5T52A

Lectin from bauhinia forficata in complex with galnac
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
229
structure length
229
Chain Sequence
SELSFNYPNFQSVEDITFQGGASPRNETLQLTPTDSNGIPIRQRAGHAVYSQPFQLRDTSFYTTFTFVIRTTSNSPADGFAIFIAPPDFPVKRYGGYLGLFEPNTATNTSANKVVAVEFDTWVNTEWKEPRYRHIGIDVNSIVSVRVTRWQDKDVFSRSIATAHVGYDGISKILTAFVTYPDGGNYVLSHVVDLAEIFPGDVRIGFSGATGQYETQYIHSWSFSSTSTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis and unique molecular recognition properties of a Bauhinia forficata lectin that inhibits cancer cell growth.
pubmed doi rcsb
source organism Bauhinia forficata
molecule tags Sugar binding protein
molecule keywords Lectin
total genus 49
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t52A00
3JU9A 4FVVA 4XBLA 4YM1A 1JUIA 1GANA 2AUYA 1Q8OA 1SCRA 4XILA 3SH5A 2ZBJA 4UW5A 1DQ6A 1V6KA 2CWMA 1HQWA 4DRRA 1QDOA 1QOTA 5T5PA 4ASMB 4P14A 4K21A 1APNA 3NV1A 3OBTA 1GV9A 4LBQA 4XJWA 3V0BA 4FPGA 2R1BA 2WKKA 2JD4A 2DVFA 2ZGPA 4GKXA 1LGCA 5DXDA 3ZXJA 1DQ0A 1PZ9A 5L73A 1QGLA 1DGLA 2GNBA 2ZGNA 3ILFA 3V65A 1D0HA 3FBYA 4LBQB 1W0OA 4WVWA 4XIKA 3V0BB 4GA9A 4Y24A 2OVUA 3OGGA 4UW3A 5EYYA 1C1FA 1EPWA 4FP2A 2A6YA 1JYIA 2P34A 1QMJA 4AWDA 2AENA 3O0WA 1VLNA 2A7AA 4LBOA 5HCFA 4XJAA 5IT6A 5IK7A 1LGNA 1VAVA 1KITA 1N3PA 2YZ4A 5AVAA 3IM0A 1Q56A 5KXBA 2GMEA 2D43A 1V6OA 1YXWA 2NN8A 4FOWA 1S0EA 5KXEA 1MVEA 4XBNA 4K1YA 4XMIA 1RITA 2PHWA 4AGGA 3WLUA 2A6XA 3A0KA 1F9KA 1V6JA 2WT1A 4FOYA 2UURA 3WDVA 4CTEA 1ULGA 2DVBA 1IKPA 3AYAA 3N7JA 2ZGKA 4AVVA 3ZXLA 3PVEA 4DQAA 4M01A 4YW3A 4FPJA 4FQ4A 1Q8QA 2D6OX 4AGVA 1S0IA 3RMYA 4ISQA 1DHKB 2ZGQA 4XJ9A 1FNYA 3USUA 3L2YA 2CTVA 2GNTA 2E6VA 2YY1A 2NM1A 5DUWA 1IS4A 3O5SA 2ZHKA 5GM0A 1LOGA 1N1SA 2VY0A 3ZVXA 2Q5TA 4XHXA 4FPFA 1UZZA 4YW1A 1H30A 2ERFA 3OY8A 1VIWB 1R1ZA 2EF6A 1KJRA 2OW4A 4XXPA 1MR5A 1W6OA 3BIWE 3W59A 1UPSA 1FNZA 1VALA 3O0VA 4DS0A 2P3IA 1CJPA 4U36A 1ONAA 4OZXA 1YIFA 2JKBA 3FUQA 3B3QE 1W6NB 4FOQA 1SLBA 1V6IA 2E51A 4ATFA 1GLHA 1LEDA 1LU1A 2WJSA 1SBEA 1LCLA 1JOJA 1V6MA 3A4UA 3I4IA 1WBFA 3POYA 3V64A 4YZ2A 5JOZA 3AXDA 3BOPA 2EXIA 1W0PA 2CYFA 3PJQA 1S0CA 2VW2A 2V73A 4GWMA 1G9FA 1YO8A 1WW5A 4M3CA 4XHBA 3WG2A 1DFQA 3N7MA 4FPOB 1UKGA 1JN2P 3SH4A 3AP4A 2LALA 2GDFA 2EXJA 1DIWA 3AZXA 1GKBA 3T1LA 3R4SA 2GNMA 2P37A 4BQ1A 3OBRA 1V00A 2H0BA 2WT0A 3AX4A 3N35A 4DFSA 2P2KA 1CN1A 1PZ7A 2P3JA 5T5JA 2ZA9A 1LHUA 1IKQA 2FHRA 1SLIA 1GICA 2YXSA 3R4UA 5GLVA 2ZHMA 1QNWA 3WG4A 1OQ1A 1GZ9A 2WT2A 2DYCA 2ZACA 3AYCA 3ZSMA 2I2SA 2R1DA 1GNZA 5JMCA 2UWBA 1RIRA 4YGCA 5KXDA 1OFSA 1UX6A 3IKWA 1HKDA 3WDWA 2ZGUA 4CZSA 4IQPA 2ZGRA 1G9CA 1G7YA 4YG6A 3BODA 4CRQA 1G86A 2ZKNA 3AP6A 4Q1PA 1G9AA 1UL9A 1KJLA 2DURA 5T5LA 1G9BA 2V5YA 4K20A 5CA6A 2GALA 3D5OA 2AGSA 1U0AA 3RQ0A 3VV1A 2GN7A 4PCRA 1GZCA 3PMEA 2RHPA 3AP7A 4Y1XA 1WBLA 3AJYA 1NXD1 3DGTA 3M3EA 3WCRA 1FATA 2SLIA 3ZSKA 3WZ1A 2ZZJA 4HL0A 4AGRA 5CB7A 1WCSA 4PBOA 3TB0A 2W68A 3WHTA 2PELA 3POWA 2EXHA 1DLLA 2ZMLA 3HR9A 5CBLA 1MS3A 1F31A 1SLLA 2PHUA 1A78A 1LU2A 3AYEA 3WDUA 3VKLA 2GN3A 3M3OA 3WUCA 2GNDA 3AXEA 2VW1A 3JUUA 2W08A 4RA0A 1D2SA 3QCWA 3ASIA 3AZYA 1IS5A 3AFKA 4P9XA 3MEPA 4WVVA 3QLQA 1KDMA 1LHOA 3ZYRA 4XIOA 2G4IA 3ZYPA 1LOAA 5GLWA 1LTEA 1SCSA 4Q8KA 1CPNA 4YM3A 4YG0A 4M00A 1S0FA 4BOWA 4DPNA 1AJKA 4UW6A 2WQZC 1SFYA 5T5OA 3WHUA 3WDTA 4BPZA 4F83A 3N3HA 3D4KA 5KXCA 3OYWB 3N7KA 2Z42A 3WOGA 2JE7A 5FRAA 1FX5A 1W6NA 2VW0A 4BMBA 1V6NA 2ES3A 1DQ2A 3AP5A 5BYNA 5DG1A 1BYHA 1DYKA 1W6PA 1ULFA 1QF3A 3B9CA 4XJ8A 5E89A 4JRAA 1AVBA 1LOFC 3LSEA 4YZ4A 4YLZA 4BLIA 4FOVA 3B00A 1W6MB 2D6LX 4R9AA 1QNYA 3AZWA 2PHTA 3WG3A 5GLUA 1QKQA 2D6PA 1DYPA 2ARXA 5DZFA 1S0JA 1Q8PA 3SLIA 4YFWA 4XTPA 2JE9A 1W6MA 1UAIA 1S1AA 1LOFA 3UL2A 4C1WA 4Y22B 1MS4A 1SBFA 3WG1A 2OUHA 4M3CB 2D6MA 2DVDA 2ZGTA 1MS8A 1QU0A 4YW2A 2D44A 5JLVA 4FP3A 1MS1A 3RSJA 1LEMA 2VUAA 2UU8A 4YFZA 5GLZA 5GZCA 1AZDA 1C1LA 4BLJA 4DRVA 4I30A 2ZGOA 1FAYA 2BQPA 2A3YA 2C5DA 4YGBA 3NWKA 3ENRA 2CNAA 4W65A 1AXYA 1DQ4A 3H0OA 2A75A 1LENA 2UWAA 1YYNA 3WNXA 3GNEA 1MS9A 1HQLA 1J1TA 2AREA 2AYHA 4C1XA 1HLCA 3D6EA 1Y7BA 3UJQA 3ZXFA 5FREA 1UMZA 1KDKA 4Y1UA 4YGDA 2A71A 3A0NA 1URXA 3T2TA 2DTWA 1MS0A 5JVVA 1JYCA 1WLCA 4HANA 1LGBA 1CPMA 1DZQA 2DWRA 4XMAA 5DZGA 1ENRA 3SISA 4GWNA 5JOWA 1W6QB 1ENQA 1RINA 5GALA 3MW4A 3R05A 2NZ9A 4H55A 3N7LA 5HCBA 2A6WA 2ZABA 2R0HA 1LULA 1Q8SA 3N36A 3LCPA 1CIWA 5EXOA 1IOAA 1CONA 2UWCA 1WD3A 3HMYA 3NV4A 5T55A 1HDKA 1WW6A 1JBCA 4PF5A 3BTAA 4XTMA 2JECA 1KRIA 1F5FA 1MZ5A 1CVNA 3M2MA 2W39A 2PHFA 4ITCA 4UW4A 2NYYA 1ULCA 3USUB 2WNEA 1LJ7A 1LOCA 4FPCA 2TEPA 3VKMA 4ZKTB 1LOEA 2ZGLA 2E7TA 1N47A 4NO4A 3AZZA 2JDZA 3AZVA 1QOSA 4L8QA 4YW5A 3PVOA 1CESA 4Y20B 1LHVA 1TEIA 4XDQA 3IPVB 1Q8VA 3V0AA 1WLWA 4XZPA 2NMNA 2P3KA 2DUOA 3OYWA 1DQ5A 1LHWA 2AR6A 4FPLA 2ZAAA 4YZ3A 3VKNA 4U2AA 4FPKA 3OPZA 2AH2A 5H9RA 2R0FA 1N3OA 3IPVA 3WDXA 3IMNA 4YGEA 3VKFC 3T1MA 1C4RA 3TAYA 5DZEA 2D3RA 2WSUA 4XOGA 3W58A 5H9SA 1WW4A 5T50A 1FV3A 5F9TA 1I3HA 5LK5A 1KQRA 1S0DA 1N1YA 1SLTA 4NOTA 3WDYA 3WVJA 4Y1YA 1JW6A 4YG3A 4M3CF 1BJQA 5GLTA 1X50A 5E88A 2D7FA 3AK0A 4PQ9A 1WUVA 3POSA 3U4XA 3IN9A 4TZDA 2PHXA 2YMZA 2EIGA 1WD4A 1AF9A 1CR7A 4TYSA 3NV2A 3FLPA 4LBMA 4XXAA 2ZGSA 4LBJA 2CL2A 5T54A 1B09A 1AX2A 1G9DA 3ILRA 3KM5A 3V0AB 4Q2FA 4Y1VA 4ISRA 4Q1RA 1JHNA 1W6QA 5IUQA 2EXKA 2VU9A 5EWSA 2JJ6A 2FMDA 4XJZA 2D6KA 2ZMNA 3AJZA 2DVAA 4P9WA 2ZGMA 4Y26A 3ZSJA 1QDCA 4PBPA 2YROA 4YZ1A 1NLSA 1FYUA 4BMEA 4AVTA 1LHNA 4BM8A 4LBKA 1GBGA 1LOBA 5F5QA 3ZSLA 1OKQA 2DUPA 2D3PA 3FFZA 2E7QA 1IS6A 4R9BA 3O0XA 4JC1A 1BZWA 3HN1A 4MYEA 1XQNA 3RG0A 1MS5A 2SBAA 1WLDA 3KQRA 4JCKA 4P9YA 4FPYA 2NMOA 1MACA 1N1TA 3B69A 3MPPG 4Q27A 5HCAA 2DTYA 1N1VA 2A3XA 2B7YA 5GZFA 5DG2A 1N3QA 1PZ8A 4FPEA 3VKOA 4XE9A 5JDBA 2ENRA 2LTNA 1C57A 1H9PA 1AX1A 4YZ5A 3B01A 1SBDA 4LBLA 3WCSA 4M3CE 3M3QA 1IS3A 4XYXA 1JXNA 4XBQA 5GZDA 1O4YA 3AYDA 4Y1ZA 5DUXA 1A8DA 3FLRA 5SV8A 2A5ZA 2CWSA 3WV6A 3ZXKA 5H9QA 1H9WA 5EYXA 4AVSA 2DUQA 3RS6A 5GZGA 1W6PB 4WV8A 2YV8A 2D3SA 5GZEA 2DU0A 3MW2A 1GYKA 1LECA 4SLIA 1AXKA 1BKZA 3C2UA 1AX0A 2EAKA 2ZMKA 3M3CA 1LODA 2HYKA 3SITA 1GNHA 3DUIA 1A3KA 3I8TA 1BQPA 2DU1A 4Q8LA 1S0GA 3LSDA 4K1ZA 2GMPA 2ZHNA 4ATEA 1SLAA 4LBQD 3INAA 1ULEA 4ZXKA 1DBNA 3PVNA 1G8WA 1ZA4A 5DUVA 4FQZA 4GXLA 3M1HA 4GKYA 2OUJA 1W6OB 2R16A 3APBA 2XG3A 4D69A 1GZWB 4YM0A 1WW7A 3O12A 4WZFA 4XJUA 1GSLA 5T52A 1LESA 4GALA 2A3WA 1S0BA 2A70A 1UN1A 3RRDA 3ZXEA 5H9PA 1AJOA 4RL7A 1GZWA 3GALA 3OY8B 5JOYA 2VH9A 4FPHA 2D6NA 1ULDA 2R49A 3WUDA 2WSVA 3MW3A 4KBBA 1ZM1A 5JOXA 2ARBA 1Z0HA 1QOOA 2EALA 3AP9A 1ENSA 4R9DA 2C9AA 1UZYA 2A6ZA 3CNAA 1SACA 1SLCA 5IK4A 2A6VA 1V6LA 4YM2A 4LBNA 4YW4A 3UJOA 3VUOA 2XB6C 4AYUA 5E8AA 1FV2A 1BXHA 1YRZA 4Y20A 4Q26A 1YI7A 2E53A 2DVGA 2PHRA 3NV3A 5IK8A 1Z78A 3OJBA 2W52A 2CY6A 5CNAA 1O4ZA 2VXRA 5IK5A 3ATGA 1AXZA 1CQ9A 4R9CA 1MVQA 3FLTA 4Y22A 3ZPYA 3Q9OA 5GJ6A 2ZHLA 5DUUA 4Z8BA 3UK9A 3SNMA 1I1EA 2NP0A 3FUOA 2GMMA 3SH3A 1DQ1A 2DV9A 5CAZA 1MZ6A 3RMXA 2KM2A 1VAMA 2WLQA 3ILNA
chains in the Genus database with same CATH superfamily
4I0WB 4XILA 2RS52 2VZSA 2ZBJA 2IVIB 1DQ6A 1W9SA 3EXUA 2RS32 4DRRA 1QOTA 2WFF1 4HVOA 4ASMB 4P14A 1APNA 4JDNA 5FZDA 1XRUA 2WNVC 3GZAA 1R1A3 2IXLA 4B3NA 4TLGA 4IV1C 1DQ0A 1PZ9A 3J26N 1QGLA 1DGLA 1RVF2 1POV1 2GNBA 2RS13 2WIIB 3ILFA 4CXYA 1RUD3 1U5XA 2B9VA 3I3DA 3Q8FA 4LBQB 4LEJA 2F4PA 4L9BA 4EZHA 2BGPA 2OVUA 2UYBA 1C1FA 4C0BA 3P6BA 3E6DA 4FP2A 3SKVA 2A6YA 1REFA 4BQYA 2A7AA 4JRLA 5IT6A 5IK7A 2X10A 4BU2A 1PK6A 1VBE2 2YZ4A 3MUY1 5C8CC 5AVAA 3FWEA 4FFHA 3IM0A 5AVPA 2XJSA 1B35A 2VR4A 3H9AA 4KGQA 2NN8A 4OVEA 5BUVA 3WP6A 1MVEA 5KXEA 3MDPA 1PO23 4XBNA 2Y38A 1ULOA 4QKBA 1MQTC 5LATA 2J1EA 5FPVA 3MIEA 4B7KA 1VE0A 1W8WA 3VBHA 1WWYA 1Y4WA 5F3EA 5C70A 1V6JA 1HXS3 4EQVA 3GZTB 5LK7B 1RUE1 1IKPA 3AYAA 3K77A 2ZGKA 4NMIA 4AVVA 2RS31 2VNGA 4IV3C 4DQAA 5JMOA 4MADA 4FQ4A 5JZGC 3LDRA 5J3UA 4MUVA 1S0IA 3PU3A 4GJZA 3ZN5A 4GQ7A 3THDA 4INDA 3USUA 2PAMA 1Y9QA 3VBFA 4BJ0A 5JI9A 2LW8A 5JPMB 4AHWA 2E6VA 2WA3A 2OQ7A 3TN93 5F2SA 3ZKUA 2W95A 4COUA 5B4NA 3RWNA 2VMFA 1N1SA 1X8EA 2XLFA 3ZVXA 1GNYA 3USSA 3VZNA 4FXGB 4QPWA 5A80A 3OY8A 1F4AA 4R52A 4MXWB 1R1ZA 3OGSA 4IV1B 4XPVA 2OW4A 1K45A 4BQXA 3WP4A 1BCXA 3H3ZA 3OTFA 4X6RB 3RI8A 3W59A 3M4FA 1K5MB 3BCWA 2W2IA 2W1WA 1GOHA 4U36A 4CDQC 3IBMA 5BNPB 3LEMA 4BH9A 2JKBA 3N9QA 1FXZA 4FOQA 1CWPA 1GLHA 1LEDA 1ND3C 4LO8A 1SBEA 1NX9A 4BHPA 1WBFA 3V64A 4AL9A 2ZS6B 2QE3A 2CYFA 5FO8B 5FXXA 1OOPB 1OFNA 5FY7A 4V1PA 1G9FA 4H14A 4M3CA 1QJX1 2VBBA 2FCUA 1UCXA 4XHBA 3BTZA 1ZRDA 2HWD1 5IVJA 1PMHX 5FQ0B 1TME1 4XFHA 1VBA2 4IE5A 1JYTA 5DAXA 2HWE3 1T2XA 4XUTA 3RYKA 2RVAA 3VBOA 2GNMA 4Z82A 3GBFA 1SG3A 2VZRA 3OBRA 4HK9A 4DNYA 2WT0A 3TN92 1NZIA 1R091 3HD8B 4DFSA 2WN2A 2P3JA 5T5JA 2ZA9A 1C8M2 1PVXA 3DCQA 5FV3A 1IKQA 2JDAA 3MV01 4I01A 5GLVA 3B9IA 1QH7A 2Q8DA 1HRV1 2QNKA 1RB8G 2I2SA 5EFUA 4N53A 2B8MA 1W90A 1RIRA 1UF2C 3N9OA 1WKYA 2W46A 2PHLA 3VBHB 1HKDA 3OGRA 3WP5A 3U11A 4IQPA 2WNUB 1RVF1 4RS5A 2F6BA 3M70A 1G86A 1RHI3 1JUHA 2QZ3A 3WNKA 1G9AA 3LDKA 4NRQA 3SHRA 2DURA 5T5LA 1NOVA 3I97A 1G9BA 4GZ9A 4K20A 1NE4A 4D3WA 4HN1A 3DPRA 3J7LA 2GALA 2J1TA 1E5SA 1U0AA 5EQUA 1R081 5SV5A 3RQ0A 2EAAA 1PGSA 4KU8A 2GH2A 3VDBA 4ZS3A 1XNBA 5HPOA 2AEYA 1QXJA 5M0TA 1WBLA 1NXD1 4IESA 4IGOA 1DP0A 2YUEA 3RI9A 3WCRA 1FATA 3D3AA 5EJZB 2SLIA 3HJRA 2X5IC 1W9FA 5LWBA 4AGRA 5FLJA 1HXS1 1VBD1 2J42A 1RUD2 3ST7A 3TB0A 3AVRA 1C8M1 2KA3A 3AKSA 4SBVA 2PELA 1QJY1 3HNMA 4MGTA 3NKTA 4FBFA 4WM7B 2RDQA 4CCOA 2PHUA 3W20A 2XBO1 1LU2A 3CJIC 1RUE2 1X7NA 3WDUA 5AFEA 3HQUA 2A1XA 3VHPA 1J3RA 3NKGA 3M3OA 4AI9A 4OFGA 4OYUA 1GFF2 1GP6A 3RZKA 4RA0A 1D2SA 5FMOS 3QCWA 4AEDB 4N9HA 4IGQA 4IEVA 3ZMOA 4N90A 4YVSB 3AFKA 3GHMA 4MLOA 4NHYA 4P9XA 4Q4X1 3MEPA 4WVVA 3JQXA 1KDMA 4B1LA 5HCHA 1OI6A 3TEYA 4AFCA 4S2FA 5EJ1B 2PHDA 2YPDA 3LF7A 5FZ3A 4Q8KA 4M00A 5C4WC 3GHNA 2KR2A 1F8VA 5T5OA 2ET1A 3WHUA 1CGPA 1NE6A 5CVRA 2QCSB 3VBUC 2WZEA 5A70A 5F39A 2DBNA 3N7KA 2WINB 2Z42A 2OPWA 4PQQA 2WFF2 1FX5A 1W6NA 5FRAA 4BMBA 4HVQA 4I2OA 2Y0OA 4RS5C 2V4VA 3B02A 1W39A 3HN3A 1OD3A 3H7JA 1O7FA 2JB8A 4JGYB 4QDRA 4TSVA 4AFMA 3AP5A 2FD8A 1BYHA 2DBIA 2VBPA 5EZWA 1QF3A 3B9CA 3SQOA 3WF3A 4RQPC 4JRAA 1AVBA 2J1RA 1W3XA 2EA7A 3LSEA 4LKDA 4BLIA 2LRPA 4FI9A 5LEJA 5A6XA 3B00A 1RUC2 4X6QB 3WG3A 1ZZ7A 5FO7B 5EV7A 1DYPA 1H1AA 2VQ0A 1RUG3 1Q8PA 4ZPIA 3MBWA 3H8RA 1AL23 1OUSA 1S1AA 1LOFA 2P1BA 1FT9A 4Y22B 4C1WA 1SBFA 5KBFA 3WG1A 1MS8A 1QU0A 1RXGA 1HW5A 4YW2A 2W9XA 2WAAA 1COV2 3RSJA 2VUAA 5C5UA 1IPJA 4DZGA 1OH4A 1H2LA 4AAPA 1WZXA 1YJLA 4E2SA 1K5MA 4AHYA 5LA0A 3D0SA 1HJGA 4UFLA 1YEWA 4I30A 4MX3A 2WNUC 3I2HA 2IVJA 5IAXA 4FTBA 1RUF1 3ENRA 2Z5WA 2R062 3NWKA 3O14A 4W65A 5FMCA 1AXYA 1HN1A 5A6QA 2A75A 1LENA 1OLME 3GNEA 1VBB2 2XGXA 5I0RA 2AREA 1HQLA 1J1TA 2I07B 1AYN2 2R041 3LD8A 4LORA 2PMWB 2X8KA 4D7SA 5ANNA 2YC2A 3V56A 1WA6X 2ZKLA 1URXA 4N8MA 3WSOA 5FZ8A 1W06A 2YFUA 5JVVA 1TVGA 2XLGA 2ARAA 1K12A 1LGBA 1SMVA 3DN7A 4LTAA 2DWRA 1JZ3A 1VBC3 4Y5SA 3AL6A 5DZGA 3LWCA 1IG0A 5FYVA 1W6QB 3K4AA 1ENQA 5IVFA 3L9JT 3R05A 1J58A 3UESA 2IZWA 4XF0A 4UFJA 2R32A 1B35C 4KWUA 4QX2A 3DXTA 3IMMA 5A6ZA 3HMYA 1WD3A 2GC2A 2JB4A 3QACA 4I0AA 5FYBA 3KGLA 3SEEA 1GR3A 2GSYA 2R6QA 4ITCA 2PHFA 1JU3A 5HV0A 1ZRFA 3USUB 1CAXA 1LJ7A 2JDMA 2TEPA 4AZZA 1QJZA 4NAMA 2WQ4A 4OCTA 1N47A 2R7EB 3AZZA 2JDZA 5JR2A 1IZ3A 4XFFA 3PHMA 1TNFA 4QQOA 1GWMA 4QU2A 3L2HA 4S2DA 3V0AA 4XZPA 5FK8A 2QJVA 3M3IA 4ZXEA 2NMNA 2P6CA 3GBGA 4IEOA 3WW2A 3HQRA 4FPKA 1XSRA 2AH2A 2QDNA 1YHFA 5FUNA 4CVUA 1A8MA 1NCQA 1ODNA 5L7OA 1VBE3 4YGEA 1K42A 1XXNA 4DUVA 1UOJA 2D3RA 3S5AA 1I5ZA 2PYTA 2WSUA 3VHNA 4IV1A 1C8NA 4XCBA 2OZ6A 5F6KA 5F9TA 2CHHA 3WVJA 1IHMA 1R093 4GMP0 3VBSB 3J9SA 3K4DA 4NPLA 1BEV1 1JW6A 1VMJA 2Y26A 2HJIA 2W87A 3EJKA 5CKQA 3ZLIA 3E5QA 4CE8A 3MYXA 2HWF2 1US3A 4PQ9A 1WUVA 3NL1A 3H8UA 4TZDA 2E26A 2RM23 3BYWA 3ACHA 3VBFB 4P9JA 5FR3A 1I5PA 5BXXA 3ACGA 3M7AA 4UFMA 1ZZCA 1CAUB 2OPKA 2ZGSA 4XXAA 4DXZA 4NIIA 1B09A 5IWFA 1AX2A 1EV13 3FHQA 1G9DA 1OA2A 2WZR1 4DXSA 4XUNA 1XU1A 4NHMA 4Y1VA 5E16A 4CP9A 2EXKA 2RDNA 1VBD2 2VU9A 3KF3A 5EWSA 2FMDA 5A33A 4C8DA 2BGOA 2DVAA 4QMAA 4Y26A 3ZDSA 1JYNA 1RHI1 3KS7A 2W1UA 3KVAA 4RQPB 4CP2A 2K46A 2WUHA 1LRHA 5CU1A 3T0BA 4QHOA 4DINB 1V9U3 5FJHA 1YQ6A 1AL22 1LOBA 5F5QA 4CCDA 2Y6HA 3RFRA 5F2WA 3ZX7A 3SCGA 3O0XA 5FWJA 3PJYA 3G6JB 4JC1A 1REEA 4QD2A 4ASLA 4MYEA 2WO3A 2XJUA 3BOWA 3DF0A 5FIXA 5J98B 3VLBB 3LOBA 1MS5A 1VPHA 3H3UA 5FXZA 4JCKA 4BA6A 1HV0A 4M4RA 1Z7S3 1F15A 1MACA 2IXIA 4Q27A 3NQHA 1PM4A 2DTYA 2VTXJ 1UOFA 2BU9A 3FHAA 4IXLA 1UYXA 2B9UA 1N1VA 2B7YA 5FZIA 5GZFA 5LB6A 4CSWA 4QQ2A 4W4ZA 4AEDC 1N3QA 1RUOA 3LA7A 3KV9A 1H0BA 4FPEA 3T08A 4I02A 2XVLA 1AR63 1C57A 2LS6A 4RR3A 5FYSA 3HIFA 1EUUA 2VCBA 3MF9A 3OD0A 2YU2A 5K0UB 1GU3A 3B94A 4F8AA 4GH4C 4QX1A 1WMFA 4BXFA 3FLRA 1YQ2A 4CYDA 2PN5A 1YC61 3WV6A 2IUWA 2IXCA 5H9QA 5K0UA 2XL9A 1AUYA 3HEIA 1XNDA 2JEMA 3NO8A 1SFNA 3PUAA 3WR0A 3BALA 2PFWA 4WV8A 5GZEA 3DYOA 4WM7A 3T3YA 3AFGA 5J96B 2QVSB 2ZMKA 4PJYA 3DUIA 4Q8LA 1S0GA 3I54A 3LSDA 4ATEA 2Y8KA 1COV1 3I2FA 5EIYB 1X9TA 1ND3B 2ZOEB 4ZXKA 3VDDA 1AR71 2WAOA 1WCQA 1YCIA 1G8WA 4JKLA 4R4ZA 3UGFA 3UKVA 5DAPA 3S7EA 5BNPC 1WA4A 4GKYA 1OLQA 5LZ6A 3HOBA 4YM0A 2DFBA 3C7HA 1GSLA 1LESA 4IUGA 4D6SA 5CEHA 2PTMA 5FK7A 5DMYA 4DB5A 1H2NA 3LA2A 4UFIA 2D6NA 2FBEA 3K2OA 4QX3A 5CFDA 3WUDA 4AF9A 4KBBA 4A41A 2ARBA 3BIEA 5F3IA 1V0AA 3J8F1 2HEVF 2VVFA 4P5YA 1UZYA 1SLCA 3AVSA 2P5BA 3BPZA 3LEIA 3OUHA 3THPA 5LBFA 2A6VA 5C9AC 5F3GA 1POV3 4MHRA 5K8SA 2QDRA 2YBSA 5C3QA 4KH9A 3SH5A 1R1A1 4ZY9A 3WF2A 2MHFA 2XLAA 3AM2A 1XPWA 4NJ4A 3BI3A 1ULPA 2E53A 3NV3A 1QQP1 4JHZA 3ZR5A 1HRI2 3OJBA 4CEWB 1EYBA 4CU9A 1CZVA 4R9CA 4DY5A 4JX0A 5EHDA 3W5MA 2BV4A 3TN91 3LIGA 1FI2A 3ECQA 1QIQA 4GWJA 1AR93 5FP3A 1DQ1A 3ACIA 5E1RA 4Y4YA 3BB6A 2VZVA 2KM2A 2XQRA 2JD4A 2RMU2 3JU9A 3D82A 4FVVA 4XBLA 4N53C 4YM1A 4CDXB 4EE2A 5FMBA 4CEYA 1ST8A 4CDUA 4EJRA 4MVTA 2WN3A 5DAQA 5T5PA 4AFAA 1KS5A 4HSLA 3LQCA 3OBTA 4PLOA 1GV9A 3GYDA 1UOGA 4XJWA 4XVHA 3WY6A 3ZYJB 3ZFGB 2JX9A 2JDPA 2BBAA 2Y6LA 5ACA2 3FBYA 3P3PA 1OHFA 3OEAA 1RMU1 5DDJ3 2QFEA 3RYRA 4K9SA 2Y6GA 4Q4V2 4E27A 3NJXA 2C9KA 5FO9B 1NA1B 5HI0A 1R082 3WQ0A 2MEV3 3O0WA 4FFIA 5ACA1 4MGQA 5HCFA 1ZRCA 4XJAA 2BPA2 1LGNA 3A22A 1KITA 4GH4A 1O8PA 5A3OA 4DIQA 2CGNA 2VMDA 4IERA 4CUBA 3S0MA 1PVC2 2GMEA 2MNGA 2YBPA 1YXWA 1UY3A 4WBBA 5HV4A 5IHRA 1S0EA 1DCSA 4BIFA 3RZJA 4K1YA 4LULA 4UFKA 2RS11 2VM9A 2A6XA 3CJIA 3A0KA 3CU7A 2WT1A 5AFBA 2UURA 4P5HA 4CTEA 1NQJA 3D0JA 1ZZ6A 2WABA 4B7EA 3PVEA 1BMV1 3MUZ1 3I3MA 3UT0A 4AGVA 4I3PA 1J84A 1ND2A 1FMD1 1DHKB 1UPIA 4HKOA 5FZCA 3H1MA 3L2YA 4LPLA 2RMU1 5F6LB 5BNNB 5LCWL 3EBRA 2C24A 4Q4X2 3ZN6B 2DF7A 4Y33A 2BVBA 1XNCA 2OT7A 2ZEZA 3O5SA 3OGJA 1LOGA 4WVMA 4YRDA 3VZMA 2Q5TA 4XHXA 1PGW1 1J59A 1CJDA 1UZZA 4YW1A 1H30A 2O1QA 1VIWB 4LO7A 3U37A 1KJRA 3TOJA 5LEKA 2HWE1 4LKSA 1EAH1 4P9IA 1UYYA 2D5FA 5IW0A 1WMEA 1UPSA 3ZFEA 4AVBA 3A21A 1VALA 4O9GA 1D4M3 4XURA 1QXPA 1AR73 2IFWA 4ARYA 2C4XA 2VXJA 3I3BA 3H8OA 2E51A 1RTVA 3KV6A 1LCLA 2H0VA 4P08A 1RVF3 2RS12 3F95A 1HN0A 3OPWA 4BK4A 4YZ2A 3BOPA 1VMHA 1W0PA 2AC1A 3H1YA 1RUC1 5D21A 1HQNA 5FZHA 1S0CA 1YO8A 4NPMA 4PIZA 5KHHA 4BQ3A 1SPPA 1GWLA 3N7MA 1JN2P 4R8HA 2XVGA 4EROA 5FBJA 4RFT0 4RN5A 4XCAA 4NPRA 1DIWA 2WR9A 4ZU4A 2XKOA 3AZXA 4EYUA 1F4HA 3CBNA 3OOXA 3BUCA 4FO9A 4IL7A 5JPNB 1QWRA 1RJ8A 1VAKA 3OB8A 1PX3A 4QPYA 3MICA 4BQ1A 4LT5A 4OHZA 3N35A 3AX4A 1PO13 2P2KA 1CN1A 1PZ7A 4A6OA 1NCQC 3FMGA 4E2GA 2IWGB 2FHRA 1SLIA 1D4M1 2BNOA 2QTWB 4XQWA 4TXWA 5K0UC 4CP9B 2Y60A 5LA2A 5A7WA 2ZACA 2DYCA 3AYCA 5L9RA 4GJYA 5JMCA 1VBA3 3ZFGA 5C7GA 5KXDA 1UZ0A 2HBTA 5KC6A 4RGAA 1I9RA 2B45X 2RJLA 4LHNA 4CZSA 1UIKA 3CEWA 4CDUB 3DEMA 5I91A 3N9NA 5JI7A 2ARCA 4OI2A 3SCHA 1UY0A 2RV9A 2B42B 1OMIA 1ZYBA 2QQWA 5CFCB 1WCKA 2Y34A 2ZKNA 5L9VA 4J25A 3O1TA 3DXUA 3MIGA 3TYJA 4LUKA 1S2EA 2PQQA 4A3XA 1VB2A 4QPIA 3WNNA 2R063 3D5OA 2VOWA 3HAGA 1GMMA 1WCDJ 4XF9A 4IEUA 1KFXL 1ZBA2 4IETA 4PCRA 1TME2 1GZCA 2EVXA 4Y3OA 1W03A 4URAA 1AR82 4I0BA 4IGPA 3UETA 4D6RA 2VZTA 3DGTA 1RUNA 4C91A 3ZSKA 3KV5A 3NSTA 1W04A 5I0DA 1VBD3 2VUDA 3ZPOA 3I49A 2IXJA 4DOUA 3CJIB 2WS92 4PBOA 5GKAC 2W68A 3CMGA 4KG0A 4CP1A 4CUAA 3TEXA 2VOTA 1F5JA 1K3IA 1SLLA 3A7QA 4ES8A 1XOYA 4QPIC 3GBWA 2GN3A 1BLZA 2E33A 2VE1A 3J7HA 3LEGA 2W08A 1D4M2 4L97A 2MEV2 1ZVFA 3MIDA 4XUQA 3ASIA 3AZYA 1XNTA 5J48A 2ID4A 3I2GA 1DLCA 4KQ7A 2DCJA 1QJU3 3URFA 4K40A 3S6PA 1Z7S2 1PO11 1VBC2 2G4IA 4CEWA 1H8TB 1LOAA 1LTEA 5C3OA 1S0FA 4META 4YVSC 3T0DA 5CYYA 2C26A 3D4KA 3QD6A 5KXCA 1VR3A 5AC92 2EIDA 3OYWB 5FYMA 2JE7A 3WOGA 2VW0A 5DPNA 2ES3A 5ISLA 2YB7A 4AW7A 3U1XA 1RXFA 4O65A 3MV11 1DQ2A 3K4ZA 5BYNA 5DG1A 1NG0A 1ULFA 3HT2A 1RUI1 2CAVA 3KB5A 5E89A 1LOFC 4LJHA 4YZ4A 5IVEA 4YLZA 3NAPA 2TNFA 3CDZB 4IEXA 3BVCA 1P8JA 2W91A 4V2VA 5F37A 2XJRA 3AZWA 1XSQA 5FPAA 5FY0A 4AEMA 1ZREA 1QKQA 2D6PA 2WA4A 4YNIA 4ZZ8A 3VZOA 4COYA 4LK7A 5L19A 3SLIA 1XE7A 4JKKA 2JE9A 2E31A 2HWD2 1W6MA 4ONUA 3ZN4A 1MS4A 4IEQA 4I3GA 4M3CB 2K9ZA 1LKNA 4AI8A 5A1AA 5F5AA 2XBO2 4L99A 3T30A 1MEC3 5K9YA 3ZOIA 4A44A 5D1IA 4IEWA 3J8F3 1OOPC 1JHJA 1LEMA 2HKXA 1ASJ2 3LFIA 3AMMA 4QX0A 2HWF3 3POJA 2FCVA 3E5UA 4QU1A 4QXCA 4YFZA 5GZCA 1XBFA 2CAUA 1LR5A 4ZU7A 2R073 2Q1ZB 4CU6A 1FAYA 5J36A 5AC93 2VO5A 1DQ4A 2UWAA 1YYNA 3WNXA 3AB0A 4CDWA 5A1FA 1OKOA 3LKJA 5JXJA 1PIV1 3ZXFA 4GMP3 1UMZA 4G4FA 5FREA 4NRMA 3VDAA 5A32B 5BY5A 1NA1A 2X29A 5I0UA 1JYCA 1WLCA 2JDKA 1W2OA 2YC0A 1YFUA 4OHYA 3SISA 1YLLA 1QJU1 3UV9A 1PIV2 4HN0A 1UO9A 1POV0 1ZX5A 5FZ6A 4ZS2A 1YUDA 5LA9A 1C5HA 1VRBA 3AMHA 2NZ9A 1C5IA 2GP5A 3MW4A 1WCUA 3N7LA 2LM3A 4RGGA 1ZBE1 2A6WA 3OF1A 5HCBA 1ND2C 1TE1B 1Q5OA 1W3VA 1X82A 2R0HA 2VMGA 3AKQA 1RUJ2 3ZIWA 3LCPA 1UX7A 1A6CA 3AMNA 1W99A 1UQXA 2UWCA 4HLTA 5LRRA 1HDKA 2ZEYA 3PLQA 1G6NA 5A7NA 4A6SA 1AR61 4W8JA 1FMD2 2JECA 5J7MA 2Q8EA 1DF0A 3PVBB 5F3CA 3DYMA 2W39A 2R043 2WNEA 1XB9A 1VBB1 5FPLA 4FPCA 4ZKTB 5C3PA 4LHKA 2ORZA 1OQDA 3JBG1 4NO4A 1L7RA 2J7MA 3DKWA 1JYXA 4L8QA 3GCWA 1KFUL 4OUEA 5F5IA 1R092 3N9LA 1YQCA 2VCMA 4Y20B 1TEIA 4QKDA 3GCXA 3SCFA 2WWUA 4ES9A 3OPTA 2P3KA 2DUOA 1DGWA 1DQ5A 1FOD2 2AR6A 2P17A 4CP0A 3TEWA 1OF4A 3OPZA 1N3OA 4E2QA 5AC91 5JZGB 4K3UA 3WDXA 3H1WA 1C4RA 2R071 3E6BA 3H42B 3MLKA 4PIYA 5DZEA 3ZFEC 2OXBA 4LLOA 1GUIA 5C4WB 4XUOA 1WW4A 2XJTA 5FKCA 1DGRN 1KQRA 1N1YA 1VRH1 3ITQA 4NOTA 3J8F2 3RVHA 4Y1YA 4YG3A 5FZLA 4M0HA 5C4WA 2NPIA 2QQNA 1PIV3 5E88A 3POEA 3U4XA 2XH6A 3IN9A 1TMF3 3B5LB 1ND2B 3RZGA 1RC6A 4XW3A 1H4GA 4KI5M 4TYSA 3C7GA 3NNMA 4QKFA 1SQ4A 5C8CB 1BBT2 3FLPA 3IIAA 1ND3A 4LBJA 2CL2A 2HH9A 3IIIA 4LKFA 3KM5A 1HRV2 3ETPA 2Q1FA 4CDQA 5BNOC 4LK6A 1JHNA 1F35A 5FAXA 1GQPA 4XJZA 1RUC3 2TBVA 3AJZA 4OLLA 4OHVA 3ZSJA 4LE4A 3T4VA 1QDCA 4NROA 4PBPA 1SFPA 5FMDA 1CX4A 5I8YA 3ZFFC 4Z92B 4A3ZA 4BM8A 3ALQA 4LBKA 3VDDC 5C9AA 1GBGA 1OKQA 3KT1A 3VD3A 1EP0A 1XNAA 2DUPA 5FUPA 3FFZA 1IS6A 3RZZA 1IQAA 3GZUC 5FXWA 1GWKA 3T2PA 1CAWB 1XQNA 5FPZA 4AEJA 3WF0A 4AHZA 4JV4A 1N1TA 3B69A 3MPPG 5FP9A 1ASJ3 1UNBA 3KCCA 1MEC1 3IZOA 4AK3A 3ZXAC 1PZ8A 5FZOB 4XE9A 3ZFFB 5JXIA 1H9PA 1AX1A 3ZXGA 2VQAA 5FYZA 4QM9A 4MXWA 1OA4A 2Y6JA 3M3QA 4GH4B 1O4YA 3AYDA 2B5HA 1TMF2 2RDRA 4QB2A 1H9WA 4AVSA 3OCPA 4PF1A 1UXXX 5LY2A 2DCZA 1EPZA 3FFQA 5L7OC 4RSUA 3I59B 4CCLA 1OA3A 2D3SA 2CGPA 2JKXA 3MW2A 4WM8A 4QXHA 1VBC1 3VBOC 2YYOA 1BKZA 1TMF1 3C2UA 4LO5B 4QB6A 2EAKA 3M3CA 3WNOA 2VCAA 1GNHA 2CU5A 4O9EA 3MFCA 3A23A 3R6SA 1Q3EA 4QM8A 3WF4A 4MGYE 1JTZX 4PIXA 1CAUA 4COWA 1ASJ1 3CKHA 3PDQA 4IE7A 1W9WA 4A7YA 3AL5A 2QQKA 2Y64A 2VUJA 3PVNA 5DUVA 1ZA4A 2JIJA 4FQZA 5F1RA 5HBAA 3M1HA 4GULA 2OUJA 2FDFA 2PAEA 4D69A 1GZWB 1IPKA 1WW7A 1NQDA 3KGZA 3WQ7A 4XJUA 5IK5A 5FXVA 1XE8A 4GALA 3NJZA 4QGNA 4EN8B 4UT5A 3RRDA 5H9PA 3VBSA 1EAH2 2HWB1 3EB7A 2E9QA 2PXJA 2RM21 2JG9B 4N7UA 4X8NA 4XQDA 2WSVA 3CQOA 1ZM1A 4YPJA 2EALA 1NCRC 4CDWC 4OI0A 2C1FA 4HFSA 4BDVB 3CNAA 1SACA 4YW6A 1BHGA 2CDOA 5FCCA 1NY72 1OD5A 5JSPA 3KSCA 1OH3A 1HB4A 4LBNA 4W50A 2QZ2A 4UFHA 2Y33A 3B93A 4XC9A 2XB6C 3SMHA 4AYUA 1BBT1 4IV3B 5FZ7A 1VBA1 1XYNA 3EQEA 4P9LA 3CHXA 3RZHA 2J1SA 4CUCA 5LA1A 2VD7A 1QJY2 2W52A 4M0NA 4NUBA 2VXRA 2W1SA 4XDPA 3ATGA 5CNAA 2BOJA 5D2AA 3Q8CA 5F5CA 4D7YA 5IFPA 4HG6B 3VD4A 5CG8A 1DZRA 3NNFA 1JU4A 3Q9OA 3ZPYA 3NJVA 3VBSC 1D7PM 4KGGA 4AXOA 2FMYA 3HBZA 3NRUA 4UF0B 4CDXA 1I1EA 2NP0A 2BFUL 3GDBA 4NIAA 1UMHA 2AEZA 5FP8A 2MPFA 4Q5OA 5IAVA 4YYOA 3SH3A 4E4ZA 4UXAA 5CAZA 2RJ2A 4EN9B 2VOKA 4E8CA 2VQUA 1SHWB 1JUIA 1GANA 1LNSA 1VRH3 1W8HA 2CDPA 2BNMA 2UYAA 1W0NA 1V6KA 2CWMA 2WNUA 4DUWA 5C3RA 4GWIA 2VQTA 4PHZA 4K21A 3NV1A 4YVWB 1HX6A 2W1QA 2QQOA 3WD5A 4LBQA 3O1SA 4RFRB 4FPGA 3TNQA 4AQ2A 2DVFA 4GKXA 5DXDA 5L73A 2VL4A 3KWVA 2ZGNA 2CV6A 3V65A 1DGRA 2WWSA 4XIKA 1W0OA 2BW8A 3ACLA 1AYM2 2FQPA 4WM8C 3SKJE 1RUI3 5EPAA 5G05L 2XXZA 2OYZA 4MV2A 3K75B 3C7FA 3ETQA 4YVSA 5FOJB 2P34A 5JUVA 4IDZA 4MGIE 4DO0A 3TEZA 1JYIA 2AENA 4HKWA 4LBOA 1JYVA 1VAVA 1PGL2 1W2NA 2RR13 5J1XA 4S2HA 3BN6A 1STMA 3RZMA 1Q56A 4P00B 5KXBA 4RQPA 2D43A 2HWC1 1V6OA 2OZJA 2D5HA 2QBXA 2XQXA 3BGAA 1HB1A 3M8LA 3KF5A 1C28A 4NWVA 4XMIA 2WO7A 4JHTA 1RITA 4AGGA 4HETA 1PGL1 4NIDA 4KU7A 3IB3A 1O5UA 1ZBA3 2FZ1A 4FOYA 3WDVA 3WNPA 1ULGA 2YU1A 2DVBA 1S4CA 3N7JA 1WMDA 3R0RA 4JQTA 1AHSA 3U75A 5CZKA 3OG2A 1YQ5A 1FPN1 4JTOA 4M01A 4PDWB 4RHV1 3RMYA 1NLRA 4ISQA 4XJ9A 4LITA 1FNYA 3OD4A 5FJKA 2CTVA 2K2SA 1QH6A 1BEV3 2D97A 1WGPA 3LFMA 3E97A 5KHGA 4QX5A 3POIA 1RMU2 5DUWA 3ZO0B 1IS4A 4JGZA 4E4SA 1BMV2 1RUG2 2ZHKA 3WEZA 1O3QA 5GM0A 1RHI2 4FPFA 4Q4W2 2VMHA 1D4VB 1UWWA 2RR11 2EF6A 1AL21 1QJFA 2JDUA 1MR5A 1S2BA 5LASA 4BQ2A 4YVWC 2XJPA 3UGGA 1RUG1 1FNZA 3O1PA 4DS0A 2P3IA 1CJPA 5G04L 1ONAA 4BZ4A 4OZXA 1YIFA 1O4TA 3ABZA 3B3QE 3FUQA 1W6NB 2VNRA 4G3YC 1SLBA 2X5IA 2XBO3 4J1XA 4DXRA 4ATFA 2WJSA 3I4IA 3POYA 3ON7A 1NY71 1V6MA 5JOZA 2VOXA 3J7NA 2EXIA 4C90A 1QQP3 1JOBA 2GC3A 2PQSA 2V73A 2VW2A 1FPN3 4XF3A 2WZPP 3WG2A 2HWC2 2X53S 1UKGA 3SH4A 1RUH2 4LKEA 1QJX3 5D8AB 3ZR6A 2WNOA 4Z1VA 2GDFA 2ORXA 5BPXA 3RNSA 4YSFA 2FDGA 2WYFA 4BCUA 1GKBA 3T1LA 5IATA 2XR4A 5KHIA 1JMUB 2P37A 5A3PA 1PO22 1V00A 2H0BA 4N7IA 4GAZA 4BB3A 4NAOA 1ZRIA 2XHNA 1JOPA 2JD9A 5DDJ2 2VBDA 2CSGA 4UAPA 4AQ6A 2ILMA 1OQ1A 3WG4A 1GZ9A 3E6CC 5A3MA 3ZSMA 5A33B 5FYYA 4K8FA 2R1DA 1GNZA 2UWBA 4D94A 1VMFA 5A3WA 3WNLA 5C6CA 2VZOA 3N9MA 3FN9A 4NVPA 2E63A 5J09A 3WDWA 4QAWA 3NVCA 1YFYA 2LROA 1Y9GA 2YBKA 2ZX2A 3W21A 1Y9MA 1G7YA 3ZYBA 1W9YA 4YG6A 1U5YA 5FYCA 3HWJA 3TNPB 5IJRA 4AEKA 1UL9A 3SEPA 4OUMA 1GOFA 2V5YA 5IVYA 5C5TA 3KQ4B 4QB1A 4XFAA 3RWKX 3VBOB 4XAEA 5CA6A 1J3PA 2AGSA 4D8MA 1OQEA 2JICA 2GN7A 2RS53 4KL1A 1ENXA 4L2NA 1OPOA 2VG9A 4BXSV 1HIXA 4FFFA 3PMEA 2RHPA 3AP7A 3JZVA 2ETEA 2V4AA 3AJYA 4Q0SA 3DL3A 4QPGB 4MHUA 3ZFFA 4HL0A 1NCQB 1O5LA 2I74A 2JG8C 4OI4A 4UOJA 1ZBA1 3PNAA 5FYUA 4JDOA 3WHTA 5CFDC 3GM8A 2F17A 3POWA 1F2NA 2WWJA 3VL9A 2ATFA 2EXHA 4BE3A 1DLLA 2ZMLA 4YVWA 5CBLA 1MS3A 4A2UA 4YARA 3ROUA 2JG9C 2XKPA 1RYYA 3WUCA 4ET7A 2GNDA 1AR72 3AXEA 4O7XA 2HYXA 1HRI1 1MPXA 3JUUA 2J22A 4QDSA 2HBUA 3VHOA 3RJ2X 3CZJA 1CAXB 5LBBA 4AAXA 1IS5A 2YC4A 5C71A 1PX4A 5C3SA 3PTYA 1LHOA 3ZYRA 4B1MA 4RYDA 4XIOA 3ZYPA 2HWB2 3RJRA 5JZGA 1SCSA 1CPNA 2A73B 4YG0A 4BOWA 3DPRC 4EN7B 2J1AA 2O8OA 3CJXA 4UW6A 2WQZC 1SFYA 4YWAA 3VDDB 4CCNA 1O91A 3N3HA 1CX1A 5ERLA 4MGSA 4HOOA 5FDBA 3VBHC 3VD7A 1HJFA 4LOTA 5FWEA 1CD3G 1EUTA 1QHDA 4Y5TA 1W8OA 3LDBA 1ALYA 4IE6A 4MGZE 4CEYB 4XJ8A 3HBKA 3WINE 3QH7A 2PLV3 3OBZA 4FOVA 3E1F1 1W6MB 4R9AA 3WF1A 3O1VA 1PVC1 2PHTA 5GLUA 3OSDA 3K46A 4AEDA 2OX0A 3MGUA 4J1WA 1S0JA 4PDWC 2X05A 4YFWA 2EIEA 4XTPA 1KD7A 3NAPC 5A7QA 3UL2A 5HXMA 1EV12 4I09A 2G19A 4IEPA 5IYYA 2WZR2 2OUHA 3RZLA 2D6MA 2JENA 1SPPB 2NQYA 5IVBA 5B2GB 2WO2A 2D44A 1L3JA 3I3EA 5JLVA 4FP3A 4XAAA 1MS1A 3O7OA 4XFGA 4HPKA 4AFBA 3AKPA 1OXCA 5GLZA 4CU8A 4CDQB 4OHXA 2P6HA 2ZX4A 4PI0A 1AZDA 2GU9A 3S5QA 1C1LA 3PIGA 3WW3A 4BLJA 2ZGOA 4DRVA 2VZQA 4EWDA 5JXGA 2C5DA 2PA7A 2BUKA 3ZIXA 4QQLA 1GP5A 1SDWA 1HB2A 4OULA 3ZSEA 4LQRA 1MS9A 2K0GA 3DECA 1Y7BA 2HLEA 4A7KA 4Y1UA 2A71A 3A0NA 4MXVA 5KC5A 3T2TA 4COVA 4FAHA 4K7JA 5LRSA 2DTWA 1GZTA 3PU8A 1MS0A 4AE2A 3HNBM 4E4DX 4XMAA 5FTTC 3HVDA 1QXRA 4P9GA 4QGMA 5JOWA 4ZHNA 3RPQA 1EV11 1RINA 1WLTA 1HRV3 4H55A 5GALA 4A4AA 5D8AC 5FPXA 2BVVA 3P3NA 3VBFC 1IG3A 1LULA 3N36A 1OVSA 5EXOA 3S57A 2WRAA 1IOAA 1RUD1 5A6YA 5FY1A 3I59A 4QXBA 3BTYA 2VVEA 1CZTA 1JBCA 5DABA 3VZLA 1MQTB 5I0TA 2OQ6A 3BTAA 4XTMA 1O59A 1CVNA 3LPFA 2ADDA 1TME3 1JZ5A 2RS51 3T09A 4UW4A 3KVBA 1VBB3 1MQTA 2ZJCA 5HXVA 4IEZA 3T0AA 4LO4B 5I8TA 2ZGLA 2WC2A 2E7TA 2ZX1A 4MZUA 4KWLA 4Q4W1 3U78A 2NLRA 3AZVA 5FZ9A 1QOSA 2UY8A 1AR92 5CIRA 5FY5A 4YW5A 3PVOA 1CESA 2XONA 1H6XA 3FZ3A 1CIYA 4XDQA 4XZUG 4AI3A 5FY9A 3IPVB 4BK5A 4CXXA 1WLWA 2QQVA 2WNVB 2VOVA 4YZ3A 5DDJ1 4B8EA 1LHWA 1W8NA 4FPLA 4OZOA 3VKNA 4U2AA 3KCXA 1XE0A 3IPVA 4LUMA 4CDXC 1W2TA 3VKFC 4AI0A 5FP7A 1ZZ9A 4XOGA 1UU5A 4Y5Z0 5T50A 4AR2A 1RGSA 3IWZA 1T6BX 1S0DA 2BDRA 4EN0A 3H8XA 4P02B 3WQ1A 1AR81 1BJQA 3FHIB 5D8AA 3AK0A 3C7OA 2JXAA 3S7IA 3LOIA 2YMZA 2EIGA 4GIQA 4NE9A 3NAPB 1AF9A 3UKTA 2JDNA 3ORJA 2GC1A 3HPNA 4LBMA 1RUE3 4MO3M 4AFDA 2Z2SB 1UY4A 3ILRA 3MO4A 3TBDA 1AR62 4Y4RA 2O8QA 4ISRA 5L36A 3UNPA 1W6QA 1UU6A 2VTFA 1W9TA 3P5BA 2JJ6A 2D6KA 3ZMNA 4NR1A 4P9WA 2BFUS 4E4HA 4AI2A 4D6QA 2RMU3 4M4PA 4UF0A 4YZ1A 1NLSA 1OPMA 2ZXQA 1KS4A 1JZ6A 3IDEA 3SXWA 1LHNA 4AVTA 2B46X 2LUWA 4KWJA 4HZFA 2QQJA 3BKZA 3ZSLA 1Q43A 1JZ4A 1JZ8A 1PK6C 4R9BA 1OVPA 5CKMA 4KNCA 5APAA 2VMCA 3GXUA 3ZYIB 1VJ2A 3I2JA 1AL0G 2WYSA 1BZWA 2O0OA 1XNKA 2HEWF 3HN1A 3VBRA 2V72A 1YQ8A 1DU3D 3RG0A 1I6XA 4Q0QA 1UYPA 3KD4A 2R072 4XETA 3VB9A 2NMOA 2RG4A 4QXKA 3TWIA 3DV8A 1W8ZA 3NJYA 4QQHA 5JIAA 4NHKA 4EN6B 1RJ7A 2XOMA 4JQRA 4HPKB 3EMRA 5JDBA 1VBE1 2ENRA 2LTNA 2WQ8A 2X09A 4GD4A 3S30A 3NNGA 1OUXA 1KEXA 1SBDA 4M3CE 2VTXA 1JXNA 3OUJA 4XYXA 4XBQA 1QJEA 1RUI2 4FCAA 2VJXA 3ACFA 4Y1ZA 4QPGC 1A8DA 1ZRRA 4NHXA 2VNOA 3ZYFA 2CWSA 3ZXKA 2GC0A 4Q4Y2 4GMP1 2E32A 4CDWB 3WX5A 2IFRA 1GQHA 1S2KA 3U4SA 2VECA 3H3LA 1W6PB 2DCKA 2YV8A 3NNJA 4RS5B 1R083 1LECA 2VGDA 2BEOA 4UI9L 1ACCA 1NAEA 1AX0A 2JIGA 1LODA 4JZRA 3IT8A 3SITA 4CXWA 1A3KA 1BQPA 2DU1A 2AACA 4A42A 4K1ZA 3K3NA 2GMPA 2ZHNA 4OQ8A 1SLAA 4LBQD 3INAA 1H8TC 2WO1A 1DBNA 5FZAA 2FDHA 4Z2AA 3K48A 4QX8A 2FDJA 2R16A 2XG3A 3ZFEB 2ZAHA 1NCRA 2JG9A 4OMCA 2RR12 3HQXA 2A70A 3JXSA 3ZXEA 4CCCA 2PAKA 1AJOA 2JDHA 5T55A 4RL7A 3GALA 4FFGA 4RD7A 5JOYA 2ZPXA 3KLSA 2BTVC 4PLMA 1ULDA 2R49A 4CCJA 4HKLA 4XF4A 5L7OB 2YPJA 2JG8A 1QOOA 1MEC2 1ENSA 2JWPA 3EO6A 3U0ZA 2A6ZA 1CAVB 1UOBA 3MPBA 3QBQA 4UYBA 4JGYA 5FKBA 1SDDB 1C8M3 2BWCA 2W94A 3I2IA 2HEYF 2HWF1 4H3WA 4YM2A 2X5IB 4L92A 4DUXA 2XL7A 1UMIA 4W6XA 2VVDA 1VB4A 3UJOA 3WT3A 3W9AA 5E8AA 1FV2A 2ZX3A 1UXZA 5IK8A 4Q26A 2PHRA 3MIHA 2DVGA 4UBHA 3CO2A 5IVVA 2XUMA 5FLHA 2W92A 3U07A 1NYWA 2XHKA 5BNOA 5JCTA 1AR83 2ET7A 4D0QA 4CU7A 2TUNA 2YDEA 2IXKA 4BISA 3PURA 3VD5A 1JI6A 2ADEA 4RGKA 3UK9A 1W2AX 2GMMA 2XMLA 2D98A 3QH6A 3ZYGA 1UZWA 3LGRA 1CZSA 3RMXA 5DZFA 4NRPA 1VAMA 2WLQA 1Y3TA 4EV0A 5CG9A 3JBG3 4XF1A 2AUYA 1Q8OA 1SCRA 3POBA 4O61A 2EICA 4UW5A 4IE0A 3W5NA 3O1UA 1HQWA 4ZONA 1QDOA 2BGCA 1S55A 5FUIA 3NNLA 3MHZA 4LA2A 3ZM8A 1W05A 1W8FA 2XJQA 4TWTA 5F32A 3V0BA 3G7DA 4LOSA 2R1BA 2WKKA 3GGLA 1QJU2 2ZGPA 1QY4A 1LGCA 3ZXJA 5K7PA 1O3SA 5ANQA 3PL0A 2G1MA 2PLV2 1D0HA 2WS93 4WVWA 1UD1A 2L9LA 3V0BB 4FTSA 1BK0A 3POFA 4GA9A 3PUQA 4CA9A 2DCTA 4TLFA 2BWAA 3OGGA 4UW3A 4Y24A 5EYYA 5A7PA 3THCA 1EPWA 2GP3A 3OGVA 3LB9A 2E7AA 1VRH2 3U10A 3JCIA 4LE3A 3ZDVA 2H6BA 1QMJA 4CCKA 4OI1A 4AWDA 4BIOA 1VLNA 1U5ZA 5A3UA 3PUHA 5FZ0A 4DEVA 3C8XA 2D40A 5FOBB 1N3PA 3UKNA 2BERA 2W0XA 4K8RB 2QQMA 2BBVA 2OKXA 4FOWA 1M06G 3O1MA 2WL1A 4OUSA 2YHJA 2DCYA 4DY3A 2PHWA 3WLUA 4XUPA 3Q8BA 4Q4Y3 3HNYM 3JBG2 2Q0AA 4JDMA 4ASKA 1F9KA 4KBZA 4XQ4A 4W6YA 5FLIA 2D93A 2ZTNA 2ZEXA 1NA1C 3MIBA 3ZXLA 4CDUC 2GZWA 4Q0PA 4YW3A 4FPJA 5LW9A 2QQLA 1Q8QA 2D6OX 1J83A 1BK1A 1BVP1 3LA3A 2ZGQA 3LE0A 4WM8B 1YWKA 1NZCA 2GNTA 4N9IA 1L7LA 2YY1A 3FL7A 2R061 2NM1A 2WBKA 5A3TA 3N9PA 5FZFA 4AG4A 1EY2A 2VY0A 4JGYC 5BNNC 1XYOA 1AYN1 4L11A 2ERFA 4XXPA 4ORFA 1RUH3 3MZHA 1ZA7A 1W6OA 3BIWE 1H8VA 5CISA 3O0VA 3GF6A 5A7OA 2RS33 1UW8A 4LO6B 2QQUA 5A3NA 1RUF3 1UU4A 1TZOA 4XEZA 2F4LA 3GZEA 1V6IA 1JS9A 2BZDA 1LU1A 1NLQA 1JOJA 1U5IA 3A4UA 5BNPA 1PM7A 3AXDA 3SC7X 5C8CA 1QEXA 3PJQA 4GWMA 2VMEA 5JWPA 1WW5A 1CAWA 4LLFA 1DFQA 2HWB3 1X8MA 4FPOB 4AHXA 3AP4A 5F7UA 3WW1A 3KHCA 2LALA 4HXCA 4JVAA 1NUKA 1PVC3 2BOIA 2EXJA 3C7EA 3MFAA 4QPIB 1H6YA 4CUGA 1JZ7A 2XWJB 3R4SA 1RL3A 1W28A 3ZKYA 3RGBA 1NCRB 2ZCWA 3IDCB 1LHUA 2YXSA 1GICA 2Q4SA 3R4UA 4OMDA 4Q4V3 4PLNA 2BJSA 2ZHMA 1O8SA 1QNWA 4BYYA 1V70A 3QOPA 4HMZA 2WT2A 3ZFGC 3Q8EA 3DKQA 4YGCA 1OFSA 2CGOA 1UX6A 4S2GA 1RUJ3 3FE5A 2R042 3IKWA 4RR3C 5FY8A 4H2AA 1YFWA 2ZGUA 4N53B 1FOD1 2ZGRA 3JD73 4XFBA 1G9CA 4N43C 3BODA 5B4XA 4CRQA 4WZCA 3AP6A 1X36A 4Q1PA 3UGHA 5LBCA 1KJLA 2VC9A 3MLLA 2RM22 1UZVA 5A32A 1PHMA 1PK6B 3NMBA 4HBNA 4QHBA 5I8SA 3VV1A 5DAWA 3POGA 3VBRC 1HXS2 3ZN6A 4DXTA 4CEWC 1D2QA 2JE8A 3ME2A 4UBGA 4B29A 5ABJA 2IC1A 4PI2A 4Q4Y1 4Y1XA 2RJKA 3M3EA 3N4MA 2Z69A 4L0PA 5IFTA 3VD9A 5FZEA 3WZ1A 2ZZJA 5A7SA 4IEYA 5CB7A 1WCSA 3RDIA 3JB8A 3KHBA 1J1LA 3HR9A 4MOAA 3AYEA 1F31A 1FOD3 1OLRA 1A78A 4QDQA 1LB2A 3VZKA 2BRTA 2XWBB 3THTA 2YFZA 4K6BA 3VKLA 3VBRB 3C3VA 5CADA 1ODMA 4COZA 5BNQA 4E8DA 3X29B 3KMHA 4HK8A 4RHV2 2VW1A 3RYPA 4B4RA 4JTNA 1JODA 2VPVA 1MZFA 4QQPA 1MZEA 3FJSA 5ACA3 5JSOA 4WVMB 4EWAA 3DPRB 4CPBA 3KZ4C 2BP6A 1AR91 5ABJC 3QLQA 2KXLA 2HWC3 3GJBA 1ZNPA 3MIFA 5FZOA 5GLWA 4YM3A 2C0ZA 4RR3B 4EWEA 1IGOA 4DPNA 1AJKA 1K5MC 3K51A 2W47A 4BPZA 2IXHA 4GB32 4N43B 3WDTA 4F83A 5F8PA 3I7DA 3AKTA 1V6NA 4FXKB 4N43A 1C3HA 2W5FA 2VULA 1X9PA 1DYKA 1W6PA 2PLV1 1COV3 5E6HA 5DN2A 5CFDB 3I2DA 2D6LX 5FYHA 3J7MA 2JG8B 5KHJA 1QNYA 3B7MA 1E5RA 1T6GC 4HT1T 2WZ8A 3P1IA 2ARXA 5BNOB 2I45A 2VCCA 1RUH1 1UAIA 1PNFA 2WFF3 3LPGA 4CPBD 2J1VA 1JZ2A 1V9U1 1OURA 2DVDA 2ZGTA 2B4KA 2VUCA 1AYN3 1GOGA 5FZKA 1R1A2 1PO21 1RUF2 1HV1A 3ELNA 2UU8A 3AC0A 3VDCA 2V09A 5CFCC 1QQP2 2XJVA 2G9GA 4LNVA 4LMFA 2BQPA 1OF3A 2A3YA 4YGBA 5DAVA 4GB31 1FMD3 5TSWA 3T4HB 4AQTA 2CNAA 4LA3A 3H0OA 3MLJA 1BBT3 2JDYA 4QWNA 5LBEA 5T3NA 1CAVA 3DYPA 5JXHA 2AYHA 2FDKA 4F3JA 4IW3A 4LIVA 1XC6A 1TNRA 4FTEA 4C1XA 1HLCA 3D6EA 2XDVA 2Y0IA 4UWDA 3UJQA 4A7ZA 4TN7A 4ARXA 1KDKA 3JD72 4YGDA 4Q0VA 3OUIA 1W8TA 3CLPA 4QGLA 3VN4A 5FQ0A 3PTRB 2G9ZA 2GH8A 4LIUA 4HANA 5JIUA 4Q0UA 4YW7A 1CPMA 1DZQA 1GQGA 1ENRA 1YI9A 3FBMA 4ZU5A 5BNNA 5KWRA 4GWNA 5FYIA 2YGMA 1EAH3 3HT1A 5EJ3A 1GP4A 3PUIA 4NIHA 3H50A 2XUEA 4Q4V1 5FZBA 1E57A 3WXPA 3WQBA 1XJAA 5JSRA 2ZABA 5FP4A 1Q8SA 5A7WB 4JAAA 1E5HA 4J6GA 1CIWA 2OS2A 1CONA 2WS91 1OT5A 2ZZQA 1YIPA 1OSGA 1RMU3 1NKGA 1WW6A 3NV4A 4OHWA 4QKNA 3D8CA 4PF5A 4NIGA 1V9U2 5A1LA 1KRIA 1F5FA 1MZ5A 1H1IA 5FPBA 3M2MA 5KR7A 2BYVE 2NYYA 1ULCA 1H1MA 2P3YA 4MSVA 5J37A 2VMIA 1LOCA 3VKMA 2Y6KA 1LOEA 4Z2WA 3EHKA 1E5IA 4JGZB 3AMQA 4A45A 1HB3A 2OIIA 1QJY3 4PDWA 5CKNA 1UY2A 4EZ4A 4KMQA 3MF6A 3ZYHA 1LHVA 3PIJA 1O6UA 1PMIA 2H6CA 4IE4A 1Z7S1 3BPSA 4CEYC 1Q8VA 5FFOC 2FDIA 3OYWA 2ZAAA 2W3JA 1W2UA 5H9RA 2VNVA 1H2KA 5FZMA 1M4WA 5C33A 1ZZ8A 1YNAA 2R0FA 2VAUA 4DEQA 3JD71 4GB33 2J1UA 4KWKA 5FZGA 2DFCA 2Q1MA 3IMNA 4D7TA 3IDBB 3IAPA 3T1MA 4NN0A 3TAYA 2BNNA 1AYM1 4RHV3 3ZXDA 3W58A 2WLPA 3ES1A 5H9SA 4AI1A 1LAJA 4R4XA 1FV3A 1I3HA 5LK5A 1SLTA 3VBUA 3WDYA 1SEFA 2ZEWA 4LHLA 3U14A 1PMJX 4QHZA 4M3CF 5GLTA 3Q8AA 1X50A 4XDOA 2D7FA 3UYJA 2UY9A 5DQ0A 3POSA 5L9BA 2PHXA 4XABA 1UYZA 4G9SB 1WD4A 1XYPA 1CR7A 4FT8A 2XVKA 2YGLA 2VZ1A 4LR4A 4XACA 4Q29A 3NV2A 1UKRA 2WZR3 2Y6FA 3OBAA 3R4DB 5FY4A 5FZ4A 5T54A 3LZZA 4NWWA 3V0AB 4Q2FA 2Q30A 1REDA 3KT7A 4BQ4A 2QQIA 3CF6E 3KV4A 4Q1RA 3WP3A 5IUQA 3O1RA 4B4QA 4MGKE 4X8PA 2ZMNA 4Z07A 5FYTA 2R30A 2ZGMA 2YROA 5BV6A 4JKMA 2DDUA 1FYUA 4FSJA 4BMEA 3FC0A 2VZUA 3VBUB 3J4UH 4BWOA 2ZX0A 1HRI3 1KGYA 2HWD3 4ZZ5A 4TTGA 4PT6A 4QX7A 1DDLA 1DZTA 1J3QA 2D3PA 3VGIA 1W8UA 2E7QA 2V5DA 2VZ3A 2WDBA 4KG8A 4FAGA 5CFCA 1PGW2 4W6WA 5EP9A 1H4HA 1OOPA 2C6SA 1WMXA 3FX3A 3KCYA 1UIJA 1R64A 5K4LA 4IV3A 2SBAA 1WLDA 4Q4W3 3KQRA 2O14A 3PUSA 4P9YA 4FPYA 4DMIA 5HCAA 1OLMA 3EYPA 3AMPA 3VHRA 4E9KA 2A3XA 2N7GA 1ZBE3 2RDSA 5DG2A 5A3LA 3OEBA 2OA2A 1SZBA 4QPGA 2B39A 3BTXA 1H8TA 4LXLA 3VKOA 3I2OA 4V2WA 1TQ5A 2Q8CA 4BQWA 4YZ5A 4CCEA 4F7ZA 3B01A 4XFIA 4LBLA 5C8WA 3WCSA 1IS3A 2QQPA 4MH0E 3I2KA 3IDAA 3I3QA 1BVVA 1L7QA 1YJKA 2FCTA 5DUXA 5GZDA 5SV8A 4OQ9A 4WM7C 5C9AB 1A34A 2A5ZA 3E5XA 3GJAA 3K3OA 4Q4X3 2EIBA 2GAUA 5EYXA 1JH5A 4H7LA 4AQSA 4NHLA 4AVAA 1TG7A 3JQWA 2DUQA 4H7MA 3RS6A 5GZGA 1XU2A 2YG0A 3TRSB 1DG6A 2DU0A 1GYKA 3BU7A 1FPN2 4SLIA 2QUOA 1PNGA 1JYWA 3CZUA 1AXKA 4AVCA 5I0SA 1DGWX 1DYOA 1IQDC 1UY1A 1OC1A 2HYKA 3LIHA 5IVCA 3I8TA 3IAQA 5LY1A 1KXGA 2WNVA 2Z79A 3VL8A 3LAGA 4CCMA 1ULEA 1O3TA 5ABJB 3MI8A 4GXLA 5FPUA 1Y43B 1W6OB 1AYM3 2P4EA 3APBA 3T2OA 4MG2A 3AKRA 3H7YA 3O12A 1U12A 4WZFA 1O3RA 2HWE2 5T52A 1NT0A 2A3WA 1S0BA 4WVZA 1UN1A 4C0HA 4HSJA 1GZWA 2AZ5A 3OY8B 2Q8OA 2VH9A 1POQA 4FPHA 2Z4FA 3ES4A 5FMOL 1D0GA 3MW3A 2VZPA 5JOXA 3O1OA 4QT6A 1Z0HA 3KT4A 2WFPA 3AP9A 1BEV2 4R9DA 1IPSA 2C9AA 3NW4A 5FBZA 1YFXA 2RE9A 1NXMA 5IK4A 4BQ5A 4B4PA 3WNMA 1ZBE2 1V6LA 4JGZC 3LEKA 3T2QA 4HONA 3CL1A 4YW4A 1RUJ1 3JB4C 5I93A 4URTA 1QJX2 3VUOA 4AOCA 1OBNA 1K5JA 1US2A 1VP6A 3BU0A 1BXHA 1YRZA 4Y20A 2QKDA 1YI7A 1Z78A 2CY6A 2G9FA 5JR7B 1O4ZA 1ZZBA 2MEV1 2KD7A 1AXZA 1CQ9A 1MVQA 3FLTA 2XPJA 4Y22A 1X33A 3PMSA 5GJ6A 2ZHLA 5DUUA 4HVRA 3VZJA 3WW4A 3SNMA 5FZ1A 4Z8BA 5JAXA 1PO12 3F2ZA 1H2MA 3FUOA 3CIHA 2FZ2A 1B35B 5KHKA 2DV9A 1MZ6A 4XFCA 4LHSA 3ILNA
chains in the Genus database with same CATH topology
4I0WB 4XILA 2RS52 2ZBJA 1DQ6A 3EXUA 2RS32 4DRRA 1QOTA 2WFF1 4HVOA 4ASMB 4P14A 1APNA 4JDNA 1XRUA 2WNVC 3GZAA 1R1A3 2IXLA 4B3NA 4IV1C 1DQ0A 1PZ9A 3J26N 1QGLA 1DGLA 1RVF2 1POV1 2GNBA 2RS13 2WIIB 3ILFA 1RUD3 1U5XA 4LBQB 4LEJA 2F4PA 4L9BA 2OVUA 2UYBA 1C1FA 4C0BA 3E6DA 4FP2A 2A6YA 1REFA 5IT6A 2A7AA 4JRLA 5IK7A 1PK6A 1VBE2 2YZ4A 5C8CC 5AVAA 3FWEA 5AVPA 3IM0A 2XJSA 1B35A 3H9AA 4KGQA 2NN8A 4OVEA 5BUVA 3WP6A 1MVEA 5KXEA 3MDPA 1PO23 4XBNA 2Y38A 1MQTC 4B7KA 3MIEA 3VBHA 1V6JA 1HXS3 3GZTB 5LK7B 1RUE1 1IKPA 3AYAA 4AVVA 2ZGKA 2RS31 2VNGA 4IV3C 4DQAA 4FQ4A 5JZGC 5J3UA 4MUVA 1S0IA 3ZN5A 4GQ7A 3VBFA 4INDA 3USUA 2PAMA 1Y9QA 5JI9A 5JPMB 4AHWA 2E6VA 2WA3A 3TN93 4COUA 3RWNA 1N1SA 1X8EA 2XLFA 3ZVXA 3USSA 3VZNA 4FXGB 3OY8A 4R52A 4MXWB 1R1ZA 4IV1B 4XPVA 2OW4A 3WP4A 1BCXA 3H3ZA 3OTFA 4X6RB 3RI8A 3W59A 3M4FA 1K5MB 3BCWA 4U36A 4CDQC 3IBMA 5BNPB 4BH9A 2JKBA 1FXZA 4FOQA 1GLHA 1LEDA 1ND3C 4LO8A 1SBEA 4BHPA 1WBFA 3V64A 2ZS6B 2QE3A 2CYFA 5FO8B 1OOPB 1OFNA 4V1PA 1G9FA 4H14A 4M3CA 1QJX1 4XHBA 1UCXA 1ZRDA 2HWD1 5FQ0B 1TME1 4XFHA 1VBA2 2HWE3 3RYKA 3VBOA 2GNMA 4Z82A 3GBFA 3OBRA 4HK9A 4DNYA 2WT0A 3TN92 1R091 3HD8B 4DFSA 2P3JA 5T5JA 2ZA9A 1C8M2 1PVXA 1IKQA 4I01A 5GLVA 3B9IA 1QH7A 1HRV1 2QNKA 1RB8G 2I2SA 5EFUA 4N53A 2B8MA 1RIRA 1UF2C 2PHLA 3VBHB 1HKDA 3WP5A 3U11A 4IQPA 2WNUB 1RVF1 4RS5A 2F6BA 3M70A 1G86A 1RHI3 1JUHA 2QZ3A 1G9AA 3SHRA 2DURA 5T5LA 1NOVA 1G9BA 4K20A 4D3WA 1NE4A 4HN1A 3DPRA 2GALA 1U0AA 3RQ0A 1R081 5SV5A 2EAAA 1PGSA 4KU8A 2GH2A 1XNBA 1QXJA 1WBLA 1NXD1 4IESA 2YUEA 3RI9A 3WCRA 1FATA 2SLIA 2X5IC 4AGRA 5FLJA 1HXS1 1VBD1 1RUD2 3ST7A 3TB0A 1C8M1 2KA3A 3AKSA 4SBVA 2PELA 1QJY1 3NKTA 4FBFA 4WM7B 2PHUA 2XBO1 1LU2A 3CJIC 1RUE2 1X7NA 3WDUA 5AFEA 3VHPA 1J3RA 3NKGA 3M3OA 4OFGA 1GFF2 4RA0A 1D2SA 5FMOS 3QCWA 4AEDB 4N9HA 4IEVA 3ZMOA 4N90A 4YVSB 3AFKA 3GHMA 4MLOA 4P9XA 4Q4X1 3MEPA 4WVVA 3JQXA 1KDMA 1OI6A 4AFCA 4S2FA 2PHDA 4Q8KA 5C4WC 1F8VA 4M00A 3GHNA 5T5OA 2ET1A 3WHUA 1CGPA 1NE6A 5CVRA 2QCSB 3VBUC 3N7KA 2WINB 2Z42A 4BMBA 2WFF2 1FX5A 1W6NA 5FRAA 4HVQA 4I2OA 2Y0OA 4RS5C 3B02A 1W39A 4JGYB 3H7JA 1O7FA 4AFMA 4TSVA 3AP5A 1BYHA 5EZWA 1QF3A 3B9CA 4RQPC 4JRAA 1AVBA 3LSEA 2EA7A 4BLIA 5LEJA 3B00A 1RUC2 4X6QB 3WG3A 1ZZ7A 5FO7B 5EV7A 1DYPA 1H1AA 2VQ0A 1RUG3 1Q8PA 1AL23 1S1AA 1LOFA 1FT9A 4Y22B 4C1WA 1SBFA 5KBFA 3WG1A 1MS8A 1QU0A 1HW5A 4YW2A 1COV2 3RSJA 2VUAA 1IPJA 4DZGA 1H2LA 1YJLA 4E2SA 1K5MA 4AHYA 3D0SA 4I30A 4MX3A 2WNUC 4FTBA 1RUF1 3ENRA 2Z5WA 2R062 3NWKA 3O14A 4W65A 1AXYA 2A75A 1LENA 3GNEA 1VBB2 2XGXA 5I0RA 2AREA 1HQLA 1J1TA 2I07B 1AYN2 2R041 2X8KA 4D7SA 3V56A 2ZKLA 1URXA 5JVVA 2XLGA 1LGBA 3DN7A 1SMVA 4LTAA 2DWRA 1VBC3 5DZGA 3LWCA 1W6QB 1ENQA 3L9JT 3R05A 1J58A 2IZWA 4XF0A 2R32A 1B35C 3HMYA 1WD3A 2GC2A 3QACA 4I0AA 3KGLA 1GR3A 2GSYA 2R6QA 4ITCA 2PHFA 1ZRFA 3USUB 1CAXA 1LJ7A 2TEPA 1QJZA 2WQ4A 1N47A 3AZZA 2JDZA 1IZ3A 4XFFA 3PHMA 1TNFA 4QQOA 4QU2A 3L2HA 4S2DA 3V0AA 4XZPA 2QJVA 3M3IA 2NMNA 3GBGA 4IEOA 3WW2A 4FPKA 2AH2A 2QDNA 1YHFA 1A8MA 1NCQA 5L7OA 1VBE3 4YGEA 1XXNA 2D3RA 1I5ZA 2PYTA 2WSUA 3VHNA 4IV1A 1C8NA 2OZ6A 5F6KA 5F9TA 3WVJA 1IHMA 1R093 4GMP0 3VBSB 3J9SA 1BEV1 1JW6A 2Y26A 2HJIA 3EJKA 3E5QA 3MYXA 2HWF2 4PQ9A 1WUVA 3NL1A 3H8UA 4TZDA 2RM23 3VBFB 4P9JA 5BXXA 3M7AA 1ZZCA 1CAUB 2OPKA 2ZGSA 4XXAA 4DXZA 1B09A 1AX2A 1EV13 1G9DA 1OA2A 2WZR1 1XU1A 4NHMA 4Y1VA 5E16A 2EXKA 2VU9A 1VBD2 5EWSA 2FMDA 5A33A 2DVAA 4QMAA 3ZDSA 4Y26A 1RHI1 3KS7A 4CP2A 4RQPB 1LRHA 5CU1A 4DINB 1V9U3 1AL22 1LOBA 5F5QA 3ZX7A 3SCGA 3O0XA 3PJYA 3G6JB 4JC1A 1REEA 4QD2A 4ASLA 4MYEA 3BOWA 2XJUA 3DF0A 5J98B 3VLBB 3LOBA 1MS5A 3H3UA 4JCKA 4BA6A 1HV0A 1Z7S3 1MACA 2IXIA 4Q27A 2DTYA 4IXLA 5I91A 2B9UA 1N1VA 2B7YA 5GZFA 4QQ2A 4AEDC 1N3QA 1RUOA 3LA7A 1H0BA 4FPEA 4I02A 2XVLA 1AR63 1C57A 4RR3A 3HIFA 3MF9A 3OD0A 5K0UB 3B94A 4F8AA 4GH4C 1WMFA 3FLRA 4CYDA 2PN5A 3WV6A 2IXCA 5H9QA 5K0UA 2XL9A 1AUYA 3WR0A 1XNDA 2JEMA 3NO8A 1SFNA 3BALA 2PFWA 4WV8A 5GZEA 4WM7A 3AFGA 5J96B 2QVSB 2ZMKA 4PJYA 3DUIA 4Q8LA 1S0GA 3I54A 3LSDA 4ATEA 1COV1 1ND3B 2ZOEB 4ZXKA 3VDDA 1AR71 1YCIA 1G8WA 4R4ZA 3UKVA 3S7EA 5BNPC 1WA4A 4GKYA 1OLQA 4YM0A 2DFBA 1GSLA 1LESA 2PTMA 4DB5A 1H2NA 3LA2A 2D6NA 2FBEA 4AF9A 5CFDA 3WUDA 4KBBA 2ARBA 3J8F1 2HEVF 2VVFA 1UZYA 1SLCA 3BPZA 3THPA 5C9AC 2A6VA 1POV3 5K8SA 2QDRA 4KH9A 1R1A1 2MHFA 2XLAA 3AM2A 2E53A 3NV3A 1QQP1 1HRI2 3OJBA 4CEWB 1EYBA 4R9CA 4DY5A 3TN91 1FI2A 3ECQA 1AR93 1DQ1A 5E1RA 4Y4YA 3BB6A 2KM2A 2JD4A 2RMU2 3JU9A 3D82A 4FVVA 4XBLA 4N53C 4YM1A 4CDXB 4CEYA 4CDUA 4EJRA 4MVTA 5T5PA 4AFAA 1KS5A 4HSLA 3OBTA 4PLOA 1GV9A 3GYDA 4XJWA 3WY6A 3ZYJB 3ZFGB 2JX9A 5ACA2 3FBYA 3P3PA 1OHFA 1RMU1 5DDJ3 2QFEA 3RYRA 4K9SA 4Q4V2 4E27A 5FO9B 1NA1B 5HI0A 1R082 3WQ0A 2MEV3 3O0WA 5ACA1 5HCFA 1ZRCA 4XJAA 2BPA2 1LGNA 1KITA 4GH4A 2CGNA 4IERA 3S0MA 1PVC2 2GMEA 2MNGA 1YXWA 4WBBA 1S0EA 4BIFA 4K1YA 4LULA 2RS11 2A6XA 3CJIA 3A0KA 3CU7A 2WT1A 5AFBA 2UURA 4P5HA 4CTEA 1NQJA 3D0JA 1ZZ6A 4B7EA 3PVEA 1BMV1 4AGVA 4I3PA 1ND2A 1FMD1 1DHKB 1UPIA 4HKOA 3H1MA 3L2YA 2RMU1 5F6LB 5BNNB 3EBRA 4Q4X2 3ZN6B 2DF7A 2BVBA 1XNCA 3O5SA 3OGJA 4WVMA 4YRDA 1LOGA 3VZMA 2Q5TA 4XHXA 1PGW1 1J59A 1CJDA 1UZZA 4YW1A 1H30A 2O1QA 1VIWB 4LO7A 5LEKA 1KJRA 3TOJA 2HWE1 1EAH1 4P9IA 2D5FA 1WMEA 1UPSA 3ZFEA 4AVBA 1VALA 4O9GA 1D4M3 1QXPA 1AR73 2IFWA 2E51A 1RTVA 1LCLA 2H0VA 1RVF3 2RS12 4YZ2A 3BOPA 1W0PA 3H1YA 1RUC1 1HQNA 1S0CA 1YO8A 5KHHA 4PIZA 3N7MA 1JN2P 4R8HA 2XVGA 4EROA 4RFT0 4NPRA 1DIWA 4ZU4A 2XKOA 3AZXA 4FO9A 4IL7A 5JPNB 1QWRA 1RJ8A 1VAKA 4QPYA 4BQ1A 4LT5A 3MICA 4OHZA 3N35A 3AX4A 1PO13 2P2KA 1CN1A 1PZ7A 1NCQC 3FMGA 4E2GA 2IWGB 2FHRA 1SLIA 1D4M1 2BNOA 4XQWA 5K0UC 2ZACA 2DYCA 3AYCA 5JMCA 1VBA3 3ZFGA 5KXDA 4RGAA 1I9RA 2B45X 2RJLA 4LHNA 4CZSA 1UIKA 3CEWA 4CDUB 5JI7A 4OI2A 3SCHA 2B42B 1OMIA 1ZYBA 5CFCB 1WCKA 2ZKNA 3MIGA 3TYJA 4LUKA 2PQQA 4A3XA 1VB2A 4QPIA 2R063 3D5OA 2VOWA 3HAGA 1WCDJ 4XF9A 4IEUA 1KFXL 1ZBA2 4IETA 4PCRA 1TME2 1GZCA 2EVXA 1AR82 4I0BA 3DGTA 1RUNA 4C91A 3ZSKA 3NSTA 1VBD3 2IXJA 4DOUA 3CJIB 2WS92 4PBOA 5GKAC 2W68A 4KG0A 4CP1A 1F5JA 1SLLA 4ES8A 4QPIC 3GBWA 2GN3A 2W08A 1D4M2 4L97A 2MEV2 1ZVFA 3MIDA 5J48A 3ASIA 3AZYA 4KQ7A 2DCJA 1QJU3 3URFA 4K40A 3S6PA 1Z7S2 1PO11 1VBC2 2G4IA 4CEWA 1H8TB 1LOAA 1LTEA 1S0FA 4META 4YVSC 3D4KA 3QD6A 5KXCA 1VR3A 5AC92 3OYWB 3WOGA 2JE7A 2VW0A 2ES3A 4AW7A 1DQ2A 5BYNA 5DG1A 1NG0A 1ULFA 3HT2A 1RUI1 2CAVA 3KB5A 5E89A 1LOFC 4YZ4A 4YLZA 3NAPA 2TNFA 4IEXA 1ZREA 2XJRA 3AZWA 4AEMA 1QKQA 2D6PA 2WA4A 4YNIA 3VZOA 4COYA 5L19A 3SLIA 1XE7A 2JE9A 1W6MA 2HWD2 4ONUA 3ZN4A 1MS4A 4IEQA 4I3GA 4M3CB 2K9ZA 1LKNA 4AI8A 2XBO2 4L99A 1MEC3 5K9YA 5D1IA 4IEWA 3J8F3 1OOPC 1LEMA 2HKXA 1ASJ2 3AMMA 4YFZA 2HWF3 3E5UA 5GZCA 2CAUA 1LR5A 4ZU7A 2R073 2Q1ZB 1FAYA 5J36A 5AC93 1DQ4A 2UWAA 1YYNA 3WNXA 3AB0A 4CDWA 3LKJA 1PIV1 3ZXFA 4GMP3 1UMZA 4G4FA 5FREA 5BY5A 5A32B 1NA1A 2X29A 5I0UA 1JYCA 1WLCA 2YC0A 1YFUA 4OHYA 3SISA 1YLLA 1QJU1 3UV9A 1PIV2 4HN0A 1POV0 1ZX5A 1YUDA 1C5HA 3MW4A 3AMHA 2NZ9A 1C5IA 3N7LA 2LM3A 4RGGA 1ZBE1 2A6WA 3OF1A 5HCBA 3AKQA 1ND2C 1TE1B 1Q5OA 1X82A 2R0HA 2VMGA 3ZIWA 1RUJ2 3LCPA 1A6CA 3AMNA 2UWCA 4HLTA 5LRRA 1HDKA 3PLQA 1G6NA 1AR61 1FMD2 2JECA 5J7MA 1DF0A 3PVBB 2W39A 2R043 2WNEA 1VBB1 4FPCA 4ZKTB 4LHKA 1OQDA 3JBG1 4NO4A 3DKWA 4L8QA 1KFUL 1R092 4Y20B 1TEIA 3SCFA 4ES9A 2P3KA 2DUOA 1DGWA 1DQ5A 1FOD2 2AR6A 2P17A 4CP0A 3OPZA 1N3OA 4E2QA 5AC91 5JZGB 4K3UA 3WDXA 3H1WA 1C4RA 2R071 3E6BA 3MLKA 4PIYA 5DZEA 3ZFEC 4LLOA 5C4WB 1WW4A 2XJTA 1DGRN 1KQRA 1N1YA 1VRH1 4NOTA 3J8F2 4Y1YA 4YG3A 4M0HA 5C4WA 2NPIA 1PIV3 5E88A 3U4XA 2XH6A 3IN9A 1TMF3 3B5LB 1ND2B 1RC6A 4XW3A 1H4GA 4TYSA 1SQ4A 5C8CB 1BBT2 3FLPA 3IIAA 1ND3A 4LBJA 2CL2A 3KM5A 1HRV2 4CDQA 5BNOC 1JHNA 5FAXA 4XJZA 1RUC3 2TBVA 3AJZA 4OLLA 4OHVA 3ZSJA 4LE4A 1QDCA 4PBPA 1CX4A 3ZFFC 4Z92B 4BM8A 3ALQA 4LBKA