5T54A

Lectin from bauhinia forficata in complex with blood group a antigen
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
229
structure length
229
Chain Sequence
SELSFNYPNFQSVEDITFQGGASPRNETLQLTPTDSNGIPIRQRAGHAVYSQPFQLRDTSFYTTFTFVIRTTSNSPADGFAIFIAPPDFPVKRYGGYLGLFEPNTATNTSANKVVAVEFDTWVNTEWKEPRYRHIGIDVNSIVSVRVTRWQDKDVFSRSIATAHVGYDGISKILTAFVTYPDGGNYVLSHVVDLAEIFPGDVRIGFSGATGQYETQYIHSWSFSSTSTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis and unique molecular recognition properties of a Bauhinia forficata lectin that inhibits cancer cell growth.
pubmed doi rcsb
source organism Bauhinia forficata
molecule tags Sugar binding protein
molecule keywords Lectin
total genus 50
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t54A00
4WZFA 4YZ5A 2A71A 2JKBA 2OUHA 2D6MA 5IUQA 3UL2A 5JOWA 1O4ZA 1LOBA 4FOVA 4M01A 1SBEA 2DVGA 1HDKA 1UPSA 2CL2A 3AZYA 3QCWA 4ISRA 4K1ZA 4L8QA 1CR7A 3SITA 1I1EA 2W39A 4YG6A 3WDUA 3OY8B 3WG2A 3NV3A 3LSDA 1AZDA 1S0GA 4DRRA 4M3CF 2Q5TA 4R9DA 3HN1A 3NV2A 4Q8KA 1AVBA 5LK5A 1GICA 5GZGA 2A6YA 2GN3A 5CA6A 5FREA 5GJ6A 1DFQA 1BYHA 1MS0A 2DVBA 1CN1A 1CONA 1DQ2A 3N35A 1C57A 2A6XA 3VKMA 1YIFA 1DZQA 1LOAA 5H9SA 5EXOA 3V64A 1VIWB 5E88A 2PHFA 2ZACA 5DXDA 2DU1A 4M3CB 3PVNA 4RL7A 4K1YA 2ZGRA 1SACA 3R4SA 5H9QA 4LBQD 5GZFA 1SLIA 1H30A 1DQ5A 1UX6A 4LBOA 2EXKA 3RQ0A 5GLZA 3U4XA 3AZXA 3ZPYA 5IK8A 4YZ2A 3RS6A 1B09A 2GMEA 3LSEA 5T55A 4BLJA 4TZDA 2WT2A 3ENRA 4DFSA 4UW3A 4YW3A 3WG1A 1YI7A 1WCSA 1PZ8A 4XJ8A 2HYKA 3WDWA 3H0OA 2UU8A 4BM8A 1N3OA 1W6MB 1G86A 3HR9A 4Y1YA 1LHOA 3POYA 3BOPA 3MW3A 5T5JA 4Y22A 1MS9A 2FMDA 4JCKA 4XBLA 1IOAA 2JJ6A 3DGTA 2ZBJA 3RMXA 3W59A 2E7TA 1AXKA 2VY0A 3RG0A 2ARBA 3I8TA 2VUAA 1EPWA 3ZXEA 1G8WA 1LU1A 2ZHKA 2NYYA 2ZMLA 4XOGA 1SLAA 1JW6A 1BKZA 5HCAA 5F9TA 1KDMA 4CTEA 1ONAA 1LU2A 1QDCA 1LHNA 3AXDA 4PBPA 1N3PA 4TYSA 5SV8A 4M3CA 4XIOA 2R0FA 2A6WA 1CVNA 1OQ1A 3IMNA 1HLCA 1Q56A 3SISA 4HL0A 3VUOA 4YW4A 3WVJA 2ZGQA 1QOOA 1GBGA 5JLVA 2AR6A 2VW0A 3O0XA 5JDBA 1LHVA 2UWBA 1AF9A 4YW1A 2D43A 1W0OA 1UZZA 2C9AA 3VKLA 2R1BA 1YRZA 1V00A 4IQPA 2D6PA 2ZAAA 4AWDA 2R16A 2D7FA 4FPOB 3POSA 3JUUA 4XHXA 4Q8LA 1G9CA 1G7YA 4YGDA 5IK4A 4YG3A 1V6IA 3I4IA 5DZEA 4DRVA 1ULDA 1AJOA 1FNYA 1V6MA 3OYWA 3PVEA 5CB7A 2A5ZA 3WDYA 4YZ3A 4Q1RA 2P3IA 4R9BA 4FPLA 3BODA 3DUIA 1AXYA 1AX1A 3IN9A 2YV8A 3B69A 1BQPA 3ILNA 2ZGMA 4XDQA 4YGBA 1MS5A 4NO4A 2DVDA 4FPYA 2VW2A 1UZYA 2A7AA 2ZGNA 2DU0A 4AGRA 3V0BA 4PF5A 2DVAA 4FPGA 1MVQA 1N1SA 1IKPA 3ZXLA 3M1HA 1S0IA 1UN1A 2A3YA 3FLRA 1MACA 3AZZA 1LEMA 1Q8QA 3WCSA 4C1XA 1GV9A 4ISQA 4M3CE 1YYNA 3ZYRA 3UJOA 3B01A 5JOZA 2JE9A 4XBNA 1DHKB 1C1FA 4FP3A 3IPVA 3IM0A 2KM2A 1LTEA 1GZWB 1GLHA 5CBLA 2W52A 3FLPA 4ASMB 1CQ9A 2P2KA 4YW2A 2DUQA 1FV2A 3GALA 3V0BB 4LBQB 1FNZA 1KDKA 3APBA 3FBYA 3V65A 3AZVA 3HMYA 1W0PA 3VKFC 4ZKTB 1DBNA 1JYCA 4Y20A 3WDXA 4AVTA 3O5SA 2WSVA 3SNMA 5EYXA 4LBLA 4XJAA 4YM3A 3M2MA 2AENA 3OJBA 1YO8A 4FPKA 4H55A 3L2YA 1MZ5A 1Q8SA 4CRQA 3V0AB 1KRIA 2AGSA 2YZ4A 1HKDA 1IS6A 4XTMA 1MVEA 4KBBA 2ES3A 3ZXFA 1BZWA 1V6NA 2EXIA 2Z42A 2EAKA 3A0KA 1GSLA 2WT0A 1Z78A 4RA0A 1W6NB 2ZHLA 1WBLA 2ZMNA 4BPZA 1GNZA 1LOGA 3AYAA 5KXCA 2ZGPA 3JU9A 1ULGA 1LHWA 3WDVA 5IK7A 1GKBA 1CIWA 1W6PB 4HANA 4Q26A 1G9FA 1V6LA 1C4RA 4ITCA 5T5LA 4AVVA 1XQNA 1AJKA 4R9CA 1MS4A 3GNEA 2ZGLA 2YROA 5HCFA 4GXLA 1ENRA 1QGLA 2CWMA 2D44A 1AX0A 1N1TA 1RIRA 1HQWA 1W6QA 1GZWA 3D4KA 5GLTA 2TEPA 3O0WA 2UWCA 4R9AA 1N47A 3ZSJA 1G9DA 1SBDA 4Y1UA 2RHPA 1ENSA 2SLIA 3B00A 3UK9A 1S0FA 1WW7A 2DVFA 3FUQA 3WNXA 1S0CA 3TB0A 1RINA 2GNBA 2E6VA 3M3EA 2GNDA 4FPFA 2PHWA 1ENQA 4FPHA 4YG0A 2PHTA 2WT1A 4WVWA 3IKWA 4W65A 2EIGA 1OFSA 3AYCA 1RITA 2DURA 4UW5A 4MYEA 3NV1A 1UAIA 3O12A 4GWMA 4YFZA 1J1TA 2D3RA 1DYPA 1KJLA 2NN8A 1FYUA 2PHXA 2AH2A 1LGNA 1W6MA 2D3SA 2ZKNA 3C2UA 4Y1XA 3SLIA 2DUOA 3ILRA 3KM5A 3MEPA 3R4UA 1LJ7A 3NWKA 3D6EA 3T1LA 4PBOA 1F31A 2ZGKA 5FRAA 4XJUA 5DG2A 3N7LA 2CY6A 1AXZA 3PVOA 5T5OA 3RMYA 2VU9A 4K20A 2A6VA 1WLWA 5H9PA 5IK5A 3AXEA 3FUOA 4FPCA 4XXPA 2ZA9A 3USUB 5IT6A 1HQLA 1LGCA 1V6JA 2FHRA 1GANA 2GNTA 2ZABA 2ZGTA 2AUYA 2PHUA 1N1VA 3D5OA 1FX5A 4XMIA 5H9RA 3VKOA 2V73A 4ATEA 4Z8BA 2A3XA 5GLUA 1Z0HA 1S0DA 3OYWB 4GALA 4NOTA 5JVVA 3N7JA 4YM0A 1A8DA 1U0AA 5T50A 2JE7A 2A75A 1DIWA 1C1LA 4Y1VA 2I2SA 4LBJA 2NM1A 1LODA 5GZEA 3WUDA 2GDFA 1JOJA 2P3JA 4C1WA 5DUWA 3N7KA 4I30A 1BJQA 3A0NA 2A3WA 1KJRA 3AYEA 3BIWE 2GMPA 3O0VA 1DQ0A 4DPNA 1LOEA 1JHNA 1SFYA 1CPNA 3FLTA 5DZFA 1I3HA 1JN2P 2R0HA 2R49A 2W08A 3VKNA 3ZYPA 3QLQA 1WW5A 5CNAA 2D6LX 3B3QE 3M3OA 4XJ9A 2WLQA 1DGLA 5KXEA 4XIKA 2A70A 2DWRA 1LOCA 4GKXA 2P3KA 1CJPA 1FAYA 3AYDA 2D6KA 1VAMA 3ILFA 1DQ1A 3SH3A 1NXD1 1ULEA 2ZGSA 2D6OX 2WSUA 4XMAA 4U2AA 5EYYA 2JDZA 5DUUA 4FPJA 3ZSMA 3POWA 3N3HA 4P9YA 2CWSA 1MS1A 3AK0A 3OBRA 4YM2A 4BMEA 5JOYA 2ZHMA 1QNWA 1WW4A 2H0BA 1JYIA 4GKYA 3AZWA 1FATA 4XYXA 1D0HA 1R1ZA 2GALA 2W68A 5EWSA 1W6PA 1SCSA 3AX4A 4P9WA 2CNAA 3WHUA 4BOWA 1LCLA 3USUA 4XZPA 1TEIA 3AP6A 3WG4A 4DS0A 2EXHA 1LULA 1W6NA 1S0EA 4LBQA 3OGGA 5JOXA 3ZXKA 1A3KA 3SH5A 2XB6C 5GALA 4SLIA 1SLTA 4AGVA 1DYKA 1WLCA 1QU0A 1QKQA 1JXNA 2DV9A 4Q1PA 3MW2A 2OW4A 1G9AA 1QOTA 1WD4A 5GZCA 2ERFA 1UMZA 3AJYA 1SLCA 1APNA 1WBFA 3B9CA 4ATFA 1IS5A 4LBNA 5GM0A 1A78A 4DQAA 4LBKA 3R05A 4PQ9A 4XJWA 5DUVA 1KITA 2ZGOA 3LCPA 4ZXKA 4OZXA 1VALA 3N7MA 2XG3A 3Q9OA 1X50A 1SLLA 2JECA 3OBTA 4WVVA 4FVVA 1MZ6A 4BQ1A 3AP4A 1LOFC 1AX2A 3IPVB 1DQ4A 2AYHA 3VV1A 1ULFA 5GLVA 1D2SA 1MR5A 3KQRA 1Q8VA 4UW4A 4FOQA 1WD3A 1LENA 1S1AA 1W6QB 2C5DA 3ATGA 4P9XA 1LECA 1QOSA 1URXA 3WLUA 3WV6A 3PMEA 3A4UA 4BMBA 4F83A 1NLSA 4YZ4A 4LBMA 5T52A 2E51A 3WCRA 5F5QA 4FQZA 3OPZA 4XILA 2EXJA 1VAVA 3M3CA 4Y24A 4U36A 5CAZA 5DG1A 4JRAA 4AVSA 1PZ7A 3PJQA 2YMZA 5DUXA 5JMCA 1IKQA 2WJSA 1GNHA 2LTNA 4Q27A 1QNYA 3WUCA 1Q8PA 4Y26A 1LEDA 4XE9A 2NP0A 1SBFA 4XXAA 2DUPA 1F5FA 1WUVA 3AP5A 5E8AA 3OY8A 4XBQA 1N1YA 5T54A 1UKGA 1JBCA 1YXWA 4JC1A 4YLZA 1BXHA 1CPMA 2EALA 1QDOA 2AREA 2WNEA 3WOGA 1H9WA 1V6OA 4XJZA 4Y1ZA 2BQPA 5KXBA 1QF3A 3MW4A 2JD4A 4YGCA 4M00A 3NV4A 3WG3A 1OKQA 2A6ZA 1GZ9A 5GZDA 5DZGA 3AFKA 4AYUA 2WKKA 4XTPA 3CNAA 2V5YA 1FV3A 1UL9A 2P34A 1SCRA 4FQ4A 4YZ1A 4FP2A 2DYCA 1LOFA 3M3QA 3FFZA 3RRDA 1ULCA 2OVUA 2OUJA 2DTWA 5KXDA 2ZGUA 3TAYA 2PHRA 3UJQA 1IS4A 4Q2FA 5HCBA 3N36A 3ZSKA 4XHBA 1O4YA 2ZMKA 4WV8A 1N3QA 5BYNA 4YFWA 1H9PA 1ZM1A 4YW5A 3WZ1A 2VXRA 1QMJA 1W6OA 2ZZJA 3ASIA 3W58A 2EF6A 3ZSLA 1DQ6A 1G9BA 5E89A 1JUIA 1IS3A 1Y7BA 2R1DA 3V0AA 2ZHNA 2NZ9A 1PZ9A 4FPEA 2VH9A 2ARXA 1WW6A 4GA9A 2YY1A 1ZA4A 3WDTA 1MS8A 4GWNA 4Y20B 2D6NA 1LHUA 1VLNA 5L73A 4FOYA 1F9KA 2CTVA 1GYKA 1V6KA 1KQRA 5GLWA 1DLLA 3AP7A 3T2TA 4AGGA 4BLIA 4YM1A 2YXSA 2B7YA 2ENRA 1SLBA 4FOWA 2G4IA 1WLDA 2D3PA 1CESA 1LGBA 1S0BA 2LALA 2P37A 1MS3A 2GMMA 3AP9A 2GN7A 5AVAA 3SH4A 4UW6A 3RSJA 1LESA 4PCRA 3INAA 2WQZC 3WHTA 4D69A 2UURA 3AJZA 4CZSA 1GZCA 4K21A 2PELA 3T1MA 4P14A 1S0JA 2SBAA 5T5PA 2CYFA 1W6OB 2E53A 2E7QA 2NMNA 3MPPG 3ZVXA 2GNMA 3BTAA 2VW1A 4Y22B 3ZXJA 4YGEA 2DTYA 2NMOA 1Q8OA 2UWAA
chains in the Genus database with same CATH superfamily
4YZ5A 2QTWB 1KGYA 1AR93 3VBUB 2EICA 5FZDA 3ES1A 1UU5A 1BVP1 3BN6A 3TEWA 4A45A 4IEWA 4XPVA 4MHUA 2DVGA 1HDKA 2WO3A 3AZYA 3JXSA 4HVOA 5JXGA 3SITA 2OZJA 3ZMNA 1JZ5A 1I5PA 3WDUA 3WG2A 1VBE3 3RZLA 1HQNA 3VZOA 1SFPA 2HWE3 5J1XA 4R9DA 1CAWB 2Y6JA 3NV2A 3WF2A 4QX7A 1AVBA 5LK5A 4CUAA 5CFDC 4MGSA 4A7ZA 5CA6A 2H6BA 1W05A 1DFQA 1W9TA 1ZBA3 3VKMA 2BNOA 4LO7A 1YIFA 2BVVA 2ZEXA 2NQYA 4EJRA 5H9SA 4CSWA 1D4VB 5E88A 5IHRA 2XBO1 4EYUA 3VBFC 5BNOC 3E5XA 3CHXA 4QKDA 2QVSB 3CKHA 2G9GA 2GSYA 1W8ZA 4S2HA 5FZ8A 2CSGA 3LE0A 4LBQD 1OMIA 2PQQA 1S2KA 3H1YA 4LBOA 2EXKA 3A23A 1RUJ2 1RUJ1 3U4XA 2WINB 4OULA 5DAPA 5IK8A 5FBZA 3I3MA 2GMEA 4BLJA 2Y34A 1YQ8A 3ENRA 4BIOA 4IDZA 1DGRA 4XUNA 5CFDB 1PZ8A 3WQ0A 4BM8A 5IAVA 1PM7A 1O4TA 3VL9A 1ZBE1 2E26A 1LHOA 2YFZA 3GCXA 5K0UB 1T6BX 2VO5A 3BOPA 5T5JA 1HN0A 4W50A 2FMDA 3WINE 1JZ2A 1IOAA 3RMXA 1TG7A 2Q1FA 2PFWA 2X5IA 3ZFFC 4BZ4A 2R071 1PMHX 5F5AA 3RG0A 4F3JA 1RYYA 2VUAA 4FSJA 4CDQA 1LR5A 3MGUA 2OX0A 2ZHKA 3J4UH 4XOGA 5DAXA 1JW6A 1POV1 5FPVA 2Q8EA 5HCAA 1NY71 5F6KA 2BW8A 1VB2A 4CTEA 4AXOA 3ZFGA 3TEYA 1QDCA 1VMHA 1QHDA 1LHNA 3MBWA 3I49A 1N3PA 4QQHA 4CDXC 4FXKB 3NRUA 2A6WA 3MZHA 3WVJA 5A3PA 2BTVC 3JCIA 4XW3A 4B8EA 1UXXX 5JLVA 4Q0UA 1PO11 4QM9A 3VBHA 1QXPA 1LHVA 1XXNA 1AF9A 2UWBA 3MIFA 5FZCA 3PMSA 4BJ0A 1AR63 1REDA 2WNVC 3H3UA 3KVBA 1UZZA 3I59A 1BMV1 3CMGA 1B35B 4LO6B 4QQOA 2G1MA 3GXUA 4IQPA 4RQPB 4AWDA 4FPOB 2JG8B 2YYOA 3JUUA 3POSA 4CDWA 1O3RA 1YQ6A 4IETA 4YGDA 4XDOA 3I4IA 1WCDJ 3B94A 4LKSA 1AL22 1RVF2 2AACA 4CEWB 1V6MA 2JDMA 2VBBA 3OUJA 5JXIA 2VOVA 2XOMA 5CB7A 3RFRA 3T09A 2A5ZA 3H42B 5LW9A 1SG3A 2P3IA 4R9BA 1OFNA 3BODA 3IN9A 1AX1A 5FYMA 5L9RA 3SKJE 2WBKA 3WP5A 5JCTA 1BQPA 3ILNA 3O1TA 4IW3A 4XDQA 4YGBA 2XR4A 5JZGB 1X8MA 2DVDA 5EJZB 1H2MA 2VW2A 2W87A 5D8AB 2DU0A 3RYPA 2WS93 3V0BA 4N90A 4W6WA 1N1SA 4FFIA 2RDNA 1XBFA 2A3YA 3FLRA 2XLFA 5A33A 3WCSA 2RE9A 4CP2A 2HWD3 2VXJA 1XNAA 4ISQA 4LIUA 2BWAA 3NNFA 1NCRA 2HJIA 3SQOA 1PMJX 2KA3A 1VPHA 1H8TC 2ZKLA 1DHKB 1C1FA 2JG9B 2OQ6A 4MGYE 4EN6B 2VMEA 5B4NA 2VZ1A 4OI2A 1GWMA 3RJ2X 2W52A 4RS5C 1CQ9A 4DUVA 5AC92 2WUHA 2VZSA 2W1SA 1DG6A 4D6SA 3V0BB 2Q1MA 1FNZA 3MO4A 4ARXA 3NAPB 3V65A 2W9XA 2JD9A 3AZVA 3VKFC 2QDRA 4Y20A 4NAOA 3WDXA 2Q4SA 4PF1A 3WP6A 2WS92 2WSVA 2Y6GA 3WY6A 1X9PA 2CV6A 5EYXA 4ES9A 4G4FA 2AENA 5FLHA 3OJBA 3NO8A 4H55A 2VMIA 3I2JA 3N9NA 2YZ4A 2YBSA 3OUHA 3HVDA 4WM7B 1MVEA 5C8CC 4CP1A 3EQEA 1BZWA 1RVF3 2EAKA 3PLQA 2QQNA 3A0KA 3H9AA 2IXLA 1AR92 5F5IA 2BUKA 1WBLA 3CDZB 3WXPA 4AQTA 4LUKA 1SFNA 2VNRA 4M0NA 4ZONA 1XJAA 2Q1ZB 2NLRA 2ZGPA 4R4XA 1ULGA 4RS5B 1LHWA 3CIHA 4HANA 3KGLA 4NROA 1C4RA 4FT8A 1XQNA 1AR62 1FPN3 1MS4A 3G6JB 1XNCA 4X8PA 3J26N 5JSRA 4OHYA 3B02A 4P5YA 1Y43B 5F32A 4BQ5A 5A3NA 1HQWA 3OOXA 2WZR1 1GZWA 4M0HA 2JDUA 3EXUA 2QCSB 2TEPA 2UWCA 3K4AA 2F17A 4KWLA 3JBG1 4QPGB 5GLTA 4CVUA 4EWEA 4Y1UA 1XSQA 1S0FA 5J09A 3FUQA 1NAEA 1UPIA 2W47A 5FY0A 3LIHA 1AYM1 4LNVA 3KCCA 1VBA2 2ADDA 2IXCA 2E6VA 2WAOA 3GHNA 4FPFA 5DPNA 2JDKA 4DUXA 5AC93 2AEZA 3FJSA 3WP4A 1YIPA 1CZVA 4W65A 2EIGA 4K3UA 2R6QA 1QJZA 5BNNA 3MPBA 4B1LA 5FR3A 3VLBB 2ZKNA 3ZYHA 1W6MA 2D3SA 4UWDA 2DUOA 2HWD2 4F8AA 3J8F2 3NWKA 2N7GA 4PT6A 5C4WA 4PBOA 1F31A 5FMCA 1NZIA 1V70A 1R082 4XJUA 1JI6A 1AXZA 2WNOA 1OA2A 2YUEA 3PVOA 4AEJA 4UFLA 1J1LA 1VMFA 2A6VA 1YFXA 3WNOA 5H9PA 3AXEA 2ZA9A 4RSUA 3USUB 4EROA 3DXUA 1T2XA 4IV3A 5IVJA 1J3PA 1LGCA 1H6YA 1GANA 3NSTA 2PHUA 4CCJA 1FX5A 4NIAA 4ATEA 4Z8BA 2V73A 5ACA1 2XONA 4Z92B 3OYWB 4TLGA 1AYM2 4XQWA 3WD5A 4B4QA 5IVEA 2BZDA 4YARA 3POGA 2JIJA 3N7JA 1RUD3 2A75A 1DIWA 1W8WA 2ARAA 2OPKA 2VZTA 3AMMA 1ODNA 2I2SA 3HEIA 3I2FA 4LBJA 4QPIB 2FD8A 1HJFA 4WM8C 2GU9A 2QFEA 4C1WA 1COV2 5DUWA 1UWWA 1J84A 1CD3G 5EHDA 4FBFA 1CWPA 3A0NA 3THCA 1RUH2 3BIWE 3O0VA 1DQ0A 3ZLIA 2VQAA 1CJDA 3FLTA 5JUVA 1R081 1YFWA 2HWE2 2R0HA 2X5IB 2W08A 3KF3A 1ZZCA 2ZX2A 3IB3A 3MV01 3ZYPA 1VBE2 3QLQA 3NMBA 2H0VA 1GU3A 2J7MA 4HPKB 4XIKA 1DDLA 1EAH3 5ABJB 4Q4W1 2CU5A 2P5BA 3ILFA 4XEZA 3WNMA 3KSCA 1HIXA 4B4RA 5EYYA 4NVPA 4FPJA 1ST8A 4JGZC 4ZPIA 3GZUC 1PGL2 4GB33 2ZHMA 3POFA 4KGQA 2H0BA 4D8MA 4KQ7A 2RR11 3PUIA 1PNGA 1R1ZA 3PDQA 5EWSA 2WO1A 5FY4A 4BHPA 5ABJA 1SCSA 1YQ5A 2VOXA 3AX4A 1H0BA 2QQMA 1F15A 1SDWA 2Q30A 2PTMA 2JICA 4DS0A 5A7PA 2RS53 4DUWA 1LULA 1OVSA 2ZX0A 2PA7A 2VULA 5K7PA 1OKOA 2WWJA 2WABA 1POV0 2IUWA 5GALA 4D3WA 1DGWA 5C8CA 3PIGA 1SLTA 4RR3C 1DYKA 5FO7B 1AR71 5BNPB 1AR72 4LO8A 1ZA7A 1BEV1 4IGPA 1BK1A 2DV9A 4Q4W2 4XZUG 1G9AA 5GZCA 3DV8A 1UMZA 5L7OB 4QKFA 3AJYA 1APNA 2KD7A 1YQCA 3WQ7A 3WX5A 1DLCA 1IS5A 1A78A 2CGNA 2PQSA 4QX0A 4LPLA 4QHZA 1JOPA 1US3A 3TN91 1KITA 3UV9A 5F1RA 2DF7A 4ZXKA 1VALA 1F4AA 2PLV3 2RMU2 2ZXQA 3N7MA 3Q8EA 4X6QB 3VD3A 4AZZA 2MNGA 1LOFC 3PTRB 3POIA 4LJHA 5A6QA 1AX2A 3I3EA 3VDAA 3VDCA 1DQ4A 3KV6A 1E5HA 5GLVA 4AI8A 2VQ0A 3VBSA 2XVLA 4CE8A 1LENA 4QXKA 3NL1A 3ATGA 4OHZA 2V4VA 2WLPA 1URXA 3WLUA 4QGNA 3PMEA 4NWVA 5FMBA 5LK7B 4N43A 2YPJA 5EFUA 3PUHA 5A6XA 3H7YA 3ELNA 3UKTA 4BK4A 1F4HA 1MEC3 1Y4WA 4FQZA 4COZA 2IWGB 3FHQA 1WZXA 4LUMA 3WW3A 2EXJA 3PL0A 4P9LA 5LRSA 5F3GA 5ACA2 4KMQA 4BQWA 3ZXAC 4BDVB 3F95A 2W2IA 2ZZQA 4H7LA 4JRAA 1W3XA 1XSRA 1XPWA 1V0AA 2WJSA 2FBEA 1GNHA 2IXIA 3U37A 4Z2WA 3AKPA 3WUCA 4Y26A 2ORZA 3RZJA 1XE0A 4B7KA 1VMJA 2BFUL 3S5QA 1W03A 1W9FA 5BNPA 2O1QA 4HOOA 3ROUA 4XXAA 3K51A 4QX8A 3I2KA 3VBFB 4JZRA 3AP5A 4XBQA 2LS6A 4LHLA 3NAPA 1UY3A 4A42A 4AI9A 1UKGA 2QQUA 2D93A 3WP3A 1H1AA 4OCTA 4RGGA 2GC2A 4ZS3A 4YLZA 5JIAA 5LA9A 5IWFA 2VM9A 4PIZA 5FPZA 4AHWA 1L7LA 2WFPA 5FZFA 2BGPA 1BBT1 2PXJA 1OLME 2VNGA 5J37A 2WWUA 4P02B 1OVPA 1QJY1 1VAKA 3Q8CA 3FMGA 4YGCA 4XAEA 3HAGA 4IGQA 3T30A 1O59A 5LCWL 4IE6A 4QQLA 1NUKA 3BGAA 2VOWA 5DZGA 3AFKA 4PDWA 1UYZA 3EO6A 3KT1A 2C6SA 4FXGB 5FQ0A 1FI2A 3CNAA 3PURA 1FV3A 4TN7A 2JG9C 5FPXA 4YZ1A 4AF9A 5C3SA 5JAXA 1LOFA 5FOBB 3FFZA 3LDBA 2OVUA 2XWBB 2OUJA 4N53A 3RRDA 3LDRA 1X7NA 1L7RA 2DTWA 2VGDA 2Y38A 2ZGUA 5KXDA 2Z79A 3ZSKA 5HCBA 3N36A 5JPNB 2FDFA 4XHBA 1RJ8A 4WV8A 3VD4A 1N3QA 2RJLA 5BUVA 2G9FA 3TOJA 1ZM1A 3GBGA 3JB8A 5BNOB 1QMJA 3RPQA 2VZUA 4JAAA 4LIVA 3R4DB 1HRI2 1JUIA 5FP3A 1ZBE2 2R1DA 5FZIA 2NZ9A 5LA1A 2XXZA 1W8HA 3JD71 3LDKA 4BB3A 3NNJA 4HXCA 4GA9A 1MS8A 3ZN6A 5A3UA 3FBMA 4QX2A 4JGZB 3SCHA 1RUI3 1V9U1 5FMOS 1F9KA 4GH4C 4DY3A 1KQRA 1DLLA 1K5MC 1PIV2 2JX9A 2OIIA 3FC0A 4RFRB 1SLBA 2VVDA 2BBAA 4AEMA 4L0PA 4QGLA 1U5ZA 3CZJA 1K12A 1S0BA 2D3PA 2LALA 4X8NA 3SH4A 4PCRA 3WHTA 1GOFA 4LHSA 3IAQA 2UURA 5CFDA 4BIFA 4CZSA 4YYOA 4K21A 1VBB3 2YGMA 2PLV1 4IE0A 4AOCA 3KMHA 1W6OB 3LOIA 3LPFA 5C9AC 5FPAA 1UY0A 2NMNA 4OMCA 2RMU1 1YJKA 1FMD3 3C7GA 3RZKA 1PVXA 4CDXB 2WFF1 1JZ8A 3U0ZA 2WIIB 2JKBA 3MIDA 5LASA 3VZKA 5J7MA 5IUQA 1LOBA 3M7AA 1D7PM 1JS9A 5FO9B 2LRPA 4K1ZA 4L8QA 4MGTA 1I1EA 2RVAA 3N9PA 2D97A 2W39A 4QX1A 1W8OA 2BP6A 3EYPA 5FPLA 4DNYA 5FUPA 1AZDA 1R092 2K0GA 1VBE1 1GWLA 2YU1A 4M3CF 4PLOA 1GNYA 2XUEA 1NYWA 4G9SB 4COYA 5FP9A 5FZOA 5F6LB 1DCSA 1O7FA 2YG0A 5FKCA 1MS0A 5BY5A 4GMP1 5IVCA 1DQ2A 1S2BA 1COV3 2XHNA 2YC0A 5A33B 4NIDA 2RR13 3AVRA 4XAAA 1W2AX 3V64A 2IVJA 2PAMA 1VIWB 3E1F1 5KHHA 3WT3A 5G04L 2PHFA 4LT5A 3QH7A 4UFHA 2DU1A 1F8VA 4BXSV 5C8WA 4Q4X3 2TUNA 1QXRA 1ACCA 3J8F1 5CZKA 4IV1C 4BK5A 1SACA 4RS5A 3R4SA 5DDJ1 3ECQA 1CZTA 5GZFA 1SLIA 3RJRA 1ZZ7A 4IL7A 5GLZA 3T3YA 3VDDC 3O1VA 1EAH1 2HBTA 3N4MA 5CADA 3RS6A 1B09A 1H1MA 2J1UA 2VC9A 4GAZA 4WM8B 4DFSA 5LA2A 5FZMA 1W04A 4UF0A 2XJTA 1R083 4GWJA 5DQ0A 3WDWA 4BH9A 3H0OA 2EAAA 2UU8A 1N3OA 1W6MB 1OPMA 1KFXL 1A8MA 4MGIE 4HN0A 1PGL1 4Y22A 5FP4A 1S2EA 4JCKA 1C8NA 1UYXA 2VUDA 3VZJA 4DMIA 3CQOA 4COWA 4CEWA 3W59A 2VY0A 1AXKA 1O8PA 1CAXB 2X53S 3H3ZA 1P8JA 3I8TA 4PDWC 1G8WA 2VTXA 1SLAA 2PN5A 3U14A 2NPIA 3MFCA 4E9KA 4M3CA 4XIOA 1CVNA 1OQ1A 2HWC1 2WO7A 3VUOA 4CP9A 2LUWA 4LMFA 2ZGQA 4CCEA 4A6OA 3U75A 3VBOC 5F2SA 3LA3A 2Z5WA 3ON7A 2Q8DA 1QEXA 5IJRA 3ZFGB 4YW1A 1REFA 3ZFFA 4IV3B 1W0OA 2JDAA 4A41A 2VTFA 5FZOB 3URFA 5FZ9A 1YRZA 1V00A 4FAHA 1MEC1 3EBRA 4PHZA 1PGW2 4UOJA 4LEJA 1X82A 2D7FA 5FZHA 1RHI1 3AL5A 3HT2A 4XHXA 4I0AA 3MUY1 2GC1A 4LLFA 1G7YA 4PDWB 4GULA 2J1TA 3ACIA 5JWPA 2RDSA 4JQRA 3E6CC 3LA7A 2MEV2 2WNUC 4JTOA 5DZEA 1AJOA 2JKXA 4DRVA 1WWYA 5FAXA 5AC91 1HRV3 3R6SA 1SMVA 1BK0A 4P9JA 5C5UA 4YZ3A 4Q1RA 2J42A 1EYBA 2RS31 2WR9A 3JZVA 3Q8BA 2XHKA 1UIKA 3IDEA 3B69A 3T2QA 1K5MA 5L9VA 1MS5A 4NO4A 4FPYA 1ASJ2 1UZYA 3MICA 4AGRA 4RHV2 4V1PA 2ZS6B 4JQTA 4PF5A 4Z1VA 4FPGA 1MVQA 5DABA 4KNCA 1UN1A 1MACA 3AZZA 3KLSA 5CFCC 2BJSA 2CHHA 3C7OA 4NJ4A 3JQWA 3NNGA 3ZYRA 3B01A 4EWAA 1PNFA 2JE9A 1GWKA 4IEZA 4FP3A 3IPVA 3IM0A 1OPOA 4K8RB 1AR73 4NPRA 4KU7A 1UY1A 5A3WA 5CBLA 3EB7A 1UW8A 2P2KA 1L7QA 1FV2A 1QWRA 1DU3D 1RHI2 1RVF1 4LBQB 4QQPA 4CXYA 1KDKA 3APBA 3FBYA 3CU7A 1ALYA 5HXVA 1W0PA 4OI1A 4ZKTB 3ZFEC 5F8PA 4B3NA 3VBUA 3SNMA 4AI0A 1NY72 1FXZA 4XJAA 1NX9A 2W46A 3V0AB 3TYJA 4QX3A 4CRQA 1KRIA 2AGSA 1HKDA 5FP8A 4XFAA 4AVBA 4ZZ8A 4TTGA 1VRH3 4CYDA 3OSDA 3VZNA 1QH6A 3NJXA 1W3VA 3ZXFA 3BU7A 4BQ3A 2Q8OA 3N9QA 1GSLA 1Z78A 4W6XA 1W6NB 4NIGA 3LKJA 4BPZA 1LOGA 5LBFA 5KXCA 2XBO2 3PNAA 3NVCA 2PHDA 2WAAA 1GKBA 3MF6A 3WQ1A 3P5BA 1VE0A 3ZM8A 4IEXA 4XC9A 5C70A 5LY1A 4HVRA 5T5LA 4AVVA 1NOVA 2W5FA 4QAWA 1EAH2 5A1LA 1ENRA 1U5IA 3AMHA 4ET7A 4NHMA 5A70A 5FY1A 2CWMA 2R062 1AX0A 2R061 3OPTA 3O0WA 3ZSJA 2WS91 1N47A 4CCDA 4PLNA 2RHPA 1ENSA 2XJSA 1TMF2 3TB0A 1XU1A 2YPDA 2ILMA 1VRBA 2Z2SB 1XNTA 1W28A 4OUMA 5KWRA 3IAPA 5FPBA 1GOHA 1YEWA 2BRTA 4EN7B 2WT1A 3KF5A 1OFSA 2BWCA 2DURA 4MYEA 2J1SA 3NV1A 4LLOA 5FZLA 1AYN3 4CDUB 4CU9A 2D3RA 1DYPA 1FYUA 1GP6A 1LGNA 1SEFA 3C2UA 4DOUA 1AR83 1RUF1 1ZRIA 3ILRA 3MEPA 4R8HA 3D6EA 5FYVA 3T1LA 4G3YC 2ADEA 1OLQA 2XL7A 2QE3A 3MIEA 1PO13 5FRAA 3HBZA 3N7LA 5DG2A 2QUOA 5A6ZA 1VR3A 4DEVA 4FPCA 3FUOA 2BNNA 2DBIA 3RNSA 5IT6A 3ZYFA 3DPRC 3RGBA 1FOD1 1KFUL 3C7HA 5FZ6A 3J8F3 2I45A 3NQHA 2ZGTA 4C90A 2AUYA 1N1VA 4XMIA 1QH7A 3I3DA 3I2OA 1Z0HA 1S0DA 2XJUA 1HX6A 2Y0IA 4GALA 4NOTA 3LPGA 5JVVA 4YM0A 2HEYF 5T50A 2JE7A 2H6CA 4Y1VA 1BMV2 5KHGA 2NM1A 2GDFA 1H8TA 3SKVA 5IW0A 5F39A 3ZIXA 3N7KA 3H8XA 2IFRA 3VDDA 1H6XA 2JENA 2A3WA 1GQHA 2O14A 1AL21 1UYYA 2XQXA 1LOEA 5DZFA 1SFYA 1CPNA 1JN2P 1KS4A 3VKNA 2LW8A 2WZR3 2VCBA 4URTA 3I3QA 1C5IA 1UKRA 2V72A 2WNUB 2HWC3 3BYWA 4A2UA 4GH4A 4XJ9A 1BLZA 1DGLA 2VMCA 2A70A 4E4HA 3AYDA 1CJPA 2JIGA 2UY8A 4MLOA 1GZTA 1Z7S3 1NXD1 2WQ8A 4IXLA 5FYZA 1EP0A 2WSUA 3SH3A 5EQUA 3EMRA 5FK7A 2JDZA 1UCXA 1W8NA 4WM8A 5LY2A 2Y6LA 3S0MA 2GZWA 3N3HA 3POWA 4KU8A 4YM2A 1VBB1 1WMEA 2RS12 3AKQA 5CEHA 1QNWA 4FO9A 1C5HA 5I0TA 1J59A 2GC3A 4QPIC 2WO2A 1STMA 3H1WA 4INDA 1D0HA 4DZGA 2GALA 2W68A 5I8TA 1ZBA1 3ZFFB 1QQP2 4NRQA 1QQP1 1HW5A 2EIEA 1RXGA 5FYBA 2ZOEB 4P9WA 3E6DA 5HV4A 2CNAA 4BQ4A 4XZPA 1PVC1 1PIV1 4CCKA 1EPZA 4QPWA 2VZQA 1ZYBA 3FHIB 2CDOA 3NNMA 4Y33A 3X29B 4NRMA 4L99A 1YFUA 1GOGA 3SH5A 5EIYB 5FP7A 1ZRCA 4XF9A 1CZSA 2WQ4A 3O7OA 4JKMA 4XUOA 3CL1A 4BA6A 3LEKA 4R4ZA 2VECA 3VDDB 5BNQA 1YNAA 3GYDA 4C0HA 4Q1PA 3OGJA 1QOTA 4GQ7A 4IE7A 3SCGA 5IYYA 4Q4V2 1WBFA 2C9KA 2DCTA 3B9CA 3K3OA 4ATFA 4FCAA 4LBNA 4D6QA 4CA9A 4HG6B 2QQPA 4LBKA 3R05A 1U5YA 4NPLA 4AFCA 4JGYA 1CX1A 3E6BA 2ZGOA 3IIAA 2XG3A 3OBTA 5K0UA 4GMP3 4PI0A 4CDXA 4MXVA 5FO8B 3IPVB 1QJX2 2AYHA 3B7MA 4J1XA 2VTXJ 5F3EA 4K40A 3D0SA 2QQLA 4FOQA 4WVMA 2C5DA 2JDYA 3DYMA 3OTFA 1QOSA 4I3PA 4WVZA 4N9IA 1VB4A 3A4UA 4BMBA 5KC5A 1QQP3 4YZ4A 5J3UA 3BTZA 5A1AA 1NCQC 4YRDA 1OQDA 4CDUA 3OPZA 2WFF3 3AL6A 4XILA 1QJEA 3ITQA 2W1QA 3M3CA 5CAZA 2YU2A 3AB0A 5EV7A 1HB4A 1Q5OA 2RM23 1DZRA 2GC0A 4OMDA 4A6SA 4EWDA 4Y3OA 5JMCA 1NA1C 1Z7S2 4MOAA 4HZFA 1ZZ8A 4OZOA 4RN5A 4AEDA 4QKBA 1LEDA 4RQPA 4XE9A 1W2OA 4WZCA 5FZ7A 4P00B 4OQ9A 2NP0A 2ZEYA 4IE5A 3OGRA 2E9QA 1JTZX 1WUVA 3DPRA 1H4HA 5IVBA 2EVXA 5LEJA 4HVQA 2FDHA 1RC6A 4E4DX 1R1A2 2KR2A 1VBC2 3OPWA 3OBAA 5J36A 1JBCA 3Q8AA 3KWVA 4CCLA 1YXWA 4NHKA 2VJXA 2R7EB 2Y6KA 4L11A 3PUAA 5DN2A 2EALA 2WNVB 2P17A 2CAUA 1XC6A 2AREA 2CGOA 2IFWA 1KXGA 1YLLA 4QDRA 1PGW1 2QNKA 4N53B 4LK6A 2ZTNA 4EN0A 4Y1ZA 3PVBB 1ND3C 3MFAA 4ZU5A 2JD4A 4L92A 3TNQA 3WG3A 3ZMOA 4L2NA 1OKQA 2QZ2A 4AHYA 2PMWB 5IATA 4Y5SA 4YVSC 2IVIB 1NE4A 4XTPA 3KCXA 4TWTA 5DAQA 5A3OA 1UL9A 3HIFA 4FP2A 4KWJA 3BCWA 3IIIA 3ZKUA 4DB5A 2JXAA 4LTAA 1YUDA 1XNBA 1RMU2 5A32B 3LQCA 2XJPA 3E5QA 3M8LA 4Q2FA 4ZY9A 5BYNA 5ISLA 4LK7A 4YFWA 4MGZE 2VXRA 1W6OA 2ZZJA 1AL0G 4E2QA 2XVGA 4Q5OA 5BXXA 1ULPA 4C8DA 5C9AA 3HQXA 5FZKA 1AR82 1DQ6A 3ZSLA 4QHBA 2BNMA 5B4XA 2ZHNA 3W5MA 4UFIA 4CDUC 1NG0A 5FCCA 1D4M2 2B9VA 2VH9A 3MF9A 3A22A 4D0QA 4M4PA 5CYYA 1XE8A 4CCNA 3KHBA 1ZA4A 4QPIA 4GWNA 2E7AA 2OT7A 3J7NA 4GMP0 5AFEA 3WW1A 1R1A3 2WYFA 4GD4A 4JGYB 3LGRA 4FOYA 2CTVA 1OUSA 1V6KA 2RS51 4BLIA 2ET7A 1AHSA 3AP7A 3J7LA 3J9SA 4YM1A 1TMF3 3T2TA 3ZYGA 4QXHA 4FOWA 2RJ2A 2DFBA 4N8MA 5ANQA 2P37A 1ND2A 1SPPB 1XNDA 4QT6A 5FOJB 5AVAA 3VB9A 5KHIA 4D69A 3OBZA 4Y5TA 2WQZC 1LB2A 2R063 4NHYA 4MHRA 4RYDA 1RUOA 5FYUA 4P14A 2WDBA 4ARYA 5I0DA 2XJRA 2E7QA 2WFF2 1UQXA 1WMDA 2FMYA 2GNMA 4HK9A 2VW1A 4Y22B 2XWJB 4MO3M 1Q8OA 1OF3A 2A1XA 2XUMA 2A71A 4JX0A 1Y9GA 3UL2A 2D6MA 4MH0E 5IFTA 3W9AA 3TEXA 1O4ZA 4AEKA 3CEWA 5A7QA 4KI5M 2Q0AA 1IG3A 3WQBA 4IEVA 3QCWA 2CL2A 1UPSA 2D98A 2VQTA 3DEMA 4ISRA 4N43B 2FCTA 1IQAA 3GHMA 4MGQA 1PVC3 1UZVA 1UYPA 2VCMA 4YG6A 5HV0A 2BDRA 5L36A 3JB4C 4DIQA 1QJU2 4A7KA 4BQXA 4AR2A 4Q4Y2 3E5UA 4DRRA 5FMDA 4JHTA 5C7GA 5CU1A 3HN1A 4Q8KA 2A6YA 5FREA 4RGKA 4XURA 3N35A 2A6XA 3BU0A 3FN9A 1DZQA 1WMFA 1UX7A 5I0RA 4PIYA 2Y33A 3CLPA 4QPYA 4AQ2A 4FTSA 1MPXA 4QXBA 2XMLA 5DXDA 1K5JA 2RJKA 2Y8KA 4RL7A 4NHXA 2XL9A 4PIXA 3MDPA 4NIHA 1E5RA 2ARCA 2YHJA 4RFT0 4GWIA 3WF1A 3ACGA 2OYZA 5K9YA 1UZWA 5FWEA 3RQ0A 2W1WA 4TXWA 3K75B 4I3GA 4IUGA 3ZPYA 1UMHA 2P6CA 3H7JA 3BPSA 1CAXA 1GUIA 3OD0A 1GQPA 3POBA 3P3PA 5I8YA 1UD1A 2JG8A 4UW3A 1YWKA 4YW3A 5JI7A 3KVAA 4N7IA 5G05L 5HBAA 4XFFA 1YC61 1IG0A 4Q0QA 3U10A 4AFMA 3ZXGA 4JDMA 3HR9A 4Y1YA 2ZX1A 3WF4A 4AFBA 3IBMA 1HRV1 1X8EA 3RYRA 2QJVA 3RWNA 1HB3A 3KCYA 5F37A 2RS13 2CAVA 3KT7A 3DGTA 4K8FA 3RDIA 4CP9B 1QJY2 2E7TA 2ARBA 1ZZ6A 2RDQA 1UMIA 4CU7A 1KD7A 2HLEA 3GZTB 4EN9B 2XJQA 1PX4A 2OA2A 5KBFA 4O9GA 4IEYA 4FFHA 2DCKA 3C3VA 1YCIA 5FFOC 1BKZA 4LITA 4EV0A 2BEOA 3JBG3 1KDMA 1I5ZA 2QBXA 3UGFA 1LU2A 3OEBA 3I3BA 3FZ3A 2WZR2 3ZFGC 5FUNA 2R0FA 3IMNA 2VVEA 4AI1A 4XACA 1Q56A 2HWF2 4KH9A 1UNBA 1FOD2 3HJRA 2AR6A 3FL7A 4EZ4A 5L7OA 5C3PA 5F7UA 1TME1 5CFCA 2VAUA 2D43A 2JB4A 4A3XA 4HKWA 2C9AA 4MXWA 2R1BA 3FHAA 4XF4A 2R32A 4META 4I01A 2VZVA 1W2UA 2A73B 2D6PA 2J22A 2R16A 3NJYA 4CDQB 3M70A 4Q8LA 3F2ZA 2Y6HA 1G9CA 3JD72 2WZ8A 4YG3A 4E2GA 5FYCA 3NJVA 2AC1A 2OXBA 3ZSEA 1FNYA 5FXVA 4S2DA 3CZUA 3RZGA 3WDYA 4CUBA 4XCBA 3N9OA 5B2GB 1WLTA 2W0XA 1W06A 3DUIA 2HH9A 4UBHA 1NZCA 2YV8A 3CJIC 4MV2A 5CFCB 3VBOA 5I0SA 1CAUA 1OUXA 2A7AA 1O6UA 2ZGNA 3ZR6A 3TRSB 1BEV2 3ZXLA 1IKPA 3T2PA 1S0IA 4IEPA 1SHWB 1Q8QA 1XYNA 1GV9A 5HI0A 2VOTA 1O8SA 4M3CE 1YYNA 4CPBD 4H3WA 1L3JA 3ZN5A 1DYOA 3UGGA 3ZN4A 4XBNA 3ZYJB 1NCRC 3TN92 2E33A 2HYXA 4Q4X1 2KM2A 5FBJA 3VHPA 4NHLA 5T3NA 1RTVA 4XETA 1GLHA 4E4SA 2HBUA 4ORFA 4MG2A 4YW6A 4W8JA 4YW2A 1VRH1 5FWJA 1JZ4A 3ORJA 4I02A 3GALA 2MEV1 4I0WB 4UI9L 2Z69A 1NCQB 4PJYA 1IGOA 1SZBA 3HMYA 2Y64A 3UESA 4ZZ5A 3ZN6B 5I91A 3PUQA 2ET1A 5J96B 3SC7X 5FJKA 3BKZA 1EV12 1CAVB 2K9ZA 2VBPA 3M2MA 1QJU3 1J58A 3PUSA 4QXCA 1HN1A 1MZ5A 4KWUA 5A7SA 2ZJCA 4CCCA 3UNPA 4J25A 1IS6A 4BISA 5IVVA 3ETQA 2XGXA 3THTA 3VZLA 5D1IA 2WT0A 3K4ZA 4RA0A 4XF3A 2ZMNA 1RUF2 3GZAA 1F2NA 1GNZA 1FMD1 2X10A 3JU9A 3N9MA 1REEA 3JQXA 4YVWA 3RYKA 3KHCA 3W20A 4Q26A 1G9FA 4ITCA 1AJKA 2BFUS 3LIGA 4R9CA 3OGVA 4NMIA 1IZ3A 4GXLA 2B42B 3FWEA 1QGLA 1PO23 1VBD3 4UT5A 2D44A 1N1TA 1W6QA 1CIYA 4CDWB 3O1OA 4BWOA 1JHJA 3IWZA 3OUIA 5IAXA 3HQUA 1SBDA 3B00A 2SLIA 1EV11 3CJIA 3H3LA 1WW7A 2DVFA 2V09A 3RI9A 2BYVE 1S0CA 3EJKA 1RINA 2XLGA 2Y6FA 4O61A 4MVTA 1OLRA 5CKQA 1RB8G 5A7WA 1V9U3 2R042 2DCJA 4LE4A 3KV4A 3AC0A 4YG0A 3FX3A 4WVWA 3AYCA 4UW5A 3SEPA 5LWBA 1D4M3 5IVYA 1UAIA 2VZRA 3O12A 1O91A 4IV1B 1MQTC 4LQRA 5D2AA 4YFZA 1J1TA 4OQ8A 2GP3A 1KJLA 1ZBE3 2BGOA 2QDNA 4FAGA 2AH2A 1HV0A 2W95A 5BPXA 2VVFA 3KM5A 2VCCA 3VDBA 2BBVA 1CAWA 1NCRB 3HNYM 4TLFA 2FDGA 2VZ3A 2ZGKA 2HWD1 5T5OA 4MX3A 3RMYA 4DO0A 2HWB2 4QU1A 4UBGA 3VN4A 5LEKA 2VU9A 4K20A 4FI9A 5D21A 3P6BA 1WLWA 3K48A 3AMNA 4NN0A 1K45A 4AHXA 5BV6A 5IK5A 2YFUA 1PX3A 5I93A 3FE5A 3SHRA 5LATA 1V6JA 2FHRA 2GNTA 4W6YA 5CKNA 2ZABA 3D5OA 4P08A 5H9RA 2QQJA 2RM21 3VKOA 2VBDA 5GLUA 3ZXDA 1EY2A 3THPA 3RZMA 2JDHA 3S30A 2I07B 4O9EA 1F35A 1ZX5A 4D94A 1XNKA 3IZOA 3OF1A 1MZEA 5F5CA 4C0BA 4NR1A 1LODA 1JOJA 3ZDSA 4UAPA 4HT1T 1OF4A 1U5XA 2P3JA 3MV11 1HB1A 2OQ7A 4I30A 4R52A 1BJQA 5JIUA 3N9LA 1KJRA 1F5JA 2JB8A 2CDPA 2J1VA 2GMPA 2VL4A 3PHMA 1G9DA 4M4RA 1NE6A 5EPAA 2HWF3 5FIXA 4GH4B 3VBHB 1JHNA 2Q8CA 3S5AA 1I3HA 2R49A 3WF3A 3I2HA 2C0ZA 4ZU4A 3IDCB 3T0BA 4RHV1 1PO22 1VBD2 3B3QE 3M3OA 5KXEA 2QQVA 1AR91 5C6CA 4ZHNA 2DWRA 4ES8A 1J3QA 3DPRB 5AVPA 3UKVA 1FAYA 1Q43A 4A7YA 2MHFA 3CJIB 1DQ1A 4XVHA 5FZ4A 1ULEA 1JH5A 2ZCWA 2ZGSA 4NPMA 2DBNA 4CU8A 5BNNC 4XMAA 2ZX3A 4QPGA 4U2AA 3THDA 2XVKA 3ZSMA 2VUJA 1TE1B 5J98B 3VD9A 4P9YA 3OBRA 1K42A 1COV1 4AE2A 4Q4V1 2B45X 3GJAA 3UKNA 4GKYA 4BQYA 1MEC2 2W92A 3UYJA 1FATA 4Z82A 4AAPA 3IT8A 3G7DA 1A6CA 3P3NA 1EUUA 2EIDA 3WHUA 1ASJ1 1LCLA 3KV9A 3GZEA 4BOWA 1TEIA 4Q0PA 2EXHA 1W6NA 3AM2A 4LBQA 3S57A 4ASKA 4OFGA 2ZEZA 3IDBB 4UYBA 2RV9A 3ZXKA 1A34A 1C8M3 5FUIA 2WZEA 1JMUB 2ZAHA 5J48A 2YGLA 3MLJA 1UOGA 1Y9QA 4E2SA 5C4WB 3WW4A 4AGVA 1WLCA 3VGIA 3ZO0B 4CXXA 1PO21 1VBD1 3OCPA 3BI3A 4CEYA 3ALQA 5FYSA 1M4WA 5FZ0A 2PLV2 2RMU3 5JZGA 1XE7A 1PK6A 2OW4A 3MW2A 3W21A 3TN93 2K46A 1HXS1 2ERFA 1ULOA 3E97A 2O8OA 1LRHA 1S55A 2WNVA 3KD4A 1JYXA 5GM0A 4DQAA 1OOPC 1PGSA 2K2SA 4PQ9A 4XJWA 5DUVA 3LCPA 2OS2A 4OZXA 3HBKA 1BEV3 4AEDC 4A44A 1SLLA 2YB7A 1OT5A 2VMDA 1MZ6A 1OD3A 3OB8A 3AMQA 4BQ1A 1H4GA 4OI0A 2J1EA 2HEWF 2Y0OA 3LEGA 5TSWA 5JSPA 3WNKA 4D6RA 4Y4RA 2X8KA 3HT1A 4B29A 4QWNA 1ULFA 5FLIA 4LKEA 3BPZA 3MI8A 3KQRA 1Q8VA 5C8CB 4UW4A 1QJU1 1XU2A 4LXLA 3A21A 4UFMA 1UY2A 3VBRA 2XLAA 1LAJA 2BPA2 4Y4YA 5ANNA 2RDRA 3U07A 3JD73 5T52A 2JG8C 4N43C 3C8XA 2F4PA 1LKNA 4AHZA 4LKFA 4JGYC 4L97A 5FZBA 4B4PA 5FTTC 4KBZA 1VAVA 4Y24A 4HMZA 3RZZA 4CU6A 3NNLA 4HKOA 4X6RB 2EIBA 5IFPA 1BBT2 3OEAA 1WCQA 4NIIA 3KS7A 4AFAA 4AVSA 1PZ7A 3PJQA 2KXLA 5DUXA 1IKQA 1FOD3 2LTNA 4Q27A 2VD7A 1QNYA 4CP0A 1RUC2 4IGOA 1Q8PA 3ES4A 5BNPC 1SBFA 1RUE1 3WSOA 4CEYB 2DUPA 1F5FA 4LHNA 3GJBA 3BTXA 5DAVA 4BYYA 1DGRN 5ERLA 4BCUA 1X36A 2R041 5I8SA 3O1MA 2WN2A 5AFBA 1RUC3 3H8UA 2BOIA 3I2DA 1XRUA 3OD4A 1W0NA 4Q4Y1 1OH3A 4E4ZA 1QJY3 3O14A 1CPMA 1RUH3 4IEOA 1E5SA 4IV3C 1K5MB 2RM22 4QD2A 1QDOA 1BBT3 2FQPA 3MLKA 1H9WA 2J1AA 1V6OA 1KS5A 3AFGA 3LFIA 4XJZA 4YVSB 1HJGA 1JYTA 5JI9A 2BQPA 5EJ3A 2B4KA 3K4DA 1QF3A 3MW4A 3AKSA 4M00A 4BU2A 3MYXA 1RUD2 4XFHA 1RUD1 2A6ZA 4RQPC 2XJVA 5FQ0B 3D3AA 1GZ9A 4QB6A 2HWB1 4AYUA 2WKKA 3VBSB 4LE3A 1RMU3 3J7MA 2V5YA 4XUPA 1RUC1 1RUNA 2P34A 2IXJA 1YJLA 5D8AA 4D7SA 1XYOA 2DYCA 1ND2B 1SPPA 3K77A 2HKXA 1ULCA 1ODMA 2W91A 2E63A 3HWJA 4BQ2A 3TAYA 3VHOA 4D7YA 5CISA 4GJZA 4QX5A 2D5HA 4O65A 1O4YA 2ZMKA 3NKGA 4XDPA 1RJ7A 3T4VA 2ETEA 3ACHA 1H9PA 1VJ2A 3D0JA 4YW5A 3WZ1A 2PHLA 3I2IA 3VBRC 3W58A 1MQTA 4V2WA 3WF0A 1G9BA 1IS3A 1MZFA 2VOKA 2YDEA 1Y7BA 3HOBA 3V0AA 1UOBA 4JV4A 1XYPA 1PZ9A 5SV5A 4FPEA 2W1UA 3A7QA 3AKRA 2YY1A 5K4LA 5LBBA 3WDTA 1O5UA 4Y20B 4YWAA 3BOWA 3POEA 5I0UA 2YBPA 4IE4A 4OUEA 2D6NA 1LHUA 3ACLA 4FFGA 1VLNA 4HKLA 4HSJA 4Q29A 5L73A 1JU4A 3VD7A 1SDDB 5DMYA 4LOSA 1PVC2 5FZEA 4HLTA 2V4AA 1C3HA 2B7YA 1JYWA 3NAPC 2E32A 2GMMA 3AP9A 1NKGA 3WEZA 2D5FA 3EHKA 4TSVA 4UW6A 4KG8A 1LESA 2DCZA 4AW7A 3KGZA 4CEYC 1HXS2 4QB1A 2PELA 3GDBA 1PM4A 3T1MA 1HB2A 2VMGA 4GZ9A 4CDWC 3SMHA 5FZGA 2E53A 1WMXA 1QJFA 3GGLA 3H1MA 2BOJA 3BTAA 1PHMA 2ZEWA 1OI6A 3RWKX 2DTYA 1HXS3 2UWAA 3ZFEA 4WZFA 3MHZA 1UOFA 1Q3EA 4Q0SA 4JKLA 2OUHA 3D82A 5JOWA 2OKXA 4FOVA 4M01A 4E8DA 1SBEA 5FXWA 5LB6A 5F9TA 3ZYIB 5JR7B 2D40A 1CR7A 4AG4A 5FZ1A 3BIEA 3OY8B 4CUCA 3NV3A 3LSDA 4GIQA 1QJX3 3HNBM 1S0GA 5LBCA 2Q5TA 3IMMA 4QM8A 3DYPA 5HXMA 5GZGA 4QPGC 1GICA 5FYTA 2P1BA 2GN3A 5A3MA 5JZGC 4DXZA 1TNFA 5GJ6A 1ND3B 2P4EA 1BYHA 2B8MA 2IXKA 3ABZA 2DVBA 1CN1A 1CONA 1RHI3 4HPKA 1C57A 1YHFA 4UXAA 4XFBA 3VL8A 5BNNB 5C33A 5C5TA 1LOAA 1UU6A 2WZPP 5EXOA 4C91A 4MZUA 4Q4V3 2ZACA 3NJZA 1OA3A 4JGZA 4M3CB 1OHFA 1TNRA 3PVNA 4K1YA 5DAWA 2ZGRA 3ZOIA 5FJHA 1IPSA 1HV1A 4LR4A 1H2NA 5KHJA 2UYBA 1OD5A 1QIQA 2X5IC 4Q0VA 5H9QA 5A7OA 3LF7A 4KL1A 1ZNPA 1NT0A 1H30A 1DQ5A 1UX6A 1GP4A 1T6GC 1UU4A 1ZREA 3KB5A 3ST7A 3Q8FA 3AZXA 4UFJA 3U4SA 4YZ2A 5ABJC 2Y26A 5LZ6A 2OPWA 4RHV3 3LSEA 5T55A 1JU3A 1RMU1 4TZDA 2WT2A 5KC6A 3WG1A 3WW2A 4IEQA 1YI7A 1WCSA 2HWB3 1W99A 1TMF1 4HSLA 1W8UA 4XJ8A 5JMOA 2HYKA 1J83A 1PK6C 4MXWB 3ZDVA 1G86A 5A6YA 4HBNA 2W94A 1HRV2 3NKTA 5LBEA 1UOJA 4FTBA 2YC2A 1W9YA 4XCAA 3L9JT 5A7NA 4GB32 3POYA 3MW3A 1MS9A 4ONUA 4XFCA 4XBLA 2JJ6A 3W5NA 4V2VA 1AYN2 2ZBJA 1RUH1 2FCUA 4CCOA 3QH6A 5JXJA 1RL3A 1GP5A 5FZAA 3B93A 4BE3A 4CEWC 1POQA 3LOBA 5A80A 1EPWA 5FLJA 3VBFA 4HK8A 4N9HA 3ZXEA 3K3NA 3MLLA 1LU1A 2JWPA 1AR61 1ENXA 1V9U2 2R043 2NYYA 2ZMLA 5IVFA 1NA1A 2BV4A 3U11A 1ZRDA 2VZPA 4AQ6A 1ONAA 3AXDA 4PBPA 4TYSA 5SV8A 3UETA 1D2QA 4OVEA 4Y5Z0 1HLCA 1YFYA 3B5LB 4HL0A 3SISA 3VBUC 4YW4A 4H7MA 1QOOA 3K46A 1GBGA 5CVRA 3O1RA 2VW0A 3O0XA 5M0TA 1ZVFA 1POV3 4N53C 5JDBA 1W9SA 3I2GA 1ND2C 3K2OA 4OUSA 3LEMA 3TNPB 3VKLA 4MADA 3O1SA 5JXHA 1H1IA 2ZAAA 3HNMA 1WCUA 3CO2A 2TNFA 4KWKA 1D4M1 5IK4A 5C4WC 2BU9A 1V6IA 2X29A 4YW7A 1ULDA 3OYWA 3PVEA 1VRH2 3USSA 1OURA 3LWCA 4FPLA 2G9ZA 3QOPA 4YVSA 1AXYA 3S7IA 1OBNA 2IC1A 4XABA 4P9IA 1WCKA 2ZGMA 4S2FA 2WC2A 4EQVA 1EV13 4JKKA 3HPNA 5JR2A 4RD7A 4LHKA 1VBA1 2WRAA 2BERA 4I2OA 2DVAA 4OHWA 1RUJ3 1FPN1 1OQEA 2MPFA 3M1HA 5FY5A 1LEMA 1NXMA 1JUHA 2O0OA 4C1XA 2JDPA 1NQDA 1UIJA 1YQ2A 2JEMA 3VBHC 3CF6E 3UJOA 2DFCA 3UT0A 3ZYBA 5JOZA 4RR3B 1CAVA 4LORA 1LTEA 2VNOA 1GZWB 4SBVA 5FY9A 4CCMA 1GMMA 3FLPA 2FCVA 4ASMB 5CG8A 3PU8A 5FY8A 2EA7A 4FTEA 1OXCA 1NQJA 1TQ5A 2DUQA 1G6NA 4H2AA 4D7TA 4QHOA 4OHXA 1ZBA2 1VBA3 2QQIA 1C8M2 3MIBA 1BVVA 3DYOA 1H2KA 1DGWX 1DBNA 1JYCA 4AVTA 3HQRA 1M06G 3S6PA 3O5SA 3SEEA 1WKYA 2WA4A 5F3CA 1ASJ3 1O5LA 4JDOA 4LBLA 2R30A 2P6HA 2HWE1 2JG9A 1SQ4A 4YM3A 1R64A 1RUI1 1YO8A 4FPKA 3WNLA 3L2YA 1Q8SA 2O8QA 5APAA 2XH6A 2FZ2A 2GAUA 4XTMA 2J1RA 3ZPOA 5C9AB 1BCXA 2GH2A 2ES3A 4KBBA 1ZRFA 2EXIA 1V6NA 2Z42A 2MEV3 1ZZ9A 1Y3TA 1H2LA 2ZHLA 3MIGA 4A3ZA 3QACA 4QMAA 2C26A 3AYAA 2ID4A 4OI4A 3OGSA 4XF0A 3WDVA 5IK7A 1CIWA 1DP0A 1W6PB 4XUTA 1V6LA 4AFDA 4CXWA 2AZ5A 3GNEA 5FMOL 4RGAA 2ZGLA 2YROA 5HCFA 2VQUA 3VZMA 2VNVA 1YI9A 3KT4A 1O3TA 2HWC2 1JZ6A 2UYAA 1RUE2 3M3IA 1RIRA 5HPOA 2QZ3A 2TBVA 3U1XA 3D4KA 2B5HA 4R9AA 5JPMB 1W39A 1NA1B 2HWF1 3T0AA 4RR3A 3UK9A 4LKDA 2VR4A 4NUBA 2Z4FA 2X05A 3L2HA 1PIV3 3JBG2 3RVHA 4DXTA 2GNBA 5K8SA 3M3EA 2GNDA 3POJA 4B1MA 3OG2A 4A4AA 2PHWA 5L9BA 1ENQA 3BVCA 4FPHA 2PHTA 1WA6X 3ACFA 1UXZA 5BNOA 3IKWA 1RITA 3PJYA 2FDJA 2FZ1A 5KR7A 4AVCA 4GWMA 1UY4A 4K6BA 5A32A 4BXFA 4LOTA 2WA3A 1PK6B 1AUYA 2NN8A 2PHXA 2VMHA 3WG4A 5C3OA 3SLIA 4Y1XA 3VHNA 4W4ZA 4P5HA 3R4UA 1LJ7A 4UF0B 1H8TB 1TME3 3VBRB 1Z7S1 2IZWA 5KHKA 1IQDC 2WN3A 5F2WA 2CY6A 1W2NA 1JYVA 1OLMA 1KEXA 3IDAA 4LO4B 2GH8A 1LNSA 3TWIA 5C71A 4XXPA 4URAA 4P9GA 1PO12 2VZOA 4UFKA 5HCHA 3LFMA 1HQLA 3ETPA 2VE1A 1O3SA 2VG9A 1I6XA 4XF1A 2B9UA 4AI2A 4EN8B 4S2GA 1AL23 2A3XA 5E6HA 2R073 3DF0A 1VP6A 2QKDA 5FPUA 4AQSA 4AAXA 3H8RA 4WBBA 3GBWA 1A8DA 1U0AA 2WL1A 1U12A 2I74A 1C1LA 2XDVA 4KG0A 5GZEA 4WM7C 3WUDA 1IHMA 5LA0A 3PU3A 2F4LA 4EZHA 2RS11 4IERA 2PAEA 4JTNA 3SXWA 3AYEA 1UZ0A 5FZ3A 2ZX4A 5LRRA 2RS32 4IV1A 4DPNA 1US2A 3O1UA 5K0UC 1JOBA 2WNUA 2X09A 4YSFA 4AL9A 4L9BA 4K9SA 4Z07A 5E16A 1JYNA 1WW5A 5CNAA 3WNNA 3TEZA 2D6LX 3RI8A 2WLQA 5E1RA 3VBOB 2C4XA 1C28A 4GKXA 1LOCA 4YVWB 2P3KA 2D6KA 1VAMA 4AK3A 4PLMA 4IEUA 2D6OX 4XFIA 5EP9A 5FDBA 5L7OC 1RXFA 2XBO3 2XKPA 3P1IA 5DUUA 1AR81 1RUF3 2ZPXA 3LB9A 4BMEA 2CWSA 1MS1A 1OOPA 3AK0A 4I0BA 4DEQA 1X33A 4ZS2A 5JOYA 2VCAA 2LROA 1AYN1 1WW4A 3KV5A 3GBFA 1JYIA 4QB2A 3AZWA 3DL3A 4XYXA 3V56A 1W9WA 1W6PA 3WR0A 1EUTA 1RUG2 4XQDA 3GM8A 5CIRA 4H14A 4ASLA 2CGPA 3USUA 4HFSA 3AP6A 3VHRA 3NW4A 3BTYA 1S0EA 4ZXEA 1TVGA 1TZOA 3OGGA 4CUGA 3LD8A 5A3LA 5JOXA 4N7UA 1A3KA 4KGGA 4OLLA 5C3QA 2XB6C 4EE2A 3ME2A 1OC1A 4SLIA 3BB6A 4LA3A 2DCYA 4GB31 4J6GA 1DZTA 1FT9A 1QU0A 1QKQA 3MUZ1 1JXNA 4QGMA 3T0DA 4AI3A 4AEDB 1WD4A 3D8CA 3I54A 3KQ4B 5FK8A 1HRI1 1SLCA 4MGKE 3WNXA 2RR12 4COUA 3DN7A 2PAKA 1HRI3 1Y9MA 1W90A 4PQQA 1XOYA 4IESA 3ZKYA 1ZRRA 2VPVA 4Q4W3 3B9IA 1NLRA 1JZ7A 3Q9OA 4WVVA 1X50A 2JECA 4QU2A 4LULA 4FVVA 4GJYA 2B46X 4I09A 5C3RA 3AP4A 3AMPA 3PIJA 2YC4A 5FYIA 3T4HB 3ZFEB 2ATFA 3VV1A 1OSGA 4QDSA 2WYSA 5FXZA 1RGSA 5A3TA 1D2SA 1MR5A 1R091 1UO9A 1WD3A 1S1AA 1QJX1 1D0GA 1W6QB 4P9XA 1LECA 3PTYA 4FFFA 4WVMB 3HD8B 3WV6A 1WGPA 1RUG3 4F83A 1R1A1 1NLSA 3WCRA 4LBMA 2E51A 4LA2A 1CGPA 1W8FA 1E5IA 4MSVA 2ORXA 3H50A 5F5QA 1B35C 3GF6A 4XFGA 4DY5A 2G19A 4HETA 2QQWA 4YVWC 2XPJA 4JHZA 4U36A 2AEYA 4QQ2A 5DDJ2 5DG1A 4DXRA 5ACA3 1X9TA 4YNIA 1GR3A 3C7FA 2Y60A 1CX4A 3FFQA 4MUVA 3H8OA 1OOPB 2YMZA 2VUCA 1OA4A 4JRLA 1ZZBA 5FKBA 1VBC3 3DCQA 1BHGA 3I59B 3HN3A 3RZHA 2GP5A 3VD5A 2B39A 5E8AA 1RUI2 2L9LA 1WA4A 3OY8A 1N1YA 1W2TA 5T54A 1E57A 2W3JA 3KZ4C 3TBDA 4Z2AA 2RS33 3BUCA 1J3RA 1JZ3A 4LO5B 5EJ1B 4E8CA 4JC1A 1BXHA 3ZR5A 2JDNA 4QKNA 1CAUB 1S4CA 5A7WB 2WNEA 3WOGA 3WNPA 2QQOA 3ZIWA 1ND3A 4CPBA 3DKWA 5F3IA 5KXBA 1O3QA 3BALA 2BVBA 3I97A 1XB9A 3NV4A 4HONA 2XQRA 4OHVA 3S7EA 1AYM3 3LAGA 5GZDA 4K7JA 2R072 4CDQC 2YBKA 2JE8A 2HEVF 2DDUA 3M4FA 4ZU7A 1DF0A 1SCRA 2C1FA 2QQKA 4FQ4A 3GCWA 4AVAA 1PMIA 4NE9A 5CG9A 3M3QA 2FDKA 3T2OA 1NLQA 2V5DA 2LM3A 3O1PA 2WWSA 5JSOA 1OH4A 1IPKA 1VBC1 3CJXA 2PHRA 3UJQA 1IS4A 3UGHA 4YPJA 1JODA 4E27A 1NCQA 3R0RA 4JDNA 3DECA 1TME2 4OYUA 4Q4X2 1GQGA 2UY9A 4DINB 2E31A 3ASIA 3QBQA 4XUQA 5CKMA 3QD6A 1QXJA 2EF6A 5GKAC 5E89A 4COVA 1B35A 3T08A 5EZWA 5FV3A 5L19A 2BGCA 2FDIA 2OZ6A 2ARXA 1RUG1 4NWWA 5FYYA 1WW6A 3ZX7A 4B7EA 4QDQA 5D8AC 5FYHA 1MQTB 1C8M1 4NAMA 3I7DA 3LZZA 4Q4Y3 1R093 5GLWA 1GYKA 3AVSA 4AGGA 3VBSC 4XQ4A 5FXXA 2YXSA 2ENRA 2F6BA 4NRPA 1K3IA 1WLDA 2G4IA 1W8TA 3DKQA 2PYTA 2RS52 3C7EA 1QY4A 1CESA 1LGBA 1MS3A 3CBNA 2GN7A 4F7ZA 3RSJA 1RUE3 3INAA 1I9RA 2VMFA 3AJZA 3AKTA 1GFF2 1GZCA 3U78A 4O7XA 3LEIA 4J1WA 1FMD2 1S0JA 5FY7A 5DDJ3 4DXSA 2C24A 3LA2A 1FPN2 4HN1A 2SBAA 4JVAA 3J7HA 4PI2A 4WM7A 5T5PA 1H8VA 2CYFA 1UF2C 3DXTA 3MIHA 3SCFA 1IPJA 2P3YA 2IXHA 2XKOA 3MPPG 2RG4A 3ZVXA 1VBB2 3ZXJA 4YGEA 5A1FA 2NMOA
chains in the Genus database with same CATH topology
4YZ5A 1AR93 3VBUB 3ES1A 1UU5A 1BVP1 4IEWA 4XPVA 2DVGA 1HDKA 4HVOA 3AZYA 3SITA 2OZJA 3ZMNA 3WDUA 3WG2A 1VBE3 1HQNA 3VZOA 2HWE3 4R9DA 1CAWB 3NV2A 1AVBA 5LK5A 5CFDC 5CA6A 4A7ZA 2H6BA 1DFQA 1ZBA3 3VKMA 2BNOA 4LO7A 1YIFA 2BVVA 2NQYA 4EJRA 5H9SA 1D4VB 5E88A 2XBO1 3VBFC 5BNOC 3E5XA 2QVSB 2G9GA 2GSYA 4S2HA 4LBQD 1OMIA 2PQQA 1S2KA 3H1YA 4LBOA 2EXKA 1RUJ2 1RUJ1 3U4XA 2WINB 4OULA 5IK8A 5FBZA 2GMEA 4BLJA 3ENRA 4BIOA 1DGRA 5CFDB 1PZ8A 3WQ0A 4BM8A 1PM7A 1O4TA 3VL9A 1ZBE1 1LHOA 5K0UB 3BOPA 5T5JA 3WINE 2FMDA 1IOAA 3RMXA 2X5IA 2PFWA 3ZFFC 4BZ4A 2R071 3RG0A 4F3JA 2VUAA 4FSJA 4CDQA 1LR5A 3MGUA 2ZHKA 3J4UH 4XOGA 1JW6A 1POV1 5HCAA 1NY71 5F6KA 2BW8A 1VB2A 4CTEA 4AXOA 3ZFGA 1QDCA 1QHDA 1LHNA 1N3PA 4QQHA 4CDXC 4FXKB 2A6WA 3MZHA 3WVJA 2BTVC 3JCIA 4XW3A 4B8EA 5JLVA 4Q0UA 1PO11 4QM9A 3VBHA 1QXPA 1LHVA 1XXNA 1AF9A 2UWBA 3MIFA 3PMSA 1AR63 1REDA 2WNVC 3H3UA 1BMV1 1UZZA 3I59A 1B35B 4LO6B 4QQOA 4IQPA 4RQPB 4AWDA 4FPOB 2JG8B 2YYOA 3JUUA 3POSA 4CDWA 1O3RA 4IETA 4YGDA 3I4IA 1WCDJ 3B94A 1AL22 1RVF2 4CEWB 1V6MA 2VOVA 5CB7A 2A5ZA 2P3IA 4R9BA 1OFNA 3BODA 3IN9A 1AX1A 5JCTA 3WP5A 1BQPA 3ILNA 4XDQA 4YGBA 5JZGB 1X8MA 2DVDA 1H2MA 2VW2A 5D8AB 2DU0A 3RYPA 2WS93 3V0BA 4N90A 4W6WA 1N1SA 2A3YA 3FLRA 2XLFA 5A33A 3WCSA 2RE9A 4CP2A 2HWD3 4ISQA 2BWAA 1NCRA 2HJIA 2KA3A 1H8TC 2ZKLA 1DHKB 1C1FA 2JG9B 4MGYE 4EN6B 4OI2A 3RJ2X 2W52A 4RS5C 1CQ9A 5AC92 1DG6A 3V0BB 2Q1MA 1FNZA 3NAPB 3V65A 3AZVA 3VKFC 2QDRA 4Y20A 3WDXA 2Q4SA 3WP6A 2WS92 2WSVA 3WY6A 2CV6A 5EYXA 4ES9A 4G4FA 2AENA 5FLHA 3OJBA 3NO8A 4H55A 2VMIA 2YZ4A 4WM7B 1MVEA 5C8CC 4CP1A 3EQEA 1BZWA 1RVF3 2EAKA 3PLQA 3A0KA 3H9AA 2IXLA 1AR92 3WXPA 2BUKA 1WBLA 4AQTA 4LUKA 1SFNA 2VNRA 4M0NA 2Q1ZB 2NLRA 2ZGPA 4R4XA 1ULGA 4RS5B 1LHWA 4HANA 3KGLA 1C4RA 4FT8A 1XQNA 1AR62 1FPN3 1MS4A 3G6JB 1XNCA 4X8PA 3J26N 5JSRA 4OHYA 3B02A 1Y43B 1HQWA 2WZR1 1GZWA 4M0HA 3EXUA 2QCSB 2TEPA 2UWCA 5GLTA 4EWEA 4KWLA 3JBG1 4QPGB 1G9DA 4Y1UA 1S0FA 5J09A 3FUQA 1UPIA 1AYM1 4LNVA 3KCCA 1VBA2 2IXCA 2E6VA 3GHNA 4FPFA 5AC93 3FJSA 3WP4A 1YIPA 4W65A 2EIGA 4K3UA 2R6QA 1QJZA 5BNNA 3MPBA 3VLBB 2ZKNA 1W6MA 2D3SA 2DUOA 2HWD2 4F8AA 3J8F2 3NWKA 2N7GA 5C4WA 4PBOA 1F31A 1V70A 1R082 4XJUA 1AXZA 2YUEA 1OA2A 3PVOA 4AEJA 1J1LA 2A6VA 1YFXA 5H9PA 3AXEA 2ZA9A 4RSUA 3USUB 4EROA 4IV3A 1J3PA 1LGCA 1GANA 3NSTA 2PHUA 1FX5A 4ATEA 4Z8BA 2V73A 5ACA1 4Z92B 3OYWB 3WD5A 1AYM2 4XQWA 4B4QA 4YARA 3N7JA 1RUD3 3AMMA 2A75A 1DIWA 2OPKA 2I2SA 4LBJA 4QPIB 4WM8C 2GU9A 2QFEA 4C1WA 1COV2 5DUWA 1CD3G 4FBFA 3A0NA 1RUH2 3BIWE 3O0VA 1DQ0A 2VQAA 1CJDA 3FLTA 1R081 1YFWA 2HWE2 2R0HA 2X5IB 2W08A 3ZYPA 1ZZCA 2ZX2A 1VBE2 3QLQA 2H0VA 4HPKB 4XIKA 1DDLA 1EAH3 5ABJB 4Q4W1 3ILFA 4XEZA 3KSCA 1HIXA 4B4RA 5EYYA 4NVPA 4FPJA 4JGZC 3GZUC 1PGL2 4GB33 2ZHMA 4KGQA 2H0BA 4KQ7A 2RR11 1PNGA 1R1ZA 5EWSA 4BHPA 5ABJA 1SCSA 2VOXA 3AX4A 1H0BA 1SDWA 2Q30A 2PTMA 2JICA 2RS53 1LULA 2ZX0A 2PA7A 2VULA 5K7PA 1POV0 5GALA 4D3WA 1DGWA 5C8CA 1SLTA 4RR3C 1DYKA 5FO7B 1AR71 5BNPB 1AR72 4LO8A 1BEV1 1BK1A 2DV9A 4Q4W2 1G9AA 5GZCA 3DV8A 1UMZA 5L7OB 3AJYA 1APNA 3WQ7A 3WX5A 1IS5A 1A78A 2CGNA 3TN91 1KITA 3UV9A 5F1RA 2DF7A 4ZXKA 1VALA 2PLV3 2RMU2 3N7MA 4DS0A 4X6QB 2MNGA 1LOFC 1AX2A 1DQ4A 5GLVA 4AI8A 2VQ0A 3VBSA 2XVLA 1LENA 4QXKA 3NL1A 3ATGA 4OHZA 2WLPA 1URXA 3WLUA 4QGNA 3PMEA 4NWVA 5LK7B 4N43A 2YPJA 5EFUA 3H7YA 3ELNA 3UKTA 1MEC3 4FQZA 4COZA 2IWGB 4LUMA 3WW3A 2EXJA 4P9LA 5LRSA 3ZXAC 2ZZQA 4H7LA 4JRAA 2WJSA 2FBEA 1GNHA 2IXIA 4Z2WA 3AKPA 3WUCA 4Y26A 4B7KA 2BFUL 5BNPA 2O1QA 3ROUA 4XXAA 3K51A 3VBFB 3AP5A 4XBQA 4LHLA 3NAPA 1UKGA 3WP3A 2D93A 1H1AA 4RGGA 2GC2A 4YLZA 5JIAA 4PIZA 5FPZA 4AHWA 2WFPA 2VNGA 1BBT1 5J37A 1QJY1 1VAKA 3FMGA 4YGCA 3HAGA 4QQLA 2VOWA 5DZGA 3AFKA 4PDWA 3EO6A 4FXGB 3KT1A 5FQ0A 1FI2A 3CNAA 1FV3A 2JG9C 5FPXA 4YZ1A 4AF9A 5JAXA 1LOFA 5FOBB 3FFZA 3RRDA 2OVUA 2XWBB 2OUJA 4N53A 1X7NA 2DTWA 2VGDA 2Y38A 2ZGUA 5KXDA 2Z79A 3ZSKA 5HCBA 3N36A 5JPNB 4XHBA 1RJ8A 4WV8A 1N3QA 2RJLA 5BUVA 2G9FA 3TOJA 1ZM1A 3GBGA 3JB8A 5BNOB 1QMJA 3RPQA 4JAAA 3R4DB 1HRI2 1JUIA 1ZBE2 2R1DA 2NZ9A 3JD71 4GA9A 1MS8A 3ZN6A 3FBMA 4JGZB 3SCHA 1RUI3 1V9U1 5FMOS 1F9KA 4GH4C 4DY3A 1KQRA 1DLLA 1K5MC 1PIV2 2JX9A 2OIIA 3FC0A 1SLBA 2VVDA 4AEMA 4QGLA 1U5ZA 1S0BA 2D3PA 2LALA 4X8NA 3SH4A 4PCRA 3WHTA 2UURA 5CFDA 4BIFA 4CZSA 4YYOA 4K21A 1VBB3 2YGMA 2PLV1 3KMHA 1W6OB 3LOIA 5C9AC 2NMNA 2RMU1 1YJKA 1FMD3 1PVXA 4CDXB 2WFF1 3U0ZA 2WIIB 2JKBA 3MIDA 3VZKA 5J7MA 5IUQA 1LOBA 3M7AA 5FO9B 4K1ZA 4L8QA 1I1EA 2D97A 2W39A 4DNYA 1AZDA 1R092 2K0GA 1VBE1 4M3CF 4PLOA 4COYA 4G9SB 1NYWA 5F6LB 1O7FA 5BY5A 1MS0A 4GMP1 1DQ2A 1S2BA 1COV3 2YC0A 5A33B 2RR13 3V64A 2PAMA 1VIWB 5KHHA 3WT3A 2PHFA 4LT5A 3QH7A 2DU1A 1F8VA 5C8WA 4Q4X3 2TUNA 1QXRA 3J8F1 4IV1C 1SACA 4RS5A 3R4SA 5DDJ1 3ECQA 5GZFA 1SLIA 3RJRA 1ZZ7A 4IL7A 5GLZA 3VDDC 3N4MA 1EAH1 5CADA 3RS6A 1B09A 1H1MA 4WM8B 4DFSA 2XJTA 1R083 3WDWA 4BH9A 3H0OA 2EAAA 2UU8A 1N3OA 1W6MB 1OPMA 1KFXL 1A8MA 4MGIE 4HN0A 1PGL1 4Y22A 4JCKA 1C8NA 3VZJA 4DMIA 4COWA 4CEWA 3W59A 2VY0A 1AXKA 2X53S 1CAXB 3H3ZA 3I8TA 4PDWC 1G8WA 1SLAA 2PN5A 2NPIA 3MFCA 4E9KA 4M3CA 4XIOA 1CVNA 1OQ1A 2HWC1 3VUOA 2LUWA 2ZGQA 3VBOC 3LA3A 2Z5WA 3ZFGB 4YW1A 1REFA 3ZFFA 4IV3B 1W0OA 3URFA 1YRZA 1V00A 4FAHA 1MEC1 3EBRA 1PGW2 4LEJA 1X82A 2D7FA 1RHI1 3HT2A 4XHXA 4I0AA 2GC1A 4LLFA 1G7YA 4PDWB 4GULA 5JWPA 4JQRA 3E6CC 3LA7A 2MEV2 2WNUC 4JTOA 5DZEA 1AJOA 4DRVA 5FAXA 5AC91 1HRV3 3R6SA 1SMVA 4P9JA 4YZ3A 4Q1RA 2RS31 1EYBA 3JZVA 2XHKA 1UIKA 3IDEA 3B69A 1K5MA 1MS5A 4NO4A 4FPYA 1ASJ2 1UZYA 3MICA 4AGRA 4RHV2 4V1PA 2ZS6B 4PF5A 4Z1VA 4FPGA 1MVQA 4KNCA 1UN1A 3AZZA 1MACA 3KLSA 5CFCC 3JQWA 3ZYRA 3B01A 4EWAA 1PNFA 2JE9A 4IEZA 4FP3A 3IPVA 3IM0A 1OPOA 1AR73 4NPRA 4KU7A 5CBLA 1UW8A 2P2KA 1FV2A 1QWRA 1DU3D 1RHI2 1RVF1 4LBQB 4QQPA 1KDKA 3APBA 3FBYA 3CU7A 1ALYA 5HXVA 1W0PA 4OI1A 4ZKTB 3ZFEC 4B3NA 3VBUA 3SNMA 4AI0A 1NY72 1FXZA 4XJAA 3V0AB 3TYJA 4CRQA 1KRIA 2AGSA 1HKDA 4XFAA 4AVBA 1VRH3 4CYDA 3VZNA 1QH6A 3ZXFA 3BU7A 2Q8OA 1GSLA 1Z78A 4W6XA 1W6NB 3LKJA 4BPZA 1LOGA 5KXCA 2XBO2 3PNAA 3NVCA 2PHDA 1GKBA 3MF6A 3WQ1A 4IEXA 4HVRA 5T5LA 4AVVA 1NOVA 1EAH2 1ENRA 1U5IA 3AMHA 4NHMA 2CWMA 2R062 1AX0A 2R061 3O0WA 3ZSJA 2WS91 1N47A 4PLNA 2RHPA 1ENSA 2XJSA 1TMF2 3TB0A 1XU1A 2ILMA 2Z2SB 4OUMA 5KWRA 4EN7B 2WT1A 1OFSA 2BWCA 2DURA 4MYEA 3NV1A 4LLOA 1AYN3 4CDUB 2D3RA 1DYPA 1FYUA 1LGNA 3C2UA 1SEFA 4DOUA 1AR83 1RUF1 3ILRA 3MEPA 4R8HA 3D6EA 3T1LA 4G3YC 1OLQA 2XL7A 2QE3A 3MIEA 1PO13 5FRAA 3HBZA 3N7LA 5DG2A 2QUOA 1VR3A 4FPCA 3FUOA 2BNNA 3RNSA 5IT6A 3DPRC 1FOD1 1KFUL 3J8F3 2I45A 2ZGTA 4C90A 2AUYA 1N1VA 4XMIA 1QH7A 1Z0HA 1S0DA 2XJUA 1HX6A 2Y0IA 4GALA 4NOTA 5JVVA 4YM0A 2HEYF 5T50A 2JE7A 2H6CA 4Y1VA 1BMV2 5KHGA 2NM1A 2GDFA 1H8TA 3ZIXA 3N7KA 2IFRA 3VDDA 2JENA 2A3WA 1GQHA 1AL21 1LOEA 5DZFA 1SFYA 1CPNA 1JN2P 1KS4A 3VKNA 2WZR3 4URTA 1C5IA 1UKRA 2WNUB 2HWC3 4A2UA 4GH4A 4XJ9A 1DGLA 2A70A 3AYDA 1CJPA 2UY8A 4MLOA 3SH3A 1Z7S3 1NXD1 3ZSEA 4IXLA 1EP0A 2WSUA 2JDZA 1UCXA 4WM8A 3S0MA 2GZWA 3N3HA 3POWA 4KU8A 4YM2A 1VBB1 1WMEA 2RS12 3AKQA 1QNWA 4FO9A 1C5HA 5I0TA 1J59A 2GC3A 4QPIC 3H1WA 4INDA 1D0HA 4DZGA 2GALA 2W68A 5I8TA 1ZBA1 3ZFFB 1QQP2 1QQP1 1HW5A 2ZOEB 4P9WA 3E6DA 2CNAA 4XZPA 1PVC1 1PIV1 1EPZA 1ZYBA 3FHIB 3X29B 4L99A 1YFUA 3SH5A 1ZRCA 4XF9A 2WQ4A 3O7OA 3CL1A 4BA6A 4R4ZA 2VECA 3VDDB 5BNQA 1YNAA 3GYDA 4C0HA 4Q1PA 3OGJA 1QOTA 4GQ7A 3SCGA 4Q4V2 1WBFA 3B9CA 2DCTA 4ATFA 4FCAA 4LBNA 2QQPA 4LBKA 3R05A 1U5YA 4AFCA 4JGYA 3E6BA 2ZGOA 3IIAA 2XG3A 3OBTA 5K0UA 4GMP3 4CDXA 4MXVA 5FO8B 3IPVB 1QJX2 2AYHA 3B7MA 4J1XA 4K40A 3D0SA 4FOQA 4WVMA 2C5DA 3OTFA 1QOSA 4I3PA 4WVZA 4N9IA 1VB4A 3A4UA 4BMBA 5KC5A 1QQP3 4YZ4A 5J3UA 1NCQC 4YRDA 1OQDA 4CDUA 3OPZA 2WFF3 4XILA 3M3CA 5CAZA 3AB0A 5EV7A 1Q5OA 2RM23 1DZRA 2GC0A 4EWDA 5JMCA 1NA1C 1Z7S2 4HZFA 1ZZ8A 4AEDA 1LEDA 4RQPA 4XE9A