA 3CSYA 1R5WA 2JELH 2C3HA 4P2QE 3IXTA 4JQIL 3U7YH 4HWBA 3QJHB 3MRBA 1N4XH 1C5DB 1EAPB 4Z7VB 3HG1B 3QAZB 4R96B 5IESL 3W39B 2J5LC 1DUZA 5I18H 2ICES 1QRNE 1WSST 3W2DL 4Z0XA 4OCYL 5IF0B 2GAZA 3KPMA 2PW1B 4LLAA 1T7XA 2BOBA 1B3JA 2ED9A 4OLZH 3LV3A 1FRGH 1UYWH 3RL1A 3K8KA 3WFDH 4JPWH 2RCSH 2X1PA 3DMMB 3U46B 2ICEB 1MWAB 2X4QA 4PJGA 2BHZA 4X9GA 3FT3A 3G6JE 5D6DC 4X9FA 4H1LG 1HN1A 1ONQB 4A6YL 1KCSL 5F7WC 4GO6B 1OT2A 1FZOA 4WFFE 5CJXC 5L8LB 3N85L 5CHNA 5HGDB 4DCQB 5KVDL 3HLAB 5F7YC 3VFOA 5DFVC 3VXUA 4XVTH 4TQEH 4WWKD 5KN5A 4AH2B 3DECA 4NKMA 1HCFX 3DX9A 3QIBB 5HJ3A 3U36B 1JPTL 2MKWA 5F1NB 4DN4H 1HKLL 5A3ID 5D5MF 5HHOD 3C5ZA 1XIWA 4K23L 4V1DD 4FXKB 5IQ7L 4KJQD 4W68A 3T0VA 3BH8A 1QFHA 3QH3A 2HT4D 4PJDA 4Y4KB 3UPCA 2XTJD 4IHOB 1H3PL 4CJ1A 1A7NL 1A2YB 5IJKC 4JFFB 2GKIA 3LZFL 4JFXB 2WIIA 3I02A 4QXGL 3IAPA 1RUQH 1LO2L 4S1SL 4OCRH 5IW3A 4FMKA 2XKNA 5CBAB 2H41A 4AMKL 2R0LH 2I9LB 3SDCD 4GAGH 5T3ZE 5BQ7A 1ED3B 1KB5A 5HI3D 3S35X 4XPTL 4KXZI 1ZHLB 3D18B 4FXGB 4MNGE 3GSQA 4V2CB 2CGRL 5F88A 3U2SA 1RZFL 3DGGA 3FOMB 3MRNB 1YNTA 3QHFH 5I8CB 4ONHB 1RJCA 3BUTA 3WV0A 3HZMB 2LE9A 1RMFL 4S0SD 2R0ZH 1S7XA 3SO5A 3TM6A 4PRIE 3QB7C 1ZT7B 5FV2A 3MRPA 4KH2A 2I07A 1MNUH 5K59F 1JF6A 3SGEI 2NY4B 3B9KD 2CR6A 1AE6H 4JANB 3DIFA 1MJ7L 1RUPL 1E6JL 2YPKA 3FB6A 1WK0A 5IHUL 4I0PD 2OS7A 1HK6A 4BA8A 2IALA 3EW3B 2JIXD 2BNQD 5F1OB 5JLZB 2CK2A 3SDXF 3K80A 3FQRA 3MV8B 3QRFM 3BE1H 3EDJA 4I3RL 1S7UA 5IK3A 1JZ5A 5L9DH 1EPFA 4WHYG 3BXNB 4P57A 3WLBA 3T77A 2EH7L 3NFNA 5FM5O 1V7MH 1UB5B 4XP9H 3OKLB 2ERJB 4JM2C 2YPLB 3IJYB 1OGAB 3DYOA 1FORL 2IAMB 3MA7A 4UAOC 3ULVF 1DL7L 2VXUH 1R6VA 4PJBA 4O58L 4PV9A 1P7KA 4D0BB 4DAGH 5DJ2B 1JGEB 5TFSH 3AM8A 3EO1B 4U6XB 1Q38A 1XR8B 2OI9B 4UIMB 4HKXA 5KSUA 3WS3A 3L3GA 5I8KL 3IDJA 3DX6A 5D7LD 3BH9A 4XP9L 2ZUXA 2DMKA 1JTPA 3PWLA 5HHNB 1IC1A 4OZHE 1EHNA 4MA3A 3TJHD 4L3ED 3U1SH 4DZ8B 3TYFA 1QSVA 1NBVL 1HXMA 1BBDL 1T0NB 2P24B 3WLWD 2ICWB 4NQEB 3HMXH 3NN8A 5I1GL 3A6OA 2CIIA 4LSRH 5GZOD 4F9PC 4WWKA 1S7WB 1AGDA 2Q1EA 1RZGA 2CLRA 4NQDD 3U9UA 4UZGA 3UTQA 5D2NE 3DVIA 4RGNB 1MI5A 3KYNA 5L2KE 3WCYA 2AJ3B 2FBJH 5IT2L 5ERWB 1A7BA 3BGMA 3CXDH 3P73B 4DVBB 2J1KA 4E5XB 1TQCC 5T3ZL 3V6ZA 3EJZD 2YD5A 4RGND 1IGFL 3EKCA 5CKAA 4JO2L 3FHAA 1GC1C 5CINL 1VFBB 4D9QD 1KV3A 2E8YA 4UDTA 3U48A 3ULUE 3D2UA 4XNYL 4YHLL 3KLAB 4F7CA 4U3HA 1FN4B 4K07A 4X6BB 4L4TB 5CZXD 3VFPA 5C0AE 4QRPA 3CZJA 1C12A 3I02B 4FFYL 4KRNA 1BVLA 4ELKB 5D6DA 1YNLH 5IVNA 2OMNA 5IMLA 3KYMA 4WEBL 1T1YA 4HCRL 5EULV 5IQ9B 2RQ8A 3T0EA 4WTZG 2BY3A 2GT9B 1A4KB 1VFOA 1JWMA 3BPLB 1GGYA 1DE4A 3MXVH 1DQQB 1XAUA 3HMWH 5KSBB 4UUJA 2PCPB 5I71B 3JVGA 3EO9L 3QIWD 3RKDC 3C5SB 5C7XL 2W92A 4Q9CA 5A2LH 3MRRB 3T2QA 1T2QL 1R24A 2OTPA 4YHOL 1FYTE 1N8ZB 3QUXC 1DSFL 5IB5A 5EZLA 1T1ZA 4XVUD 5EUKA 5GQBA 1HOCB 2JCCA 2YKLH 3QT2A 4K7PH 2WLZA 4JGMA 3RVTD 3ET9F 3E8UH 3T8XA 2L7JA 4XH2B 2QR0B 4JM4H 4RDQF 4LL9A 1VERA 5BMFH 1MFBL 2OR8A 1WJ3A 4JDVA 4RAHA 2X4NB 4M6NH 2XZCL 4S1QH 3S34H 1MCLA 2DWEA 1UG9A 1IQWH 2G5BA 1G7QB 3IGAB 5E1AA 1QZ1A 3AREA 4EVNB 2VITA 3UJJH 3MXWH 5IGXH 4D0BA 1NDGA 5DC0A 5EUOB 4M7LL 2PYFA 5DUBB 1T6WA 1U8LB 2ZJSL 4EI5B 3IFNH 4YFDB 3CFKB 1LEIB 4X6DE 4KROC 3BW9B 3RX7A 1NCWL 4LCCA 5EU5B 3TBWB 3H8NA 4O2EA 1NFIB 3RWFA 4L3EE 2C7UB 5C86A 5D9SB 2R2EA 3RNQA 4M1CC 2APVA 4TSBH 4Z0XB 2IPUK 4FQQB 3CUPB 2R4RH 5TE4H 4K2UL 5C70A 1WAAE 4XMKL 1F3RB 2NTFA 4HUMB 1YN7B 4Y1AD 2DQUH 3O6KH 4PREB 1NEZA 4YZFE 4OLUL 1BQHA 1JGUH 1PX4A 4WU5A 5FB8A 1T22B 1W0WB 2P7TA 4G43A 3ZKSD 3T09A 3SGKC 4EDWH 2O5ZH 4U0RC 4KZEH 2PNDA 3QULA 3X13A 4F9LA 1MCJA 3SOBH 2IH1B 1UVQA 3O3BB 1YY9D 5E94A 2H9GA 5IV2A 5T1KA 2VJXA 1HQRA 2DN7A 3JV4A 5DEGB 1GIGH 1MOEA 1IC5H 1R0AH 2FX7H 4F58H 2J7LA 3AAZA 1YEIL 1YY8B 1S7TA 2XQYK 3LRSB 1RK0B 4G6MH 4F7TA 1LO5B 2NY2B 1F6FB 4PJ7F 5EOTA 3IJSA 1BBJA 5IKCA 3ULVL 5J12C 1KB9J 1S7RB 3BWUC 3ES6A 3CVHL 3IF1B 3OKKA 5DJCA 2WWMD 3I75A 3PDOB 5ELIA 4XCFH 2HTKD 5SX5H 3B2VL 3NZHH 5EC1A 5DK0A 4R26L 1ED3A 3FFCA 1FFRA 1IC5L 1U36A 2Z92A 1XH3B 1CD0A 2ESVA 1KB5L 4H5SB 4X4XA 1R0AL 4KI5D 2NW2A 2NY3C 3L7FA 4FQLL 4Z7QF 3IAGC 3O3EA 1YQVH 3AXLA 4ZOEA 3B2UC 5CFHA 2JKXA 1IAKB 4JFDA 3QNYB 4KHXH 4JY5H 1XGUB 2CO6B 2KDGA 4D8PA 2ARJA 4NWUH 4ZUWA 5CEZE 1JF5A 5FEBA 3HC0B 3QDMD 5EBMB 2C3VA 2BJML 3RGVC 5JPNA 3VXMD 1KELL 3KYOA 5C08A 3VFWA 1SMAA 4G7VH 4YGVA 5KZCD 2R56H 4LKCA 3DBXB 1GGBH 3AS3A 5I1LA 1FRGL 4HUWB 5JHDD 1QPXA 1FNSH 2R4RL 2HWZL 4M5YH 1QO3B 3H3BC 2Y7QA 3ULUD 1F11A 2YD6A 1ZMYA 1HIML 3BKYL 4HJGA 4PGBB 1F4WH 3CH1A 3BOVA 1OAXH 2CQVA 4M8QA 4M5ZH 5K9JL 4E0RB 3V2AR 2O93L 3W11C 3A6BL 4KMTH 1G9NH 2VXTL 3F8UB 4D0DB 1WUNT 2ATKA 3OKLA 3O9WB 3BEVB 3TC9A 1IGTA 5I30L 5F71A 3UC0H 1MVUB 4I0PB 4JGUA 2WWMC 4HS6B 1NGYA 1JZ2A 5C0CB 1KEGH 1SJEA 4G6JL 1NGQL 2PTVA 3LDBC 5IG7B 2M1KA 3TBVB 3BD3A 2EIEA 3SN6N 1R3JB 4IBLT 2PYFB 1FH5L 3N9GH 5DUBA 4F57H 4PGDA 3TO4D 3E6FB 4EUPB 5DDHB 5DWUL 4G5ZH 2V2XA 4JHBA 1MJ7H 1RUPH 1A64A 1LNUB 3IRPX 5IB1A 3FZUC 2HRPL 1KG0A 4JM4L 1NEUA 4D0DA 3GRWL 3QUZC 1W0VA 1XGPB 3MODL 2GTZA 3L5JA 1QSFA 2YPLE 1ZVHA 4N8VG 3NCYS 4AH2A 1BF8A 3T0BA 3O3UN 4NCC1 3P4OA 5D96B 3PWUA 3X12B 3NTCH 3K4DA 1K85A 1AP2A 3WNMA 4TUKH 4QGTA 5BZDB 3JXAA 3BMVA 3S9DB 5EU6E 1OVZA 3CDYA 4FTVB 4PRHE 1T89A 1JGVH 5E0QA 2GY7B 3THML 5DJYA 1T1WB 3SCMC 4CL7A 3SKUD 2HRPH 4O4YH 4NO5B 1ND0B 2QQKH 2HN7A 4H1LH 4H25B 2A73A 4NKOA 2ADJA 2Z0BA 1UM4H 1IGIH 4U1SB 4ZTPL 2DKMA 4F9LC 3KPPB 3QIWC 4PUBL 1I9IL 5FM5M 1FYTD 1OW0C 3MRMB 1LDSA 4S1QL 4P46B 3KDMA 4LKXA 5IMMA 1X6LA 4X5XA 1HZHL 4M00A 1J8KA 4DCQA 3UTTD 4ZUTB 3VGAB 3TBSA 3SE9H 2J12B 4ELKA 1PGRB 1NGPL 3QWRD 4YDKH 2OZ4A 3HA0A 1M7IA 1I1YB 5J12B 1D7FA 4OM0L 4TVPL 3WS6C 4HC1H 1MFDL 3WUWB 3MLTA 3BI9X 2NW2B 4KRPC 2K3TA 1MCPH 4JFPA 4LSUL 3HS0B 3UO1L 1OAZH 2V7NB 2JB6A 4PRIA 1OAYL 5E8NA 2A1WL 2EZ0C 4P2YA 4Q6IA 4R90H 2YOCA 3F6LA 3EIFA 3MJ7A 3MLUH 1CD1B 4WUUA 4G8FB 4UNUA 3UTZA 1P84K 2C4XA 1MCRA 3GBML 4TRPL 4WO4C 2NXYB 4L8BB 4OQTH 1G0DA 1K2DA 4R3SB 1FO0B 3HC4L 4HIJB 1HYRC 5GRVL 4BZ1H 4DGVL 1L7IH 4WW1B 3Q1SH 5KAQF 1QO3A 3DYMA 5MP6H 3HS0A 1NCBH 1C16B 3VXSD 1SY6A 4KC3B 3JBG7 5DMIL 4ONFL 1OTTD 3U0WL 4ODXA 4YFEA 3QEUB 2X89A 3BEVA 3DIFB 3VFTA 4F2MB 1QRND 4KKAD 5M7QA 1MVFA 3C5JA 1J1OL 2DQHH 3JTTB 5HYJD 5I9QB 3RZCD 3NIDE 2ZSWB 4APQA 2WAHA 2EDTA 3O8XD 1P69B 2CD0A 3VXNB 2VLJB 1AHWC 5DZOA 2XKSA 1R3HA 4OD2B 4GMSH 1A0QH 1L4IA 4JHZA 3MJ9L 3KNBB 4PJXE 5GGQL 1NGWB 3DXAD 1BP3B 3TCLB 2EO9A 1YEEH 4P5MA 1S7WA 2KBGA 3QUXB 2FO4A 2HVKB 1Y0LA 2IQAB 5DA4A 1KCLA 3JTSA 1B4RA 3LEVL 5TDNA 4LCYB 3BSZL 5H94A 1XZ0A 3RA7L 2YWZA 5BO1L 1EGJH 3C2AH 3CD4A 1U8HA 1G7PA 1XR9B 3LKQB 4N5EC 4YHKL 4N0YH 1MEXL 3GB7B 4TPRL 3HC3H 4BSVB 1X4XA 3TBTA 1E6JH 1OD7A 4QRPD 3SKMB 4UNVA 1JHLH 5EH1A 2GYSA 1CDBA 4PP1D 4MA8H 4GAJH 4PR5A 4OFYA 5KSUB 2XTJE 1H8SA 5IIEA 2FO4B 2QADB 4P2OB 1MIEL 4WCYL 2P5EA 4ZNEA 3RY6A 2JJWA 5FGSA 3OAZK 3TV3H 5IMLB 4IIQC 4QYOA 1JNLL 1R5VB 3V6OE 2Y06L 4CVWA 2W60A 1JRHH 1GSMA 4XWGL 1A7QL 2E6PA 1ZTXH 1JWMB 5JHDE 4H0GA 3RTQC 3V6OC 3BFOA 4NNPL 3DLQR 1MELA 3MRJA 4XXCA 1TITA 1XEDA 2IADB 4KQ3L 3SJVA 1M6OA 1TDQA 1U8QB 3R0MA 3CXHK 4YDLB 4KKCD 1BOYA 4XHQA 2D7OA 1FL6A 4F7PB 3OGOE 3B83A 25C8L 1T1XB 5KSVA 1B2WL 4M5YL 5HDLA 3OGCB 4NZTH 4JRYA 4A2LA 4NNYA 2IALB 4NN6B 1XH3A 1MFAH 4X8JB 3UBXA 4RMRA 4IRSC 5JMOC 1TCRA 2NY6C 4KTEH 4M7KL 2K9UA 1DEEB 2XQBH 4JR9H 4HFUL 1HKFA 4HULB 2M8XA 3JWOL 5GRZA 2ARWA 4MGXA 3BHBA 2DQJL 2E27H 3D9AH 3KYOB 5C08B 3GK8H 3HE7B 1YPZA 4G8GB 2VQ1B 4XBGB 3NCFB 1XGQB 3EO0B 1RUKH 1I4FA 2FR4A 2IFFH 1LMKA 1FHGA 1LWRA 3QNXA 4MJ2A 2FJGB 4XPFL 1A02N 4ZPTB 5FHAH 4AL8H 3TNNA 4W6XB 3TVMB 1PQZB 1T6VN 5FCUH 1F90L 5ICXB 5H35A 3TT3L 4NRYB 5FO8A 4I0CC 4UIMA 4C83A 3CH1B 4M1GH 3L3HA 3CFEA 3CVHH 4GH7B 4MD4A 1AGFB 3MFGB 3P3YA 3GSNL 5I8EB 2R8SL 1KIQB 4KQ3H 3HNTL 1ITBB 3OPZH 3VXMB 3B5HA 4RFNB 5E00B 3ZYZA 2KH2B 2YRLA 4OI9A 1F4YL 3QDMA 1NAMH 2XG5A 4HK3N 4YHNA 2EECA 5GPRA 3CPLB 3PWPD 4TUKL 5GIRA 1U6AH 3CSPA 5E6IA 3MNVB 4MXVF 1F6AB 1U93B 3LS5L 3RKDD 2XG4A 5T3ZD 4BZ1L 1S5IH 3O6LH 1ZT4A 4M3JA 4PRHA 2AJYH 2Q3ZA 3D5OF 3HAEH 5ICYA 3PP4L 3QUKB 4HGMA 4J1UB 2V6HA 5EFIB 3LQZA 4OQ1A 3VE0A 1CDIA 4LGSB 1UADC 1V3JA 3ZT7A 1D6VH 3OMZA 3KGRA 5JXEC 1OLLA 5MEQA 4TNWF 2L0DA 4X80L 4I5BA 1R3LA 4MCYB 3EFFB 1F8TL 4KQ4L 3TVMC 1DFBL 4MB5A 5TGBB 3RTQA 4KKBD 2PW1A 4EVNA 3DRTB 5IJKA 3MRIA 2D0HA 1OAUL 4XNXH 3UJIH 2VWEE 4P99A 1MLBA 4YX2L 3RWCB 5KVDH 3SDDD 1LP9A 2Q20A 3LN4A 5JXAL 3GBMH 3OTTA 1BBJB 4Q9BA 1EFXD 1A6PA 4P5TA 2VXTH 5BV7H 3QUMB 3LPWA 4NGHL 2FIKA 4QXUH 1VADB 4XMLL 3ALXA 4DUVA 1A6WH 4PG2C 2RGSA 4H25A 4HG4J 3OF6D 4U2ZA 3BKCL 1NUNB 5J6HA 5F3BB 5J4MA 2J8UB 4NKDA 5HXMA 2ICWJ 4BFIA 4BYHA 1F4AA 3PGFH 1FG9C 4XPFH 4PV8A 5I6XC 4Y16D 1Q72H 4N0YL 5IOPA 4LCUA 4GLRI 1UXWB 3MRJB 4G43B 2IADA 4DKDC 1OAKH 3KS0H 2A6DA 5JQ6H 4JFZL 2WIIB 3BX7C 4UILH 5IBLC 2D4FA 4LCWA 3WHXB 1RK1A 3ZHDA 1EO8L 2WK2A 1A0QL 2Y36L 1MPAH 3PJSB 3NTCL 4QHLA 4EQ3A 5DFWH 4YBHA 3M1BA 3BIBX 3OB0H 2V5SA 5MERA 4PJ8C 4UU9A 3SE8L 3IDYC 2EYTB 2O5YL 1RIUL 4KI5F 4L8DB 4N90E 3UP1A 1MFEH 4R4BA 3T04D 3EDDA 4Y16B 4C55A 5ADOL 2DKUA 4PRPD 4XCEA 4QWWD 1FP5A 3AUVA 1R3IH 3CFIC 5D1XA 4G8IB 5IM7A 4MNQE 4GRMB 1UC6A 4LPCA 1PKQA 4JRWA 3VWJD 5GJSL 4LDLB 15C8L 1MAKA 3QHZH 3BPCB 3VGAC 1UJ3C 1MIML 4K8RH 5CJOH 3QJHA 1S9XA 1MF2H 2APXA 2VDQH 2FEEI 3FQWB 5HHMD 3TGXA 4FZEH 4QRSB 4JHWH 1IBGH 3B2UD 4OSUL 3AB0B 5LQBH 4E41D 3WJLC 1JUFB 2CJUH 3DBXA 3RWDB 4YDLC 5JW4R 4K3HA 1NMBL 2GCYB 4PJ5D 1OAYH 3RPKA 4CVXB 2IBGA 5F7EH 1KTDA 5L7XH 3V5KB 5KSBF 3HRZA 1UKSA 1DQJA 3STBA 3L1OH 2EDLA 3AGVA 1U8KA 3WS3B 5E4EC 4XVJL 4PY8I 3VE0B 4X0KA 2XRAH 1JWUB 2YRZA 1A8JH 2WBKA 2PO6A 5F96L 5EORH 3HFMH 1C5BL 4JO3H 3DXAB 5BVPH 3V6FB 3FO1B 4ALAL 4G3YH 4K94C 1XF3A 3MGOB 5AAWA 2ENSA 3HUJF 4RGMC 1YYML 5F1NA 3W0WD 5JR1L 5JMRA 3MRMA 4V1DB 3RWCA 7CGTA 3QUMH 1DQJB 1LO5A 3G9AB 4DZBB 3MRBB 1FCCA 3DETD 4X6FA 1S3KL 4WWKB 3O3DA 4M61A 5GGVY 4GG6B 1F58L 5GJTH 1AH1A 2R1YA 1HYSC 3QISA 1AR1D 3LKSB 4XVUC 5J11B 3BZEA 2UY6A 1CL7L 4DGIH 2X4UA 2XFXA 3UYRH 1FZKA 1IGCL 2VWEC 1AO7B 3NPZB 2NXYD 3QUZD 1YEFL 5T1MA 2Q86B 3QAZC 3O4LD 3PL6C 4QT5B 1YMMB 4JG1L 1IQWL 3GJEB 5LXGH 2VSDA 4PJGF 4Z0BL 5ITBL 1X5LA 2CDGA 3LQAH 2OL3B 4PRID 5C0RL 1BVKB 2VDRH 1UKTA 1CLYH 3B8SA 4JFHE 4JKPH 2DDQH 2ADIA 1YMHA 4HMEA 4O5LH 1U92A 3PP4H 4GKNA 1Z9LA 5GZNC 1ACYL 4MQ7A 4ZUVA 3TO2B 4GRWE 1NSNL 1IM9D 5ISZB 4LHUD 5E08H 4C57C 4YWGH 4M6MH 1KPUA 4QHNB 3I3BA 3D85A 4WUUE 1U3HB 1HI6B 2IAMD 2X10A 5EBLB 4P4RB 2APFA 2NZIA 3NFNB 2Y23A 4IHOA 4L4VE 1KOAA 5L0QB 2Z4QB 1UXSA 2IGFH 3ULUH 4JGJA 4GW5B 4NOBA 4NC2B 1PY4A 1MCBA 2AJXH 4HUWA 2VC2H 4JO2H 3S36X 5HYSA 3DVGA 3VXPA 5TF0A 1RZKC 1NAKL 1W8OA 3HI6H 4N8VB 5FUCE 5BRZD 4YXHH 4HXBH 3OAZH 1JWSA 5T1DH 4AEIL 1RZJC 1N5YH 2ZP0T 3G6AA 4OD2A 3IXTB 3T8XB 4F8TA 1Q0YL 5HVHB 4C83B 3CFEB 1S7XB 2FD6L 4Z7OF 1FVDB 4PJ9B 3SKJL 3SDXB 2YZ1A 5LXGL 4MZ2A 3MJ7B 2D0GA 2MHAA 2NY4D 3B9KB 4LPVA 4PBVC 4OZGB 2NTSP 3JTSB 1KFAL 3G04A 1U8MA 3IFNL 2P8LA 1MVUA 1W8NA 1NGYB 1FLTX 2OXHA 1G1CA 4OM1L 5EWIL 2NY7H 4OFYD 3BMWA 5FYKU 1JWSB 3GI9L 4D9RE 2FCBA 2BSSB 4XMPH 3BQUA 3IFOB 4JQVA 2YN3A 5I1CL 1KTLB 3O11B 1OQXA 4OFPA 5DI8A 3VMPA 4JLRA 3C8DA 4JFQA 4NRZA 4OV5B 5FDWA 5BOPA 1BAFL 5DJ8B 1LDPL 1TJHL 1EHLH 2P5EB 5AZ2L 1HHGB 4NPYB 3QEGH 4Z7UB 4XAWH 4GS7C 3BO8B 3MRFA 3L6FA 1WIPA 4O9HH 3GMPA 3GIVB 1T5WB 2WBJD 2VTFA 3O0RH 5FYKE 5TH2A 4PJ9C 1JYXA 1PZ5A 1T4KB 2R1WB 2ZOLB 3QH3B 2X2YA 1DBMH 2AABL 4HBQA 3VFMB 1MHEB 5T1LA 1TMCB 3HRPA 4KUCF 3O3BA 1HSBA 5CS7A 4Z7UA 2P45B 3BKYH 3BP5A 3U82B 3OB0K 4X5WA 1A6AA 4P23A 4OLUH 1UQSA 1INEH 4JVUA 4PJEE 2BNQE 3ETBF 4OZFG 2X4TA 3HI6L 3QUZA 3WKNA 1BZ7B 2DIBA 1W72A 4FMFA 2QQKL 5D72L 2CIIB 2XV6B 3N1FC 1NLBL 4UT7L 3FFDA 2FLBT 5I30H 2CLZB 2Z91A 2HJKA 5E2TL 5T1LB 3QPQC 4Z78A 1OM3L 4ZSOA 4JRYE 1OF2A 2E7MA 4JFYA 3RUGA 2AXHA 2EDRA 1ZLVH 4WHDA 3PWJA 3V5DB 5EZIL 5E2UH 3PXHA 4OGZA 1OLZA 4QKXB 4NQTA 1K3IA 1UZ6E 4OM1H 2YPLD 4KK6C 5EWIH 1QRNA 3OKOA 2W0PA 3M1BB 1VA9A 4Q9QL 5DQJA 3DRQB 2LQRA 1FVCA 3ARDD 5IW6B 3DV4B 2J4WL 1ZHNA 3JUYA 3MUY1 1HXYA 2CLVA 4OV6F 5IJVB 5ITBH 4NO2A 3V4VL 4X7DC 2YS4A 2IPTH 1II4E 1ZGLM 3TYGL 4F9PA 2KZ1B 8FABA 3ESUF 4IOIA 2PUQT 3JVGC 4G8IA 2FGWH 3VDBA 5KS9B 3UBXB 3KPOA 4PJIE 5HYQB 1EDQA 4RFOH 4NZRH 4FABH 3PHQA 4J3TA 5BV7L 3DYPA 1YC8A 3ECBA 4FFWC 3SO3B 2DLFH 3MLWL 4Y4FA 5TF1L 4ZS7H 2H32H 2G75A 3SDCC 3QZWA 3PGDB 2D7MA 1IGTB 5JZ7C 2VLKB 3RVTC 1ULVA 1HSAB 3WFEL 4L3AA 5JUEH 3H9SA 1YN7A 5JNYA 4JRXB 3EHBC 4UT6L 1FLRH 4ZAKB 2MQ3A 1FC2D 2ZG3A 4Y2DC 3BQUB 1R3JA 2GJJA 1XGTB 4JAMA 4JZJC 1AQKL 5D7LA 4CMMB 3A67L 2RAMA 4XCCH 3RY4A 1RI8A 4N8CH 3TO4B 1J0KA 4EN3A 1JNNL 2D0FA 4F37F 4G8GE 4G8EA 1BFVL 1IE5A 3KPQB 3VFUA 5D2LB 3MRFB 1CYGA 1TJIH 4X6EB 5KOVC 1U8PB 1JV5A 4XCNB 2QJDA 2AQ2A 2J2ZA 1YY8A 4BSVA 3RL1B 4PJDF 2FGWL 4GT7A 3HHRB 1CVSC 1DDHA 4N0UA 4PRHB 4AEHH 4GKZA 3WD5L 2VUOA 1XGTA 4JAMB 3QO1A 4YPGB 4CMMA 5J6GA 5FYLL 2VDRL 2PN5A 5HVWA 3FT2A 4NYLA 4LASH 4P23D 4PP2A 1IBGL 1OARH 3C6SB 4HW6A 1MLCB 5J06A 4OGAC 5E2WH 2DLFL 1NCWH 1T2XA 1N0LA 4MDIB 1RFDH 2CKBH 1T1YB 1A6AB 2ADJB 2PYEE 3DRTA 4P23B 2F54B 4X8JA 5FOJA 4WV1B 3IDIB 4UAOB 3KPRD 3EHBD 1MCWM 1KF9B 4PJBE 2H26A 4I18B 3HPJB 2Y5TB 4K94L 2FIRT 2XRAL 1PY9A 1DEDA 3T3MF 5CEZL 4EUPH 4ELMB 1T20A 4I4WA 1X5HA 3P4LA 5EU3B 3S37L 1UWEL 2B4CC 2W0FB 2VABA 4KZEL 4JPKL 4LSDA 4G6AC 4GKOA 4YUEH 1U8IB 4K3GA 3BESR 2VN4A 4KKLD 1JNJA 2CPCA 2IJ0C 3P2TA 3V5HB 3TCXA 1GOHA 2FH8A 2AV7A 2GUOA 2UZIH 3BN9D 3KVQA 1YEKH 4TTGA 1JZ8A 3U7AA 3L95B 1LDPH 4NUJB 5JIPA 2AI0H 5E8NB 1OSZA 4MXWH 5EBLA 1BD2D 2OP4H 1ADQA 5JQ6L 3BRDA 4G6KL 4UILL 4P3DB 1D5XB 1TFHA 3ELAT 3MREA 3L3KB 5E8PB 3BVNA 3D3VE 3ARFA 2VXSL 3PL6B 3FQXB 1L0XA 5B39B 2QHRH 4LVNB 4RGNC 3NZHL 5FGCB 1SMOA 1U93A 3L3JA 2X09A 1D9KD 25C8H 5GGSA 3QI9C 3CCHB 3F7QA 4EI5A 5E6YA 3CC5B 4L4JA 2UVEA 2QSVA 4J1UA 3RIAK 5C0RH 1QR4A 2PO6C 1T04B 2BHYA 1N5AB 4WI2A 3O2WH 5BW7A 4ZUUA 5E99L 5ACLA 2AK1H 2BY1A 4P3CL 4Z76B 5E08L 3HR5A 2I9TA 4N8PA 4U0RB 4I13B 4HDIA 1CN4A 5IVXE 1YECH 2UYLB 4TULL 4HUUA 1BIIB 4KZDH 5ICYB 2DQCH 4NQCB 4CBPA 5FO7B 4TUJB 4M03A 4UV7H 5CKGA 1GGCH 2P8PA 5FKPB 1KBGH 3QCUL 4XPHH 1PG7L 4XCYA 5SV4A 1UVQB 1UWEH 5TDNB 1PYWA 5C0IA 1J11A 2YXMA 3PWPB 4Q9QH 4XTRD 5F7EL 4KRLB 5T1DL 3MRIB 1WFTA 12E8H 4RZCB 1CE1H 3C6LB 4WO4B 1DP0A 4HX1A 1F3JB 4MNQA 2H1PL 1GIGL 3NN8B 4EUPA 3ZMRA 3LN4B 2AJUH 4TNVK 4WNQA 2EE9A 4JHAH 3V52L 3FT2B 4NYLB 3FCTA 4CNIB 3BPOB 4AQOA 4N90D 2AXJA 4G8GD 2X70B 1G7LB 2DQFA 3NABH 2ZCKL 4YQXL 3WIHH 4HH8A 5FA4A 1IEBA 4UDUB 1DUYA 2ADIB 4EDWL 2GAZB 2BNQB 2EYRA 1UWXH 3PXJA 5J56B 2AJSL 5M95B 2X7LA 1RZ7L 1NCCL 3B9DA 3IDIA 3U46A 1F8TH 1BZQK 4KQ4H 2JIXB 2X4SB 2MCG1 4FTVA 1BFTA 1EFQA 2HFEB 3OHXA 5TE7H 5I1EH 1N7MH 5F3HB 2Q6WB 3QEHB 2WIMA 3V0WH 2QQLH 4UV7L 4AIOA 5L2KB 4G8FA 4R2GD 4KTEL 3VXUB 3NH7L 4P46C 1UKQA 2YEZB 3QCTH 3KPPA 5LGKA 3T1FB 1KJ3L 1K6QH 4LCWD 2HJLA 5JXED 1YA5A 1S7UB 1PVHA 2MCPH 3OR6A 4PJEA 3ZZ1A 1NMCB 1WBZB 3TZVA 4X6DF 4U31A 2A6IA 3VD9A 5JDSB 1BLNA 4MJIB 2JCCF 1EVTC 3L3DA 5IJVA 3TBSB 4E41E 1B0GA 3TT3H 4JFHD 4P2OD 3ULVH 4XBGA 1PJ9A 4PYHA 5EC2A 3L5XL 4ZSOE 4FZ8L 1QSEE 2HKFH 1T7YA 5DD1H 5FM8A 5I66A 1LEGB 4JO1H 4MJ5B 3IFOA 3CCHA 4HUXA 3D9AL 1YYLH 3HR6A 4OJFL 1BFVH 4JHAL 2VAAB 1HHIB 4NQED 1KIQA 3OG4B 2QLVB 4H1LB 2ZNWA 1JWUA 4RBPK 3B6SA 3PWLB 3CFCH 3FAWA 3D3VD 1DBKH 1AHWA 5FCUL 2XTJC 3L6FB 1DQML 4GRWB 3IVKB 5IHUH 4MA1C 1NDGB 3U9PH 2J88H 1U9KA 5ALCH 3HAEG 5EG6C 5BZDA 1WITA 5CSBA 1Y6KR 1CGTA 4KY1H 2JB5H 3ISWA 4RNRA 4TSBL 3LKRB 3FRPA 4CVZB 1I3VA 3DWTA 2DQIH 1NLDL 3K1KC 4Y0GA 4YGAB 1TNMA 3WDJA 3N9GL 1QSFE 2WUBH 1K4DB 2YPLA 4EUPG 4PLNC 1DVFB 4ZUSA 2PYEA 4ZQKB 2H8PB 3QG6B 4NRXA 4NZRL 2Y6SC