5T54A

Lectin from bauhinia forficata in complex with blood group a antigen
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
229
structure length
229
Chain Sequence
SELSFNYPNFQSVEDITFQGGASPRNETLQLTPTDSNGIPIRQRAGHAVYSQPFQLRDTSFYTTFTFVIRTTSNSPADGFAIFIAPPDFPVKRYGGYLGLFEPNTATNTSANKVVAVEFDTWVNTEWKEPRYRHIGIDVNSIVSVRVTRWQDKDVFSRSIATAHVGYDGISKILTAFVTYPDGGNYVLSHVVDLAEIFPGDVRIGFSGATGQYETQYIHSWSFSSTSTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title Structural analysis and unique molecular recognition properties of a Bauhinia forficata lectin that inhibits cancer cell growth.
pubmed doi rcsb
source organism Bauhinia forficata
molecule tags Sugar binding protein
total genus 50
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t54A00
1V6IA 5T5JA 3ZPYA 1WD3A 1A8DA 5E89A 1A78A 2H0BA 5EWSA 5FREA 1S0GA 2P3IA 1N3QA 4XZPA 4Y26A 4YZ4A 2W08A 2YV8A 2CTVA 1GZ9A 2ZZJA 1Y7BA 4Y1YA 1SACA 2WQZC 4YM3A 4ITCA 3WNXA 2ERFA 1EPWA 3AP4A 2ZMKA 5F5QA 2DVGA 1PZ8A 1QGLA 3N7MA 4FOVA 1AXZA 1LENA 3PJQA 2VW0A 1GNZA 4LBLA 1Q8VA 1KJLA 3IPVA 4XIOA 2PHFA 5GZGA 3PVOA 5HCFA 2ZMLA 2A6VA 1YXWA 5GLZA 1MS3A 1MS1A 3ZSLA 3SNMA 3POSA 2R0FA 3NV1A 1V6KA 1HQWA 3WDYA 2NP0A 1FV2A 5DZGA 1HKDA 1LGBA 1HLCA 1FAYA 2E6VA 2UU8A 3ZSMA 4LBOA 3AJYA 1LHVA 2YROA 3VKNA 5GLUA 1AX1A 3SH3A 1URXA 4WVVA 1J1TA 3LSDA 1Q8OA 1RINA 3ILRA 4UW4A 3T2TA 4YFWA 1N3OA 2CNAA 1S0CA 1BYHA 2GDFA 2R1DA 2ZA9A 3BIWE 4FPEA 2DVDA 3V0AA 2A70A 4C1XA 4XJUA 5CNAA 4R9DA 1SCRA 4JRAA 3FLTA 3LCPA 4YW3A 2A7AA 3M3EA 3AFKA 4PQ9A 1N3PA 1C4RA 3WVJA 2A71A 5T5LA 3RQ0A 5KXCA 3AK0A 1GBGA 2ZHNA 1JUIA 2ZHKA 2SBAA 1SFYA 2ZGOA 4M00A 4XIKA 1W6MB 5SV8A 3VKOA 1IKQA 1W6QB 1V6LA 3O0VA 3ZSKA 3JU9A 1QU0A 2P2KA 1KJRA 4NO4A 5GLVA 3ZXJA 2OUHA 4FPCA 1F5FA 1GZCA 2ZGMA 3D5OA 2P37A 3W59A 1MVEA 2JE7A 3WDXA 1S0JA 1LGNA 3AP5A 3A0NA 3AXDA 4NOTA 2ZGPA 5IT6A 4YW5A 1UPSA 5DUWA 1UX6A 1CPMA 3RRDA 5JOZA 4GWNA 1ZA4A 4XTPA 1MZ6A 1GV9A 2VW1A 1FNYA 4XE9A 3PVEA 4FPYA 3WOGA 2NMNA 2DUPA 3ZXLA 5JOXA 3D4KA 2GMPA 4DFSA 5T5PA 2A3WA 1UL9A 3CNAA 2GN7A 3M3QA 1SCSA 1JXNA 3AP7A 3AZYA 3BOPA 4M3CA 1MS4A 2C5DA 5GALA 4DPNA 4AYUA 2DUQA 1JOJA 4FVVA 5FRAA 5IK8A 1GKBA 2PHTA 2A6YA 2P34A 3R4SA 4BLJA 1QDCA 5H9RA 4FOYA 3LSEA 1DQ1A 1XQNA 4FPFA 2D6KA 1WBLA 2WJSA 3ZYRA 4AGGA 3O0XA 4GKYA 1LJ7A 1LEMA 3ASIA 1AX2A 4M3CE 5AVAA 1LOGA 1RIRA 1MZ5A 4F83A 4AWDA 3SH4A 1VAVA 1W6PA 4HL0A 3ZXFA 5IK5A 2DTWA 2E51A 2YZ4A 4YM0A 2WSUA 1LHNA 1V00A 3RG0A 1MS8A 3FUQA 4FOWA 1QNWA 2FMDA 4Y1XA 1IS3A 3OY8B 4FPLA 5KXBA 3OYWA 3AX4A 4FP2A 4BQ1A 2LTNA 3B00A 3V0BB 2W68A 1BZWA 1F9KA 2ZBJA 4LBMA 4M01A 1LHOA 1N1TA 2GN3A 4Y1UA 4GA9A 4Q8KA 5T54A 1H30A 2E7TA 3AYEA 1O4ZA 1NLSA 3NWKA 4P9YA 3R4UA 1DBNA 1W6OA 2DVBA 2VXRA 3AP6A 4YGCA 3OPZA 2ARBA 4UW5A 4XJ9A 4ZXKA 1IKPA 1GZWA 2C9AA 4JC1A 1WLDA 1LCLA 1DFQA 2ZHMA 1GLHA 4GWMA 5GLWA 3B9CA 2VUAA 4YM2A 1OQ1A 3WG2A 1N1VA 2CWSA 3POYA 1VALA 2LALA 4WVWA 3UL2A 3WUDA 1CN1A 2DWRA 5IUQA 1MS0A 2ZGKA 1SLBA 4XYXA 1LOFC 4AVVA 2DU0A 4BMEA 4FPOB 4XJZA 1H9WA 1ENRA 3MW4A 4BOWA 2AENA 1AJKA 1N47A 1LHUA 4LBQD 4CTEA 3ILNA 5EYYA 3O0WA 1HDKA 1MS5A 4DS0A 3B69A 2ARXA 2JE9A 1ULGA 2WT0A 1KQRA 3WG4A 4XOGA 1W0PA 3N7KA 4YLZA 4YW2A 4BPZA 2PHXA 3IPVB 3WCRA 3OJBA 2D3PA 4XHXA 2ZHLA 1IS4A 2OVUA 1DQ4A 1ENSA 1QF3A 4TYSA 3OGGA 1LOAA 1LU1A 5H9QA 3B3QE 3VV1A 1G9BA 4AVTA 2I2SA 2EXHA 1AJOA 3UK9A 2UWBA 5KXEA 4XBLA 1G9CA 4YW1A 3UJOA 5JOYA 1YYNA 3ENRA 3FUOA 4ATEA 2WLQA 1JN2P 1APNA 3AYAA 1LECA 1D0HA 3O12A 2A6ZA 2R49A 4K1YA 1NXD1 3M3CA 1BXHA 5GM0A 5BYNA 5CAZA 1G9DA 1TEIA 1X50A 1LEDA 2DVAA 1CJPA 1WUVA 2CL2A 2E53A 5GJ6A 1AZDA 3SLIA 2Z42A 2WKKA 5GZFA 2OUJA 4XMAA 4ISRA 2ES3A 3ZVXA 2JECA 4XTMA 1JBCA 4WZFA 3AYCA 1Q8SA 1S0FA 2EXIA 2PHWA 3FFZA 4XMIA 1LOEA 3N3HA 1SLCA 2D3RA 2GMEA 1W6NB 2BQPA 3V65A 1YIFA 2P3KA 3USUB 3IM0A 3WG1A 1V6MA 1DIWA 2GNBA 1Q8QA 2YY1A 2ZGSA 1BKZA 2WT2A 4XJWA 5E88A 1O4YA 1Q56A 1LTEA 1G7YA 1HQLA 1JYIA 5DZFA 4Y24A 4R9BA 3KM5A 3GNEA 4ISQA 3UJQA 2D6PA 2VY0A 2GALA 3WUCA 3U4XA 3T1LA 2D7FA 1KRIA 4XJ8A 2EALA 4YZ3A 4U2AA 4R9CA 2D6MA 5T52A 2ZGRA 2XB6C 1ULEA 5EYXA 4UW3A 4YG0A 2HYKA 4FP3A 4LBQA 3WDTA 2D44A 5HCAA 3M3OA 3OBRA 1LGCA 1SBFA 2A75A 4K20A 2ZKNA 3DUIA 4Y20A 4R9AA 1C57A 4D69A 3IMNA 2EXKA 1GNHA 2ZACA 4LBKA 4YG6A 4XXPA 4M3CB 1I3HA 1QOTA 1WLWA 4Q8LA 5JMCA 1AXKA 4Y22A 1FYUA 1VLNA 2YXSA 3WZ1A 4AGRA 4Y1ZA 4FPJA 4YGDA 3WV6A 2A6WA 2OW4A 2ZGTA 5HCBA 1UZZA 2D6OX 3APBA 5DUVA 4CZSA 4CRQA 1D2SA 2CY6A 2GNMA 1DHKB 1U0AA 1Z0HA 3QCWA 5DG2A 4Q1RA 3M1HA 1V6JA 2ZMNA 4K21A 4PF5A 2DU1A 1FX5A 5GLTA 3SITA 3AZZA 3HMYA 1CPNA 4K1ZA 3OY8A 1R1ZA 1SLTA 1WCSA 1YI7A 2TEPA 3L2YA 4Y1VA 1YO8A 3NV4A 1DQ2A 2VW2A 4WV8A 4XBNA 2RHPA 1Z78A 3OYWB 4P14A 4L8QA 5GZDA 1G9FA 1BQPA 5JVVA 4P9WA 5E8AA 3ATGA 4YG3A 1AVBA 2CWMA 1LOFA 3TB0A 2A5ZA 1LHWA 2AH2A 2B7YA 3VKMA 1UAIA 1IS5A 1ONAA 3AXEA 3FLPA 4OZXA 1FV3A 1WD4A 2W52A 1DGLA 3AJZA 1G9AA 3B01A 2ZGQA 5EXOA 3WDUA 1W6OB 4ATFA 4LBNA 4YZ2A 2VU9A 4XJAA 2UURA 3BODA 2JD4A 1GZWB 2NMOA 4C1WA 1OKQA 1FNZA 3VKLA 1A3KA 1JHNA 2CYFA 3ZYPA 3IN9A 4UW6A 4YZ5A 3AZVA 3RSJA 2AGSA 4YGBA 4GKXA 5IK7A 3ILFA 2W39A 2SLIA 1MVQA 2DTYA 3A0KA 4I30A 1DYKA 1ZM1A 5CA6A 2R16A 1SLAA 4AVSA 3SISA 1CQ9A 4RA0A 1C1FA 2UWCA 3W58A 4ASMB 1GSLA 5CBLA 1DQ0A 3TAYA 5DXDA 1CONA 2DV9A 1Q8PA 1YRZA 2ENRA 3VUOA 3HR9A 4DQAA 1S0EA 4FQZA 5T55A 4XDQA 1KITA 3I8TA 3ZSJA 1MS9A 1VAMA 4LBJA 5L73A 2ZABA 3N35A 1AXYA 5DZEA 4ZKTB 3N7LA 1QDOA 2WT1A 2DVFA 1F31A 4FQ4A 1LOCA 1N1YA 3IKWA 2EXJA 1WW6A 2D6NA 1GICA 4KBBA 2XG3A 1CESA 2EF6A 1SBEA 2A6XA 4SLIA 2A3XA 4MYEA 1DQ5A 3NV3A 1DLLA 2P3JA 5CB7A 4BMBA 2GMMA 2D43A 3FBYA 3QLQA 2KM2A 1WBFA 3RMXA 1N1SA 3A4UA 4Q1PA 3MEPA 1VIWB 3V0AB 1MACA 2E7QA 3WLUA 2Q5TA 4JCKA 3FLRA 2PHRA 4Q26A 5LK5A 2FHRA 4DRRA 4YZ1A 5DUXA 4FPGA 3PMEA 2NN8A 3DGTA 1S1AA 1W6MA 4FPKA 5F9TA 2R0HA 2YMZA 4PCRA 4Z8BA 1W6QA 1H9PA 4XBQA 5T50A 5T5OA 3ZXKA 2VH9A 5GZEA 2UWAA 3INAA 3Q9OA 4Q2FA 3O5SA 5KXDA 1LULA 1JYCA 1ULDA 2R1BA 2GNTA 2WSVA 3C2UA 3I4IA 3V64A 2ZAAA 1W6NA 1CVNA 2AR6A 1AX0A 3POWA 4YGEA 4GALA 4XHBA 3USUA 1PZ9A 1CIWA 3OBTA 3HN1A 1GYKA 5GZCA 2AUYA 5JDBA 4YW4A 1RITA 1V6OA 1IS6A 3MPPG 1WW7A 1DZQA 3JUUA 2D6LX 3N36A 2AREA 1QKQA 5DG1A 5JOWA 1S0DA 3VKFC 4AGVA 4U36A 1QOSA 2JJ6A 2PHUA 2ZGLA 2EIGA 3WCSA 2PELA 3WG3A 3WHTA 3RS6A 3WDVA 1QMJA 1LU2A 2G4IA 1DYPA 4H55A 4XXAA 1QOOA 2EAKA 1ULFA 1CR7A 1LODA 2ZGNA 3WHUA 1S0IA 1PZ7A 3RMYA 4YFZA 2GNDA 3R05A 4XILA 4LBQB 1I1EA 1WW4A 2NYYA 1G8WA 1V6NA 1JW6A 3ZXEA 4BM8A 5IK4A 4Y20B 3AP9A 3KQRA 2V73A 1W0OA 3H0OA 3M2MA 1SBDA 1FATA 1WW5A 3MW3A 4HANA 1LESA 3T1MA 1MR5A 2DURA 1BJQA 3GALA 1UKGA 3MW2A 3NV2A 4P9XA 1GANA 4W65A 3AYDA 3SH5A 1ULCA 4Y22B 1W6PB 2DUOA 1WLCA 2A3YA 3AZWA 2JKBA 4M3CF 4GXLA 3V0BA 3PVNA 1UZYA 1OFSA 1S0BA 3BTAA 2D3SA 2WNEA 1SLIA 5H9PA 4PBPA 4Q27A 3D6EA 4DRVA 5JLVA 1C1LA 1KDKA 2AYHA 1DQ6A 2JDZA 4FPHA 1UMZA 1G86A 3AZXA 5H9SA 4BLIA 2NM1A 4PBOA 4YM1A 1B09A 2ZGUA 4IQPA 5DUUA 3N7JA 2NZ9A 3WDWA 1ENQA 2DYCA 1IOAA 2V5YA 4TZDA 4RL7A 1AF9A 1SLLA 1QNYA 1UN1A 4FOQA 1KDMA 1LOBA
chains in the Genus database with same CATH superfamily
4XPVA 4Z92B 3M8LA 1A78A 2H0BA 5E89A 2VMIA 2P3IA 4I3GA 3RYPA 4DUVA 3ZN4A 1H8TB 4WBBA 3JD71 4Y1YA 5C5TA 1U12A 3WNXA 3AP4A 4DNYA 2HWE3 2PTMA 2ZMKA 3WF4A 1QGLA 1UXZA 3PMSA 5IATA 1DGWA 3PJQA 5EJ1B 3KQ4B 1YQ5A 5FBJA 4AK3A 3HEIA 2IXKA 4QQOA 2VOTA 5GZGA 5C6CA 1YUDA 1UOBA 2Y64A 2ZMLA 3ZOIA 4CXWA 3TRSB 2NQYA 3ES4A 2K46A 3OEAA 2LM3A 4NHLA 4XEZA 5FJHA 3ZFEB 2FDHA 4CCLA 1V6KA 1HQWA 4P9LA 3WNNA 1HKDA 3IBMA 5CZKA 5FKCA 4COUA 2HWD1 1HLCA 3NNLA 2UU8A 2VZ1A 4RFRB 1ZBE1 3THPA 1ST8A 3ZSMA 4COVA 1W2UA 5FY7A 5J37A 3NJVA 5JXHA 1IQDC 5GLUA 4OFGA 1UIKA 4QPWA 5FYSA 1URXA 3UV9A 1J1TA 2VR4A 3L2HA 3LSDA 4Z82A 4CPBD 2XBO1 3T2TA 3SMHA 2R1DA 1BYHA 3BIWE 4CU8A 4N53C 1I6XA 2ZCWA 3LA2A 4Q4X1 3V0AA 2WWSA 5FWEA 2R062 4BE3A 3K48A 2WR9A 1SCRA 1SFPA 1YQCA 2ZXQA 4JRAA 2A7AA 5IAVA 4BA6A 4QX1A 2JE8A 4EWEA 5LA0A 3NNGA 3VD5A 1ZX5A 2A71A 4CP2A 4XAAA 5KXCA 1EAH3 1OVSA 3GZEA 4Q5OA 3LEKA 1E57A 4MV2A 4NE9A 4XIKA 3C7EA 5ERLA 1CAVB 3ES1A 3JD72 4UF0A 1RUI3 1W6QB 3JU9A 5FJKA 1NA1A 4A3ZA 4OUEA 4TSVA 3DPRB 3IDCB 4N90A 3ZXJA 3PL0A 1F5FA 2ZGMA 2JDNA 2P37A 1FPN1 1GQPA 4A42A 2WFF1 2JE7A 5KHGA 1O3SA 3OPTA 4QQ2A 2D5HA 5FUIA 2XL9A 5IT6A 1W9WA 4TXWA 5C5UA 1K5MA 2JB4A 1QXPA 1UX6A 3MLJA 5F2WA 1PVC3 1MZ6A 1GV9A 3AMNA 2HWD2 4XE9A 1DYOA 1H2LA 1V9U3 1ZBE2 1E5HA 3RZKA 1E5RA 3POBA 4X8NA 2DUPA 5JCTA 4JQTA 4YYOA 5FLJA 1IPJA 1XYPA 5JAXA 5IFTA 3WNKA 2XBO2 3M3QA 4QXCA 2Y60A 4C0HA 2R071 2B4KA 4RR3A 4AYUA 1SPPA 4AF9A 1CWPA 1GKBA 2W91A 3VN4A 4DIQA 4C90A 4RQPC 4A44A 1AL21 5FZOB 2WNVC 2IXCA 1WZXA 1V0AA 3ETQA 5K4LA 5LCWL 4Y5Z0 1TZOA 3AKRA 1EYBA 3J7NA 4ZZ5A 1LEMA 2I74A 3ASIA 5FKBA 1ALYA 1KEXA 5TSWA 1NCQB 1DCSA 3ZM8A 1LOGA 3HBZA 5A7OA 1O3RA 1BCXA 3SH4A 1OH4A 1Q3EA 4L99A 5IK5A 4CPBA 4HVQA 3RG0A 2BW8A 4XF0A 3H9AA 2JICA 2ZX1A 3VZJA 2X53S 1FPN2 1MQTB 2WFF2 4Y1XA 3OY8B 1NE4A 1KFXL 1PK6B 2WS93 3OYWA 4E9KA 1IG0A 3K75B 4I0AA 3N9PA 3S5QA 2XJTA 2E33A 3JQXA 5FZMA 1GU3A 1W9TA 3OBZA 1EP0A 2ZBJA 3HAGA 2GN3A 1N1TA 3KV5A 5EIYB 4Y1UA 1D4VB 4W8JA 3LPGA 1POV1 3CHXA 5T54A 5JXIA 4JVAA 2E7TA 3AYEA 3NWKA 4P9YA 5JDBA 3R4UA 2DVBA 1ZVFA 4Q29A 1JMUB 1W05A 4L92A 4AOCA 5IYYA 4JC1A 1WLDA 1LCLA 1DFQA 1RGSA 3A7QA 1ND2B 1MEC3 2R072 4YM2A 3WG2A 1VALA 3GBWA 4CXXA 4IE0A 4C91A 1UOGA 3T0BA 1PO11 2IUWA 2LALA 3WUDA 1R64A 4DO0A 2DWRA 4D7SA 3AMQA 1AL22 1K3IA 2F6BA 4IL7A 3KVAA 4KL1A 1YQ6A 4XJZA 2HEVF 4UOJA 2WO2A 4BOWA 3MW4A 3LA3A 1WCKA 5AC93 2AENA 4HZFA 1N47A 4GMP1 2IWGB 5D8AB 3NJXA 4DS0A 1GWLA 1MS5A 3B69A 3UGFA 3AL5A 1ZYBA 1OSGA 2XJPA 4BU2A 2PLV3 3PVBB 4YLZA 2GH8A 2ORXA 4I01A 2RG4A 3HBKA 3B02A 2FDKA 2JD9A 4LO7A 1ACCA 1DQ4A 4TYSA 3OGGA 1RXGA 4AZZA 2RDNA 5FZHA 4JGYB 1U5IA 5JMOA 5EZWA 1C3HA 3J26N 2UWBA 1PX3A 1CX4A 1G9CA 4CUAA 1YCIA 3BYWA 1YYNA 4FXGB 4BIFA 1PX4A 2TNFA 3KLSA 4JDMA 4XF4A 2A6ZA 2R49A 4K1YA 1NXD1 2L9LA 4AR2A 2PMWB 4LKDA 1PIV1 4OI1A 4EYUA 4E4DX 5FPAA 3I97A 2W5FA 4UFHA 1OLRA 1ZZ8A 1OKOA 4MXWB 4QQLA 1XSQA 3U14A 1PO12 5F2SA 5A80A 5C9AB 4LT5A 2YUEA 4RHV1 2ZKLA 3CJIA 5GZFA 1D2QA 4XMAA 1REFA 3I2JA 4CU6A 2A73B 2CGNA 3MIBA 4PI0A 4CDUB 3FFZA 1REEA 1S0FA 4HXCA 2PHWA 4XMIA 3VDDA 1W6NB 4YRDA 2BQPA 2UY8A 1IG3A 2B39A 4EN7B 1W3VA 1YIFA 5L19A 2P3KA 5LWBA 3IM0A 3AVSA 4D6QA 1DIWA 2ZGSA 1Q8QA 4TWTA 3S0MA 2WO3A 1QJZA 2WT2A 4BQXA 4PDWC 2VVDA 5C3PA 1G7YA 1HQLA 1X82A 5L7OA 2Y0OA 4YVWB 2CGPA 3ZN6B 4Y24A 4R9BA 3FWEA 3OUIA 5CFCC 3GNEA 1L7RA 4AFBA 4Z1VA 1C8NA 2QNKA 2VCMA 3DYOA 4NWWA 1RUH3 4XJ8A 4HKWA 2QVSB 4NIDA 2YGMA 3H3UA 3WP6A 4D94A 4A6SA 2PAEA 1WLTA 1W3XA 2VCCA 2ADEA 2A75A 2ZKNA 2VOVA 3DUIA 4Y20A 5DAQA 2RS53 3BVCA 2VO5A 4D69A 2J1VA 5IWFA 2EXKA 1GNHA 4YW7A 1PIV2 2CV6A 2X5IB 1G6NA 1REDA 2VNVA 2PQSA 3DV8A 2EVXA 4Y1ZA 4FPJA 4LITA 3WF2A 3JZVA 2A6WA 4RHV2 2OW4A 2QQWA 3NNFA 4Y3OA 3APBA 3QBQA 2VGDA 3ZFFB 4CRQA 1A6CA 2CY6A 5I0DA 1DHKB 1U0AA 1Z0HA 3E6DA 1OPOA 2WWUA 4FFHA 2ORZA 4XFAA 4A45A 3WD5A 2ZMNA 2D98A 4LOTA 2IFRA 1DGRN 2QQKA 3GBFA 4PF5A 5GLTA 1OQDA 3U11A 1AR81 3LKJA 1VPHA 4K1ZA 1SLTA 1WCSA 2LW8A 4Y1VA 2XONA 3ZN5A 3WW3A 5KHHA 3THDA 1ZZ6A 4A2UA 2XKOA 2HYXA 2QZ3A 2VD7A 3J8F3 4AI8A 5EFUA 5KC5A 2MNGA 3JB8A 2BU9A 4L8QA 1BQPA 3QH6A 2B8MA 3FC0A 3CZJA 1AVBA 2CWMA 1LOFA 3LE0A 4FXKB 1RMU3 1IPSA 1GQGA 1LHWA 3K3NA 2Q1ZB 1IS5A 1R1A3 1JH5A 3CEWA 2JENA 1A8MA 3FLPA 3TWIA 4B7KA 1UO9A 1UW8A 3J4UH 2W52A 1XE8A 2VMEA 1W8HA 1H2NA 1Q5OA 1UYZA 1CJDA 3NJYA 1ZZ9A 2JD4A 1OKQA 5FMDA 2QZ2A 2B9UA 2FQPA 3T09A 3U10A 4Y5TA 4MUVA 3AZVA 3HT2A 5HXVA 2H0VA 2WFPA 3KCYA 2W39A 4R8HA 3ZSEA 5FMOS 4I30A 5JSRA 5A7SA 5C4WA 1KXGA 4AVSA 3SISA 2JG9B 5FXXA 4RA0A 1NXMA 2V4AA 4YPJA 3W5NA 5FPVA 4JHTA 5BNOC 1NCRA 4P9IA 1YFUA 5FAXA 2YU1A 4C0BA 4QPIA 2DV9A 5DXDA 1YRZA 4QHZA 3VUOA 2HJIA 4QHOA 1S0EA 1MZEA 4N43B 4XDQA 3ZX7A 2D97A 4NPLA 4MADA 2VTXJ 3J9SA 1AR82 3CLPA 4NIIA 5AFBA 4AGVA 3N35A 2ZEYA 3N7LA 1QDOA 3WQ7A 3ZIXA 2DVFA 5D8AC 4ARXA 2P1BA 3RFRA 1LOCA 5FUPA 4CCKA 3IKWA 4G4FA 1GICA 1T6GC 2Y6JA 1CAWB 2TUNA 3PU8A 1RHI1 1UZVA 3VBSA 3NV3A 1DLLA 4AVBA 4ZXEA 2GMMA 3LPFA 3N4MA 5IVEA 4RYDA 3A4UA 4IETA 1OURA 1VIWB 1WCUA 4LEJA 4EWDA 1XNDA 4JGYC 2BOIA 2E7QA 3W20A 2F4LA 3WLUA 4WM8C 1PO21 3FLRA 5LK5A 2RS33 2FHRA 4DRRA 2BERA 4CCJA 2PYTA 1VBD3 3KGLA 1X33A 1VP6A 1Y9GA 4ORFA 3WQBA 5DMYA 3O14A 5FP7A 5JI9A 1EV13 1W6MA 4N7IA 1UU6A 5JPNB 5A3UA 4ZPIA 4NIHA 2VMDA 5C8WA 1H9PA 4GULA 4XUPA 4HG6B 4XBQA 3TOJA 4GH4C 3VBRB 4FTEA 3UYJA 3SKVA 2VH9A 3ZXKA 3INAA 3T3YA 3O5SA 5KHJA 3KCXA 1YWKA 4CSWA 4ARYA 1VBB3 1XOYA 3V64A 3HNYM 1PVXA 3POWA 5C9AC 4QPGC 4YGEA 4GALA 4OHYA 2ZX2A 1RUE3 2FZ1A 5ABJB 2WA4A 5FY9A 1JOPA 3O1SA 1K12A 2YPDA 4CDUC 5IVFA 1XBFA 1F8VA 3PURA 3FE5A 1FI2A 2DFBA 4KGGA 4RS5C 4B4QA 3H7JA 4CEWB 5DABA 1PMJX 3I7DA 5LASA 3NKTA 1D4M1 4U36A 4FAGA 5HXMA 2EIGA 3KB5A 4AHYA 2PELA 5A6ZA 1ZRIA 4Q0UA 5I0UA 3KT7A 3WDVA 1QMJA 1RHI2 1QXRA 1LU2A 4IEVA 1C8M3 1XU1A 3LFMA 3THTA 3UKVA 3VBOB 1ND3B 4C8DA 1D0GA 4DY5A 3CKHA 4A7KA 1OLQA 1PO22 5FCCA 3IDBB 2Y38A 4NHYA 1UY2A 1YQ8A 5FTTC 5K0UB 1GOFA 1S4CA 4MGQA 3H0OA 3Q8EA 4OI4A 4QHBA 1WW5A 1L7LA 2VQAA 1LESA 1JZ6A 3GM8A 2O0OA 2DURA 1BJQA 4P9XA 4WM7C 3K4ZA 4L2NA 2D93A 2O1QA 3MIDA 1YJLA 3SQOA 1BVP1 2DUOA 2X5IC 2A3YA 1JS9A 3ZDVA 2JKBA 1NQJA 3LZZA 3BUCA 2VQTA 2WNUC 3PVNA 2WQ8A 5C71A 1RUI1 1F4HA 3IZOA 2PHDA 3BTAA 2D3SA 3I49A 2VULA 4UBHA 4BK4A 3D6EA 5JLVA 5C8CB 4DB5A 1VE0A 4LO5B 1A34A 1J58A 2AYHA 2JDPA 3RI9A 5A3MA 2VCAA 4XAEA 1D4M2 4PBOA 5KWRA 1O7FA 2V5DA 3AMHA 4RN5A 1XNBA 1AHSA 4R4XA 2VBDA 4YW6A 2P17A 2ZGUA 1GNYA 1UWWA 3C7GA 5DUUA 5BNPB 1PVC1 1IOAA 2DYCA 4CP1A 4M0NA 1HQNA 1RJ7A 2D43A 5IHRA 1V9U1 3DKWA 5JSPA 1WMFA 1V6IA 1WD3A 1A8DA 3OPWA 4IV1B 5FREA 4IEQA 1N3QA 1BMV1 2FCTA 4XZPA 4MGKE 4YZ4A 2X10A 3BOWA 4BXSV 4QX0A 2ET1A 1WA4A 2OXBA 4IEXA 1SACA 2WQZC 3RDIA 2ERFA 1DF0A 1O6UA 1PZ8A 2DVGA 4LHSA 4CDXB 2HWC3 1YQ2A 1H1MA 5FZ8A 5F3IA 2VW0A 4AI3A 1QY4A 3O1UA 3CBNA 1KJLA 4A6OA 4H7LA 3R4DB 3PU3A 5LA1A 3ITQA 2BEOA 1OT5A 2FZ2A 2QQVA 5CISA 5J3UA 1DLCA 2UYAA 1WA6X 4NIAA 3ZSLA 2WZEA 3NV1A 3VHOA 1LRHA 1RUI2 4IEWA 5DAXA 3BN6A 2VTXA 1FAYA 2E6VA 3DYPA 4N53A 1CAXA 1R083 4LORA 3GXUA 4BIOA 5J7MA 2VQUA 2FDGA 1XJAA 4CDQA 1PHMA 3QACA 4N43C 3BPSA 2WS91 1K45A 1Q8OA 4WVZA 1PNGA 1FMD3 5D21A 2WYSA 3H3LA 4UW4A 4XC9A 1F5JA 3A22A 1N3OA 4LPLA 1S0CA 4YFWA 3BTYA 2ZA9A 1YFWA 4QX7A 4AI0A 1QJY3 4SBVA 4QX8A 1PVC2 1COV1 4C1XA 1OMIA 4MH0E 3LEGA 4XJUA 4R9DA 4E2SA 1I5ZA 1V9U2 4XACA 5A3WA 1OFNA 1UY1A 3AFKA 4PQ9A 5A3NA 5A70A 4KGQA 3WW4A 4YVSC 3D0SA 2HWB3 5CYYA 1J3PA 1BMV2 5FZDA 1GBGA 2ZHNA 3NAPB 1AR71 2K2SA 3AMMA 3TN92 3CJXA 5SV8A 3VZOA 1MEC1 4JZRA 5FMCA 4INDA 3VKOA 4LE3A 4AFMA 1UZWA 3O0VA 5C3SA 1CX1A 3PUIA 1QU0A 4AL9A 1RUD1 1KJRA 1UNBA 4NO4A 2ETEA 5FR3A 2ZEZA 3ZXGA 1GZCA 3W59A 2GP5A 3VBRC 5JPMB 4IV3B 1ZZBA 2FDFA 2BNMA 3AXDA 5AC91 3URFA 4Q4V3 4ASLA 1RUC3 3EMRA 1UPSA 5I8TA 4GWNA 4R4ZA 1JI6A 2VW1A 1XE7A 1AL0G 2BGCA 1FNYA 4JGZC 2FBEA 1IHMA 4MOAA 2PLV1 4QB6A 4ZS3A 1UYPA 4OHZA 2QKDA 1J84A 3WT3A 1ZRDA 4DFSA 2A3WA 4QX3A 5KBFA 2WS92 3SC7X 3K4AA 2WNVA 3E5UA 5A3OA 4L97A 5B2GB 5F3CA 2BBVA 3BOPA 2JDAA 2C5DA 4M3CA 1SDDB 4XUNA 1COV2 2EIBA 2W9XA 4QKNA 2PHTA 5IK8A 2VZQA 3LIHA 2J1AA 1RUF3 4Q4W3 1OOPB 4PIYA 3DYMA 4IEOA 1W8UA 3LSEA 1DQ1A 4FOYA 1DGRA 4QXHA 5FZ0A 4AGGA 1K42A 4DMIA 1YFYA 3RZJA 2RJ2A 1MPXA 4JDOA 1JHJA 2XLFA 2DCYA 4GKYA 1LJ7A 1AR72 3D0JA 5ACA3 4OHWA 5AVAA 1B35B 1W99A 4K3UA 2JX9A 4MGZE 1MEC2 1MZ5A 3OUHA 4AWDA 2PN5A 3E1F1 3J7HA 2YPJA 5LY2A 5F6KA 3ZXFA 4ES8A 1RUD2 2E51A 4YM0A 4B4RA 2WSUA 2W1UA 1MS8A 4YNIA 1WCQA 2X05A 2XPJA 1CD3G 2E32A 4XF1A 5KXBA 3T4HB 1W8FA 4XCAA 4XURA 4AEDB 5AC92 4BQ1A 5IVCA 3B00A 4UWDA 5FBZA 3H8XA 3TNPB 3W5MA 5FZ1A 1JTZX 4LE4A 2RM23 1ZRRA 2P4EA 4L0PA 5IVJA 2GSYA 5A32B 2VZTA 1H30A 2J1SA 4RFT0 4Z2AA 3MF9A 1W6OA 2VXRA 4YGCA 3HT1A 3OPZA 4XCBA 1GZWA 2C9AA 3VBUB 5C8CC 1RUH1 3ZFGC 4GWMA 3E5XA 3POEA 5GLWA 3WNMA 1N1VA 1YNAA 1GP6A 1LKNA 3POYA 3T0AA 3WEZA 4KWLA 4UFIA 3TEZA 3QOPA 3PJYA 4PF1A 4QWNA 2ZGKA 5FOJB 5KHIA 4XYXA 2DU0A 1UIJA 2XUEA 3BGAA 1NLQA 3H50A 4XVHA 2Y6GA 1ENRA 2QDNA 1ASJ3 4HFSA 4LHLA 5FY0A 3ILNA 1BLZA 4QMAA 2ID4A 1L7QA 1JZ7A 4CDWC 2G9GA 3SXWA 2K0GA 4A7YA 4CDXC 1OPMA 1BEV3 2HH9A 3JXSA 2RV9A 1UPIA 2NLRA 3VV1A 4MLOA 2VNGA 4CCOA 2EXHA 4AQSA 2B46X 4D6SA 5FPXA 4GMP0 1XYOA 1U5ZA 3UJOA 3ENRA 3FUOA 4KH9A 2WLQA 3G6JB 3T2OA 1JN2P 4ATEA 5FY8A 3O12A 4Y33A 3J8F1 3ZDSA 4PLNA 5E6HA 2B42B 1TMF3 1TE1B 1RUH2 1G9DA 1LEDA 2DVAA 5C70A 1RMU1 2CL2A 3PUSA 4W50A 5GJ6A 3WF1A 1AZDA 4FFFA 1R1A1 1T6BX 2OIIA 3RPQA 4E4HA 3K46A 3NVCA 4I0BA 2OUJA 4XTMA 4CP9A 2HLEA 4PDWA 5DAWA 3O1TA 4BH9A 4WZFA 3AYCA 1Q8SA 2JXAA 2YYOA 2DF7A 5APAA 5A7WA 1LOEA 2JDHA 1O4TA 5CFCA 2WIIB 2OKXA 4IXLA 2Y26A 3V65A 4LLFA 3USUB 2RS13 3WG1A 1NA1B 1QJX3 2GNBA 1QIQA 4AI9A 1O4YA 1Q56A 5FV3A 1LTEA 3Q8CA 4LNVA 4CYDA 1FXZA 5JR7B 1JYIA 1UF2C 5DZFA 2WO1A 3OGSA 1QHDA 2BWCA 3I2IA 2GALA 1ODNA 3AVRA 2D7FA 3F95A 1K5MB 3ST7A 2Y8KA 3RVHA 4K8RB 1QXJA 2OQ7A 4YZ3A 3SEEA 1AYN3 1NZIA 1TNRA 5M0TA 2BVVA 2XB6C 3U78A 4Q4X2 4E2GA 3VDAA 5BNNC 2WAAA 4HETA 4FP3A 5HCAA 2D44A 4L11A 1LGCA 3I3EA 4K20A 4IW3A 3BKZA 1SEFA 2J1EA 5HPOA 3KVBA 3J8F2 2C0ZA 1GWMA 3DN7A 3NMBA 4XUOA 1J59A 4LBKA 4BQ4A 3KV4A 3DKQA 1I3HA 1QOTA 2GC3A 4RR3B 1AXKA 3GBGA 1RMU2 3B9IA 3ZYJB 1HRI3 1OLMA 1FYUA 1UU5A 1SPPB 4Y22A 4OUMA 1R1A2 5K9YA 1U5YA 2BRTA 2AC1A 5FK7A 3WV6A 1SHWB 4OUSA 5B4XA 2RS31 4QDQA 2I45A 1VBD1 2CHHA 5DUVA 4CZSA 1D2SA 3T4VA 5DG2A 1EV11 4Q1RA 1JU3A 4W4ZA 3ELNA 3VBHC 3M1HA 4HKOA 3R6SA 4MGIE 4HVRA 1E5IA 2VBBA 4K21A 3C8XA 5DQ0A 3S30A 3ORJA 4AVCA 3RJ2X 2I07B 4LKFA 5A7NA 1H4GA 3OY8A 3L2YA 2AEYA 1YI7A 2TEPA 5FFOC 5FYZA 2R043 3WQ1A 4W6WA 2VW2A 3PUQA 1VBB1 4B3NA 5K8SA 1W0NA 1ZBA1 1VBA3 1Z78A 3OYWB 4P14A 1O5LA 1G9FA 1RUE1 2VZRA 5JVVA 1VAKA 3RYKA 5E8AA 3TB0A 4CP0A 4NRQA 4Z07A 2A5ZA 5FLIA 4F3JA 5A1AA 3T08A 3VKMA 2IC1A 3I2GA 1UKRA 4Y5SA 5I8YA 5LW9A 1FV3A 2FDJA 3HPNA 1DGLA 3FFQA 4OVEA 3J7MA 2N7GA 4B7EA 2Z4FA 2GP3A 3WDUA 3MF6A 2G19A 3LWCA 1UOJA 4YZ2A 4J6GA 2VBPA 2JG8A 2NMOA 3HIFA 4LUKA 5LRRA 4C1WA 1RC6A 3VBFC 3VKLA 4YZ5A 2QDRA 4UW6A 5BNOA 1C8M1 3RSJA 3ILFA 3GYDA 3VBUC 4S2FA 3WF3A 1MVQA 2VG9A 1ULPA 3A0KA 3ZR5A 1DYKA 5CFDA 5CA6A 1H8TC 4GAZA 2XVKA 5ANNA 1CQ9A 2BJSA 2O8QA 4LKSA 1YI9A 4Z2WA 1VBD2 1GSLA 1DQ0A 1ZZCA 1EV12 4JKMA 4QD2A 3TAYA 3HN3A 4E8DA 2ZEWA 5EQUA 4DQAA 4FQZA 2GAUA 3JCIA 4P02B 1ZRCA 1CGPA 1DDLA 1MS9A 3CO2A 4LBJA 1HV0A 5A3PA 3ZFEC 3ZYFA 4EZ4A 4ZKTB 2WRAA 2WT1A 4AAXA 4EN9B 1N1YA 2P3YA 3AC0A 4IUGA 5JIAA 1VBB2 2HWF3 5L9BA 4AI1A 4JGYA 1NY71 1ZBA2 2Y0IA 2EF6A 5LBFA 1PNFA 4WM8A 4MYEA 1EUTA 1RUE2 4W6XA 1H2KA 1VRBA 1W9FA 2P3JA 3PNAA 4TN7A 5F8PA 5CB7A 4BMBA 3FBYA 2KM2A 1UU4A 3AL6A 5LA9A 4AHXA 1UOFA 4GH4A 1OUSA 4DUWA 2PHRA 4Q26A 1OA2A 1S55A 2QBXA 1JYNA 3PMEA 2NN8A 2ZX0A 1WMDA 3WP3A 1GWKA 4PCRA 2AZ5A 3MHZA 5FYCA 4DOUA 5CKNA 1GFF2 1KS4A 4H3WA 1C8M2 2VTFA 4QPGA 1ODMA 5FYYA 1OQEA 5GZEA 4D7TA 2OT7A 5FYHA 4Q2FA 3LEIA 4R52A 1M4WA 1JYCA 5IFPA 3CJIB 4NJ4A 4CDUA 4A3XA 1JZ5A 2XJRA 3WP5A 4NWVA 4LIVA 2DCTA 1UZ0A 3RZLA 1W6NA 1CVNA 3H3ZA 1AX0A 4RS5A 3I2DA 1HIXA 4S2GA 4XHBA 1PZ9A 3DPRC 3MBWA 3VDDB 1XE0A 1GYKA 1Y4WA 4BHPA 3POJA 3GCXA 5FZIA 4NHXA 4XQWA 1V6OA 1IS6A 2HWC1 1HB2A 3MPPG 4OMCA 1DZQA 3C3VA 3HD8B 4Y4RA 4CUGA 3N36A 3O1MA 1HXS3 1OA4A 4MSVA 2QQUA 2JEMA 4KNCA 5DG1A 5L7OB 3JQWA 1S0DA 4LMFA 4HONA 4QKBA 3VKFC 1QOSA 2PHUA 3AFGA 4PJYA 1L3JA 1NY72 4P00B 4QPYA 1XRUA 3R0RA 2ZS6B 5C3RA 3I3DA 2VZVA 4XXAA 3BIEA 3ZO0B 4EN6B 1RVF3 1EPZA 2C6SA 2QTWB 3MIHA 4XUTA 1W2TA 2WLPA 1S0IA 1PZ7A 5BPXA 1VBE3 4WM7A 3WY6A 4YFZA 4XQDA 3RZGA 1I1EA 1WW4A 1X8MA 4UFKA 2NYYA 4Y20B 5JSOA 2B45X 1SQ4A 3LQCA 1W0OA 2IVJA 3M2MA 2FD8A 1QJY1 3T1MA 2O14A 1HJGA 4CA9A 2WNUA 3MW2A 4AEKA 5I0SA 3E5QA 3Q8BA 1BVVA 5JZGB 2LROA 4K8FA 1W6PB 4LK7A 4QQPA 1WLCA 2HWB1 3JBG3 4FTSA 2WL1A 1NCQC 4OYUA 2YB7A 4M3CF 3S57A 4GXLA 3IMMA 3GZAA 1JYWA 3ROUA 4AVAA 3KF5A 3V0BA 1J83A 4N8MA 2WA3A 4NPMA 1CAUA 3ZPOA 1BK0A 3O1OA 5A7PA 1MQTC 2HWC2 1YJKA 3LDRA 5H9PA 1PK6C 4OLLA 4PBPA 4DRVA 3KT1A 3N9NA 3FHIB 5J98B 4QKDA 1DQ6A 5H9RA 4DEVA 2VL4A 1WMXA 1G86A 3I3MA 3UT0A 4BLIA 4Q4V1 3VDBA 2Y6LA 2ZX3A 1KFUL 3RWNA 1XYNA 1RUC1 1B09A 1BBT3 3ZIWA 3BU0A 3M3IA 3N7JA 2NZ9A 4LR4A 4LQRA 1OF3A 3DF0A 3WDWA 2V5YA 2RR13 5IJRA 1AF9A 1SLLA 1QNYA 4FOQA 5FP9A 1KDMA 3BODA 4A4AA 2DBIA 1UMIA 2C24A 5EWSA 1PM4A 1S0GA 3AM2A 5F5IA 2ILMA 3N9LA 2OA2A 1QH6A 5CEHA 1ND2C 1H6XA 2LRPA 4ZZ8A 2W08A 1GZ9A 2ZZJA 4FI9A 3HJRA 1QJY2 4ITCA 3AB0A 4P08A 3Q8FA 4IEPA 3B94A 5F5QA 3N7MA 1AXZA 1UY0A 1RUF1 4Q4W1 1Z7S3 5FZ3A 4LBLA 1HN0A 3MYXA 5C4WB 5CKQA 3IPVA 2V72A 3P1IA 2ADDA 2HWB2 5HCFA 2A6VA 1YXWA 3IWZA 5BV6A 4M4PA 3LOIA 2PAMA 1MS1A 1TNFA 1NCRB 5ACA1 3SNMA 5F7UA 3POSA 3S7IA 4QPIB 3ACHA 4QXKA 5DZGA 5LK7B 1KD7A 1LGBA 2C26A 2ZTNA 4RGAA 4ASKA 3FX3A 4E2QA 1JZ2A 5E1RA 4LBOA 3AJYA 1LHVA 3MUY1 1AX1A 3SH3A 2C4XA 4WVMA 4H7MA 5JUVA 2XLGA 1PGL1 1KGYA 3DXTA 1RINA 3ILRA 4UBGA 2R073 4YVSA 3LGRA 3K51A 5T5OA 2CNAA 2Q1FA 1RUC2 4QGMA 5BNQA 4FPEA 5FXVA 3VBSB 2HBTA 4HPKA 2A70A 2WAOA 4S2DA 5A6QA 5C3QA 5CNAA 5EHDA 5JI7A 2ET7A 4IEYA 4YW3A 1AL23 3M3EA 1N3PA 5T5LA 4DY3A 4DXTA 5IW0A 1RB8G 4ZU5A 4AFCA 3AK0A 3LFIA 3MPBA 2SBAA 4NRMA 1W6MB 4CEYA 1Y43B 4MZUA 3AKQA 3OCPA 1LNSA 1IKQA 1VR3A 1V6LA 1W8TA 4MXVA 4XF3A 4LXLA 2E9QA 2HWE1 1RUF2 4Q4W2 1NOVA 1H2MA 4LA3A 4JGZA 4RGGA 3IDEA 5KC6A 2VMGA 3AP5A 2BTVC 1XU2A 4NOTA 2ZGPA 1ASJ1 2QUOA 3GJBA 5ACA2 4YW5A 3I2FA 3VHPA 1CPMA 1OF4A 1QWRA 1W9YA 5F37A 3RYRA 3GDBA 4QM8A 1ZA4A 4PLOA 3VD7A 2Q4SA 4W6YA 4YVWC 4D8MA 5HI0A 3O1RA 2YC0A 1PGSA 4HK8A 3PVEA 2XL7A 1GOHA 2YG0A 3ZXLA 4DINB 3D4KA 5JOXA 5FXZA 2V09A 2JB8A 1HRV3 1BEV1 5T5PA 1PGL2 5HV4A 2MEV3 3NNMA 1UL9A 2YBPA 4PI2A 1YHFA 2XOMA 4J25A 5GALA 2X09A 4Q0QA 4CCDA 5L7OC 1WWYA 1PO13 2DUQA 2XJUA 4FVVA 5FZBA 3MFCA 4YSFA 2A6YA 2FDIA 4MVTA 4MGSA 3H8UA 4QX5A 4BLJA 4EJRA 5C33A 1XQNA 4JDNA 2C9KA 4FPFA 3ZYRA 1RUJ3 2WJSA 4XF9A 4AXOA 5A6XA 4LO8A 1CZVA 4GMP3 1J3RA 1EAH1 2WYFA 2E7AA 4V1PA 4QXBA 4O61A 4B1MA 3KHCA 1VAVA 1NUKA 2W1QA 3I2OA 1TQ5A 3MGUA 1FT9A 4CXYA 3UGGA 2FMYA 3ZFFC 2HWE2 3VHRA 3FUQA 2FMDA 2J7MA 2VQ0A 1F4AA 3DXUA 3WNPA 1IS3A 4FPLA 1UYYA 1QQP3 3AX4A 4FP2A 3VD3A 5JZGC 3LA7A 1W03A 3MUZ1 1ASJ2 3ON7A 2LTNA 2YFZA 1C5HA 5FZ7A 3EXUA 3I59B 1BZWA 1F9KA 4OQ8A 4M01A 5C8CA 3ZFGA 2RS11 4GA9A 4P5HA 5F3GA 5J1XA 4IEUA 1YIPA 5FZ6A 1JZ4A 5AVPA 3IIIA 4OI0A 2W87A 4UFMA 3AP6A 4KU8A 4UW5A 4XJ9A 2W2IA 4ZXKA 1BEV2 1IKPA 3F2ZA 3GGLA 1GLHA 3B9CA 2VUAA 4AHWA 4AQ2A 1OQ1A 1AYN1 3OGJA 2XHKA 2YFUA 4RHV3 4WVWA 1DGWX 3UL2A 3WINE 4Q0PA 5IUQA 1C28A 1PM7A 4BQ5A 1LOFC 2DFCA 2MHFA 1TME3 3PIJA 4FPOB 3LAGA 2W0XA 2OYZA 1H9WA 4CDWA 1EAH2 4HK9A 5FZAA 3S7EA 5CG9A 1AJKA 1GQHA 4LBQD 1W39A 3O0WA 5EYYA 5KR7A 1HRI1 2JG9C 1QJEA 1DU3D 2WT0A 1H1AA 1KQRA 1O59A 3HOBA 4E27A 4DXRA 2GH2A 4XOGA 1W0PA 3N7KA 4YW2A 2IXJA 4BPZA 2JDYA 1VMHA 4QU2A 2PHXA 4FFIA 3OJBA 4QAWA 4XHXA 1POQA 2ZHLA 1KS5A 5CIRA 3WW1A 2OVUA 1NAEA 3B3QE 4CCNA 3GF6A 5A1LA 3KCCA 4F8AA 2I2SA 5F1RA 1AJOA 3SEPA 2RS12 3UK9A 3IIAA 4RGKA 3LIGA 4ES9A 4N53B 3NSTA 4PQQA 4BB3A 1CAXB 1VB4A 4YW1A 1AUYA 2R041 1APNA 3AYAA 1EUUA 1D0HA 4KI5M 4CDQB 5HCHA 2WN2A 1AR63 4IGQA 4XFCA 5BYNA 5CAZA 1FOD3 3WR0A 1TEIA 5FQ0A 1X50A 3BALA 1NLRA 5CG8A 5JR2A 1AYN2 2EAAA 3D8CA 4RSUA 4NIGA 1US2A 2TBVA 2Z42A 3VBSC 3UGHA 1JOBA 3AKPA 2JECA 1NX9A 3BB6A 3MDPA 5FZLA 4D0QA 4QDRA 2QQPA 5FZCA 4KG0A 1X36A 1SDWA 3PLQA 4IEZA 3HQRA 2D3RA 4NN0A 5ANQA 3MZHA 3TEXA 5FYMA 2AEZA 4LIUA 3WXPA 1HRI2 2WZ8A 1V6MA 3WQ0A 3WX5A 3LOBA 4X6RB 1YLLA 1BKZA 1OA3A 4XJWA 1HB1A 1Y9QA 1D7PM 2HEWF 5ABJC 3WW2A 2W3JA 3NNJA 5BNNA 3KM5A 4ISQA 3IAQA 3VLBB 5B4NA 3UJQA 1O91A 2D6PA 3WUCA 5ISLA 4RQPA 4DXSA 3OD4A 4CEWC 4U2AA 1W04A 2QQMA 1OVPA 5EYXA 3I2KA 3N9QA 2HYKA 2R042 4LBQA 4GJYA 1W8WA 3X29B 1JZ8A 3ZYBA 3M3OA 4OZOA 1SBFA 2HWF1 4RD7A 1OUXA 3U0ZA 4R9AA 1C57A 2JIJA 4LULA 4JKKA 3VBOC 1ND3C 1STMA 2J1RA 1SMVA 2WNVB 3OTFA 5A33A 1ZREA 4M3CB 4Q8LA 5F5AA 3VBHA 1CZTA 4GQ7A 2WZPP 3WZ1A 3K3OA 4GB33 4LLOA 3VHNA 4YGDA 1OHFA 5K0UC 3B5LB 1I5PA 3E6CC 4TLFA 1W90A 2CDOA 2GNMA 4HSJA 4NRPA 3ACLA 3LDBA 2VZPA 4JX0A 1V6JA 5FYIA 5DAVA 3I3QA 3EJKA 3OOXA 3BCWA 1FX5A 4K9SA 4XFBA 1PGW1 1ULOA 3AZZA 3HMYA 4XQ4A 3SITA 3H1YA 5IVVA 3O1VA 1VRH3 1R1ZA 2KD7A 2PLV2 4LO6B 4XBNA 2RHPA 1HV1A 1AYM3 4BQWA 2WO7A 2RJKA 2QCSB 4P9WA 2VUCA 5F39A 1YC61 5A32A 2Z79A 2CAUA 3VBFA 2XR4A 1UAIA 1ONAA 4X6QB 2HBUA 2GZWA 3AXEA 4OZXA 4IE4A 5D2AA 2Q8OA 1HXS1 3ZKUA 5FZKA 1GOGA 1WD4A 1XNCA 3BU7A 1G9AA 3AJZA 5F5CA 3B01A 4NHKA 3VBUA 5BNPC 5EXOA 3HNBM 3TEYA 1I9RA 1W6OB 2HWF2 4LTAA 3E6BA 3H1WA 1H8TA 2JIGA 1GZWB 1POV0 5IVBA 2RS51 4HVOA 4AAPA 1A3KA 3ZYPA 4BQ2A 3VZLA 4CVUA 1WCDJ 4IV1C 1RVF1 4GKXA 4NAMA 4YGBA 2YU2A 2DTYA 2EICA 3E97A 1VBE1 2OPWA 4G9SB 4KBZA 4MGYE 2R16A 2WZR3 1SLAA 3QD6A 2BV4A 4ASMB 1C1FA 2UWCA 3DL3A 3RGBA 2XVGA 4OHXA 4TLGA 3VL8A 3ZFEA 1H4HA 5C7GA 1AR93 4B1LA 1HW5A 1VBC3 3ME2A 3KV9A 4IGPA 1R093 5LATA 5T55A 4O9GA 1LB2A 3I8TA 5L36A 1PGW2 1XC6A 1VAMA 3T2QA 5DZEA 5FMBA 3PIGA 5DDJ3 2W95A 4LJHA 3JBG1 1D4M3 4FQ4A 2EXJA 3T0DA 4KBBA 4BISA 3I2HA 1QJU3 1CESA 4GZ9A 2A6XA 5D1IA 2A3XA 2BNNA 2VNRA 3AKTA 3EBRA 3NRUA 4AG4A 4AQTA 4OMDA 2KXLA 5JWPA 5KHKA 4V2WA 2YBKA 3A21A 3QLQA 4AE2A 3MLKA 1N1SA 5FPBA 4Q1PA 1W9SA 3MEPA 3V0AB 3FJSA 3ZLIA 1HXS2 2RJLA 2Z5WA 1MACA 4CE8A 3IB3A 2LS6A 4JCKA 1BHGA 4O9EA 5FP8A 4YZ1A 3H8RA 4G3YC 3T2PA 4FPGA 1S1AA 5FY4A 1F15A 2EA7A 1CAVA 4BZ4A 1BBT1 2RVAA 4FPKA 1Y3TA 5BUVA 1W8OA 2R0HA 2RS52 2YMZA 4Z8BA 1W6QA 1UXXX 2BFUS 3GHNA 4CDQC 2HEYF 2RR11 3ACGA 2PQQA 1RVF2 2F4PA 3DPRA 4XDPA 4H2AA 5EV7A 4EE2A 4UF0B 1NZCA 1Q43A 2UWAA 4IERA 3Q9OA 3VDCA 4EN8B 5FO8B 1VBE2 3NAPC 5KXDA 4JV4A 1ULDA 3I4IA 2WSVA 1H6YA 2WN3A 3IDAA 2A1XA 4CP9B 5FUNA 4PDWB 2AR6A 4BJ0A 1C5IA 2XJSA 2O8OA 1CZSA 3USUA 5A7WB 1CIWA 3U1XA 3OBTA 4COWA 2AUYA 5CFCB 4YW4A 1RITA 4XETA 2ZJCA 3NO8A 2OZ6A 4IV3C 1Z7S1 1HX6A 2D6LX 1XNTA 4KG8A 2LUWA 4KMQA 1QKQA 3JBG2 4ZS2A 2VCBA 3ACIA 5JOWA 3U4SA 4JKLA 1RUG3 2VZUA 2ZGLA 3PTRB 4XFGA 4KWJA 4IE7A 3WCSA 1WKYA 4V2VA 3WHTA 4GIQA 3EYPA 2RMU3 4FO9A 1DYPA 4H55A 4AI2A 2ZZQA 4CUCA 2XVLA 5A7QA 3TBDA 1QOOA 3KF3A 4K6BA 3B7MA 3SHRA 1CR7A 1LODA 3I3BA 1OBNA 3RMYA 2GNDA 5FZOA 2V4VA 4XILA 3U37A 2E26A 4URAA 1G8WA 1V6NA 1JW6A 4LUMA 5LBBA 4BM8A 4BYYA 2PA7A 3TN93 4D3WA 4Q4Y3 2VC9A 5IK4A 2WINB 3KQRA 3IAPA 1NCQA 3I54A 3DCQA 1BBT2 1SBDA 1FATA 3MW3A 4HANA 3HQXA 4META 4XABA 3SCFA 1GP5A 3NV2A 1OOPC 2RR12 1H1IA 1GANA 4W65A 4IE6A 1X7NA 3SH5A 4Y22B 1QH7A 3CU7A 2BFUL 2VM9A 4BQ3A 1JYVA 1MQTA 3MLLA 1B35C 3AZWA 3OBAA 1PK6A 3S6PA 4N9IA 1DP0A 4J1XA 4E4SA 4ZU7A 1W2NA 1UZYA 2BUKA 3EB7A 1OXCA 4AFDA 3MICA 1OI6A 1OFSA 2ARCA 4NUBA 2IXLA 4EZHA 1SLIA 1UMHA 2YBSA 1UQXA 1Z7S2 3CDZB 4Q27A 4AEDC 4CCMA 1ZRFA 1C1LA 3D3AA 3MV01 3NKGA 3ACFA 1GZTA 5J48A 4GD4A 3FHQA 4FPHA 1UMZA 3AZXA 5H9SA 3ETPA 3RJRA 2XUMA 2YGLA 4AFAA 1GR3A 1DZTA 4YM1A 2BGPA 4B29A 5BY5A 4S2HA 3JB4C 1ND2A 4IQPA 1COV3 3UNPA 2ZOEB 3WSOA 3OD0A 4TZDA 2IVIB 4RL7A 5L9VA 2B9VA 4QX2A 2IZWA 2Q30A 3K2OA 2EIEA 3ZYGA 1H8VA 1NQDA 3OEBA 5T5JA 1GP4A 3LF7A 3ZPYA 1RUNA 1WMEA 4HKLA 2FCVA 1HRV1 1AR73 4Y26A 2MEV1 1O3QA 2DBNA 2PAKA 2YV8A 2CTVA 2RS32 2JG8B 2WDBA 3OGVA 1Y7BA 3LB9A 5FIXA 5D8AA 4YM3A 4AEMA 1RUD3 4I2OA 1EPWA 3KWVA 5BNOB 2XQXA 4EQVA 4FOVA 4XFIA 1LENA 1US3A 1WGPA 1GNZA 1E5SA 5IAXA 4MHUA 5FOBB 1Q8VA 5CFDB 4XIOA 2BNOA 3P3NA 2PHFA 3PVOA 1JUHA 1RUJ1 4QGNA 1UY3A 5LB6A 5GLZA 3TYJA 1MS3A 4GWJA 1IZ3A 2R0FA 3WDYA 2R30A 2Y6HA 5I0TA 2NP0A 3LD8A 1FV2A 2X29A 1GMMA 4NR1A 3VZKA 1W28A 1VB2A 1F35A 2YROA 2OQ6A 3VKNA 4EWAA 3AMPA 2W92A 3PHMA 5A1FA 5G05L 4WVVA 1IGOA 2PFWA 1QQP1 4FT8A 4FTBA 3H42B 2VVEA 4WM8B 2GDFA 4EV0A 2WABA 1UX7A 2DVDA 2WWJA 4HN0A 4MXWA 4B8EA 4BQYA 2B5HA 2D5FA 4I3PA 2PXJA 4BK5A 3P6BA 5I0RA 5G04L 5CADA 2J42A 3FLTA 3LCPA 5C9AA 3SCHA 1C4RA 2VMCA 3M70A 4GH4B 3WVJA 2QQIA 3ZXDA 1UCXA 3CQOA 1BK1A 1QEXA 3RQ0A 1HRV2 4F7ZA 5LRSA 2G9ZA 2IFWA 2MEV2 1O5UA 1JUIA 2PHLA 5CVRA 2XKPA 2ZHKA 2VOWA 2ZGOA 1SFYA 3KHBA 4IESA 4M00A 5FY5A 1H0BA 4HSLA 2Q8DA 1JZ3A 5DAPA 5EPAA 5FYTA 2VJXA 2KR2A 3GHMA 5BXXA 3ZSKA 2P5BA 4L9BA 3UKTA 4QPGB 2P2KA 5FLHA 4MO3M 5GLVA 4XUQA 2OUHA 2P6CA 4FPCA 2YC2A 1XNKA 4OCTA 3D5OA 3NL1A 2E31A 4YVWA 1MVEA 3ZN6A 4E8CA 3WDXA 1TME1 1S0JA 1RUJ2 2RDSA 1LGNA 1UYXA 4BWOA 3A0NA 4UFLA 4FSJA 3MI8A 4RS5B 1NYWA 3TEWA 1NA1C 5EJ3A 5DUWA 3RRDA 2H6CA 4M0HA 5JOZA 3GZUC 4UFJA 3MO4A 4XTPA 2R063 4A7ZA 2FCUA 4FPYA 3WOGA 2NMNA 1R081 1O8SA 4PLMA 1K5MC 2GMPA 3J7LA 1QQP2 3CNAA 1XNAA 2GN7A 4EN0A 3KV6A 1SCSA 1JYTA 2BWAA 1JXNA 1X9TA 3AP7A 1FMD1 3AZYA 4UT5A 1MS4A 2X5IA 1HB3A 3JD73 4DPNA 1JOJA 1HN1A 3P5BA 5LZ6A 5FRAA 1P8JA 3U75A 2P34A 4OHVA 4MG2A 3R4SA 4P5YA 1XB9A 1QDCA 5JIUA 4IDZA 3GJAA 4WM7B 1RL3A 3POGA 2D6KA 1WBLA 3ZFFA 4FBFA 4HN1A 2OPKA 2YC4A 1AR61 1OD3A 3O0XA 4RR3C 3VGIA 1FOD1 1ZA7A 1AX2A 4M3CE 4N9HA 1RIRA 4F83A 5JZGA 1W6PA 4HL0A 2WNUB 2DTWA 2HWD3 2YDEA 5FZEA 2XXZA 3OUJA 2CGOA 2YZ4A 4UXAA 1ZBE3 1LHNA 1V00A 3OSDA 3RZZA 4ET7A 3VZNA 3HVDA 1QNWA 4FOWA 1O8PA 1TME2 5LBCA 4P9GA 3VB9A 4I02A 2XBO3 4NMIA 1YFXA 3C7OA 4I09A 3V0BB 2W68A 1CAUB 1F2NA 4LBMA 2QJVA 4Q4X3 1LHOA 2QQLA 3K77A 4Q8KA 5JXGA 1O4ZA 1IQAA 1R082 1NLSA 4LOSA 5FZFA 1DBNA 4NAOA 4DUXA 2ARBA 4HBNA 3FN9A 2ZHMA 3EO6A 4QU1A 4GWIA 2VZSA 5DPNA 1FMD2 2CWSA 3H1MA 1RYYA 3AKSA 5A3TA 4PIZA 4JQRA 1CN1A 4A41A 2JG9A 1MS0A 1FPN3 2CDPA 1SLBA 2WFF3 1CIYA 3ZYHA 4AVVA 3DECA 3WNOA 4BMEA 2F17A 3PUHA 1AR62 2DCKA 1FOD2 4PIXA 3EHKA 4JRLA 1LHUA 4CTEA 3KD4A 4N43A 1HDKA 2QFEA 3WNLA 2ARXA 2JE9A 4JTNA 4PT6A 4HT1T 1ULGA 4GB31 2JG8C 3HWJA 3WG4A 2VMHA 1J1LA 1HB4A 3RNSA 5A6YA 4EROA 2W1WA 3IPVB 3WCRA 2D3PA 4Q0VA 3CF6E 3VD4A 4KQ7A 3U07A 1IS4A 4QKFA 1CAWA 5LBEA 1ENSA 1QF3A 4MX3A 1LOAA 1LU1A 1RTVA 4I0WB 5H9QA 5CFDC 1PMHX 4Q4V2 1G9BA 4AVTA 3KZ4C 4NHMA 4LHKA 2QQNA 4LO4B 3V56A 3ZXAC 2JWPA 2P6HA 1VRH1 5KXEA 4XBLA 5FK8A 3BI3A 2RM21 5JOYA 5FZGA 2YHJA 4WVMB 1LECA 1X8EA 3MV11 3RI8A 4HMZA 3M3CA 2WQ4A 4XFHA 1AYM1 1BXHA 5GM0A 5I93A 2BYVE 5J09A 4YVSB 2OZJA 3KT4A 5LEJA 2BZDA 3VBRA 5DN2A 1TVGA 3CIHA 1CJPA 1WUVA 2AACA 2E53A 2KA3A 4HPKB 5CU1A 3SLIA 1ZNPA 3CZUA 1MZFA 3MFAA 4IGOA 2WKKA 4GJZA 2WNOA 1NKGA 4ISRA 2ES3A 3ZVXA 4PHZA 4QDSA 3SCGA 3C7FA 2RDQA 1JBCA 5L9RA 3Q8AA 4LKEA 2EXIA 5ABJA 3N3HA 4OULA 1SLCA 3GZTB 2VXJA 2GMEA 4CEYB 3KMHA 4FCAA 2Y6KA 5LA2A 1SG3A 1VMFA 4AHZA 3CJIC 4WZCA 4AW7A 3PTYA 2IXIA 2W46A 2YY1A 4CCCA 3OGRA 4GB32 2XJVA 4JAAA 1U5XA 1POV3 2JKXA 5E88A 3SKJE 1W06A 2IXHA 2WZR1 3MIGA 5FMOL 4CEWA 2E63A 5EP9A 5I8SA 1ZBA3 2VOXA 4JGZB 3VDDC 5GKAC 1YEWA 2J1UA 3LEMA 4Y4YA 4CU9A 1AR91 1GUIA 1TG7A 2VY0A 2WBKA 3U4XA 4NPRA 3T1LA 5LEKA 3BTZA 1KRIA 1VBC1 1R091 3C7HA 1DZRA 2EALA 2VPVA 3VBOA 1ND3A 5SV5A 1M06G 1RUOA 4R9CA 2D6MA 5T52A 2ZGRA 1VRH2 1ULEA 5DDJ1 1VJ2A 1T2XA 2BBAA 2RM22 4UW3A 2ZX4A 4YG0A 3WDTA 5FDBA 2QE3A 2Z69A 3N9OA 3OBRA 2ZPXA 2GC2A 4MGTA 1QJU1 3WF0A 2GC1A 5K0UA 2DCJA 1AYM2 5C3OA 1JU4A 3IMNA 1HJFA 2ZACA 3G7DA 4YG6A 1TMF1 4XXPA 4N7UA 1WLWA 5JMCA 3OB8A 3LDKA 5AFEA 2WC2A 1XSRA 1VLNA 2YXSA 2XJQA 5F6LB 4AGRA 2BPA2 4ZY9A 4NVPA 2BGOA 2VE1A 5F32A 4BXFA 2ZGTA 5HCBA 1UZZA 2D6OX 3FMGA 3POFA 4D6RA 3KSCA 3M7AA 3QCWA 3UESA 2Q1MA 1NT0A 4O7XA 4XDOA 3ZYIB 5I91A 4JTOA 1OLME 2DU1A 3S5AA 3UETA 5CKMA 1LR5A 2C1FA 3K4DA 1CPNA 1W8ZA 4URTA 3THCA 3ABZA 1QJX1 2WZR2 1YO8A 3NV4A 1DQ2A 2JDUA 3UKNA 4H14A 1ENXA 3L9JT 4WV8A 3I59A 1NG0A 2W1SA 1AR92 3P3PA 3KS7A 5GZDA 4DEQA 5BNPA 4XFFA 2R7EB 4B4PA 1PIV3 4COYA 1VBC2 4JHZA 3ATGA 4YG3A 3W21A 1R092 3CL1A 1SZBA 2AH2A 2B7YA 3ZFGB 1VMJA 4ZONA 3D82A 4IV1A 5FWJA 4CCEA 5DDJ2 5E16A 5EJZB 2W94A 2ZGQA 4ATFA 1RUG1 4LBNA 1XXNA 2VU9A 4O65A 1QJU2 2UURA 2BDRA 4XJAA 4QQHA 3NW4A 2X8KA 1FNZA 4CUBA 2RMU1 1JHNA 2CYFA 3IN9A 1TMF2 4CDXA 2AGSA 2HKXA 5IK7A 5FPLA 3RWKX 4AEJA 2SLIA 2K9ZA 2CSGA 1ZM1A 4LA2A 3VZMA 4COZA 2XDVA 5J96B 2R6QA 1OH3A 3W58A 3FZ3A 2W47A 3TN91 4Q4Y1 3A23A 4CDWB 5CBLA 2RE9A 3M4FA 1CONA 1K5JA 1Q8PA 2DDUA 2H6BA 3POIA 3MIEA 2ENRA 2WUHA 3HR9A 2OX0A 5T3NA 5C4WC 1KITA 2XGXA 1S2KA 2Q8EA 3ZSJA 5L73A 2ZABA 1AXYA 4OQ9A 2XHNA 3O7OA 1QJX2 2XMLA 3B93A 1F31A 1NCRC 4HOOA 4QPIC 1WW6A 2D6NA 2XWJB 4UAPA 2G1MA 2VUDA 2XG3A 4ZHNA 1LAJA 1SBEA 3T30A 4SLIA 3W9AA 5IVYA 4QB2A 1VBA1 1DQ5A 2J1TA 2VVFA 1WBFA 3RMXA 4XZUG 2JDKA 1JODA 3USSA 3BPZA 4MHRA 2Y33A 1XPWA 1DG6A 2Q5TA 4CU7A 1UY4A 4DXZA 3EQEA 3OF1A 1RUG2 5DUXA 3NAPA 3MIFA 1J3QA 3DGTA 3RZMA 5F9TA 5FQ0B 2RMU2 5FXWA 5FYUA 5K7PA 1Y9MA 4XW3A 5T50A 2VZ3A 5LY1A 4OI2A 3ECQA 4DZGA 4YARA 1AR83 2GU9A 1SFNA 3WP4A 3ZKYA 5FZ9A 2RDRA 3H8OA 1LULA 2R1BA 2GNTA 3C2UA 4IV3A 4KU7A 1RJ8A 4QB1A 2ZAAA 4Q4Y2 2G9FA 3PDQA 2XQRA 4LHNA 3O1PA 2Q8CA 3HN1A 2D40A 1OC1A 5GZCA 5FPUA 2MPFA 1RXFA 4M4RA 4QT6A 3ZR6A 3VL9A 2BP6A 2VAUA 2UY9A 4QM9A 1WW7A 5JXJA 3H7YA 3JUUA 1IPKA 3ALQA 2AREA 4CEYC 2DCZA 3GCWA 2ARAA 5FO7B 3KGZA 5BNNB 2JJ6A 1OD5A 4TTGA 1UD1A 3TNQA 4LK6A 5FPZA 2BOJA 5FY1A 3WG3A 3DEMA 3RS6A 2QQJA 2XH6A 4FFGA 1PMIA 1VBA2 5FP3A 2G4IA 2Y6FA 4KWUA 2ZAHA 1X9PA 4RQPB 5FP4A 1O3TA 3VD9A 1S2BA 2ATFA 1ULFA 2EAKA 2GC0A 2VECA 5FYVA 4UYBA 2ZGNA 5J36A 3WHUA 1OOPA 2Z2SB 3R05A 4X8PA 4ZU4A 4LBQB 1QJFA 4BDVB 3PUAA 3FBMA 3ZXEA 2EIDA 1ZZ7A 5A3LA 5HV0A 2JDMA 2VZOA 2ZEXA 3AP9A 3NJZA 2V73A 3FL7A 1B35A 5FZ4A 2CU5A 5A33B 1MR5A 3GALA 1UKGA 3FHAA 3AYDA 1ULCA 3VBHB 1JYXA 5F3EA 2VUJA 3ZMNA 4Q0SA 2OS2A 2QQOA 3CMGA 4UI9L 5HBAA 1EY2A 2Q0AA 2UYBA 4AEDA 2CAVA 4D7YA 2VNOA 4YWAA 4ONUA 2XLAA 5FO9B 4AQ6A 1RHI3 4QGLA 4BCUA 1S0BA 2VOKA 4IE5A 2WNEA 2NPIA 4P9JA 2BVBA 3N9MA 3RZHA 2Y34A 3IT8A 1KDKA 2XWBB 3NQHA 3HQUA 3HNMA 1PO23 4E4ZA 2JDZA 1W2OA 1S2EA 3OG2A 2NM1A 2VMFA 4NROA 4K40A 1W2AX 1V70A 1NE6A 1W8NA 3QH7A 4HLTA 3ZMOA 3BTXA 4KWKA 5FYBA 1ENQA 4J1WA 4K7JA 2J22A 2R061 1UN1A 2R32A 1LOBA 4FAHA 3VBFB
chains in the Genus database with same CATH topology
4XPVA 4Z92B 3M8LA 1A78A 2H0BA 5E89A 2VMIA 2P3IA 4I3GA 3RYPA 3ZN4A 1H8TB 4WBBA 3JD71 4Y1YA 1U12A 3WNXA 3AP4A 4DNYA 2HWE3 2PTMA 2ZMKA 1QGLA 3PMSA 1DGWA 3PJQA 4AK3A 2IXKA 4QQOA 5GZGA 5C6CA 1YUDA 2ZMLA 3TRSB 2NQYA 3ES4A 4XEZA 3ZFEB 2LM3A 4NHLA 1V6KA 1HQWA 4P9LA 1HKDA 3IBMA 4COUA 2HWD1 1HLCA 2UU8A 3ZSMA 1ZBE1 3THPA 4COVA 1W2UA 5J37A 5GLUA 4OFGA 1UIKA 1URXA 3UV9A 1J1TA 3LSDA 3L2HA 4Z82A 2XBO1 3T2TA 3SMHA 2R1DA 1BYHA 3BIWE 4N53C 1I6XA 2ZCWA 3LA2A 4Q4X1 3V0AA 2WWSA 2R062 4BE3A 3K48A 1SCRA 4JRAA 4BA6A 2A7AA 4EWEA 1ZX5A 2A71A 4CP2A 5KXCA 1EAH3 4MV2A 1E57A 4XIKA 1CAVB 3ES1A 3JD72 1RUI3 1W6QB 3JU9A 1NA1A 4TSVA 3DPRB 3IDCB 4N90A 3ZXJA 1F5FA 2ZGMA 2P37A 1FPN1 5KHGA 1O3SA 2WFF1 2JE7A 4QQ2A 2D5HA 2XL9A 5IT6A 1K5MA 1QXPA 1UX6A 3MLJA 1PVC3 1MZ6A 1GV9A 3AMNA 2HWD2 4XE9A 1H2LA 1V9U3 1ZBE2 4X8NA 2DUPA 5JCTA 4YYOA 5FLJA 1IPJA 1XYPA 5JAXA 2XBO2 3M3QA 4C0HA 2R071 4RR3A 4AYUA 4AF9A 1GKBA 3VN4A 4C90A 4RQPC 1AL21 2WNVC 2IXCA 3ETQA 4Y5Z0 3AKRA 1EYBA 1LEMA 2I74A 3ASIA 1ALYA 1O3RA 5TSWA 1NCQB 1LOGA 3HBZA 1BCXA 3SH4A 1Q3EA 4L99A 5IK5A 4HVQA 3RG0A 2BW8A 4XF0A 3H9AA 2JICA 2ZX1A 3VZJA 2X53S 1FPN2 1MQTB 2WFF2 4Y1XA 3OY8B 1NE4A 1KFXL 1PK6B 2WS93 3OYWA 4E9KA 4I0AA 2XJTA 3JQXA 1EP0A 2ZBJA 3HAGA 2GN3A 1N1TA 4Y1UA 1D4VB 1POV1 5T54A 4JVAA 2E7TA 3AYEA 3NWKA 4P9YA 5JDBA 3R4UA 2DVBA 1ZVFA 4Q29A 4L92A 4JC1A 1WLDA 1LCLA 1DFQA 1RGSA 1ND2B 1MEC3 2R072 4YM2A 3WG2A 1VALA 3GBWA 4C91A 1PO11 2LALA 3WUDA 2DWRA 4D7SA 3AMQA 1AL22 2F6BA 4IL7A 4KL1A 4XJZA 2HEVF 4BOWA 3MW4A 3LA3A 1WCKA 5AC93 2AENA 4HZFA 1N47A 4GMP1 2IWGB 5D8AB 4DS0A 1MS5A 3B69A 1ZYBA 1OSGA 2XJPA 2PLV3 3PVBB 4YLZA 2GH8A 4I01A 3B02A 4LO7A 1DQ4A 4TYSA 3OGGA 4JGYB 1U5IA 5EZWA 1C3HA 3J26N 2UWBA 1CX4A 1G9CA 1YCIA 1YYNA 4FXGB 4BIFA 3KLSA 2TNFA 4JDMA 4XF4A 2A6ZA 2R49A 4K1YA 1NXD1 1PIV1 4OI1A 4E4DX 1OLRA 1ZZ8A 4MXWB 4QQLA 1PO12 5C9AB 4LT5A 2YUEA 4RHV1 2ZKLA 3CJIA 5GZFA 1D2QA 4XMAA 1REFA 2A73B 2CGNA 3MIBA 4CDUB 3FFZA 1REEA 1S0FA 2PHWA 4XMIA 3VDDA 1W6NB 4YRDA 2BQPA 2UY8A 2B39A 4EN7B 5L19A 1YIFA 2P3KA 3IM0A 1DIWA 2ZGSA 1Q8QA 4TWTA 3S0MA 1QJZA 2WT2A 4PDWC 2VVDA 1G7YA 1HQLA 1X82A 5L7OA 2Y0OA 4YVWB 2CGPA 3ZN6B 4Y24A 4R9BA 3FWEA 5CFCC 3GNEA 4AFBA 4Z1VA 1C8NA 2QNKA 4NWWA 1RUH3 4XJ8A 4HKWA 2QVSB 2YGMA 3H3UA 3WP6A 4D94A 2PAEA 1WLTA 2A75A 2ZKNA 2VOVA 3DUIA 4Y20A 2RS53 4D69A 2EXKA 1GNHA 1PIV2 2CV6A 2X5IB 1G6NA 1REDA 3DV8A 2EVXA 4Y1ZA 4FPJA 3JZVA 2A6WA 4RHV2 2OW4A 3APBA 3QBQA 2VGDA 3ZFFB 4CRQA 1A6CA 2CY6A 1DHKB 1U0AA 1Z0HA 3E6DA 1OPOA 4XFAA 3WD5A 2ZMNA 2D98A 2IFRA 1DGRN 3GBFA 4PF5A 5GLTA 1OQDA 3U11A 1AR81 3LKJA 4K1ZA 1SLTA 1WCSA 4Y1VA 3ZN5A 3WW3A 5KHHA 1ZZ6A 4A2UA 2XKOA 2QZ3A 3J8F3 4AI8A 5EFUA 5KC5A 2MNGA 3JB8A 4L8QA 1BQPA 3QH6A 2B8MA 3FC0A 1AVBA 2CWMA 1LOFA 4FXKB 1RMU3 1GQGA 1LHWA 2Q1ZB 1IS5A 1R1A3 1JH5A 3CEWA 2JENA 1A8MA 3FLPA 3TWIA 4B7KA 1UW8A 3J4UH 2W52A 1XE8A 1H2NA 1Q5OA 1CJDA 1ZZ9A 2JD4A 1OKQA 2QZ2A 2B9UA 2FQPA 3U10A 4MUVA 3AZVA 3HT2A 5HXVA 2H0VA 2WFPA 3KCYA 2W39A 4R8HA 3ZSEA 5FMOS 4I30A 5JSRA 5C4WA 1KXGA 4AVSA 3SISA 2JG9B 4RA0A 1NXMA 5BNOC 1NCRA 4P9IA 1YFUA 5FAXA 4C0BA 4QPIA 2DV9A 5DXDA 1YRZA 3VUOA 2HJIA 1S0EA 1MZEA 4N43B 4XDQA 3ZX7A 2D97A 3J9SA 1AR82 3CLPA 5AFBA 3N35A 3N7LA 1QDOA 3WQ7A 3ZIXA 2DVFA 5D8AC 1LOCA 3IKWA 4G4FA 1GICA 1T6GC 1CAWB 2TUNA 1RHI1 3VBSA 3NV3A 1DLLA 4AVBA 2GMMA 3N4MA 3A4UA 4IETA 1VIWB 4LEJA 4EWDA 1XNDA 4JGYC 2E7QA 3WLUA 4WM8C 1PO21 3FLRA 5LK5A 2RS33 2FHRA 4DRRA 2PYTA 1VBD3 3KGLA 1X33A 1VP6A 4ORFA 5JI9A 3O14A 1EV13 1W6MA 4N7IA 1UU6A 5JPNB 5C8WA 1H9PA 4GULA 3VBRB 4XBQA 3TOJA 4GH4C 4FTEA 3ZXKA 2VH9A 3INAA 3O5SA 3KCXA 1YWKA 1VBB3 3V64A 1PVXA 3POWA 5C9AC 4QPGC 4YGEA 4GALA 4OHYA 2ZX2A 1RUE3 2FZ1A 5ABJB 2WA4A 4CDUC 1F8VA 3FE5A 1FI2A 2DFBA 4KGGA 4RS5C 4B4QA 3H7JA 4CEWB 3I7DA 3NKTA 1D4M1 4U36A 4FAGA 2EIGA 3KB5A 4AHYA 2PELA 4Q0UA 5I0UA 3KT7A 3WDVA 1QMJA 1RHI2 1QXRA 1LU2A 4IEVA 1C8M3 1XU1A 3THTA 3UKVA 3VBOB 1ND3B 1D0GA 4DY5A 4A7KA 1OLQA 1PO22 5FCCA 3IDBB 2Y38A 5FTTC 5K0UB 3H0OA 4OI4A 4QHBA 1WW5A 2VQAA 1LESA 2O0OA 2DURA 1BJQA 4P9XA 4WM7C 4L2NA 2D93A 2O1QA 3MIDA 1YJLA 1BVP1 2DUOA 2X5IC 2A3YA 2JKBA 1NQJA 3LZZA 2WNUC 3PVNA 1RUI1 2PHDA 3BTAA 2D3SA 2VULA 4UBHA 3D6EA 5JLVA 5C8CB 4DB5A 4LO5B 1J58A 2AYHA 3RI9A 5A3MA 1D4M2 4PBOA 5KWRA 1O7FA 3AMHA 1XNBA 1AHSA 4R4XA 2P17A 2ZGUA 5BNPB 5DUUA 1PVC1 1IOAA 2DYCA 4CP1A 4M0NA 1HQNA 1RJ7A 2D43A 1V9U1 3DKWA 5JSPA 1WMFA 1V6IA 1WD3A 1A8DA 4IV1B 5FREA 4IEQA 1N3QA 1BMV1 4XZPA 4MGKE 4YZ4A 3BOWA 2ET1A 1WA4A 4IEXA 1SACA 2WQZC 3RDIA 2ERFA 1DF0A 2DVGA 1PZ8A 4CDXB 2HWC3 1H1MA 4AI3A 2VW0A 1QY4A 1KJLA 4H7LA 3R4DB 2BEOA 2FZ2A 5J3UA 2UYAA 3ZSLA 3NV1A 3VHOA 1LRHA 1RUI2 4IEWA 1FAYA 2E6VA 4N53A 4BIOA 1CAXA 1R083 5J7MA 4CDQA 1PHMA 3QACA 4N43C 2WS91 1Q8OA 4WVZA 1PNGA 1FMD3 3TBDA 4UW4A 1F5JA 4YFWA 1N3OA 1S0CA 2ZA9A 1YFWA 4AI0A 1QJY3 4SBVA 1PVC2 1COV1 4C1XA 1OMIA 4MH0E 4XJUA 4E2SA 4R9DA 1I5ZA 1V9U2 1OFNA 3AFKA 4PQ9A 4KGQA 3WW4A 4YVSC 3D0SA 2HWB3 1J3PA 1BMV2 1GBGA 2ZHNA 3NAPB 1AR71 2K2SA 3AMMA 3TN92 3CJXA 5SV8A 3VZOA 1MEC1 4AFMA 4INDA 3VKOA 4LE3A 3O0VA 1QU0A 1RUD1 1KJRA 4NO4A 2ETEA 3ZXGA 1GZCA 3W59A 3VBRC 5JPMB 4IV3B 1ZZBA 2BNMA 3AXDA 5AC91 4Q4V3 4ASLA 1RUC3 1UPSA 5I8TA 4GWNA 4R4ZA 2VW1A 1XE7A 1AL0G 2BGCA 1FNYA 4JGZC 2FBEA 1IHMA 2PLV1 4OHZA 2QKDA 3WT3A 1ZRDA 4DFSA 2A3WA 5KBFA 2WS92 2WNVA 3E5UA 5B2GB 4L97A 2BBVA 3BOPA 4M3CA 2C5DA 1COV2 5IK8A 2PHTA 1RUF3 4Q4W3 1OOPB 4PIYA 4IEOA 5H9RA 4FOYA 3LSEA 1DQ1A 1DGRA 4AGGA 4DMIA 1YFYA 4JDOA 4GKYA 2XLFA 2DCYA 1LJ7A 1AR72 3D0JA 5ACA3 4OHWA 5AVAA 1B35B 4K3UA 4MGZE 2JX9A 1MEC2 1MZ5A 4AWDA 2PN5A 4ES8A 2YPJA 5F6KA 3ZXFA 1RUD2 2E51A 4YM0A 4B4RA 2WSUA 1MS8A 4YNIA 2XPJA 1CD3G 4XF1A 5KXBA 4AEDB 5AC92 4BQ1A 3B00A 5FBZA 3TNPB 1JTZX 4LE4A 2RM23 1ZRRA 2GSYA 5A32B 1H30A 4RFT0 3MF9A 1W6OA 2VXRA 4YGCA 3HT1A 3OPZA 1GZWA 2C9AA 3VBUB 5C8CC 1RUH1 3ZFGC 4GWMA 3E5XA 5GLWA 1N1VA 1YNAA 3POYA 1LKNA 4KWLA 3QOPA 3PJYA 5KHIA 2ZGKA 5FOJB 4XYXA 2DU0A 1UIJA 3H50A 1ENRA 2QDNA 1ASJ3 4HFSA 4LHLA 3ILNA 4QMAA 4CDWC 2G9GA 3SXWA 2K0GA 4A7YA 4CDXC 1OPMA 1BEV3 1UPIA 2NLRA 3VV1A 4MLOA 2VNGA 2EXHA 4AQSA 2B46X 5FPXA 4GMP0 1XYOA 1U5ZA 3UJOA 3ENRA 3FUOA 4KH9A 2WLQA 3G6JB 4ATEA 1JN2P 3O12A 3J8F1 3ZDSA 4PLNA 2B42B 1TMF3 1TE1B 1RUH2 1G9DA 1LEDA 2DVAA 1RMU1 2CL2A 5GJ6A 1AZDA 1R1A1 2OIIA 3RPQA 3NVCA 4I0BA 2OUJA 4XTMA 4PDWA 4BH9A 4WZFA 3AYCA 1Q8SA 2JXAA 2YYOA 2DF7A 1LOEA 1O4TA 5CFCA 2WIIB 4IXLA 2Y26A 3V65A 4LLFA 3USUB 2RS13 3WG1A 1NA1B 1QJX3 2GNBA 1O4YA 1Q56A 1LTEA 1JYIA 4LNVA 4CYDA 1FXZA 5JR7B 1UF2C 5DZFA 1QHDA 2BWCA 2GALA 2D7FA 1K5MB 3ST7A 1QXJA 4YZ3A 1AYN3 1TNRA 2BVVA 2XB6C 4Q4X2 4E2GA 5BNNC 4HETA 4FP3A 5HCAA 2D44A 4L11A 1LGCA 4K20A 1SEFA 3J8F2 2C0ZA 3DN7A 1J59A 4LBKA 1I3HA 1QOTA 2GC3A 4RR3B 1AXKA 3GBGA 1RMU2 3B9IA 3ZYJB 1HRI3 4Y22A 1FYUA 1UU5A 4OUMA 1R1A2 5K9YA 1U5YA 3WV6A 4OUSA 2RS31 2I45A 1VBD1 5DUVA 4CZSA 1D2SA 5DG2A 1EV11 4Q1RA 3ELNA 3VBHC 3M1HA 4HKOA 3R6SA 4MGIE 4HVRA 4K21A 3S30A 4AVCA 3RJ2X 2I07B 1H4GA 3OY8A 3L2YA 2TEPA 1YI7A 5FFOC 2R043 3WQ1A 4W6WA 2VW2A 1VBB1 5K8SA 1ZBA1 1VBA3 1Z78A 3OYWB 4P14A 1O5LA 1G9FA 1RUE1 5JVVA 1VAKA 3RYKA 5E8AA 3TB0A 4CP0A 5FLIA 4Z07A 2A5ZA 4F3JA 3VKMA 2IC1A 1UKRA 5I8YA 1FV3A 4OVEA 1DGLA 3FFQA 2N7GA 4B7EA 3WDUA 3MF6A 3LWCA 4YZ2A 4J6GA 2JG8A 2NMOA 3HIFA 4LUKA 5LRRA 4C1WA 1RC6A 3VBFC 3VKLA 4YZ5A 2QDRA 4UW6A 5BNOA 1C8M1 3RSJA 3ILFA 3GYDA 3VBUC 4S2FA 1MVQA 2VG9A 3A0KA 1DYKA 5CFDA 5CA6A 1H8TC 2XVKA 1CQ9A 2O8QA 1YI9A 4Z2WA 1VBD2 1GSLA 1DQ0A 1ZZCA 1EV12 3TAYA 4QD2A 4DQAA 4FQZA 2GAUA 3JCIA 1ZRCA 1DDLA 1MS9A 3CO2A 4LBJA 1HV0A 3ZFEC 4ZKTB 2WT1A 4EN9B 1N1YA 5JIAA 1VBB2 2HWF3 4AI1A 4JGYA 1NY71 2Y0IA 1ZBA2 2EF6A 1PNFA 4WM8A 4MYEA 1RUE2 4W6XA 1H2KA 2P3JA 5CB7A 3PNAA 4BMBA 3FBYA 2KM2A 1UU4A 4AHXA 4GH4A 2PHRA 4Q26A 1OA2A 1S55A 3PMEA 2NN8A 2ZX0A