5T54A

Lectin from bauhinia forficata in complex with blood group a antigen
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
229
structure length
229
Chain Sequence
b'SELSFNYPNFQSVEDITFQGGASPRNETLQLTPTDSNGIPIRQRAGHAVYSQPFQLRDTSFYTTFTFVIRTTSNSPADGFAIFIAPPDFPVKRYGGYLGLFEPNTATNTSANKVVAVEFDTWVNTEWKEPRYRHIGIDVNSIVSVRVTRWQDKDVFSRSIATAHVGYDGISKILTAFVTYPDGGNYVLSHVVDLAEIFPGDVRIGFSGATGQYETQYIHSWSFSSTSTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
molecule tags Sugar binding protein
source organism Bauhinia forficata
publication title Structural analysis and unique molecular recognition properties of a Bauhinia forficata lectin that inhibits cancer cell growth.
pubmed doi rcsb
total genus 50
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t54A00
1FATA 2WQZC 3I4IA 3JU9A 4LBOA 3WDXA 2ZGLA 1VAMA 1DZQA 1WW4A 2EXIA 3LSEA 1H30A 1CN1A 3M3EA 4FPEA 2E51A 3O0XA 5GLWA 3WCSA 1S0IA 3A0NA 1D2SA 1V6OA 2GMEA 2GDFA 1DQ1A 5T52A 1MS9A 4UW4A 1IKQA 1JN2P 1DQ2A 1QMJA 1UAIA 2D6MA 4FVVA 1KJRA 5FRAA 1IOAA 3ATGA 5HCFA 1SBFA 1V6MA 4Q8KA 1W6QA 2ZZJA 5GJ6A 4YM3A 3NWKA 3RG0A 3BIWE 1MS5A 5DZEA 3N3HA 3UJQA 4Z8BA 4YM2A 1GICA 4YW2A 3ILNA 1PZ7A 1WBLA 2UWBA 2AR6A 4U2AA 3INAA 3WUDA 2KM2A 1JUIA 2DUOA 3WUCA 4LBQA 4XIKA 2XG3A 4BMEA 4YLZA 3LSDA 3HR9A 3FLPA 1FV2A 1CIWA 3OYWB 2PHXA 1ULEA 2VU9A 3W58A 1MR5A 4Q2FA 4CRQA 1YO8A 5DUXA 3KQRA 3BODA 1N3PA 1YRZA 2DYCA 1QU0A 2A3WA 3R4UA 4Y22B 1KDKA 3AP4A 3ZVXA 4F83A 1DFQA 4XJ9A 3U4XA 2DVFA 4IQPA 1W0PA 4YGBA 4PF5A 1KRIA 1V6IA 3C2UA 3SH3A 4FPHA 4YGEA 4K1ZA 1UZYA 3O12A 2NM1A 1LHOA 3M3OA 2ES3A 2GNMA 1ULFA 4AYUA 1GZWA 4LBKA 3VKLA 2R16A 1EPWA 1W6NA 4BMBA 1IS5A 4ITCA 2D6OX 2EXJA 1LJ7A 3WDTA 4YG0A 3A4UA 3FUOA 3PJQA 4Q8LA 1FX5A 3USUB 5IK5A 1S0JA 2AENA 3TAYA 1ZA4A 3ZXJA 1DQ4A 1MS3A 4DS0A 1GSLA 1OKQA 2B7YA 5GZDA 1ULCA 1DIWA 2FHRA 2I2SA 1OQ1A 3USUA 2OVUA 5E89A 2G4IA 2DTYA 1CQ9A 1GV9A 1LGBA 1O4YA 1QF3A 2GNDA 1BZWA 4LBMA 4P9XA 4Q26A 4YZ1A 5IT6A 1I1EA 5IK4A 4DPNA 2ZMKA 1QNYA 3B00A 3B9CA 1W6PA 1WUVA 1AVBA 1PZ9A 1F9KA 3M2MA 5GALA 4M01A 3M3QA 1Q8QA 3SH4A 1W6OB 1BQPA 1SLAA 2ZGKA 3OPZA 3ZXFA 1Y7BA 3O0VA 1G9AA 2ZHLA 3ZXKA 1SLTA 5E88A 3ZSKA 2ZGQA 4I30A 3RQ0A 1YYNA 1FNYA 3AZVA 1KITA 5JOZA 1GKBA 1N1TA 5DUVA 5T50A 4LBQB 4AVSA 4XBLA 4HANA 4K1YA 5KXDA 3B69A 5JVVA 4NO4A 5JOWA 3FLRA 2DUPA 1URXA 3WG4A 4LBJA 3IPVB 3QCWA 3ILRA 3WV6A 1Q8PA 1DQ0A 2PHUA 3SH5A 1LESA 1F31A 1W6MA 2CTVA 1F5FA 5T5JA 4YW4A 1N1SA 4Y1VA 2ZGUA 4SLIA 1U0AA 4NOTA 2ZKNA 5L73A 1S0FA 2R0FA 1TEIA 1C4RA 1GANA 2JE7A 3WLUA 2ZA9A 2AREA 1I3HA 4YG6A 2UU8A 3N35A 2WJSA 2ZMLA 2YROA 4LBLA 1S0DA 2DVAA 3FUQA 3ZYRA 4UW3A 4Y1ZA 4LBNA 4XJAA 1UL9A 2A6ZA 4FPJA 2YXSA 4FPKA 4Y22A 3MPPG 1FAYA 1WD4A 2CL2A 4M00A 3NV1A 4D69A 2A6YA 2D3RA 4R9BA 4YGDA 5SV8A 4BQ1A 1QOOA 3WDVA 5JLVA 5BYNA 2W52A 2CY6A 2P37A 5H9QA 2P34A 5F5QA 2W39A 1IS4A 4GWNA 2GMMA 4Y1YA 4C1WA 3WCRA 3AZXA 4GKYA 2A71A 1VLNA 1A3KA 1Q8OA 3IKWA 2CWMA 2WSVA 4Y1XA 1UMZA 1LOGA 2DU0A 1FYUA 2R0HA 3ILFA 4KBBA 1D0HA 4XXAA 2DV9A 2A70A 4FP3A 2CYFA 3T1MA 1MVEA 2UWCA 1FV3A 1JBCA 4HL0A 4XMIA 1LHNA 5DG1A 1ZM1A 2E7QA 1BJQA 1LECA 2V73A 3IM0A 3LCPA 3B3QE 5GM0A 4LBQD 1N3QA 2C5DA 1A78A 5EYXA 4YZ2A 4XE9A 5KXBA 3AYCA 2ZBJA 3ZPYA 4Y20B 3AZYA 2ZGRA 3O5SA 4PCRA 1JXNA 4XTMA 2JDZA 1W6PB 1CPMA 5GLZA 2ZGMA 4XOGA 1UX6A 2DTWA 4YW3A 4FOWA 5GLVA 3AX4A 3A0KA 4Y1UA 1NXD1 3W59A 4ATFA 2A75A 1LU1A 1PZ8A 1QKQA 1LCLA 3CNAA 3POSA 4PBPA 4Q27A 3RMXA 1G9FA 2D3SA 4XJUA 3OBRA 3OY8B 1G9CA 3VKMA 1AX0A 3AJZA 1O4ZA 3V65A 2CWSA 2ZGOA 4M3CA 4DQAA 5CBLA 2NP0A 3N7KA 1LEDA 1LODA 1SACA 2P3KA 3PVOA 1V6LA 3RMYA 2VUAA 1GNHA 2CNAA 2AH2A 1GBGA 1AXKA 1YI7A 1N1VA 3AYDA 3KM5A 1AJOA 2LTNA 2YZ4A 2WSUA 2D43A 3NV3A 4M3CE 5H9PA 2GALA 2D6NA 4XJWA 1AX2A 1DHKB 3M1HA 4FP2A 3AK0A 1JHNA 2DWRA 2V5YA 3AYAA 4FQZA 3AP9A 1GYKA 4P9YA 4XHXA 3SLIA 1SLIA 4BM8A 1WD3A 2PHTA 5JOXA 5IK8A 4L8QA 3WZ1A 3PVEA 4XJZA 3WVJA 4ISRA 3NV2A 4UW6A 5CNAA 3WG3A 1AX1A 2PHWA 1IKPA 3N7JA 4XHBA 1GZWB 1Q56A 3WOGA 2A5ZA 4W65A 3MW2A 2PHFA 4PBOA 4RA0A 4TYSA 2DUQA 4XJ8A 5GZEA 3T2TA 4K20A 1W6OA 4XIOA 4AGRA 3D6EA 4FOYA 4CZSA 5EYYA 1MZ6A 3V0BA 4M3CF 2ARXA 5T5OA 1SBEA 3VKNA 5KXCA 1V00A 1SLCA 2E7TA 4BLIA 1JYIA 1XQNA 1Q8SA 5DZFA 2D6PA 4FPFA 1MS1A 1QOSA 2AYHA 4K21A 2DVBA 1CPNA 1MS4A 1DQ5A 2SLIA 1C1LA 4YM0A 5DXDA 1VALA 2D7FA 2GMPA 3PMEA 1DYPA 1H9PA 5IK7A 1LULA 3NV4A 2WKKA 1BXHA 2E6VA 1CONA 1RINA 1KDMA 1DYKA 3IN9A 4H55A 5JOYA 1GZ9A 4DFSA 4FPLA 1KJLA 1W6MB 4P9WA 4BPZA 1LOEA 1WLDA 3N36A 5KXEA 1YIFA 2A3YA 2A6VA 1MS8A 5F9TA 5AVAA 5LK5A 4BLJA 5DUUA 1ENSA 1Z0HA 4MYEA 1LOFA 2EAKA 2NMNA 3BTAA 3WG2A 1APNA 1WLCA 4XDQA 3UK9A 4FPGA 2WT1A 1LOCA 1LU2A 1VIWB 1S0BA 1X50A 1QDCA 2PELA 4JRAA 4XTPA 3AXEA 2LALA 2JKBA 4FPCA 2EIGA 2ZACA 1SBDA 1VAVA 2NMOA 1QGLA 3WDWA 4JCKA 1ONAA 1N1YA 2Z42A 1ENQA 1V6KA 2D44A 3WG1A 1CESA 1QOTA 2AGSA 4ZKTB 4ASMB 5GZFA 2H0BA 2WLQA 1WW5A 2DU1A 1MS0A 3L2YA 3M3CA 2D6LX 3O0WA 2EF6A 4PQ9A 1HDKA 1WLWA 2A6WA 4WVWA 1LEMA 3OBTA 4JC1A 1HQLA 4DRVA 3ZSLA 4ATEA 1LOAA 1V6JA 3IPVA 4C1XA 4P14A 4XXPA 1G9BA 2E53A 1R1ZA 4AVTA 1RIRA 2OUHA 4YFZA 2EXHA 3B01A 4YGCA 5T5PA 4YZ5A 2JECA 2R1DA 2ZGSA 2VW2A 5H9RA 4R9DA 2NZ9A 2YMZA 2ZAAA 2P2KA 2YV8A 1HQWA 2ZGTA 2ERFA 4FPOB 3V0AA 1A8DA 3AP7A 2ARBA 2WNEA 1H9WA 3ZYPA 2ENRA 1ENRA 1DLLA 3SITA 4R9CA 1W6QB 3AYEA 1W0OA 5H9SA 4XILA 2GNTA 4XMAA 3SISA 3D5OA 4Y24A 3OJBA 2DVGA 3RRDA 1AJKA 1UPSA 5EWSA 1LGNA 4YG3A 2ZHKA 4YFWA 2VH9A 3RSJA 1LHUA 3V64A 1KQRA 4BOWA 1N47A 2A7AA 1LENA 4Q1PA 3SNMA 2OUJA 1LHWA 4ISQA 1S1AA 4GA9A 1AXYA 2DURA 3OYWA 3FBYA 1SCRA 3I8TA 4CTEA 3H0OA 4YZ3A 3ASIA 3N7MA 2PHRA 1SCSA 2ZHNA 1CJPA 1FNZA 1UN1A 1LOFC 2ZHMA 2WT2A 3WHTA 1MZ5A 1DGLA 1GZCA 4YW1A 1DQ6A 1MVQA 4UW5A 4Y20A 4YM1A 4AWDA 1WW6A 4XBQA 3FFZA 1SFYA 3HMYA 3VKFC 5FREA 3HN1A 1OFSA 2NYYA 1WW7A 3R4SA 4FOVA 2GN7A 3ZSMA 4RL7A 5HCAA 5JMCA 1G86A 1GNZA 1J1TA 5GLTA 5GZCA 1WBFA 1IS3A 1QNWA 2W68A 4OZXA 1G8WA 1SLBA 2EXKA 3VV1A 2D3PA 3JUUA 1G9DA 3ZSJA 1S0GA 3MW3A 2JJ6A 3UJOA 3AJYA 3VUOA 3APBA 5EXOA 1AXZA 1IS6A 4GALA 4M3CB 1AF9A 1MACA 5T5LA 4AVVA 1LOBA 1Q8VA 5HCBA 5JDBA 4GXLA 1V6NA 1JOJA 2JE9A 3Q9OA 3D4KA 4R9AA 5DZGA 3T1LA 4AGVA 1SLLA 3GNEA 5GZGA 3R05A 3ZXEA 2R49A 4YW5A 2AUYA 1HKDA 1B09A 4U36A 1ULGA 2D6KA 3V0AB 3WNXA 5CA6A 3OY8A 4Y26A 2OW4A 2RHPA 1C1FA 2WT0A 5IUQA 1NLSA 2SBAA 2TEPA 2XB6C 1CR7A 2JD4A 2ZGPA 3AFKA 3QLQA 4XBNA 3POWA 4FPYA 3TB0A 4FOQA 1ULDA 3IMNA 5T55A 1JW6A 2A3XA 3POYA 5DG2A 2ZABA 5DUWA 1HLCA 2Q5TA 3WHUA 4YZ4A 5CB7A 2EALA 4WV8A 4WVVA 1UKGA 1BKZA 3WDYA 3AZWA 1CVNA 2VW1A 4ZXKA 1G7YA 2ZMNA 3MW4A 2GNBA 4AGGA 3AZZA 2P3JA 1LTEA 1WCSA 4FQ4A 3ZXLA 3UL2A 2VXRA 4WZFA 1RITA 1LGCA 1AZDA 1Z78A 1QDOA 2GN3A 2UURA 2UWAA 4Q1RA 5E8AA 2C9AA 3DUIA 1BYHA 4GKXA 3AP6A 3V0BB 2W08A 3N7LA 1UZZA 5CAZA 1C57A 2FMDA 1DBNA 4XZPA 1JYCA 1W6NB 2DVDA 2BQPA 3AXDA 2VW0A 3RS6A 2YY1A 4DRRA 5GLUA 2P3IA 5T54A 3AP5A 3MEPA 3DGTA 2HYKA 4TZDA 2R1BA 3BOPA 4XYXA 1N3OA 3OGGA 1S0CA 1S0EA 3FLTA 3WDUA 1GLHA 3GALA 2VY0A 3PVNA 4GWMA 1LHVA 2NN8A 1YXWA 2ZGNA 2A6XA 3ENRA 3VKOA
chains in the Genus database with same CATH superfamily
1W8WA 3IDEA 4IUGA 2KR2A 4L97A 2ZGLA 2P5BA 5CADA 2EXIA 4FPEA 1K45A 2RM22 4XFAA 1CN1A 4IE6A 5GLWA 3BALA 3O0XA 1PO21 2ZXQA 3UKNA 1V9U3 4QGMA 5JR2A 1ZZCA 1JYXA 5LEJA 1O6UA 5T52A 2JDYA 1MS9A 3HT1A 2VNOA 1DYOA 1UAIA 1DQ2A 4C91A 1QJY3 2D5HA 3MIFA 2Q8DA 3ATGA 4Q4V1 3HQXA 4CCJA 4CCKA 2P6CA 2WFF2 2VTFA 4RD7A 3NWKA 1AL0G 1QH7A 2JDMA 3BIWE 4BK4A 4QPGA 1DG6A 3KVAA 4BQWA 4LK7A 2RR12 5E16A 2Q30A 3PJYA 1VBD1 3WUDA 1C8NA 1YFYA 5F39A 1HX6A 5FFOC 4OHZA 5I0SA 4IEUA 5LBCA 3TEYA 1I6XA 4XQWA 4GULA 5FPXA 4LORA 1QJEA 1RUE2 3OYWB 1CIWA 2VZRA 1S55A 2IXJA 1MR5A 1R093 2P17A 2RMU3 4Q2FA 1OBNA 1EPZA 1CAUA 1YO8A 4IE0A 4KMQA 3KQRA 2WLPA 3BODA 4RGAA 4E27A 1QU0A 1KDKA 3ZVXA 2VUJA 5A33B 5A70A 5K0UA 1UIKA 1YCIA 3MUY1 4PF5A 2QQIA 2Y8KA 3C2UA 4FPHA 3C7HA 4L92A 3SQOA 4AOCA 4CCCA 4MGZE 4LJHA 4I0AA 1FXZA 2GNMA 1G6NA 4QPIB 4E4DX 3VKLA 2R6QA 4QX0A 1EPWA 4BMBA 1IS5A 2OT7A 1GNYA 5FO7B 3WDTA 1FOD3 2VZQA 3A4UA 4K8RB 1EAH2 3ZIXA 4CCMA 5B4NA 2W95A 1S0JA 1NCQB 1VMHA 3B02A 1VBC1 1DGRA 2Y6FA 4E2GA 4DUWA 1ULCA 3VD7A 1H8TB 4Q4Y1 5FZFA 1XE7A 3IZOA 5KHIA 2HWE2 5JI7A 4GWIA 5A1AA 1PO11 5E89A 1C3HA 1GV9A 1H8VA 1QF3A 2TBVA 4CDUC 4YZ1A 2YC4A 3S30A 2QZ2A 4LKEA 4DPNA 2L9LA 3NRUA 3B00A 3ZDSA 3I3MA 2FZ2A 4NROA 2XQRA 1PZ9A 4LXLA 3VBRC 2QQNA 3WP4A 3AMPA 3E1F1 3HWJA 1ND3B 1BQPA 3N9NA 4CP2A 3I2HA 5FOJB 4QX5A 4OYUA 3JD71 3C7OA 1SLTA 1HRV1 1ST8A 3P3NA 5FZHA 5JOZA 1NA1A 2XJUA 1OQDA 5JXGA 1QJY2 1N1TA 1XXNA 4DUVA 4XQ4A 4HVQA 2ZCWA 3RYKA 1D4VB 5T50A 2W3JA 3TYJA 5EQUA 4KWUA 5K0UC 4KQ7A 3T0DA 2HWB1 4MXWA 1JTZX 1SZBA 1ZBA2 1RUJ2 2WZR3 3ELNA 3B69A 2RS12 3VBHB 3MV01 1O59A 5FZCA 3WG4A 2VBBA 4Y5SA 2ZX1A 2PHUA 5DAVA 2HWF2 4A6SA 3JZVA 4K9SA 3SH5A 1VBA3 1F31A 2P4EA 2R061 5EZWA 3TN93 2BERA 1XNAA 4DINB 1J1LA 2XVGA 1U0AA 4SLIA 3CLPA 1NCQA 1TEIA 3HEIA 4RSUA 2JE7A 2PMWB 4QPGC 3WP5A 1W8HA 1Z7S3 1A8MA 2ET7A 3CF6E 4HBNA 3GDBA 4JDMA 2VVDA 4JKLA 4P9IA 3J26N 4UAPA 2RS13 4OUSA 3LB9A 2PLV2 3BCWA 1YFWA 3CJIB 1ZBE3 3G6JB 3KT1A 4ET7A 5FYZA 5DMYA 2WJSA 2YROA 3KCYA 1W2NA 2V4AA 4JTOA 5APAA 2DVAA 4XZUG 1XJAA 4IEOA 4N8MA 4UW3A 5AC91 1WZXA 4LBNA 3WNMA 1UL9A 2VNVA 2FDKA 1GMMA 4LR4A 4QX3A 2XLGA 1XSQA 1FAYA 2C1FA 1OOPB 1WD4A 4Y22A 3T08A 2QCSB 4M00A 3WNOA 4YARA 4D69A 5FCCA 3I2KA 3IDBB 3ZFEC 3FJSA 3KT4A 3VZLA 3POGA 1L7LA 2W1WA 1IS4A 4GWNA 5FPLA 4LULA 2VBDA 3WCRA 3AZXA 2A71A 1VLNA 1A3KA 1Q8OA 2VTXA 3BVCA 4Q0VA 5FJKA 2DU0A 1LOGA 1FYUA 2BNOA 2IFRA 4KBBA 4NHYA 3WW4A 1PMIA 3HVDA 4N53B 4QXBA 3DL3A 3T3YA 3ZFFB 5JWPA 1K12A 1PGL2 5LCWL 1DGRN 2QQWA 1POQA 3ZIWA 2ETEA 1KS5A 3HOBA 1EV11 1JBCA 1OA2A 2VOTA 3QD6A 4N7IA 5D8AC 2E7QA 5DG1A 4QX8A 4NRMA 4AW7A 5IFPA 3IMMA 3U07A 4HKWA 1AR73 1U5XA 2V73A 4I2OA 3NJZA 1ZBA3 3VHNA 3KD4A 3U1XA 5FMBA 1TMF3 1RUJ1 2HWD2 2JDKA 2VZTA 3AYCA 3ZPYA 5FTTC 3AZYA 3H3UA 4B7EA 4QB1A 4MLOA 4PCRA 3VBSC 2FCTA 1W6PB 1WMXA 5GLZA 4FOWA 5BNOB 5GLVA 3VD9A 3CJXA 3JB8A 1VB2A 3KB5A 5FZ8A 4AI1A 2XHKA 2VCAA 3A0KA 4LIVA 4COVA 1LU1A 2WZR1 3N9MA 4PBPA 1PIV2 3MO4A 3B5LB 5IVBA 1G9CA 1SPPA 3GBWA 1RUF3 4DQAA 3V65A 1UMHA 2CWSA 3C8XA 3N7KA 1AUYA 2J1RA 3UKVA 1H0BA 1GBGA 3EO6A 3K4AA 3MDPA 4FSJA 1AYN1 3AYDA 2E33A 4IXLA 2KXLA 1UOFA 4Q4W2 3PUAA 2VMEA 1JI6A 4XJWA 1Z7S1 1DHKB 1UNBA 3GJAA 4MUVA 3AYAA 3H1MA 5BNPA 2X5IC 4XUNA 1U5ZA 2XKPA 1OC1A 1SLIA 2EVXA 5BY5A 2YBKA 1F2NA 4V1PA 2B46X 1PGW1 4QQOA 3ZFGB 1NYWA 4Z2AA 2PQQA 1AX1A 3N9OA 1KD7A 2CGNA 2QQUA 3KCXA 5EP9A 4W65A 4CDWB 5L9VA 4IGPA 3URFA 4DOUA 1C8M1 1PGL1 4CDXC 3KQ4B 2QDNA 3HQRA 1ND3A 3LOBA 1W6OA 1CX1A 1S2BA 4FOYA 4AAXA 3THTA 5FYBA 3V0BA 1RVF1 5T5OA 3GHMA 4CDWA 5IHRA 2E7TA 3NL1A 2YB7A 4BLIA 1CAXA 4AEDC 1Q8SA 4I3PA 4FCAA 4CEWB 4Q0PA 2D6PA 2VQTA 4IV1B 4YVWA 1HB4A 2RS32 2IXHA 5FZ3A 4K21A 2VMCA 1MS4A 5DXDA 2FDJA 4I3GA 4JGYB 1RHI3 4HPKA 4AG4A 1CAXB 4P5HA 4MXWB 1JZ3A 4CCEA 5IK7A 3ZPOA 5DAPA 2DFBA 4S2HA 4QKBA 2D93A 5CFDC 3ZFEA 5FWJA 5A3TA 5F5IA 4WM7B 4LHNA 2DBNA 1DYKA 5FYYA 4QGLA 2ORZA 2OPWA 4HSLA 3ZM8A 2WYSA 2YU1A 3CHXA 3HPNA 4DFSA 5JXJA 5ACA3 3U0ZA 3D0JA 4P9WA 1UF2C 2JD9A 2B39A 2VVEA 2G9GA 4FFGA 2XH6A 3AKPA 1ODMA 4EWAA 2ZEZA 5AVAA 5LK5A 3ETQA 2WABA 2XBO1 5DUUA 1Z0HA 4RFRB 1OH4A 3HNBM 3WF4A 1APNA 2O8OA 4XAEA 5LA0A 2VL4A 1POV3 1LOCA 1LU2A 4YNIA 1TME1 2X5IA 2PELA 4JRAA 4HFSA 2BOIA 3GM8A 2VQ0A 1QQP2 5JXHA 2NMOA 1QGLA 1YJKA 4G3YC 1FT9A 4CDQB 1IGOA 4K6BA 1UY4A 2C0ZA 2D44A 5A3OA 3VBSA 1QOTA 5BNOA 4S2FA 4QDSA 4ZHNA 5GZFA 2O1QA 5F5AA 3S7IA 3ECQA 4B8EA 1WW5A 2DU1A 1XC6A 3T2PA 4PQ9A 2EF6A 2UY9A 1RUH1 2ZAHA 4BQXA 3JD72 4JC1A 1HQLA 5EIYB 3KHBA 4ATEA 5C71A 3IPVA 3T4VA 1G9BA 5FIXA 4YVWB 4AVTA 2N7GA 1K5MC 4NIHA 2W5FA 4Z82A 3B01A 5A3PA 3H7YA 2R1DA 4JHZA 2QZ3A 1B35C 3OF1A 2VW2A 4PIYA 3T0AA 1LRHA 2NZ9A 2ZAAA 4Y5TA 1FPN2 2VO5A 1HQWA 4QT6A 4CCLA 1FPN3 3OUJA 5FY8A 2GSYA 3AP7A 1O8PA 4HN1A 3ZR5A 2TNFA 1H9WA 1ZYBA 3WSOA 3HBKA 4RGGA 1DCSA 5C8CB 4MGSA 5FXZA 5H9SA 1GP4A 2E31A 2WA3A 2BDRA 4XMAA 1PGSA 4Y24A 3RFRA 1R081 2WBKA 4M4RA 1RMU3 1J3QA 4YFWA 2VD7A 1CZSA 1KQRA 2WS93 4BOWA 4AE2A 3B93A 1N47A 1COV3 4Q1PA 3WW2A 3LDRA 2RS31 4GA9A 4A7KA 4FFHA 5C6CA 3FBYA 4R4ZA 3LIGA 3O1UA 3FHAA 2BVVA 5FO9B 3P6BA 4WZCA 1NE4A 1LOFC 1PHMA 2WT2A 5A6QA 5FMCA 1WLTA 1DLCA 1UYXA 1DGLA 4JGZC 3SKVA 1DQ6A 2B5HA 2K46A 2VMIA 4UW5A 3I54A 4YM1A 2DCZA 2I74A 2GZWA 5LWBA 1WW6A 4QDQA 4XC9A 4XBQA 2F6BA 4IGQA 1OFSA 3R4SA 1XPWA 2GN7A 1SEFA 2VMHA 1HRI2 4DXTA 2K2SA 1V0AA 3I3EA 2FD8A 1OHFA 2RDSA 4MGQA 1WA6X 2YUEA 1WA4A 1WBFA 1IS3A 3FFQA 4OZXA 2EXKA 1OH3A 1TNFA 4LE3A 1G9DA 1BMV1 3MW3A 1Z7S2 3AJYA 3OD0A 4LT5A 3APBA 1NT0A 4JX0A 2R041 4GALA 4MXVA 3VL9A 1AR61 5CKQA 3E6DA 4XFCA 5DDJ3 4EN0A 1MACA 1MZFA 5T5LA 4AVVA 1Q8VA 5HCBA 5JDBA 5FMDA 4GXLA 3U75A 4WVMB 4AGVA 2CHHA 3Q9OA 3J7HA 1Y9GA 1IHMA 4M4PA 1W05A 4MH0E 3NAPC 3VLBB 4DMIA 3RZKA 1RGSA 3PUSA 2WDBA 5F5CA 3OB8A 4CEYC 1W9WA 1OMIA 3ST7A 2YU2A 1QJZA 5FZ0A 5F3CA 2ZX2A 1U5YA 4EZ4A 4W50A 4J1WA 2AEZA 2NQYA 1C1FA 3OGRA 2XB6C 5FV3A 4AHYA 4N43A 2ZGPA 4XBNA 3AFKA 2QFEA 5A7NA 4AF9A 3POWA 2R32A 3DXTA 3BGAA 1ULDA 2XJPA 5T55A 1JW6A 2A3XA 3O1VA 5DG2A 1VP6A 2W47A 1ZRDA 2VOXA 5C33A 1HB1A 4Q5OA 3DXUA 2EALA 1YNAA 2VUDA 1UKGA 4R52A 4WV8A 3AZWA 4WVVA 5DQ0A 5BPXA 3R6SA 3ZYGA 5AC92 5C4WB 1EYBA 2VW1A 4ZXKA 2VZVA 1W28A 5C3PA 4KWKA 2ZMNA 3ITQA 2BU9A 3SHRA 4AGGA 1YIPA 4ZU7A 2DCYA 5KHJA 3K2OA 4FQ4A 3DEMA 5C9AA 4XUTA 5I93A 1FMD1 4HLTA 2UURA 1AL22 1QDOA 3T4HB 4QDRA 2OKXA 4N53A 3DUIA 3FHQA 1REDA 5FZ1A 3KV6A 1JYNA 2BFUS 5IVFA 1C57A 2E9QA 1D4M1 4XZPA 1JYCA 1POV1 4OHXA 2BQPA 4CDQA 4S2GA 2HWF1 4GZ9A 4A45A 4B1MA 1PVXA 2GC1A 3MEPA 2B9VA 3OCPA 4Q4W3 4RR3A 2HWC1 3OGGA 1S0CA 2HWB2 4ZZ8A 3ENRA 2A6XA 4EWEA 5F6KA 5CFCB 5KXBA 3B7MA 3I4IA 1BHGA 2RS11 3M3EA 4META 4M0HA 2E51A 3WCSA 5CYYA 5A3WA 2FDGA 4NRQA 4UYBA 3SMHA 2GDFA 1DQ1A 2XUMA 3K4DA 4XQDA 1OLQA 3KWVA 4PDWA 3TNQA 5BNNB 1IKQA 5C8CC 4Q4V2 1QMJA 2P3YA 5J3UA 2JB4A 2BTVC 3H8XA 2XHNA 1V6MA 2JICA 2PQSA 1XNCA 2XBO3 1RUI1 2ZZJA 3POBA 3EBRA 3C7EA 2EA7A 3RG0A 5IVJA 1MS5A 1W99A 1OXCA 4P9JA 3OGVA 3B94A 1GICA 4AFBA 3VL8A 1YFUA 1PMJX 1X82A 2GU9A 3UGFA 2UWBA 2KM2A 5LBEA 4OI2A 1JUIA 2VVFA 1SPPB 1XB9A 4AFDA 3S5AA 1ASJ3 3H3ZA 3R0RA 3AMQA 4MOAA 3LSDA 3FLPA 1W9TA 3IT8A 1R083 4XEZA 4MSVA 3W58A 4KL1A 4BQ2A 4OI4A 4CRQA 2BP6A 1N3PA 1NA1B 1YRZA 1O3TA 2ZEYA 3P3PA 3AP4A 2HBTA 1DP0A 4RGKA 4CDQC 3SCGA 1ZBE2 3LZZA 3OGSA 4IQPA 1KRIA 2VPVA 1E5IA 2X10A 4YGEA 1F4AA 1L7QA 3WW1A 4ARYA 1JZ8A 4D6SA 4CP9B 1LHOA 4QX2A 4FAGA 1W9FA 3M3OA 4AVAA 1UU4A 1ULFA 1ULPA 2HEYF 4DY3A 1WMEA 5CFCA 3J8F2 4LBKA 3VB9A 3BPSA 2J1UA 2CV6A 3OPTA 1REEA 2QJVA 3ZO0B 1MQTA 3ZDVA 1WWYA 3FUOA 3GZTB 2VQUA 1TZOA 2C26A 3MIDA 1AR83 2RM23 3THDA 1NAEA 4KI5M 1GSLA 5GZDA 4DS0A 2VULA 4RHV3 1SFPA 2FHRA 2QBXA 5EV7A 1OQ1A 5J1XA 2H6BA 2OVUA 2XJVA 4X8NA 5JMOA 2YC2A 1UY1A 1WCUA 2V5DA 4LTAA 5FYTA 2G4IA 5IAVA 1WMFA 5ACA1 2GNDA 1BZWA 1ULOA 4HG6B 4HVOA 3KF5A 2B45X 3B9CA 4A3XA 1W6PA 3VZOA 1JYTA 1UU5A 1AVBA 4RS5B 4ONUA 3M2MA 2Q1ZB 4AI2A 4W6WA 3F95A 1C28A 1K3IA 3NMBA 1O7FA 4M01A 4NHLA 5L7OA 3POEA 1BK0A 3J7LA 3CO2A 3WP3A 1RUC1 1AYN2 3O0VA 4GB32 5A7PA 2BOJA 5ABJA 1G9AA 3KMHA 3Q8AA 1JHJA 5E88A 3S0MA 4I30A 4TXWA 4OQ9A 2LM3A 1POV0 4A42A 1VBB3 1I5ZA 4HZFA 4H7MA 1QJX2 2XONA 3ZXGA 1PIV1 4J1XA 3HQUA 4AAPA 4K8FA 5A3UA 1RUJ3 2WZR2 4AVSA 3M4FA 3ZYFA 2XJQA 4XBLA 5A32B 3BUCA 5KXDA 4NO4A 5JOWA 5LRSA 1URXA 3IPVB 3ILRA 1OA4A 1RUH3 1DQ0A 1NUKA 1ZRCA 1W6MA 2CTVA 1NA1C 4IEXA 3VDDB 3O14A 4BA6A 1X9PA 2EAAA 1N1SA 3BKZA 3PLQA 4XABA 4XACA 1OSGA 5L73A 4IE4A 5ACA2 1O5LA 1MQTC 2R0FA 5LRRA 4WVMA 5FQ0A 3VHRA 1C4RA 1VE0A 1WGPA 4QQLA 1PNGA 1GWLA 3N9LA 4XDPA 5DAQA 4X6RB 5FZIA 4AHXA 1PX4A 4UXAA 2AREA 3TEZA 4AI9A 3LE0A 4YG6A 2QQMA 4IETA 3N35A 5K9YA 1S4CA 3AL6A 1GR3A 5KR7A 4B4RA 1CAVB 5JPMB 4LBLA 4P9LA 1S0DA 3MIBA 1XYOA 1NQDA 1VBE2 5FYHA 3FUQA 4E2QA 2BRTA 1AHSA 4Y1ZA 4ZXEA 4XJAA 4FPJA 2YXSA 5CVRA 1M4WA 5BNOC 4DUXA 2GP3A 1SQ4A 3WNPA 2CL2A 3J8F1 1GOGA 2IFWA 4JQRA 4R9BA 2X8KA 4YGDA 5SV8A 4AVBA 3VBSB 5C7GA 5IFTA 1UZ0A 2R7EB 1EUTA 1DF0A 2W52A 2ZS6B 2HWB3 2UY8A 5FYCA 3ZFFA 4AZZA 3IIAA 4C1WA 2GMMA 4BZ4A 3BOWA 3IKWA 2WSVA 1BLZA 1QY4A 1UMZA 4Z1VA 3BI3A 1D0HA 1ZX5A 1H1MA 4Y4YA 1W8OA 3CL1A 2DV9A 1UIJA 1BK1A 4LO7A 4XXAA 3USSA 2A70A 5FY9A 5CFCC 2CYFA 5JSPA 4CUCA 5LZ6A 1YEWA 4MADA 1XNKA 4J25A 4BQ3A 1OD5A 5HI0A 3K4ZA 1QJY1 2ZX4A 3S7EA 1ZM1A 2IXLA 2JIJA 2VE1A 4CP0A 4QHBA 3ZXDA 4COWA 4JGYA 5F2SA 3LCPA 1W9SA 2QTWB 2J1VA 4LBQD 5ANQA 2K0GA 1ZBE1 1RHI1 3BU0A 1ND2C 1NY71 2C24A 1QXPA 3O5SA 3ACFA 5LY2A 5I0UA 1CPMA 4LHSA 3I49A 5FZ6A 3HT2A 4HPKB 1BEV1 4Q29A 4YVSC 3MZHA 4JHTA 1PZ8A 4Q27A 3POSA 2ID4A 1JZ2A 3RMXA 1CZTA 5C4WC 3P5BA 2XJSA 4W8JA 4JGZA 2LROA 3ZYBA 1AYM3 2NP0A 3RI8A 4M3CA 2ZTNA 3E6BA 1LODA 2WQ8A 3MICA 4GMP3 4SBVA 1V6LA 4XFIA 5EFUA 4ES9A 1TME3 4HSJA 4QPGB 1JZ6A 1AXKA 1RUOA 1N1VA 1H6XA 1NQJA 3KZ4C 4URAA 2WSUA 3IAPA 4XF9A 2WO7A 1HRV3 4XFFA 3OBZA 2D6NA 4RFT0 4AFCA 3M1HA 4K7JA 5CEHA 3UNPA 1W2UA 4AFMA 3SXWA 1IZ3A 1QJU2 2WNUA 1GYKA 4P9YA 5FLJA 3SLIA 2FQPA 2JDPA 4HETA 3NJXA 1WD3A 1EUUA 5FZKA 4F7ZA 5IK8A 2FDIA 4G9SB 4LA2A 5J09A 5K7PA 4ISRA 5K4LA 4UW6A 3MHZA 2VM9A 3NAPB 4NJ4A 2PHWA 3N7JA 2DCKA 3GJBA 3PIJA 4XHBA 3H7JA 4XVHA 3GCXA 3WOGA 1EP0A 4XURA 4UFMA 4TTGA 1ASJ1 1MEC1 2C4XA 3HJRA 3MW2A 4PBOA 4XF3A 3WY6A 4TYSA 2YBSA 1ZZ7A 4YW6A 1NOVA 2W92A 4V2VA 4AGRA 1UXZA 3Q8BA 3GBGA 4AHWA 1K42A 3IIIA 3HN3A 1Y43B 3MV11 1V00A 4Q4V3 1U12A 1XQNA 2J1AA 4FPFA 4B29A 4ZS3A 1QOSA 1Q5OA 2PLV1 2RR11 1CPNA 1UU6A 4YM0A 1C1LA 1V9U2 1D4M3 3CEWA 2CDOA 3UGGA 3PMEA 4MGYE 4EN8B 1LAJA 5FK8A 2HLEA 2XKOA 4D6QA 4XF4A 1CONA 2OQ7A 3CQOA 1GZ9A 2AEYA 4KG0A 4JGZB 4LO4B 4FPLA 1KJLA 1A6CA 1H8TC 1S2EA 4X6QB 3N4MA 5A7SA 3L2HA 4XDOA 3TNPB 1WKYA 3RNSA 2VZUA 5KXEA 1F4HA 2NPIA 3FHIB 4IEQA 2ZEWA 1MS8A 4ASKA 4DXSA 4E4SA 1GWMA 2DCTA 4BLJA 3I3QA 5FDBA 2HH9A 1ENSA 2Y6LA 4KWLA 3F2ZA 3WG2A 1W8ZA 4OUMA 1I5PA 2FBEA 3CIHA 3GYDA 2D40A 5LA9A 5SV5A 2RDQA 2WT1A 2VMGA 3ZN4A 4QPIC 1HRV2 1W2TA 5A7OA 1X8MA 1QDCA 5AFEA 4XTPA 3H42B 2VUCA 3AXEA 4MGIE 2JKBA 1VAKA 1OT5A 1H4HA 4NUBA 4QWNA 2VOWA 2YPDA 1XSRA 1EAH3 4QKNA 2E26A 3MFAA 1Q3EA 3VD5A 4JCKA 4CSWA 5CZKA 4TSVA 1ZBA1 1WCQA 5BNPB 3VDDA 1HRI1 4ZKTB 4V2WA 4ASMB 3RZHA 3MYXA 1T6GC 2H0BA 3L2YA 1CAWB 1H1AA 3M3CA 4E8CA 3O1TA 1LEMA 3POJA 1B35B 2LS6A 3RVHA 3WF0A 2VZOA 1LOAA 3ZSLA 4C1XA 1L3JA 2VCCA 2BJSA 2RMU1 5FP9A 2JG9A 1UX7A 4Q0QA 3VDAA 2WFF3 2WYFA 4M0NA 2IVJA 2ZGSA 5H9RA 3U11A 4AL9A 2WNVB 4Y33A 3J7NA 2YMZA 3VD3A 2ERFA 3HNYM 1IPKA 1A8DA 5HV4A 4HN0A 5LEKA 2Y33A 2WNEA 1J83A 3LWCA 1DLLA 3SITA 2LW8A 3AYEA 5A6XA 4LKDA 2VG9A 2WNUC 3VZNA 4XILA 2GNTA 1R082 2BWCA 3D5OA 1HB3A 5CU1A 5DN2A 5FZ4A 5I91A 1AJKA 4NVPA 4QHZA 5EWSA 1RVF2 4EQVA 2Q8OA 2ZHKA 4XPVA 5JSRA 1RMU2 1XRUA 3RSJA 2A73B 3V64A 1VB4A 3ALQA 2JG8A 1LENA 4A4AA 3DYPA 2CGOA 3SNMA 1LHWA 3QH6A 4K40A 2DURA 4E2SA 5AVPA 5FBJA 4MO3M 1XBFA 2Q4SA 2R073 3EMRA 1JMUB 4CTEA 2YPJA 1HQNA 5F7UA 3ASIA 2R063 4JRLA 1OLRA 3WHTA 1E5HA 4RS5C 4AEMA 4LIUA 5L36A 2WS92 3ZMNA 4Y20A 5A6YA 1PVC1 3WQ7A 4ARXA 5T3NA 5FZ7A 5E1RA 2D5FA 4GQ7A 4INDA 1X7NA 1WW7A 4O9EA 4AEDA 4KGQA 1SDWA 1H2LA 1JU4A 1GNZA 3ETPA 3UKTA 3VGIA 3W5MA 1DDLA 4OHYA 1QNWA 2W68A 4NAMA 3VV1A 3PIGA 4Q4W1 3UETA 2D3PA 2FCVA 4ZS2A 1O91A 4AEDB 3ZSJA 2X05A 3CKHA 3HAGA 5F37A 2WNOA 5J7MA 4QU2A 2RS53 5I0RA 3HD8B 4GMP0 1AF9A 4QPYA 3JQWA 4DXRA 4BCUA 2JDHA 3GBFA 5EHDA 2XQXA 4NIIA 3ON7A 3T1LA 1CJDA 1SLLA 4E8DA 1OPOA 4A6OA 4DIQA 4D7YA 2QQPA 3RZLA 1CAUB 2RR13 2D97A 2R49A 4QXHA 4BQYA 2WNUB 4YW5A 4KBZA 1HKDA 1OF3A 1AR81 2MHFA 3VBHA 1O8SA 2JB8A 4IERA 5C3QA 3WNXA 2GH2A 4Y26A 2OW4A 4FI9A 2RHPA 1NLSA 2TEPA 3PURA 1O4TA 3DKWA 4KU8A 2JD4A 3QLQA 2WNVC 2QQVA 4FPYA 2FDFA 2HWD1 4FOQA 5BNNA 4XUOA 3IMNA 4GIQA 1CX4A 2Y34A 5FPZA 4LE4A 5FZ9A 2WINB 3CBNA 3KGLA 5CB7A 1RUD2 3AKRA 5J98B 1BKZA 1D4M2 3CU7A 3OBAA 1NE6A 1CVNA 3I2DA 2XJTA 3BB6A 2VNGA 3LOIA 4FTEA 4FFFA 2IXCA 2RJKA 1WCKA 3MW4A 2VJXA 4H7LA 3OEAA 2VMFA 1QJU1 1LTEA 1WCSA 3AFGA 3UL2A 2VXRA 4QM9A 1RUG3 3NJYA 1RITA 3WINE 5BNPC 5IYYA 5JCTA 4BIOA 3N9PA 1Z78A 1PIV3 1BYHA 2CDPA 4O9GA 2VXJA 1W90A 5FKCA 4FXKB 2OYZA 2EIDA 5CAZA 2CU5A 2DVDA 3AXDA 3NSTA 3WW3A 1ZZBA 3FMGA 3JXSA 3PU8A 1NKGA 3AP5A 1LNSA 4LEJA 2HYKA 2QQKA 3AKSA 4ZU5A 4N7UA 1HXS1 3WNKA 3BOPA 4MG2A 1F5JA 1YQCA 4IE7A 3CZUA 3JB4C 3I97A 4S2DA 3FLTA 1GLHA 3GALA 3PVNA 1HB2A 2NN8A 4N53C 4PF1A 2WR9A 4CXXA 5C5TA 2VZSA 4IV3A 4W4ZA 1ZZ8A 2WQZC 3VKOA 3JU9A 4LBOA 5A3MA 1COV1 3I2FA 1PGW2 1X8EA 4XUQA 5FYMA 3RWNA 3RZGA 1VAMA 1NY72 3LSEA 1H30A 4HVRA 5C8WA 2TUNA 2Z69A 3VDBA 1S0IA 4OULA 1X36A 1C8M3 3A22A 1W06A 2C9KA 2GMEA 1UD1A 1AR93 2XXZA 3I3DA 3NNJA 3FE5A 1RJ8A 4UW4A 1PM7A 5FUPA 4ES8A 2D6MA 2F17A 5FRAA 1IOAA 5F3GA 1SBFA 1OOPC 1W6QA 3ZMOA 4CXYA 4NPMA 3KV5A 5F6LB 3MF9A 5GJ6A 4YM3A 2R042 3LIHA 1KS4A 5DZEA 2EICA 5AFBA 3UJQA 2RJ2A 4Y4RA 3LAGA 2XPJA 4CYDA 4UBHA 1YQ2A 3ILNA 2J1EA 1ZNPA 1AR92 3INAA 2HWF3 2YG0A 2OZ6A 2WWSA 3WUCA 2Y64A 1YQ8A 4UI9L 1FV2A 1NCRA 2VU9A 4OI0A 1C5IA 2WL1A 2XVKA 1TMF2 1XNTA 5DUXA 3W20A 2VTXJ 2A3WA 3R4UA 4L2NA 4Y22B 1COV2 1RJ7A 1VPHA 4XJ9A 4ZZ5A 2BGPA 2WRAA 2DVFA 4LHKA 4Z92B 2E7AA 3VBHC 5FPAA 3SH3A 2H6CA 3U14A 3ZYJB 5I0TA 2ORXA 2CAVA 1Y9QA 3Q8CA 2VBPA 2YGMA 2FMYA 3JCIA 2JDAA 3NAPA 2ES3A 4OLLA 5A7QA 2Q8CA 4DEVA 5K0UB 4AYUA 1GZWA 1ZREA 2WNVA 4MVTA 3E5XA 1W8FA 2R16A 1RUG1 1W6NA 1BVP1 2HWC2 2YFZA 2WZEA 1AR71 1P8JA 3MI8A 4YG0A 3NVCA 4IL7A 4D0QA 5LBBA 3I59B 3K48A 5IK5A 1HV1A 4JDNA 3Q8FA 1KXGA 4TN7A 4HK8A 3MBWA 2FDHA 4YVSB 2BWAA 1VBC3 3T2QA 4EYUA 1ND3C 1AR82 4CCNA 2OZJA 2IUWA 3USUA 5L9RA 2WAAA 1JZ5A 2DTYA 1CQ9A 1LGBA 3QBQA 4LBMA 4P9XA 4QGNA 5FPVA 5FP7A 1ND2B 1W03A 4CDUB 5JIUA 5L7OB 3O1RA 5IK4A 3PHMA 1QNYA 3WNNA 4AEJA 1VBB2 1W04A 3E5QA 5D21A 1WUVA 3K3OA 4H3WA 4JZRA 5FK7A 4A7ZA 5C3SA 2ADEA 4BE3A 1F9KA 3LQCA 1E5RA 5GALA 3M3QA 4EJRA 1SLAA 2ZGKA 4D6RA 4GB33 1RUC2 3QH7A 3ZXFA 4DZGA 1NCRB 1Y7BA 4JV4A 5D8AA 3SEEA 3WXPA 1JYWA 4BDVB 1YJLA 2JENA 2IXIA 3ZSKA 2WUHA 2BBVA 1YYNA 1FNYA 3AZVA 3H50A 4OHWA 4C8DA 4AI8A 4NAOA 3FC0A 3NNFA 1NG0A 4HMZA 1QIQA 4EE2A 3ZXAC 3AKQA 5F1RA 4PI0A 5BUVA 3BU7A 4PJYA 4P5YA 2VGDA 3OD4A 5FLIA 5JVVA 3U4SA 4IE5A 1VJ2A 2RM21 4LBJA 4UOJA 3WV6A 4HT1T 1Q8PA 1US2A 1UZWA 1VBA1 1BVVA 2RV9A 1SG3A 4Y3OA 2ZJCA 1LESA 1Y4WA 1XYNA 4YW7A 4EWDA 1F5FA 1VRH3 3K77A 1T2XA 5FZGA 3T0BA 4YW4A 5L9BA 2VZ3A 2ZGUA 2YC0A 1VRH2 2WQ4A 4GAZA 1F15A 4PLNA 2I45A 5CG9A 3LPFA 5GKAC 1VR3A 3ZR6A 5M0TA 5C70A 3BN6A 5C8CA 2ZA9A 3AM2A 4QPIA 4X8PA 1DZRA 1I3HA 2J42A 4BH9A 4A7YA 2UU8A 1W8UA 1VBC2 3OG2A 1QXJA 2ZMLA 3P1IA 1MQTB 3O1SA 3D8CA 3RZZA 3S57A 3ES1A 2QUOA 4OMCA 3PUIA 3VDDC 4B3NA 3H8UA 5FZDA 4FPKA 2PXJA 3MPPG 5EPAA 3CDZB 1D7PM 3M70A 3LD8A 4LLFA 5BNQA 2CAUA 2HWC3 3NV1A 2A6YA 2D3RA 3SCHA 3WDVA 1OPMA 4BWOA 1HV0A 5F3EA 2CY6A 2RS52 3POFA 2P37A 1CAWA 2P34A 4L99A 5F5QA 4WBBA 4NWWA 4CDUA 1UY0A 1NLRA 4Y1XA 1OVSA 4CCOA 1NXMA 2DDUA 3ILFA 2IVIB 1TG7A 2R0HA 4PLOA 5FR3A 2QE3A 1F35A 2KA3A 4ZPIA 2MNGA 5A7WB 4XCBA 2JG8B 3KS7A 4FP3A 2VNRA 2EIEA 3T1MA 4AQ6A 3T2OA 1MVEA 2UWCA 4BXFA 3W5NA 4CEWA 4MZUA 2PAMA 1LHNA 1LR5A 1WMDA 4ZU4A 1RUI3 2YGLA 1BJQA 1LECA 2I07B 5JAXA 2AC1A 3IM0A 5GM0A 3ACGA 4LKFA 1N3QA 1T6BX 1A78A 2C5DA 4YZ2A 4WM7C 3PMSA 5CFDA 5C9AC 2O8QA 4C90A 2ZBJA 1HIXA 3H1YA 4Y20B 5G04L 3D82A 4IEVA 3AKTA 2ZGRA 2Q8EA 3J7MA 4A3ZA 4Q4Y3 1W8NA 4RHV1 4XOGA 4YW3A 1UX6A 2DTWA 1TME2 2YYOA 3VDCA 3AC0A 5FZOA 4EV0A 2GC3A 3AX4A 5FY1A 1NXD1 5A1FA 4ATFA 2A75A 4UF0A 3CNAA 4XJUA 3OBRA 3OY8B 4AR2A 4QQHA 3VKMA 4WM8A 1AX0A 3AJZA 3PVBB 1O4ZA 1R1A2 5CBLA 3PTRB 3E5UA 1RUF1 2R072 3ES4A 3RMYA 2P3KA 3RZJA 2VUAA 1GNHA 1JS9A 1UZVA 2AH2A 2CNAA 4ORFA 5FXXA 3KM5A 1AJOA 2CGPA 2YZ4A 2D43A 3LKJA 4EZHA 3ZFGC 4YVSA 4DNYA 4LOSA 1QWRA 2OS2A 3AK0A 1JHNA 2DWRA 2V5YA 4MHUA 4QXKA 5JR7B 4XHXA 1UQXA 3LDKA 4BM8A 4XFGA 2X5IB 3FN9A 4FO9A 3ROUA 1IG0A 1WCDJ 5JOXA 4L8QA 2BNMA 3PVEA 3WVJA 2Y6GA 1AL21 1YQ5A 1I9RA 5K8SA 3O7OA 2XLFA 3WG3A 3ZN6B 1IKPA 4QX1A 1GZWB 1Q56A 2FCUA 1J3PA 4DEQA 1ZZ6A 2Q0AA 4XF0A 3M3IA 4XJ8A 3KGZA 1UW8A 5GZEA 4AK3A 1V9U1 5JPNB 4K20A 4XIOA 4LITA 5FY7A 4CUGA 4CZSA 1VMFA 4M3CF 2ARXA 3FBMA 1SBEA 2X53S 4OVEA 3VKNA 4FTSA 2JEMA 1NZCA 2O14A 3JQXA 4CP1A 5DZFA 2RS51 1MS1A 3UT0A 3IWZA 3NNLA 2DVBA 1H6YA 1DQ5A 1OA3A 1GUIA 3KLSA 4NN0A 1VALA 4UFLA 3VZKA 2PAEA 3VBUC 5FOBB 2JXAA 4ZY9A 5BNNC 1DYPA 1H9PA 2HYXA 1W39A 3MIEA 4AI0A 4OFGA 1OI6A 3NV4A 1HJGA 2WKKA 2ZX3A 4AVCA 2E6VA 4H55A 4CUBA 3UV9A 1YHFA 4QXCA 1LOEA 1W2OA 1WLDA 3RDIA 3RWKX 3DYMA 2A6VA 5D8AB 2XMLA 4PDWB 5F9TA 2VZ1A 1DGWX 2Q1FA 3GGLA 5F32A 1LOFA 2EAKA 4ZONA 3ZFFC 1RC6A 3O1PA 3WQ1A 1WLCA 4XDQA 4FPGA 4NIAA 3J9SA 3A21A 1VIWB 1UYYA 2VR4A 1ZRRA 3THPA 3ZYIB 2LALA 1JYVA 5I8SA 4QB6A 4B7KA 4L9BA 2W2IA 3TOJA 4N90A 1YLLA 3MIHA 3O1OA 1N1YA 3Q8EA 2PLV3 3ACLA 3VD4A 1CESA 1OUSA 5LA1A 2WLQA 1W3XA 3OOXA 3O0WA 4CVUA 1WLWA 2GH8A 1GQHA 3ME2A 4DRVA 2BW8A 4FXGB 5ABJC 3LDBA 4E9KA 2ZX0A 4XXPA 2WO2A 2Y26A 5A7WA 4OCTA 1RIRA 2OUHA 4YZ5A 2ARAA 2JECA 4CDXA 5LBFA 2OIIA 1RUI2 1FMD3 1VBB1 3BTZA 4NE9A 4QQPA 1DU3D 1E57A 3WF3A 5LA2A 4ASLA 2OPKA 4CP9A 3MGUA 1JODA 3NNMA 1OOPA 3CMGA 2WO1A 3MLLA 1EY2A 3ZYPA 3RYPA 2ENRA 1ENRA 4HXCA 1AYN3 1PK6A 4MX3A 4CEYB 1SDDB 1W0OA 3IDAA 2BYVE 3IDCB 3TEWA 3SISA 4MHRA 4MV2A 4FBFA 1XU2A 1XE0A 1UPSA 4YG3A 3G7DA 1D0GA 2VH9A 3A23A 1BBT3 4EN6B 1LHUA 4XW3A 3OGJA 3AMNA 4O61A 1SFNA 3WNLA 3OYWA 3ZKUA 1SCRA 2WZ8A 3S5QA 1VBE1 4HK9A 3H8RA 3DECA 2YFUA 2W94A 1C5HA 5G05L 1GOFA 3WD5A 4A41A 1VBD2 2PHRA 1SCSA 5C5UA 2ZHNA 4F3JA 1CJPA 1UN1A 1FNZA 1JOPA 3DV8A 5KC6A 1SMVA 3VBFA 3E6CC 4RYDA 4CU8A 5J37A 2QQJA 2WN2A 1QQP3 3EYPA 1MVQA 4XCAA 1O3QA 1SFYA 3VKFC 5FREA 2J7MA 3JBG1 1UOBA 1UPIA 2NYYA 3ZSMA 5JMCA 2HJIA 1R1A1 1IPJA 4GMP1 1AYM2 5GLTA 3RJRA 4RR3C 5FY5A 5FY0A 5I8YA 1G8WA 1SLBA 4XETA 3GCWA 2NLRA 5JZGB 3AL5A 1NCQC 2E32A 4J6GA 2DBIA 2JJ6A 4HONA 3LFIA 5HV0A 1GP6A 4KGGA 2BVBA 4PIXA 5KHKA 3WF2A 1AXZA 4CXWA 4M3CB 4YYOA 2WC2A 3QOPA 1H8TA 1LOBA 1QXRA 2VMDA 2JE9A 4R9AA 3D4KA 4AHZA 4D7SA 3VBOC 1GP5A 2XOMA 4O65A 3GNEA 2IC1A 4COYA 3R05A 3ZXEA 4LPLA 1HJFA 1YWKA 2Y6HA 1B09A 2HWE1 1ULGA 2RE9A 1IQDC 3K51A 5CA6A 3VHPA 3SEPA 1XNBA 1GWKA 4QKFA 3RPQA 2RDNA 2WT0A 4N9IA 5IUQA 3NKGA 4DY5A 4JDOA 1CR7A 5FUNA 1RTVA 1UKRA 1AR62 2XBO2 4E4ZA 3R4DB 2QKDA 4D7TA 3POYA 2ZABA 2MEV2 3PTYA 3LA2A 5DUWA 1HLCA 2PHDA 3PUHA 1K5MB 3ZX7A 4AI3A 5I0DA 5IVVA 1F8VA 3EQEA 4YVWC 2DCJA 3WDYA 2GC2A 2BPA2 3EXUA 4O7XA 3RJ2X 4TLGA 3PL0A 5JZGC 1MZEA 2Y6JA 3TN91 2Y60A 2GNBA 1AR72 4L0PA 1RUE3 3AZZA 2P3JA 5KC5A 1OURA 1IG3A 1RUG2 3AVRA 5A1LA 2ZOEB 2C6SA 4XUPA 1W9YA 2MEV1 4PIZA 1AZDA 2GN3A 2UWAA 4EN7B 5E8AA 3THCA 4Q0SA 4GKXA 5ERLA 3UESA 5FPBA 3AP6A 3N7LA 3OUHA 2FMDA 1DBNA 1W6NB 2VQAA 3RGBA 4BQ5A 3RS6A 4HKOA 4A2UA 1VRBA 5GLUA 5T54A 3AMHA 3DGTA 1OLMA 1RUNA 2PFWA 1VRH1 1N3OA 4XYXA 5FKBA 5FZMA 4WVZA 1S0EA 3NO8A 2W0XA 3WDUA 4N9HA 2W1SA 3POIA 4XAAA 5FZOB 1YXWA 1R1A3 2XG3A 1HN0A 4RQPA 1FATA 2H0VA 3WDXA 5J48A 2RS33 1WW4A 1DZQA 2CSGA 4AEKA 1MEC3 1UXXX 4CCDA 3VBFC 1GOHA 3A0NA 1XU1A 3PUQA 1D2SA 4P02B 5CFDB 1V6OA 2JDNA 2Z79A 4HKLA 4UFIA 4NRPA 4R4XA 1UY2A 4HOOA 1JN2P 2UYAA 4JGYC 4FVVA 4CU9A 4IEYA 1KJRA 1STMA 2BFUL 4CE8A 5HCFA 1QJX1 2XUEA 4Q8KA 4P08A 4AQTA 3CZJA 1TQ5A 4CEYA 2XWJB 4IV1C 4QM8A 4IV3C 5JXIA 1NLQA 3IAQA 4GD4A 4CEWC 1IQAA 2HEVF 3N3HA 4Z8BA 3TEXA 1RHI2 4YM2A 1YI9A 3OUIA 5FYSA 4N43C 4YW2A 2V72A 4IEPA 1PZ7A 1WBLA 4OHVA 4LOTA 2AR6A 5HPOA 5KBFA 2XDVA 4U2AA 5FYUA 1RUH2 1LB2A 2DUOA 4CDXB 4LBQA 4XIKA 1UY3A 4Y5Z0 3W21A 4BMEA 4YLZA 4YWAA 1X33A 3HR9A 1PO13 2J22A 3DPRA 5FLHA 4AXOA 2PHXA 1ULEA 4CDWC 5ABJB 2B9UA 5C4WA 2RJLA 1KFXL 5A80A 4RN5A 3JBG2 3VBOA 2DYCA 4MGTA 1YFXA 1QQP1 2VC9A 3OTFA 4UFJA 3SC7X 4F83A 1DFQA 4TWTA 5L19A 3KV9A 3U4XA 4YGBA 1W0PA 2JX9A 5J96B 3PNAA 1V6IA 3L9JT 4K1ZA 3ZLIA 1UZYA 1O3RA 3O12A 2NM1A 4KH9A 4I0BA 2VAUA 2WN3A 3EB7A 2JIGA 3EJKA 4RQPB 2XL9A 3UYJA 1H2KA 1OD3A 4ITCA 3VZJA 2D6OX 2EXJA 1LJ7A 1V70A 2V09A 1TMF1 4UBGA 1RMU1 4COZA 1JZ4A 3PJQA 4Q8LA 1FX5A 3AB0A 2AACA 2QVSB 1MPXA 2PYTA 2AENA 2W1UA 4LO6B 4LQRA 3USUB 4D3WA 5I8TA 5FZEA 5HXVA 3TAYA 5CG8A 1CGPA 1RUD1 1ZA4A 3ZXJA 1DQ4A 1JUHA 1MS3A 2B7YA 1OKQA 4BHPA 1DIWA 3FZ3A 4B1LA 2I2SA 3KCCA 1DZTA 3M7AA 4IW3A 1J84A 4COUA 4NPLA 1O4YA 5IT6A 3E97A 1BBT1 3H1WA 4Q26A 5C3OA 1I1EA 3O1MA 2ZMKA 2XVLA 4IEWA 2WA4A 3LA7A 4I02A 1UOGA 1W0NA 1Q8QA 3SH4A 1W6OB 2XGXA 3OPZA 1W2AX 4UT5A 2PHLA 2OX0A 4R8HA 2ZHLA 3DPRC 5FBZA 3ZXKA 2ZGQA 1GFF2 3H9AA 3RQ0A 2Q1MA 1KITA 1K5MA 1GKBA 1QJX3 5DUVA 2RVAA 5HBAA 4UWDA 4RQPC 4D94A 3WX5A 4LBQB 1B35A 3JBG3 2RDRA 2J1TA 2HKXA 4HANA 4K1YA 1CZVA 2PN5A 1H2MA 3ZFEB 3FLRA 2MEV3 2W46A 2DUPA 4IGOA 3QCWA 5JSOA 2AZ5A 3WP6A 4BQ4A 3PDQA 5DAWA 3KV4A 2B42B 5T5JA 1REFA 4Y1VA 4UF0B 4NHXA 1QJFA 4NOTA 1XYPA 3OSDA 2ZKNA 3V56A 1S0FA 1EV12 4BJ0A 4BU2A 2WS91 4OQ8A 2W87A 1GANA 3GXUA 2Y6KA 2W1QA 4A44A 5J36A 3CJIC 3BPZA 3LEMA 2YDEA 3U78A 1OLME 5IVYA 4N43B 3I2IA 1NZIA 4BISA 2WIIB 4LK6A 4OI1A 3ZYRA 4AFAA 2JG9C 3TWIA 3DKQA 4IV3B 1KGYA 3WT3A 2A6ZA 1VBE3 1UOJA 3A7QA 4NMIA 4OZOA 1Y9MA 1OVPA 3WR0A 2XL7A 5LK7B 4Q4X2 2JKXA 4KU7A 5JIAA 4BQ1A 5JLVA 1QOOA 1CD3G 2VCMA 5BYNA 1ENXA 5H9QA 2F4PA 4KWJA 3K75B 2W39A 3VBFB 4Y1YA 5FZAA 4GKYA 4QB2A 2ET1A 4PQQA 2CWMA 1US3A 2HWD3 5F3IA 2ZEXA 1Y3TA 2J1SA 5KWRA 1ZZ9A 1GZTA 3BYWA 1RUE1 2Y0IA 5ANNA 4IEZA 1E5SA 4XF1A 3I59A 5C3RA 3K3NA 1FV3A 2QQLA 2VOKA 3MLJA 4HL0A 4LUKA 4XMIA 5FAXA 4H14A 2JG8C 1YC61 2LRPA 1OFNA 2VCBA 2PA7A 5FUIA 1PK6C 2WWJA 3TRSB 4D8MA 1R092 5B4XA 1QH6A 3VBRB 3B3QE 5EYXA 2ATFA 4XE9A 4LA3A 3NW4A 2GP5A 2B8MA 4LO5B 2JWPA 4K3UA 4W6YA 4CA9A 2KD7A 3WQBA 4I0WB 2QNKA 1JXNA 4XTMA 4PLMA 2JDZA 2ZGMA 4NIGA 4Z2WA 1CWPA 1ZA7A 1RVF3 3LFMA 4H2AA 4Y1UA 2IXKA 5LY1A 3W59A 1FI2A 1QKQA 1LCLA 1PVC2 4WM7A 1G9FA 1HXS3 2D3SA 2P6HA 2PTMA 2W91A 3HBZA 3MIGA 2VZPA 3VN4A 3WQ0A 2ZGOA 3WF1A 1AYM1 1LEDA 1SACA 2G9ZA 2WWUA 1U5IA 3PVOA 4LLOA 4JVAA 3T09A 5LATA 1YI7A 3GZAA 1TVGA 5B2GB 2XLAA 2LTNA 3NNGA 4C0HA 4RHV2 2ZZQA 3I2OA 3NV3A 4JQTA 4M3CE 1PO22 5H9PA 2BEOA 2GALA 3PU3A 1LKNA 1PMHX 1AX2A 4Q4X3 5HCHA 2VECA 1IPSA 4URTA 4FP2A 2FZ1A 1H4GA 2G9FA 5D2AA 4FQZA 3ZN6A 3AP9A 2WFPA 4QMAA 5DDJ2 2A1XA 1R091 2PHTA 3KVBA 3ABZA 3WZ1A 3C7GA 4XJZA 5DAXA 5FY4A 1O3SA 1XNDA 3NV2A 4MGKE 5CNAA 3TBDA 4LO8A 3I2JA 3IB3A 3VBOB 1OKOA 2A5ZA 2PHFA 3AMMA 4NHKA 4AQ2A 4IESA 4RA0A 4DB5A 2BV4A 2DUQA 2JE8A 5JI9A 2Y0OA 3T2TA 5A6ZA 3DF0A 3C7FA 1OUXA 1QJU3 3D6EA 3CJIA 1MZ6A 5EYYA 5FZBA 3VBRA 1SHWB 5KXCA 4YSFA 1SLCA 1NCRC 3OEBA 1JYIA 2WZPP 1FOD1 4LKSA 2AYHA 4YRDA 1GQPA 4RR3B 2P1BA 1MEC2 2SLIA 4NWVA 3RZMA 1ZRFA 2Y38A 2D7FA 3H8OA 1C8M2 2B4KA 2R30A 3HNMA 2GMPA 1JOBA 2QDRA 3WEZA 5A32A 5FYIA 5A3NA 1LULA 5L7OC 3DCQA 1CIYA 1GU3A 2HBUA 1BXHA 1RINA 1KDMA 3C3VA 3IN9A 3TN92 1JU3A 5JOYA 5FXVA 2VOVA 1J59A 3MLKA 1DGWA 3ACIA 1AR63 1W6MB 3AVSA 5CKMA 5DDJ1 1PK6B 4BPZA 3BTYA 3N36A 1YIFA 2A3YA 2XJRA 5EJ3A 3VZMA 4CU7A 5JZGA 3GHNA 4MYEA 1ALYA 2NMNA 3BTAA 5CISA 2PAKA 4GH4B 4RS5A 1HW5A 3NKTA 4UFHA 2ZPXA 1D2QA 1AR91 3S6PA 3UK9A 2OQ6A 1UYPA 5FJHA 1L7RA 5FMOL 1S0BA 1X50A 1VBD3 4CUAA 2RMU2 3FL7A 4G4FA 4NHMA 2GC0A 4JTNA 4AQSA 3LF7A 4FPCA 2BBAA 2EIGA 2ZACA 1SBDA 3LGRA 1VAVA 2BUKA 3VHOA 3WDWA 4NIDA 3I2GA 5ISLA 1ONAA 2Z42A 1ENQA 1V6KA 1ODNA 2V4VA 3DYOA 3WG1A 2AGSA 2RG4A 4PT6A 1PX3A 4BB3A 1ZRIA 1TE1B 2JDUA 1HRI3 2JG9B 1MS0A 3EHKA 3JD73 3ZOIA 3MF6A 2BGCA 2D6LX 3LEGA 4WVWA 1HDKA 2A6WA 4I09A 4B4PA 3OBTA 4QPWA 1K5JA 1PO23 2BNNA 1KEXA 4QU1A 4GB31 4FAHA 5BXXA 1ACCA 1V6JA 4P14A 2X09A 1ZVFA 2E53A 2W9XA 4JKKA 1R1ZA 4EN9B 4WM8B 1BMV2 4YFZA 2EXHA 4GJYA 1OQEA 4YGCA 5T5PA 5FYVA 2IZWA 5IJRA 5DPNA 2WFF1 3LA3A 5KHGA 4C0BA 2BGOA 4R9DA 3I3BA 5LW9A 2XWBB 2P2KA 1FMD2 2YV8A 2ZGTA 3MFCA 4W6XA 3SKJE 3WLUA 4LMFA 3D3AA 3NJVA 4FPOB 4TLFA 5FO8B 1RXGA 5IVEA 3V0AA 4BK5A 2ARBA 4IV1A 3RI9A 2HWE3 5A33A 4R9CA 1W6QB 1ASJ2 4Q0UA 5AC93 1RXFA 4BYYA 1R64A 4LUMA 3N9QA 3BIEA 4UFKA 2WO3A 3OJBA 2E63A 2DVGA 3RRDA 4XFHA 1LGNA 2K9ZA 2R043 1CAVA 5A3LA 4GH4A 5LB6A 4OUEA 1QEXA 1TNRA 2ZKLA 5FXWA 1HN1A 2A7AA 1RUC3 4QHOA 1H2NA 2OUJA 1AL23 4JKMA 4ISQA 1S1AA 1AXYA 3DPRB 2R071 3ZYHA 1PNFA 3I8TA 4PDWC 2F4LA 1KFUL 1ND2A 3H0OA 2OA2A 4YZ3A 3ZSEA 2BZDA 3N7MA 2XR4A 3LEKA 1RL3A 2MPFA 2ZHMA 1MZ5A 1GZCA 4YW1A 4NR1A 4GWJA 4Q4X1 5CIRA 1YQ6A 5FZLA 4AWDA 1YUDA 1NX9A 3FFZA 1PVC3 3D0SA 2Z4FA 3HMYA 5DABA 3HN1A 1H1IA 4FOVA 3U37A 5D1IA 3VBUB 5HCAA 4RL7A 4YPJA 1UO9A 1UCXA 1G86A 4CPBD 1J1TA 1RUF2 3FWEA 4GJZA 4BXSV 3KT7A 1BCXA 2R062 3BTXA 1RYYA 5GZCA 4QD2A 3I7DA 5CKNA 1EV13 2ARCA 1M06G 4DO0A 4P00B 1A34A 3JUUA 4FT8A 3VBUA 1PM4A 3KSCA 1S0GA 3UJOA 3VUOA 2DFCA 2DF7A 2EIBA 3DN7A 1W8TA 2D98A 5EXOA 5LASA 1IS6A 1BEV3 3W9AA 5IATA 4FTBA 3B9IA 2YHJA 2YBPA 2Z5WA 3FX3A 4I01A 2GAUA 2Z2SB 5EJZB 5FP3A 1X9TA 4PI2A 2OXBA 1V6NA 1JOJA 1QHDA 4L11A 5DZGA 3X29B 3ZKYA 4DXZA 3KHCA 4BIFA 5JUVA 3GF6A 2LUWA 1J58A 5GZGA 3UGHA 5FQ0B 3ACHA 2G19A 4LHLA 2AUYA 3ORJA 5FP8A 1RUD3 3MPBA 3T30A 4U36A 1UYZA 2D6KA 4PHZA 3V0AB 2IWGB 4OMDA 1BEV2 4CPBA 3OY8A 1XE8A 2X29A 5E6HA 1JH5A 2SBAA 5KHHA 1EAH1 5IWFA 1BBT2 3TB0A 4F8AA 3SCFA 2Q5TA 1UWWA 3WHUA 2ADDA 4WM8C 4YZ4A 5EJ1B 5FMOS 3RYRA 4FFIA 4Q4Y2 5HXMA 1GQGA 4XFBA 4EROA 3LPGA 5TSWA 1JZ7A 1G7YA 2WAOA 3NQHA 4P9GA 5FPUA 4QAWA 1RB8G 1PO12 3KF3A 2UYBA 3ZFGA 4QQ2A 2O0OA 1S2KA 3ZXLA 1HXS2 1VMJA 4IDZA 4NPRA 4WZFA 1W3VA 5IVCA 3IBMA 4QX7A 4KG8A 4B4QA 4QKDA 5IW0A 2HEWF 1LGCA 1XOYA 1FOD2 3MUZ1 3GZUC 2G1MA 4Q1RA 5IAXA 1UMIA 3U10A 2C9AA 3GZEA 3LEIA 5FP4A 5BV6A 3V0BB 1OF4A 1VBA2 2W08A 3OPWA 3QACA 4LNVA 5F8PA 1Q43A 1UZZA 3ZN5A 5C9AB 2VW0A 3H3LA 3M8LA 2YY1A 4DRRA 5F2WA 2P3IA 4CU6A 2ILMA 4E4HA 1J3RA 4GH4C 2R1BA 4TZDA 3HIFA 3J8F3 1O5UA 2VY0A 1FPN1 4GWMA 4JAAA 1LHVA 2ZGNA 3J4UH 4KNCA 5FWEA 3K46A 4Z07A 2QQOA
chains in the Genus database with same CATH topology
3IDEA 4L97A 2ZGLA 5CADA 2EXIA 4FPEA 2RM22 4XFAA 1CN1A 5GLWA 3BALA 3O0XA 1PO21 3UKNA 1V9U3 4QGMA 1ZZCA 5LEJA 5T52A 1MS9A 3HT1A 2VNOA 1UAIA 1DQ2A 4C91A 1QJY3 2D5HA 3MIFA 3ATGA 4Q4V1 3HQXA 2WFF2 4RD7A 3NWKA 1AL0G 1QH7A 3BIWE 4QPGA 1DG6A 2RR12 5E16A 2Q30A 3PJYA 1VBD1 3WUDA 1C8NA 1YFYA 4OHZA 1HX6A 5FFOC 5I0SA 4IEUA 1I6XA 4XQWA 4GULA 5FPXA 1RUE2 3OYWB 1CIWA 1S55A 2IXJA 1MR5A 1R093 2P17A 2RMU3 4Q2FA 1EPZA 1CAUA 1YO8A 4E27A 4RGAA 3KQRA 2WLPA 3BODA 1QU0A 1KDKA 3ZVXA 2VUJA 5A33B 5K0UA 1UIKA 1YCIA 4PF5A 3C2UA 4FPHA 4L92A 4MGZE 4I0AA 1FXZA 2GNMA 1G6NA 4QPIB 4E4DX 3VKLA 2R6QA 1EPWA 4BMBA 1IS5A 5FO7B 3WDTA 1FOD3 3A4UA 1EAH2 3ZIXA 1S0JA 1NCQB 3B02A 1VBC1 1DGRA 4E2GA 1ULCA 1H8TB 4Q4Y1 1XE7A 5KHIA 2HWE2 5JI7A 1PO11 5E89A 1C3HA 1GV9A 1H8VA 1QF3A 2TBVA 4CDUC 4YZ1A 3S30A 2QZ2A 4DPNA 3ZDSA 3B00A 2FZ2A 3VBRC 1PZ9A 3WP4A 3AMPA 3HWJA 1ND3B 1BQPA 4CP2A 5FOJB 4QX5A 3JD71 1SLTA 1HRV1 3P3NA 5JOZA 1NA1A 2XJUA 1OQDA 1QJY2 1N1TA 1XXNA 4XQ4A 4HVQA 2ZCWA 3RYKA 1D4VB 5T50A 3TYJA 5K0UC 4KQ7A 2HWB1 4MXWA 1JTZX 1ZBA2 1RUJ2 2WZR3 3ELNA 3B69A 2RS12 3VBHB 3WG4A 2ZX1A 2PHUA 2HWF2 3JZVA 4K9SA 3SH5A 1VBA3 1F31A 2R061 5EZWA 3TN93 4DINB 1J1LA 2XVGA 1U0AA 4SLIA 3CLPA 1NCQA 1TEIA 4RSUA 2JE7A 4QPGC 3WP5A 1Z7S3 2ET7A 1A8MA 4HBNA 3CF6E 4JDMA 4P9IA 3WLUA 2VVDA 4BE3A 3J26N 2RS13 4OUSA 3LB9A 2PLV2 3BCWA 1YFWA 3CJIB 1ZBE3 3G6JB 3KT1A 2WJSA 2YROA 3KCYA 4JTOA 2DVAA 4IEOA 5AC91 4UW3A 4LBNA 1UL9A 4LR4A 2XLGA 2C1FA 1FAYA 4Y22A 1OOPB 1WD4A 4YARA 5HI0A 2QCSB 4M00A 4D69A 5FCCA 3IDBB 3ZFEC 3FJSA 3KT4A 3VZLA 1IS4A 4GWNA 4LULA 3WCRA 3AZXA 2A71A 1VLNA 1A3KA 1Q8OA 4Q0VA 1LOGA 2DU0A 1FYUA 2BNOA 2IFRA 4KBBA 3WW4A 1PMIA 1PGL2 4N53B 3ZFFB 3DL3A 5JWPA 1DGRN 3ZIWA 2ETEA 1KS5A 1EV11 1JBCA 1OA2A 3QD6A 4N7IA 5D8AC 2E7QA 5DG1A 4AW7A 3U07A 4HKWA 1AR73 1U5XA 2V73A 4I2OA 3NJZA 1ZBA3 3VHNA 3KD4A 1TMF3 1RUJ1 2HWD2 3AYCA 3ZPYA 5FTTC 3AZYA 3H3UA 4B7EA 4MLOA 4PCRA 3VBSC 1W6PB 5GLZA 4FOWA 5BNOB 5GLVA 3CJXA 3JB8A 1VB2A 3KB5A 4AI1A 2XHKA 3A0KA 4COVA 1LU1A 2WZR1 4PBPA 1PIV2 3B5LB 1G9CA 3GBWA 1RUF3 4DQAA 3V65A 2CWSA 3N7KA 1AUYA 3UKVA 1H0BA 1GBGA 3EO6A 3MDPA 4FSJA 1AYN1 3AYDA 4IXLA 2KXLA 4Q4W2 4XJWA 1Z7S1 1DHKB 4MUVA 3AYAA 3H1MA 5BNPA 2X5IC 1U5ZA 2XKPA 1SLIA 2EVXA 5BY5A 1F2NA 4V1PA 2B46X 1PGW1 4QQOA 3ZFGB 1NYWA 2PQQA 1AX1A 1KD7A 2CGNA 3KCXA 4W65A 4CDWB 3URFA 4DOUA 1C8M1 1PGL1 4CDXC 3LOBA 2QDNA 1ND3A 1W6OA 1S2BA 4FOYA 3THTA 3V0BA 1RVF1 5T5OA 3GHMA 4CDWA 2E7TA 3NL1A 4BLIA 1CAXA 4AEDC 1Q8SA 4I3PA 4FCAA 4CEWB 4Q0PA 2D6PA 4IV1B 4YVWA 2RS32 2IXHA 4K21A 1MS4A 5DXDA 4I3GA 4JGYB 1RHI3 4HPKA 4AG4A 1CAXB 4P5HA 4MXWB 5IK7A 2DFBA 4S2HA 5CFDC 2D93A 3ZFEA 4WM7B 4LHNA 1DYKA 4QGLA 4HSLA 4DFSA 3U0ZA 5ACA3 3D0JA 4P9WA 1UF2C 2B39A 2VVEA 2G9GA 2XH6A 3AKPA 4EWAA 5AVAA 5LK5A 3ETQA 2XBO1 5DUUA 1Z0HA 1APNA 2O8OA 1POV3 1LOCA 1LU2A 4YNIA 1TME1 2X5IA 2PELA 4JRAA 4HFSA 2VQ0A 1QQP2 2NMOA 1QGLA 1YJKA 4G3YC 1FT9A 4CDQB 1IGOA 4K6BA 2C0ZA 2D44A 3VBSA 1QOTA 5BNOA 4S2FA 5GZFA 2O1QA 3S7IA 4B8EA 3ECQA 1WW5A 2DU1A 4PQ9A 2EF6A 2UY9A 1RUH1 2ZAHA 3JD72 4JC1A 1HQLA 4ATEA 3IPVA 1G9BA 4YVWB 4AVTA 2N7GA 1K5MC 4Z82A 3B01A 3H7YA 2R1DA 2QZ3A 1B35C 3OF1A 2VW2A 4PIYA 1LRHA 2NZ9A 2ZAAA 1FPN2 1HQWA 4QT6A 1FPN3 2GSYA 3AP7A 4HN1A 2TNFA 1H9WA 1ZYBA 4RGGA 5C8CB 5H9SA 2WA3A 4XMAA 1PGSA 4Y24A 1R081 1RMU3 1J3QA 4YFWA 1KQRA 2WS93 4BOWA 4AE2A 3B93A 1N47A 1COV3 4Q1PA 3WW2A 2RS31 4GA9A 4A7KA 5C6CA 3FBYA 4R4ZA 2BVVA 5FO9B 4WZCA 1NE4A 1LOFC 1PHMA 2WT2A 1WLTA 4JGZC 1DGLA 1DQ6A 2B5HA 2VMIA 4UW5A 3I54A 4YM1A 2DCZA 2I74A 2GZWA 1WW6A 4XBQA 2F6BA 1OFSA 3R4SA 2GN7A 1SEFA 2VMHA 1HRI2 2K2SA 1OHFA 2YUEA 1WA4A 1WBFA 1IS3A 3FFQA 4OZXA 2EXKA 1TNFA 4LE3A 1G9DA 3MW3A 1Z7S2 3AJYA 3OD0A 4LT5A 3APBA 2R041 4GALA 4MXVA 3VL9A 1AR61 5DDJ3 3E6DA 4XFCA 4EN0A 1MACA 1MZFA 5T5LA 4AVVA 1Q8VA 5HCBA 5JDBA 4GXLA 4WVMB 4AGVA 3Q9OA 1IHMA 4MH0E 3NAPC 3VLBB 4DMIA 1RGSA 4CEYC 1OMIA 3ST7A 1QJZA 2ZX2A 1U5YA 4J1WA 2NQYA 1C1FA 2XB6C 4AHYA 4N43A 2ZGPA 4XBNA 3AFKA 2QFEA 4AF9A 3POWA 2R32A 1ULDA 2XJPA 5T55A 1JW6A 2A3XA 5DG2A 1VP6A 1ZRDA 2VOXA 5C33A 2EALA 1YNAA 4WV8A 1UKGA 4R52A 4WVVA 3AZWA 5BPXA 3R6SA 3ZYGA 5AC92 5C4WB 1EYBA 2VW1A 4ZXKA 4KWKA 2ZMNA 3SHRA 4AGGA 1YIPA 4ZU7A 2DCYA 5KHJA 4FQ4A 5C9AA 5I93A 1FMD1 4HLTA 2UURA 1AL22 1QDOA 4N53A 3DUIA 1REDA 2BFUS 1C57A 2E9QA 1D4M1 4XZPA 1JYCA 1POV1 4OHXA 2BQPA 4CDQA 4S2GA 2HWF1 1PVXA 2GC1A 3MEPA 3OCPA 4Q4W3 4RR3A 2HWC1 3OGGA 1S0CA 2HWB2 3ENRA 2A6XA 4EWEA 5F6KA 5CFCB 5KXBA 3B7MA 3I4IA 2RS11 3M3EA 4META 4M0HA 2E51A 3WCSA 3SMHA 2GDFA 1DQ1A 2XUMA 5BNNB 4XQDA 1OLQA 3TNQA 4PDWA 5C8CC 1IKQA 4Q4V2 1QMJA 5J3UA 2BTVC 1V6MA 2JICA 1XNCA 2XBO3 1RUI1 2ZZJA 3EBRA 2EA7A 3RG0A 1MS5A 4P9JA 3B94A 1GICA 4AFBA 3VL8A 1YFUA 2GU9A 1X82A 2UWBA 2KM2A 4OI2A 1JUIA 2VVFA 4AFDA 1ASJ3 3H3ZA 3R0RA 3AMQA 3LSDA 3FLPA 3IT8A 1R083 4XEZA 4MSVA 3W58A 4KL1A 4OI4A 4CRQA 1N3PA 1NA1B 1YRZA 1O3TA 3P3PA 3AP4A 4CDQC 3SCGA 1ZBE2 3LZZA 4IQPA 1KRIA 2VPVA 4YGEA 3WW1A 1LHOA 4FAGA 3M3OA 4AVAA 1UU4A 1ULFA 2HEYF 4DY3A 1WMEA 5CFCA 3J8F2 4LBKA 2CV6A 1REEA 2QJVA 3ZO0B 1MQTA 3FUOA 3GZTB 3MIDA 1AR83 2RM23 4DS0A 1GSLA 5GZDA 2VULA 4RHV3 2FHRA 5EV7A 1OQ1A 2H6BA 2OVUA 2XJVA 4X8NA 4LTAA 2G4IA 1WMFA 5ACA1 2GNDA 1BZWA 4HVOA 2B45X 3B9CA 4A3XA 1W6PA 3VZOA 1UU5A 1AVBA 4RS5B 4ONUA 3M2MA 2Q1ZB 4AI2A 4W6WA 1C28A 4M01A 1O7FA 4NHLA 5L7OA 3CO2A 3WP3A 1RUC1 1AYN2 3O0VA 4GB32 5ABJA 1G9AA 3KMHA 5E88A 3S0MA 4I30A 2LM3A 1POV0 1VBB3 1I5ZA 4HZFA 4H7MA 1QJX2 3ZXGA 1PIV1 4J1XA 4K8FA 1RUJ3 2WZR2 4AVSA 3M4FA 2XJQA 4XBLA 5A32B 5KXDA 4NO4A 5JOWA 5LRSA 1URXA 3IPVB 3ILRA 1OA4A 1RUH3 1DQ0A 1ZRCA 1W6MA 2CTVA 1NA1C 4IEXA 3VDDB 3O14A 4BA6A 2EAAA 1N1SA 3PLQA 1OSGA 5L73A 5ACA2 1O5LA 1MQTC 2R0FA 5LRRA 4WVMA 5FQ0A 3VHRA 1C4RA 4QQLA 1WGPA 1PNGA 4X6RB 4AHXA 4UXAA 2AREA 4YG6A 4IETA 3N35A 5K9YA 1GR3A 4B4RA 1CAVB 5JPMB 4LBLA 4P9LA 1S0DA 3MIBA 1XYOA 1NQDA 1VBE2 4E2QA 3FUQA 1AHSA 4Y1ZA 4XJAA 4FPJA 2YXSA 5CVRA 1M4WA 5BNOC 1SQ4A 2CL2A 3J8F1 2IFWA 4JQRA 4R9BA 4YGDA 2X8KA 5SV8A 4AVBA 3VBSB 2W52A 1DF0A 2ZS6B 2HWB3 2UY8A 3ZFFA 3IIAA 4C1WA 2GMMA 4BZ4A 3BOWA 3IKWA 2WSVA 1QY4A 1UMZA 4Z1VA 1D0HA 1ZX5A 1H1MA 4Y4YA 3CL1A 4XXAA 2DV9A 1UIJA 1BK1A 4LO7A 3USSA 5CFCC 2A70A 2CYFA 5JSPA 1XNKA 1OD5A 1QJY1 2ZX4A 3S7EA 1ZM1A 2IXLA 4CP0A 4QHBA 3ZXDA 4COWA 4JGYA 3LCPA 4LBQD 1ZBE1 2K0GA 1RHI1 1ND2C 1NY71 1QXPA 3O5SA 5I0UA 1CPMA 3HT2A 4HPKB 1BEV1 4Q29A 4YVSC 3MZHA 1PZ8A 4Q27A 3POSA 3RMXA 5C4WC 2XJSA 4JGZA 1AYM3 2NP0A 3RI8A 4M3CA 2ZTNA 3E6BA 1LODA 3MICA 4GMP3 4SBVA 4XFIA 1V6LA 5EFUA 4ES9A 2CGPA 1TME3 4HSJA 4QPGB 1AXKA 1RUOA 1N1VA 1NQJA 3KZ4C 2WSUA 4XF9A 1HRV3 4XFFA 2D6NA 4RFT0 4AFCA 3M1HA 4K7JA 1W2UA 4AFMA 3SXWA 1IZ3A 1QJU2 2WNUA 1GYKA 4P9YA 5FLJA 3SLIA 2FQPA 4HETA 1WD3A 4F7ZA 5IK8A 4G9SB 4LA2A 5J09A 5K7PA 4ISRA 4UW6A 3NAPB 2PHWA 3N7JA 2DCKA 4XHBA 3H7JA 3WOGA 1EP0A 1ASJ1 1MEC1 3MW2A 4XF3A 4PBOA 3WY6A 4TYSA 1ZZ7A 1NOVA 4AGRA 3GBGA 4AHWA 1Y43B 1V00A 4Q4V3 1U12A 1XQNA 4FPFA 4B29A 1QOSA 1Q5OA 2PLV1 2RR11 1CPNA 1UU6A 4YM0A 1C1LA 1V9U2 1D4M3 3CEWA 3PMEA 4MGYE 4EN8B 2XKOA 4XF4A 1CONA 1GZ9A 4LO4B 4KG0A 4JGZB 4X6QB 4FPLA 1KJLA 1A6CA 1H8TC 3N4MA 1BMV1 3L2HA 3TNPB 3RNSA 5KXEA 2NPIA 3FHIB 4IEQA 4E4SA 1MS8A 2DCTA 4BLJA 5FDBA 1ENSA 4KWLA 3WG2A 4OUMA 2FBEA 3GYDA 2D40A 5SV5A 2WT1A 2VMGA 3ZN4A 4QPIC 1HRV2 1X8MA 1QDCA 5AFEA 4XTPA 3AXEA 4MGIE 2JKBA 1VAKA 1H4HA 2VOWA 1EAH3 3MFAA 1Q3EA 4JCKA 4TSVA 1ZBA1 5BNPB 3VDDA 1HRI1 4ZKTB 4ASMB 3MYXA 1T6GC 2H0BA 3L2YA 1CAWB 1H1AA 3M3CA 1LEMA 1B35B 3ZSLA 4C1XA 1LOAA 1L3JA 2RMU1 2JG9A 4Q0QA 2WFF3 4M0NA 2ZGSA 5H9RA 3U11A 2WNVB 2YMZA 2ERFA 1IPKA 1A8DA 4HN0A 5LEKA 2WNEA 3LWCA 1DLLA 3SITA 3AYEA 2VG9A 2WNUC 3VZNA 4XILA 2GNTA 1R082 2BWCA 3D5OA 5CU1A 5I91A 1AJKA 4NVPA 5EWSA 1RVF2 2Q8OA 2ZHKA 4XPVA 5JSRA 1RMU2 1XRUA 3RSJA 2A73B 3V64A 1VB4A