5T54A

Lectin from bauhinia forficata in complex with blood group a antigen
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
229
structure length
229
Chain Sequence
SELSFNYPNFQSVEDITFQGGASPRNETLQLTPTDSNGIPIRQRAGHAVYSQPFQLRDTSFYTTFTFVIRTTSNSPADGFAIFIAPPDFPVKRYGGYLGLFEPNTATNTSANKVVAVEFDTWVNTEWKEPRYRHIGIDVNSIVSVRVTRWQDKDVFSRSIATAHVGYDGISKILTAFVTYPDGGNYVLSHVVDLAEIFPGDVRIGFSGATGQYETQYIHSWSFSSTSTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis and unique molecular recognition properties of a Bauhinia forficata lectin that inhibits cancer cell growth.
pubmed doi rcsb
source organism Bauhinia forficata
molecule tags Sugar binding protein
molecule keywords Lectin
total genus 50
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t54A00
3VKLA 4RA0A 4JCKA 2ZGLA 3A4UA 3N7LA 3NV2A 3C2UA 2DVBA 1DQ0A 1V6JA 5SV8A 1IS3A 1AJKA 2DURA 2ZGRA 2ZGMA 3NV1A 2EF6A 4FPOB 4FQ4A 4P9WA 2D3SA 1V6IA 5GZCA 2ZABA 4UW6A 1WBLA 3ZXJA 1FYUA 4LBKA 5GZEA 3DUIA 2UU8A 3HN1A 1CIWA 4DPNA 3N7MA 2P3KA 2E6VA 3V0BB 3POYA 1KRIA 1UZZA 3B9CA 3RG0A 2B7YA 3USUB 4XHBA 3OGGA 4YGEA 2E53A 1DQ2A 2ERFA 5JVVA 4XYXA 1C4RA 2WQZC 3JUUA 5GLZA 1SBFA 1ULFA 3AP9A 5KXEA 1GZWB 2WT1A 3LSDA 2D43A 4TYSA 5CNAA 4RL7A 5DUUA 4FPFA 5E88A 1JBCA 1ZM1A 1VIWB 4Y20A 4Y1ZA 4P9YA 1A78A 2ENRA 4CTEA 4AGVA 2ZGOA 1LESA 2EALA 4XZPA 5IK4A 3M1HA 1N3PA 1MS3A 4FPKA 2YXSA 4PF5A 4WZFA 4BLJA 4R9AA 2DUPA 3H0OA 1BYHA 1NXD1 3U4XA 1DQ1A 1N3OA 4Y22A 1DZQA 3ZSKA 1I1EA 1X50A 4L8QA 1GV9A 4K21A 4YG0A 1LHOA 3O0WA 1QGLA 1RIRA 5CA6A 1BQPA 1O4ZA 4P9XA 2GALA 5GM0A 4YZ2A 1W6NB 4NO4A 1GICA 2AENA 3ENRA 1LEMA 4H55A 3M2MA 3WDWA 3OYWA 4FOWA 4Q8LA 3SH3A 2NYYA 4YW2A 2UWCA 2VH9A 2FHRA 2ZHLA 3V0BA 1V6MA 2R49A 3A0NA 2GN3A 1JUIA 5GZDA 3VKFC 1LOEA 1AVBA 1U0AA 1ONAA 1BKZA 3M3QA 1DIWA 3AZXA 2DV9A 3FLPA 3O0VA 4XMAA 5DXDA 1S0GA 5GZGA 2NMNA 4SLIA 4ZKTB 1V6OA 5BYNA 3MW4A 3ZXKA 3VV1A 3B3QE 1EPWA 3R4UA 4FPCA 1PZ8A 2WKKA 3AJZA 2D6PA 1SFYA 2EXHA 3AX4A 3AZVA 3I4IA 4XJZA 1JOJA 2GN7A 2A6WA 2UURA 3AP7A 3M3CA 3WG3A 1DFQA 1QOSA 3LCPA 3W58A 1G9AA 5HCAA 2R1DA 2NMOA 4YW3A 3OBTA 2ZHMA 2GNMA 5GALA 1N3QA 1WW5A 1S0CA 4MYEA 1FNYA 2ES3A 4GKYA 4YGCA 1R1ZA 1DYPA 1WBFA 2I2SA 1KITA 3GNEA 5DG1A 3IMNA 2EIGA 2LTNA 4UW3A 3IN9A 3SISA 2DVDA 4Q1PA 3VKMA 2D7FA 4D69A 1GSLA 1UL9A 2AREA 4K20A 2R0HA 2CL2A 3FFZA 3T1LA 4CRQA 3ILFA 4Q2FA 3ASIA 1S0FA 4UW5A 1LU1A 1C1LA 4FOVA 2PHUA 3AXEA 1FNZA 2SBAA 2WLQA 4XBQA 4YZ3A 5H9SA 1W6QA 4FVVA 1A3KA 5E89A 5H9PA 4M01A 4DS0A 4PCRA 2D3PA 3GALA 1O4YA 2A75A 3FUQA 1FATA 2A3WA 1SLIA 3WG2A 3RQ0A 1CPNA 1LODA 4JC1A 1LENA 4PBOA 3WZ1A 4DRRA 1GYKA 1W6PB 1DQ6A 5T54A 2OVUA 4AWDA 1YIFA 4XXPA 1D2SA 1HKDA 1N1SA 2CWMA 3HR9A 2OW4A 3IPVB 1LTEA 3PVNA 4NOTA 1JW6A 3PJQA 4WVVA 2ZKNA 4GWNA 3TB0A 4XJWA 4Y1UA 3IPVA 3SH4A 2D44A 3ZVXA 3R05A 5AVAA 1OQ1A 2CWSA 4Q1RA 3INAA 4LBQB 5KXBA 4OZXA 1C57A 1LU2A 3T1MA 1VAVA 1XQNA 1N1YA 2VW2A 3LSEA 1WW6A 2P37A 2NN8A 1H9WA 1Z78A 2CY6A 5CBLA 3OJBA 4AVTA 3SLIA 1GLHA 1W0PA 4K1ZA 4M3CA 3B69A 1JXNA 5EYXA 3AYEA 3D5OA 3O0XA 2JJ6A 1LOGA 4XIKA 1QOOA 2AGSA 2CTVA 5IK8A 3NWKA 3ZYRA 4XJUA 3ZXLA 1AXZA 2LALA 3AZYA 1ENQA 1GANA 1LCLA 2PHWA 4PQ9A 4BPZA 1G9CA 2NP0A 5EYYA 1DLLA 3AYCA 1W0OA 4M00A 5GLWA 1GNHA 3POWA 2DTWA 3M3EA 1BJQA 4YLZA 1B09A 1DGLA 1APNA 1LGNA 4Y1XA 5EWSA 5L73A 4XE9A 1AF9A 5KXCA 2DU1A 4DRVA 5H9RA 2GMPA 1F9KA 2ZZJA 3M3OA 1LHNA 1CVNA 5T52A 1HDKA 3UJQA 4ATEA 1AX1A 4Y1VA 4ITCA 1S0JA 4FPEA 1AX0A 2BQPA 2JD4A 3B01A 2EAKA 4LBOA 4R9BA 3VKOA 1CONA 2ZMNA 1WCSA 1SLBA 2AR6A 5DZGA 3WDUA 1VAMA 4K1YA 5IK7A 1AXKA 3FBYA 2WNEA 2ARBA 1CQ9A 1KJLA 4BM8A 2JDZA 3O12A 3USUA 1ULEA 2P3IA 2OUHA 3RMYA 5T5JA 2DYCA 1UPSA 1ULCA 1SLCA 3AYAA 3OBRA 3RRDA 3WLUA 3WV6A 1QF3A 2ZAAA 3AJYA 1KJRA 1JHNA 2D3RA 2DU0A 5T5LA 2A3XA 4IQPA 5DG2A 4YW4A 3N35A 4GKXA 2VU9A 3HMYA 3SH5A 2VW0A 4Z8BA 1DYKA 4XMIA 2CNAA 2PHRA 4YFZA 1VALA 2H0BA 3APBA 4Q8KA 2VW1A 4YM3A 4YM0A 3OPZA 1H30A 2A6YA 3UJOA 1LOBA 4Y24A 3WDYA 3WVJA 1MACA 4JRAA 4ZXKA 5DUVA 1F5FA 1LJ7A 4FQZA 1TEIA 3ZYPA 2V73A 3RMXA 5CB7A 1W6NA 5JOWA 1WLWA 2GNDA 1WLCA 3Q9OA 1QNWA 1Q56A 3UK9A 3V0AA 3ILNA 2W39A 4GA9A 1JYIA 3MW2A 1CR7A 2DVGA 2Q5TA 1V00A 1MS8A 3BIWE 1AJOA 3R4SA 1IS6A 1S0BA 2A71A 3OY8A 4KBBA 1UZYA 1IKQA 3WDVA 2A6ZA 5JOYA 3ZXEA 3ZSLA 1VLNA 1LEDA 1GKBA 5IK5A 1GZWA 3TAYA 1GZCA 2XG3A 2D6MA 4ISQA 1CJPA 1G9DA 2E7QA 4YM2A 4FOQA 5CAZA 1W6PA 2SLIA 2ZMKA 2TEPA 3AP6A 3PVEA 5E8AA 3IKWA 5FREA 2A6XA 1Q8QA 2EXJA 3N36A 3WG1A 1FV2A 4YFWA 4AVVA 1YXWA 1LECA 2A5ZA 2R0FA 5IUQA 3VUOA 2PHTA 1HQWA 5LK5A 3PMEA 5JLVA 2D6LX 5JOZA 1S0DA 3N3HA 2Z42A 3AFKA 3POSA 2PELA 2WSVA 3BODA 4XHXA 3WDTA 2ZGPA 5GJ6A 1DQ4A 4UW4A 1MZ6A 1CN1A 2WSUA 4YZ5A 1SBEA 1KDKA 1MZ5A 3WG4A 4FP2A 3W59A 3FLRA 4YGBA 2P34A 4YW1A 2A7AA 4U2AA 3WHTA 1FAYA 2DUOA 3ILRA 1JYCA 1ULGA 2R1BA 5GLUA 4Y1YA 1SBDA 1YRZA 2OUJA 4YG3A 3ATGA 4LBQD 1N47A 1S0IA 2YZ4A 1YI7A 5DUXA 4FP3A 3OYWB 1W6OA 4M3CF 4FPYA 4C1XA 1G86A 1IOAA 2NZ9A 4FPHA 1W6QB 1UX6A 3WCRA 2C5DA 2GDFA 1V6KA 1DQ5A 4YZ1A 1J1TA 1GNZA 2EXIA 1WW7A 2FMDA 4XOGA 1SACA 2VUAA 4TZDA 1LHWA 1RINA 3N7KA 3AP5A 2EXKA 3MW3A 2R16A 2GNTA 3V64A 1HQLA 4HL0A 1H9PA 5HCBA 1LHVA 1Q8VA 1ULDA 1S0EA 3FUOA 2DWRA 2VXRA 4YZ4A 5T5PA 3FLTA 4AGRA 1FV3A 4XDQA 1D0HA 1LOAA 4XJ9A 4LBJA 1YYNA 1KQRA 1NLSA 5EXOA 3WCSA 1Q8OA 2JKBA 1QU0A 4M3CE 1ENSA 2NM1A 4F83A 4XIOA 1JN2P 4YM1A 2DUQA 2AH2A 3WNXA 4Y22B 3ZSJA 2ZGNA 4YGDA 2ZGKA 4BQ1A 3JU9A 3I8TA 3AP4A 1WD4A 1MS0A 2DVAA 4PBPA 4GXLA 1FX5A 2PHFA 1G7YA 1LGCA 5DUWA 2ARXA 1W6OB 2GMMA 2P2KA 3N7JA 4U36A 1LULA 1KDMA 2JECA 2PHXA 3WHUA 3B00A 1F31A 2WT2A 1LGBA 4DQAA 3L2YA 1ENRA 1QNYA 1WD3A 1CPMA 1ZA4A 1GBGA 1LHUA 1S1AA 5T50A 2C9AA 4BOWA 4YW5A 3V0AB 2YV8A 3O5SA 4XTMA 2W08A 4FPJA 4LBNA 2D6KA 3KM5A 2ZGSA 5IT6A 2JE9A 2GNBA 3AYDA 1IKPA 4Q27A 1W6MA 1LOCA 4AYUA 1QOTA 1PZ7A 2W52A 2YROA 5H9QA 1G8WA 1MR5A 2AUYA 4Y20B 4XILA 1V6NA 4P14A 3SITA 2GMEA 3DGTA 1WUVA 3VKNA 5JOXA 5KXDA 1UKGA 2A70A 3D6EA 4LBLA 3RS6A 2E51A 5T55A 3WUDA 1BXHA 2ZHKA 2VY0A 3AZWA 4WVWA 1AZDA 2YMZA 4XJ8A 4XXAA 5GLVA 3WDXA 4XBNA 4CZSA 2UWBA 1OFSA 3V65A 1UN1A 2WJSA 2ZGUA 1Q8SA 5JMCA 1DBNA 5DZEA 3SNMA 1UMZA 1Q8PA 1RITA 1QDCA 1UAIA 1WLDA 2AYHA 1BZWA 3CNAA 3QCWA 5F5QA 4BMBA 4HANA 4DFSA 1OKQA 1PZ9A 4WV8A 4YG6A 3RSJA 3D4KA 3KQRA 5GLTA 1QMJA 2A6VA 4GWMA 2ZA9A 5GZFA 1MVEA 3MEPA 3WUCA 4FPGA 2ZACA 3IM0A 1MVQA 3BTAA 3NV4A 2DTYA 4FOYA 3ZXFA 1AX2A 2ZBJA 1MS5A 5T5OA 4AGGA 1AXYA 3WOGA 4ATFA 2HYKA 3BOPA 2UWAA 2RHPA 2V5YA 2ZHNA 3ZSMA 4FPLA 3ZPYA 4BMEA 4XTPA 2W68A 1QKQA 1IS4A 1WW4A 2E7TA 3OY8B 2KM2A 4GALA 1CESA 3MPPG 2ZGTA 1SLLA 1W6MB 1LOFA 4XBLA 1SCSA 3QLQA 4R9CA 2CYFA 1N1VA 1SLAA 4W65A 4Y26A 1GZ9A 3UL2A 3AXDA 1MS4A 2WT0A 4ISRA 1N1TA 4XJAA 1G9BA 1LOFC 5FRAA 5DZFA 1YO8A 1MS1A 5JDBA 2D6NA 1DHKB 1IS5A 1QDOA 1Y7BA 4I30A 3AK0A 4LBQA 3T2TA 2D6OX 1G9FA 2A3YA 4Q26A 4ASMB 2DVFA 1MS9A 3A0KA 4R9DA 1C1FA 2XB6C 2ZMLA 1A8DA 1SLTA 3NV3A 5HCFA 4AVSA 4C1WA 1URXA 2JE7A 2YY1A 3PVOA 5F9TA 2P3JA 1HLCA 4BLIA 2G4IA 1Z0HA 1I3HA 3AZZA 4M3CB 1SCRA 1V6LA 2ZGQA 4LBMA
chains in the Genus database with same CATH superfamily
2OQ7A 2YDEA 1R1A2 4RA0A 2B42B 3NV2A 2PA7A 4UFJA 3C2UA 3JBG2 2XBO1 2PMWB 4DEQA 1AJKA 1XNKA 2ZGMA 3HQRA 4FQ4A 4KNCA 2D3SA 1V6IA 4K7JA 5FYVA 2RMU1 1Q43A 4QB2A 5F7UA 2VZ1A 2RM22 3DKQA 5B2GB 1H1MA 2JE8A 4DPNA 1QJU3 3V0BB 3ZFGC 1NYWA 2ZEYA 4C91A 2WL1A 2B7YA 4ARYA 5JI9A 3A7QA 2AZ5A 4JX0A 2E53A 1K5MB 4OHVA 5JVVA 1C5IA 1RUOA 3JUUA 4LLOA 4AVCA 2ADDA 1GZWB 2Y64A 3LSDA 5IVYA 5LBCA 4AW7A 2CV6A 4G3YC 4M4RA 2VTFA 4FPFA 4Y20A 4PI2A 3HBKA 2HWC1 4P9YA 4V2VA 3T08A 2EALA 1AL0G 2B4KA 1N3PA 3WP5A 4B7KA 4PF5A 3KGLA 4F8AA 4OCTA 4B4RA 1W8OA 3HQUA 4HK9A 1ZREA 1PHMA 2BEOA 4UI9L 1HV0A 4Q4V2 2DUPA 3H0OA 1BYHA 3U4XA 1XPWA 1C3HA 4ZZ8A 3OGJA 2OQ6A 2FDKA 5I0RA 4K21A 2WBKA 2YU2A 1LHOA 4DXSA 2V5DA 2VMIA 1CIYA 1ODMA 3HD8B 2W1SA 4OUSA 5CA6A 1BQPA 4P9XA 2LUWA 5BUVA 4NPLA 5KHJA 1W6NB 2ARCA 1PNFA 1LEMA 3LFIA 4HVQA 1TG7A 2VAUA 3L9JT 3LPFA 4PT6A 2NYYA 4YW2A 5FZ8A 2ZHLA 4QX2A 5D2AA 5A3WA 3T09A 4DMIA 1SDWA 2RS51 3A0NA 2JXAA 1PGL1 3POJA 1LOEA 3BYWA 4ES8A 4AAXA 5FXZA 4GH4A 1ONAA 1YIPA 3M3QA 5CFCA 1DIWA 2DV9A 3O0VA 5DXDA 4JVAA 1IPJA 3PLQA 2DCTA 4AQ2A 2NMNA 4CDXB 2RDRA 4ZKTB 2XLFA 1VE0A 4HXCA 3ZXKA 3B3QE 2XJQA 3EMRA 3IBMA 3R4UA 1EY2A 1T2XA 4FPCA 4IEXA 1R64A 2EXHA 3AX4A 2X5IC 3KSCA 3ZYIB 1PM7A 2Z79A 4H2AA 2WNVC 1W9FA 3RZJA 3KWVA 4AHWA 3DV8A 4D94A 3AP7A 1UW8A 4OLLA 1W8UA 3W58A 4FBFA 3IZOA 1G9AA 3MIGA 3ZLIA 2GNMA 2VCAA 5DPNA 3OD4A 2XQRA 4R8HA 1OQEA 4GAZA 1REEA 4A7YA 3EYPA 1N3QA 3H3ZA 2W3JA 4YGCA 4J1WA 3PUIA 1WBFA 1E5IA 1UU5A 3MDPA 1STMA 5JR7B 2VQUA 3GNEA 2I45A 1S2EA 4OQ9A 4UW3A 3SISA 2D7FA 1AR73 2AC1A 5FY8A 2QFEA 3FFZA 3UGFA 3UGHA 2OPWA 4LKEA 4CRQA 5KHHA 1FT9A 4LA2A 1S0FA 1Z7S3 3ES1A 1GP6A 1C1LA 3KCXA 3SXWA 4AI2A 3VDAA 1OD5A 2C26A 2R072 3MUY1 4YZ3A 4FXGB 5A3LA 2XUMA 4JTOA 4M01A 3ZN6A 4B1LA 4DS0A 4LUMA 5J7MA 1UU6A 1OOPA 2A3WA 1QJY2 4Q4W2 5FP7A 3RQ0A 1LODA 3PHMA 1PNGA 3Q8BA 3QH7A 2XJUA 4TLFA 5EP9A 4DRRA 2RV9A 2WNOA 4PIYA 2BRTA 5L19A 2K46A 1QJY1 2JICA 2OVUA 4Q4W1 4A7ZA 2CGPA 1YNAA 2MEV3 1HKDA 1N1SA 3HR9A 3IPVB 2OW4A 1JZ6A 1LTEA 5DAPA 3O1RA 1JW6A 5C4WB 4CUAA 3VHPA 5C9AC 4WVVA 4I02A 3NJVA 3OSDA 5FY4A 3NNGA 5F39A 3ZVXA 3PU8A 2CWSA 1L7RA 2JEMA 1UMHA 4ZY9A 4DUVA 1XNAA 3FX3A 3KGZA 4OZXA 3T0BA 4Z1VA 3T1MA 2ZX2A 3LSEA 3P6BA 4AQSA 4IETA 1HX6A 2ZEZA 2NN8A 1H0BA 1Z78A 4IDZA 1ZYBA 2D98A 3VBUB 3SCGA 4DY5A 3ZDSA 1JXNA 1OA2A 2ZS6B 3HQXA 3OBAA 4RHV3 5FY7A 5LEKA 3RWKX 4XUPA 1NOVA 1VBA1 1XNTA 2ZAHA 4QQOA 3N4MA 3KHBA 2AGSA 1H6YA 3DKWA 4CP9A 4E4ZA 2WFF2 2HWB1 1VB2A 2LALA 1G9CA 1OUSA 2EICA 4BPZA 2NP0A 2QJVA 2VTXA 1OURA 3AYCA 1TE1B 2HWB2 1GNHA 4KU7A 4LLFA 3M3EA 3ZN4A 3E6CC 5A32A 5FDBA 1DGLA 3MICA 5GKAC 1TQ5A 5LASA 3LAGA 4GB33 1F9KA 1NT0A 2WA4A 3VD7A 2CSGA 4ITCA 4KMQA 2A1XA 4FPEA 4M0NA 1AX0A 5JZGC 4D7SA 4LBOA 4AR2A 2XQXA 1LNSA 1SLBA 2QE3A 2ZMNA 3CU7A 1VAMA 2AEZA 2ETEA 5DAWA 4ES9A 1AXKA 1LB2A 1FPN3 2YBPA 1XSQA 5CKNA 1KJLA 1QJFA 2WN3A 2JDZA 2HWD3 4D7YA 3RMYA 1AR83 4KH9A 1TZOA 2DYCA 1UPSA 2JX9A 4QPYA 4HSJA 3WLUA 1POV0 1RUF2 2ZX1A 3DL3A 2XKPA 4ET7A 4FFHA 3TEWA 1GMMA 1QF3A 1KFUL 1C8NA 1JHNA 4BZ4A 1UD1A 3G7DA 4CCKA 4OHYA 1BBT3 2HWC2 3CO2A 2VW0A 3VHNA 5EJ1B 3WF2A 3S5AA 1O3QA 2JG8A 3GZEA 5F5IA 2CNAA 5C33A 4CUGA 1PM4A 1UOJA 1UYYA 4YVSA 1NA1C 1QJEA 4N90A 4Q0SA 3POFA 2R042 4YM3A 2XJSA 1YEWA 3B94A 1D7PM 1I5PA 4A45A 4O61A 4AI8A 2VZ3A 1H30A 3WINE 1D2QA 4NJ4A 3UJOA 1JYIA 4Y24A 2AEYA 2DCZA 2OA2A 3WVJA 3KVAA 4I01A 4ZXKA 4KQ7A 1F5FA 1WCKA 1LJ7A 3C7EA 3BU0A 3BI3A 5JOWA 4MO3M 1UCXA 3Q9OA 3LZZA 5F2WA 2O8QA 3KHCA 1AR91 3TYJA 2R063 1AR62 1MS8A 3UT0A 1HRV2 1IS6A 4KBZA 2RS52 2OIIA 3OY8A 4KBBA 3WDVA 1RGSA 5FJKA 2K9ZA 4RR3A 2LW8A 3ZXEA 1VLNA 1LEDA 5FY0A 2QVSB 2YBKA 1ND3C 4QKNA 2K2SA 2D6MA 2XG3A 4Z2AA 1OKOA 1G9DA 2OPKA 4HBNA 5JIUA 5CG8A 5FLJA 5CAZA 1W6PA 4G4FA 4AFDA 1Q3EA 3N9OA 3LEKA 5E8AA 2RR12 1HRI1 1RUC1 4AQ6A 2A6XA 1OQDA 1JODA 3N36A 3AMQA 5A1LA 4AVVA 1YXWA 2A5ZA 1HRI2 1RUC2 3FL7A 3GGLA 3HNMA 4ONUA 4URTA 1OLQA 2PHTA 3VBUA 3VUOA 1OUXA 3SEPA 3WF1A 4Y3OA 5JSRA 1UIJA 2D6LX 5FPBA 3O1MA 5HCHA 2BVVA 3N3HA 3POSA 2PELA 2PN5A 2VR4A 2WSVA 4S2HA 1QJX2 5BNOC 4CPBD 2ZXQA 2QQVA 2JG8B 3D3AA 4C8DA 4E4DX 2I74A 3BN6A 1L7QA 4Q29A 1MZ5A 2BGPA 1C8M3 2IXLA 4N53A 3K4AA 1OPOA 5K8SA 5FYTA 4Q4X2 2A7AA 3C7FA 1FAYA 3GBWA 2JDPA 5HBAA 1RJ8A 4LOSA 2ZJCA 1ULGA 4OI2A 2R1BA 2VBDA 1W8HA 1BBT1 1ZBE3 3K77A 1J59A 1I6XA 5BPXA 1H2NA 3ATGA 4Z2WA 1N47A 2GC0A 1S0IA 5DUXA 4L97A 4BQ3A 1UZVA 1NCRB 1IOAA 1EAH3 3MIBA 2R071 3B7MA 5FQ0A 2HBTA 2Y6FA 3P3NA 3WCRA 2GDFA 2XJTA 3MIEA 1V6KA 1W8ZA 4LMFA 1GNZA 2FMDA 1J84A 2VUAA 4TZDA 3N7KA 1J3QA 2J1TA 2R16A 4C0HA 1SG3A 2OZJA 4GQ7A 4K6BA 2JD9A 4XFHA 4BXSV 1JZ8A 4CDQB 1A34A 4QX1A 1SFPA 5FZ1A 3B5LB 1PMHX 2V72A 5T5PA 5B4NA 1MEC3 4AGRA 1I5ZA 4BK4A 5ACA1 1SEFA 1D0HA 2QCSB 4TN7A 1LOAA 2G19A 5FV3A 5J96B 1W03A 1KQRA 4RQPB 1A6CA 5EXOA 1UKRA 2HWF2 3D0JA 3MYXA 4E8DA 5ACA2 5C4WC 4ZONA 2C0ZA 4LO7A 5C8CC 1JH5A 1US3A 2GC3A 2BOIA 4EN8B 3MF6A 4M3CE 5JXJA 1ZRDA 4KWKA 5FO7B 1JN2P 1Y3TA 3S30A 3NW4A 1RUF3 1VMFA 3K3OA 5IAVA 4BQ1A 2FMYA 1WD4A 2VCMA 5CU1A 2MPFA 2HLEA 4IEOA 3KV4A 3S6PA 1GOHA 1ND3B 2PHFA 2B45X 2WFF1 5J36A 1BVVA 2ARXA 1W6OB 2VOWA 2WNUA 3WF0A 4E2QA 2P2KA 3N7JA 4U36A 1LULA 2G1MA 4CDUB 3O1UA 3WW4A 5A80A 2IXJA 2PLV3 2XBO2 2X09A 4NHXA 1JUHA 4J1XA 4BWOA 1GWKA 2WZ8A 1CPMA 3HT1A 1GBGA 4IEZA 1ZZ7A 4HLTA 1POV1 1HRI3 2D6KA 1RUC3 2C24A 3KM5A 5FYSA 4PI0A 2GNBA 1REDA 2X10A 3DXUA 3NVCA 5FBJA 2BYVE 3EBRA 1G8WA 1MR5A 3DPRA 2XDVA 4HKLA 5BNOB 2ZX3A 4EQVA 2WABA 5J3UA 1V6NA 1PIV1 3SCFA 3NAPB 4LO6B 4LOTA 4J25A 1W2AX 4NHKA 4GWJA 3D6EA 4LBLA 1CAVB 1VBA3 1TMF1 3C3VA 4JDOA 4PDWB 4IGPA 4QPGA 1OHFA 3TEXA 1UZ0A 2YMZA 1UY2A 4LO8A 5IYYA 5SV5A 3U75A 3RI8A 1AR71 1Q8SA 2OYZA 5C5TA 3ZFEC 3K4DA 2BJSA 3CLPA 4HFSA 1J1LA 2GH2A 4P5YA 4FAGA 1AYN3 2YB7A 1W04A 3HJRA 2MEV1 3ZYJB 4BMBA 4YVSC 4EWDA 4F7ZA 4HANA 4DFSA 1ZZCA 4WV8A 3VBFA 1W06A 3BGAA 5I8SA 3KQRA 5A6QA 5GLTA 4DNYA 5JZGA 3MBWA 1QMJA 5K9YA 2MEV2 5IVVA 3LA2A 4CP9B 1ST8A 2CAUA 3WUCA 1CZTA 4IE6A 4O9EA 5FUIA 3BTAA 4FOYA 2VC9A 1AX2A 1NE4A 1X33A 2ZBJA 3A23A 5T5OA 1ASJ3 4TXWA 1AXYA 3VDDC 3Q8AA 4WM7A 4XCAA 2FDJA 1AR92 2P17A 1PGL2 2FQPA 2ZHNA 4FPLA 3I97A 3H7YA 3PNAA 4XTPA 4ZS3A 1QEXA 3SCHA 1HRV1 4QX5A 5F3EA 4N7UA 2FBEA 2P6CA 4LNVA 4LTAA 1ND2B 1SLLA 4YNIA 1RJ7A 1SCSA 4DUXA 2IC1A 1NXMA 4XETA 1UWWA 1GZ9A 5D8AC 4INDA 1QWRA 3UL2A 3I59A 1DCSA 3H8UA 5LBBA 5FWJA 5FRAA 2Y34A 5JDBA 1RUJ3 1MS1A 1YO8A 1HV1A 3MLJA 5LZ6A 4GJZA 5AC91 5FZ9A 1WLTA 5LCWL 5C7GA 4LBQA 3T2TA 1POV3 2CAVA 1CAVA 1MS9A 1B35C 3E5XA 5F37A 5A7QA 4AVSA 3NV3A 1O91A 3GHNA 1CAWB 3WNOA 5BNPC 2G4IA 3LEMA 4N7IA 1B35B 5IATA 1HJFA 3QD6A 4OULA 5E6HA 4I3PA 1SCRA 3LB9A 3RYPA 3UESA 2OKXA 3ZN5A 4I0WB 4LBMA 2WS92 4W50A 1K5MC 3BKZA 1VBC3 1X7NA 4CDUA 4XCBA 1XU2A 5JPNB 4JRLA 3ZFGA 4JTNA 1V6JA 3X29B 1IS3A 1RHI3 2DURA 1BK0A 1MZEA 1SZBA 2EF6A 2ZGRA 3O1OA 2WFPA 4XUTA 3ZXJA 3ROUA 1DG6A 2UU8A 3DUIA 1CIWA 3OD0A 1MZFA 2VE1A 3N7MA 3PTYA 2E6VA 4O9GA 1O6UA 4CCCA 3POYA 5DN2A 1KRIA 1UZZA 4AEDB 1CX1A 3RG0A 3TBDA 3NNFA 3N9LA 3RDIA 2VVFA 4YGEA 1W2TA 2YPDA 3ALQA 4RN5A 1C4RA 2WQZC 4RR3B 3T0DA 5TSWA 2RJKA 5KXEA 2WT1A 4FXKB 3VBRB 2OX0A 1TNFA 5DUUA 4DZGA 5HV4A 3HVDA 2BU9A 1VIWB 1YJKA 2DBNA 4WM8B 4Y1ZA 4L9BA 1I9RA 1WMEA 4HETA 4AGVA 4XVHA 4UXAA 1X9TA 3M1HA 1ENXA 5JMOA 4P9IA 4A6SA 3KF3A 1JZ3A 1YFUA 5FZBA 3T4HB 5F5CA 4BLJA 1K45A 1MQTB 5CISA 5D8AA 4JZRA 4TLGA 1NXD1 3WQ1A 4GULA 4PIXA 1HN1A 4Y22A 2WO1A 3C7GA 1X50A 4L8QA 1GV9A 3LDKA 5FXVA 1L7LA 3WF4A 4K8FA 2QNKA 3AB0A 1GR3A 3AMHA 3H7JA 4HZFA 1O4ZA 4MGZE 4XFCA 3W5MA 4YZ2A 5GM0A 3RYKA 4NO4A 1GICA 1VBA2 3CIHA 4LEJA 2AENA 3NKTA 3WP4A 2Z4FA 1ZZ8A 1D0GA 4GH4C 4H55A 3H8XA 1H1IA 4A44A 3OYWA 4FOWA 4QGNA 1CAXB 3SH3A 4LIUA 4COZA 2WZEA 4LHLA 1COV3 5FZAA 4CUCA 2R49A 4RGKA 1QXPA 1UYZA 3VKFC 1X82A 2W0XA 3J9SA 3VN4A 4CXXA 2J42A 4KGGA 5L7OC 1U0AA 2RMU2 4XMAA 4RYDA 1IQDC 3FLPA 4EZHA 5GZGA 5FPVA 1ZBA1 3OOXA 2FCVA 3HBZA 3GBGA 4QGMA 3VV1A 5LY1A 3OGVA 1EPWA 5F8PA 2HEWF 3AJZA 4FFGA 1LRHA 1SFYA 3LIGA 4AE2A 2PLV2 2XBO3 3I4IA 4HONA 1SPPB 4HKOA 3CZJA 3RZZA 4NAMA 3M3CA 1EUTA 5JIAA 1DFQA 3K3NA 3VZMA 1RUD3 4Y33A 3VBRA 1UY0A 5FFOC 2OXBA 1OSGA 2B8MA 1O5UA 3AL6A 1RUF1 5GALA 1GZTA 2WLPA 4UFLA 2BBVA 3USSA 3AVRA 3G6JB 4C0BA 1KGYA 1VB4A 4MYEA 2C6SA 1O5LA 1DZTA 1TMF2 1B35A 4XACA 1YHFA 4LR4A 1R1ZA 3AMMA 1DYPA 1QQP3 2ZCWA 3OUHA 5FZHA 4Q4Y3 1WMDA 1KITA 4Q4V1 2Y6HA 3ACFA 3CQOA 1OC1A 4JDNA 4BXFA 4N43A 2DVDA 4Q1PA 5FCCA 2HWF3 1UL9A 2AREA 2VQTA 3MF9A 2BNOA 3T1LA 3LOBA 1W90A 4BDVB 3OEBA 2VUDA 2BUKA 4RFT0 4Z07A 2X5IA 1YQ5A 3VBFC 4OI1A 1LU1A 4JGYB 4ASKA 2PHUA 4DIQA 3AXEA 5JR2A 1FNZA 2WLQA 2B46X 2C1FA 5FAXA 4FVVA 5FZMA 3RGBA 1A3KA 5LBEA 4PCRA 2D3PA 1IPKA 3OGRA 1O4YA 5FY1A 3VBSA 1FATA 4CDWB 4CCDA 1SLIA 3WG2A 4QHOA 4NHYA 3EXUA 4CSWA 1CPNA 1DGRN 2JIJA 4LXLA 1UXZA 1V9U3 1AR61 4BQXA 4LO5B 1NA1B 2QQJA 1YIFA 4AWDA 2QQPA 5FJHA 3RVHA 1D2SA 2VJXA 2CWMA 5HCBA 4NOTA 2ATFA 3PVNA 4RGAA 3PTRB 2ZKNA 3HAGA 4QX8A 1GOGA 3TB0A 2IFRA 3IPVA 2W2IA 4H14A 4KWJA 3I3EA 4X8NA 5KXBA 3W20A 1WCQA 4EZ4A 3DPRC 4QM8A 4Q4X3 1C57A 5F3IA 1UX7A 1LU2A 2PHLA 5A70A 3J7NA 1XQNA 1HN0A 4EROA 3NAPC 1WW6A 4WM8A 3CZUA 1H9WA 4JQRA 3URFA 4PDWA 4RQPA 1QJU1 4K1ZA 2VNVA 3B69A 4M3CA 4NUBA 4QU1A 5K0UA 3THTA 4BISA 4DXRA 5A3TA 2QQNA 2OZ6A 2Z69A 4QPIC 1QJX1 4XIKA 3H3LA 3JBG3 4QX7A 3E97A 4EN0A 3IT8A 2IVJA 1AXZA 3AZYA 1W28A 1LCLA 2PHWA 2H6CA 3RYRA 1W05A 2WQ4A 1XYNA 4NROA 3M4FA 4P00B 5FXWA 1GQHA 4RSUA 2HH9A 5GLWA 4XZUG 2DTWA 1BJQA 1YQ8A 2WS91 5JZGB 4DINB 5EWSA 4Y1XA 3K46A 3LD8A 1PO13 5KXCA 5C3QA 4DRVA 4X6RB 1CVNA 4MGIE 4E4SA 1R082 2GC1A 3FFQA 3KD4A 4R9BA 2KA3A 3AMNA 1RUG2 2G9GA 1E5HA 1R081 1PIV3 1RL3A 2RS53 2VZPA 5DZGA 2XL7A 1UZWA 1ZZBA 2VBBA 2F4LA 3VDDB 3ZYBA 5ABJA 3O12A 4EN7B 2P3IA 4XFFA 5CKQA 1ULCA 1SLCA 3HT2A 3ZR5A 1NY72 2JDHA 3OBRA 4IERA 5FPXA 3KMHA 4NMIA 2ZAAA 3AJYA 1KJRA 3VZLA 2DU0A 1X8MA 3CBNA 5DG2A 1F35A 3M3IA 1YWKA 1A8MA 3HMYA 2XH6A 5IVBA 5A1FA 3SH5A 1BMV1 3KV5A 3KT7A 4YVSB 1W2OA 2WYFA 4Z8BA 1TNRA 2BNMA 1DYKA 2RDNA 5KHKA 2PHRA 2R043 1OF3A 1VBB3 4XQDA 3ZYHA 3AMPA 2WR9A 1VALA 4Q8KA 1QIQA 4META 5BNNC 5D1IA 3VBOC 2WA3A 2J1SA 1LOBA 1CAWA 4XAEA 2VMDA 4JRAA 3MZHA 3RZLA 4ASLA 5DUVA 3VBOB 4FQZA 3ST7A 1H1AA 3JD73 3POIA 3D0SA 5CB7A 3ZYPA 1ASJ1 4GD4A 1WLCA 4XURA 3UK9A 1RUI3 3V0AA 4MHUA 5LB6A 3RJRA 5AFBA 1RC6A 5C9AB 4JKKA 2Y26A 1JZ5A 4KG8A 3MW2A 1VMHA 4R52A 5JXHA 1CGPA 2C4XA 2Q5TA 4XUNA 3BIWE 5LK7B 1NG0A 3R4SA 1G9BA 1S0BA 4CVUA 1OT5A 4GJYA 1IKQA 5JOYA 3PL0A 2O0OA 5FYUA 5DAVA 5A3MA 5IK5A 2YC2A 1GKBA 4NWWA 4DXZA 1J83A 3TAYA 5J48A 4OHWA 2SLIA 1BLZA 2QQLA 3AKSA 3E1F1 3AP6A 4B4QA 3PVEA 4Q0QA 3IKWA 4JHTA 1PVC1 3OCPA 3MHZA 1Q8QA 3WXPA 2EXJA 4O7XA 3ZPOA 2RS33 2Y8KA 1LECA 4ZPIA 2R0FA 1PVC2 3ZXAC 4JQTA 4AXOA 4Y5TA 3IDBB 5K4LA 3U1XA 3BPZA 1NE6A 2Z42A 2WZPP 3PJYA 2VM9A 5IFTA 1RYYA 3WDTA 3OUJA 5BY5A 3ZR6A 3JQWA 1OOPC 5FLHA 3AVSA 5ABJC 3OPTA 5C8WA 4UW4A 1NUKA 5IFPA 2WYSA 1DF0A 4JGZC 2WRAA 1AR63 1MQTC 4LHKA 1W3XA 3WG4A 1ZRCA 4ARXA 2BOJA 2BGCA 4IE7A 4YW1A 1EV12 2XJVA 4MXWB 4U2AA 2Q8DA 3WHTA 3CHXA 4XFGA 3Q8EA 4PF1A 2VMFA 5EFUA 5GLUA 1SBDA 1EV11 1YRZA 2OUJA 4XUOA 4LBQD 2PYTA 3CMGA 3OPWA 1WMFA 2X8KA 1W6OA 4RR3C 5JAXA 3RZMA 2Q30A 4C1XA 2B9VA 1G86A 4X8PA 2KR2A 4FPHA 1W6QB 3UGGA 1UX6A 2PFWA 3ACIA 5EV7A 4UAPA 4YZ1A 2J1EA 2GAUA 2V4VA 4OZOA 5FQ0B 4LJHA 1E57A 4RS5A 2VD7A 3WW3A 1OMIA 2GNTA 2XXZA 5LEJA 3V64A 4FTEA 2ARAA 2R073 1LHVA 1Q8VA 2VXJA 3FUOA 3NJYA 3TN92 2DWRA 4MADA 2VXRA 3MLKA 4YZ4A 2R7EB 3FLTA 1DU3D 4AVBA 3MLLA 2Y6GA 2QBXA 5FBZA 5IVCA 2E33A 3ZSEA 5BNNA 3R4DB 4LBJA 1YYNA 4AOCA 3IIAA 2RE9A 1SFNA 3CJXA 3WCSA 1RMU3 2GC2A 2JKBA 2Y6JA 1QXRA 2DBIA 1WA4A 1YFXA 3D8CA 3GXUA 1CD3G 5F3GA 1JHJA 4N53C 5CFDA 1L3JA 1AYM3 1ENSA 1MQTA 1S4CA 2NM1A 4HKWA 3VL8A 5A3NA 4Q0PA 4YM1A 3WNXA 2DUQA 1YQ6A 4CDQC 5FZCA 2ZGKA 5EJZB 2B39A 2BFUS 3JU9A 4L92A 1KS4A 3I8TA 3RJ2X 4ZU7A 1U5ZA 1MS0A 3EQEA 3N9PA 3PVBB 5FK7A 1W3VA 2BP6A 2QQMA 3PU3A 4OYUA 4Q0VA 1JYWA 1RUG3 1REFA 3DF0A 2RG4A 2E9QA 2JECA 4AFMA 1XJAA 4I3GA 1F31A 3FN9A 4NRQA 1ENRA 4K3UA 1QNYA 1ZA4A 1LHUA 2JG9B 1K42A 3T30A 2C9AA 4PDWC 4LBNA 1PVC3 3EB7A 2JE9A 1NQDA 1HXS2 1H4HA 3AYDA 1W6MA 3IDAA 2BGOA 4Q27A 2VOTA 1PZ7A 4WM7B 5I0SA 2VBPA 2J1VA 2QQIA 2BFUL 2XPJA 2VNOA 4P14A 1UOBA 2Q8CA 4AEMA 2WIIB 5G05L 4D7TA 5KR7A 3HOBA 2JG8C 3FHIB 3WQBA 4E2SA 3U11A 1ZX5A 2A70A 2Z5WA 3CF6E 4SBVA 4FSJA 4PLMA 5ANNA 5JUVA 2C9KA 4LKFA 2XGXA 1NY71 1HB1A 3WUDA 3H50A 3I2FA 5FYZA 3WR0A 1FMD1 4WVWA 4BJ0A 1NKGA 3GZTB 3WDXA 4XXAA 2FDFA 2FDIA 4XBNA 5BNNB 1BMV2 3I3BA 4N43B 2WJSA 2ZGUA 2HWF1 5JMCA 3SNMA 4NR1A 3VBFB 1VMJA 5A6ZA 4MV2A 1ZNPA 3QCWA 2E7AA 2VOKA 2IXIA 4V1PA 3ACHA 3PUAA 3MGUA 2VZRA 1IHMA 4I09A 4LIVA 2WZR3 2A6VA 3Q8CA 4GWMA 2BTVC 5CFCC 4XPVA 2W87A 2ZACA 3IM0A 3TNPB 4K40A 1W9YA 1WKYA 4FAHA 2CU5A 2UYBA 2HBUA 3SEEA 5L9VA 2P5BA 4QXHA 5E1RA 2XVKA 3W21A 4IE4A 1X36A 3F2ZA 4EWAA 3WOGA 4ATFA 1RUE3 4DXTA 4OHXA 2UWAA 2E32A 4BMEA 2ZEWA 3UETA 3LEGA 4A3ZA 4NHMA 4GMP0 3BTZA 4QQLA 5K7PA 2IXKA 1UQXA 3MV01 4FFFA 4GALA 4NE9A 3R6SA 4P9LA 3LF7A 3HPNA 1RUH1 2ZGTA 1W6MB 3U10A 1VBE3 4XBLA 3QLQA 4R9CA 1N1VA 2TUNA 5KC6A 3VZOA 4OI0A 1PVXA 1MS4A 2WT0A 4XJAA 3O1TA 5IHRA 2PLV1 1PIV2 5DZFA 4Q4Y2 4B4PA 5DAXA 2D6NA 1QDOA 1PGSA 1QJZA 2IXHA 4CCEA 1R1A3 2QQUA 5B4XA 1TMF3 2XL9A 2W46A 4EJRA 2D6OX 1G9FA 2XVGA 3VD3A 5FZOB 1Y43B 4R4XA 4UT5A 2WWSA 4MG2A 4CCOA 2ZMLA 2QQOA 4CDUC 4N53B 2YY1A 2ET1A 3WNPA 4BLIA 1HLCA 3FHQA 5C3SA 1C8M1 1GFF2 2D97A 2JDNA 4YRDA 5ISLA 4M3CB 5K0UB 2RHPA 3B01A 1RHI1 2P3YA 1YQ2A 1UNBA 2G9ZA 4GMP3 3VKLA 4LK7A 1XNCA 2QDNA 3WD5A 3A4UA 1IZ3A 2LM3A 5FZ7A 4COUA 5C3OA 5SV8A 4P9WA 3VBSC 4FPOB 1GNYA 4L99A 1PMIA 4UW6A 1VBE2 1WBLA 4BHPA 5FOJB 1QXJA 5JSPA 4MVTA 4MX3A 3HN1A 2IZWA 1PGW1 1W9WA 5C9AA 1U5XA 3NL1A 3WT3A 4BQ2A 3USUB 2OT7A 3FZ3A 1RUE2 3OGGA 5DDJ1 4A6OA 1DP0A 1DQ2A 2ERFA 2ZTNA 4XYXA 3NNJA 3T2OA 1UY3A 4O65A 1SBFA 3AP9A 4MUVA 3ES4A 2TBVA 1GUIA 4R4ZA 4TYSA 5FYHA 5CNAA 4MGYE 4RL7A 2NLRA 2PAEA 2Y33A 5E88A 1PK6A 5FZ3A 3LDRA 4CP2A 5C6CA 4CTEA 2ZGOA 2YBSA 4XZPA 1MS3A 4FPKA 4WZFA 5CG9A 2B5HA 3DYMA 1W99A 3ZDVA 4CDWC 3FWEA 3T0AA 5AC92 2VL4A 1DQ1A 1N3OA 1I1EA 1QH6A 2WINB 3LIHA 1HJGA 3V56A 1GU3A 1EP0A 4QDRA 4QX3A 5FZOA 1UOFA 4YG0A 4LITA 4QM9A 4COVA 3UNPA 5FZKA 4AFAA 1RIRA 1QJU2 3E6DA 1ZRIA 2RM23 3VDBA 1TME1 4P08A 2A73B 2W1WA 3VGIA 3ENRA 2JDKA 1F8VA 2Q1ZB 1F15A 3M2MA 4FO9A 4XW3A 5F32A 3WDWA 2ORXA 4QAWA 2MHFA 2UWCA 2WO2A 2FHRA 4URAA 2IWGB 4OUMA 2JG9C 3ELNA 4IV1A 4MOAA 4D0QA 5FO9B 5FZ6A 5C71A 4KI5M 1OA3A 3E5QA 1H8TB 2VECA 4QDQA 2CGNA 2ZX0A 3PIJA 4SLIA 5C4WA 3KV6A 2JWPA 2WKKA 4NHLA 3J26N 1H8VA 5FP9A 1RUG1 3AZVA 3WX5A 2XJRA 5HPOA 3LOIA 1U12A 4P9JA 4AHZA 2VUCA 4AK3A 1KFXL 4XF0A 2GP5A 4X6QB 1QOSA 2D5HA 5FY5A 1Y9QA 2R1DA 4YVWC 1D4M1 2ZHMA 3OBTA 2BWCA 1M06G 2WWUA 1J3RA 4Y4RA 2VMCA 2XONA 3CJIA 5FYCA 3WSOA 1EYBA 1D4M2 3I54A 5KHGA 1WW5A 2VOVA 2JDMA 2ES3A 2X29A 3MUZ1 4QHZA 2N7GA 4GKYA 1DGWA 2D5FA 3CJIC 5LBFA 2I2SA 5DG1A 5KC5A 1RMU2 3GM8A 3IMNA 2EIEA 2EIGA 2YG0A 3VKMA 2WO7A 4D69A 4XF9A 1GSLA 4K20A 4XC9A 2R0HA 1CAXA 4LE3A 1NCQA 2CGOA 4Q2FA 4B8EA 4DO0A 2WUHA 4CXYA 3ASIA 3SQOA 4E27A 4UW5A 3N9NA 5A7WA 3RZGA 5C3PA 4FOVA 5FYMA 5I0TA 3VB9A 4XBQA 1UYPA 1OVSA 1W6QA 4KWUA 1WMXA 2BERA 5E89A 5H9PA 1C5HA 2Y0IA 1V9U1 4DEVA 3GALA 3FUQA 2FD8A 1ASJ2 3ZFEA 1H2KA 4I0BA 3MIDA 5C70A 3WQ7A 2VMEA 3VHOA 1VAKA 4JC1A 3GJAA 1LENA 3WZ1A 4AEKA 5BNOA 1GYKA 1SQ4A 4BK5A 1W6PB 1GP5A 1O8PA 2JG9A 4IV1C 1TME3 4COYA 4XXPA 1SPPA 2QQWA 1ZBA2 3L2HA 2YYOA 2GH8A 2E31A 5FP3A 5BV6A 3AFGA 4GWNA 1W0NA 3ACLA 1RUH2 3R05A 4ZHNA 5AVAA 1OQ1A 4Q1RA 4LBQB 2WWJA 1AYN1 4XAAA 1VAVA 1N1YA 2VW2A 3ABZA 3O14A 4Q4Y1 5CBLA 2F17A 3I2DA 3I2JA 1GLHA 1HXS3 3WP3A 1GQPA 3ETPA 1SHWB 1RUNA 3AYEA 5KWRA 5FKBA 2QTWB 3O0XA 4H7LA 5IVJA 5BNPA 1LOGA 3ZMOA 1JZ4A 1QOOA 2YFUA 2CTVA 4AL9A 1H2MA 3PMSA 1VBC2 1IG3A 3NWKA 5IVFA 3ZXLA 5DDJ3 2WS93 4ZXEA 4LORA 4NRMA 1ENQA 1GANA 1XE8A 3PIGA 4JGYA 4PQ9A 3ZMNA 4AFCA 5EYYA 4WBBA 1X9PA 4JHZA 1Y9MA 5I91A 3WNNA 2G9FA 2PAKA 4QPIB 1U5YA 3KB5A 2HWE3 4YLZA 1NCQB 3BOWA 3BVCA 1APNA 1LGNA 1VR3A 3BIEA 5L73A 3FMGA 1AF9A 3GCWA 5F5AA 1OD3A 5H9RA 2ZZJA 4PQQA 5CFDC 4AHYA 2YGMA 5T52A 3UJQA 4CEYB 1NA1A 1AX1A 4Y1VA 5C8CA 5C3RA 2JD4A 2BBAA 3VZNA 2Q1MA 4GB31 4XFBA 4YYOA 1WCSA 3WDUA 1OOPB 3C7OA 4K1YA 5IK7A 3FBYA 2ARBA 5FZIA 4BM8A 2ZKLA 1ULEA 5LA9A 1O3SA 5T5JA 4HPKB 2Y6LA 3AYAA 4QMAA 3RWNA 2IVIB 3AKTA 2DCJA 2VZVA 3RRDA 3JD72 3THDA 3WV6A 3HNBM 5FPAA 3TN91 3KZ4C 3MIFA 5BYNA 4EE2A 3N35A 1AR93 4GKXA 1CZVA 2VU9A 4HVOA 4M4PA 5LRRA 2JDYA 2VGDA 2O1QA 3POEA 4OHZA 3MFAA 4L2NA 2DFBA 2FZ2A 5J37A 3GF6A 1ULOA 3DXTA 1DYOA 1HB4A 4YFZA 4S2FA 4A3XA 1O3TA 3APBA 4CEWC 1UMIA 2VW1A 1BK1A 4B29A 3ORJA 3U0ZA 4JKMA 1VRBA 2RDSA 3BCWA 3OPZA 4LULA 3JB4C 3VBOA 4PJYA 5CVRA 2A6YA 5BNQA 1PO21 3BUCA 5T3NA 4DB5A 4QB6A 5A7SA 2XHKA 1NLRA 3RI9A 4CCJA 4NIHA 2FDHA 1PO22 3WNLA 5JSOA 1QNWA 2QKDA 2Y0OA 4AEDA 2Z2SB 5J1XA 2W39A 4IV3C 4PLOA 2DVGA 5A32B 3RNSA 1XC6A 3OUIA 2HEVF 1AJOA 2ZPXA 1W9SA 4UF0B 3IIIA 1JTZX 3DPRB 5AFEA 2P6HA 1WCDJ 3ZSLA 5A6XA 1AR81 5A3UA 1HW5A 4CDQA 1IGOA 1R083 1CJPA 1W39A 2E7QA 2VOXA 4YM2A 1FPN1 4Q5OA 2TEPA 1PO12 3JXSA 4CUBA 1R091 1VRH1 1WA6X 4W6WA 4WVMB 5FREA 5EJ3A 3RZHA 2B9UA 4NIIA 2UY9A 4OI4A 5LA2A 4QPGB 1PO11 1FV2A 3OB8A 1OFNA 4CA9A 5FWEA 3JZVA 1R092 1VRH2 3AKPA 4UFMA 5D8AB 2WO3A 1FOD3 4AHXA 4B7EA 1HQWA 1QJX3 2WNUC 3PMEA 3B9IA 3AFKA 3PUHA 3BODA 4QPWA 4XHXA 1FOD2 3GHMA 4UFHA 4QQ2A 1AHSA 1RB8G 5F1RA 1YJLA 2ADEA 4GMP1 3U4SA 4B1MA 1DQ4A 4XDPA 1CN1A 4CE8A 1FOD1 1H2LA 1SBEA 5EIYB 4IEPA 3TEYA 1XB9A 4MGTA 5F6KA 4OUEA 2X5IB 2CDOA 3MFCA 3FLRA 4OFGA 4NIDA 1RUI2 4GIQA 5CZKA 3UKTA 1BVP1 3ILRA 1XOYA 2PAMA 2ZZQA 1NCQC 1UIKA 4Y1YA 5I0DA 5IWFA 4YG3A 4MHRA 2F6BA 1CAUA 2VMGA 4JDMA 3J4UH 4FP3A 4FCAA 5DAQA 4BQWA 2J22A 4M3CF 4FPYA 5JXIA 2NZ9A 2RS31 3LGRA 5J98B 1V9U2 2C5DA 1VPHA 4W6YA 1J1TA 2PQSA 4AEDC 1WW7A 1PO23 5IW0A 4XOGA 2LRPA 5DQ0A 1LHWA 3W5NA 2EXKA 1HB2A 1MEC1 4MGSA 5CYYA 2VZOA 2NQYA 3S5QA 1ACCA 1H9PA 1S0EA 1DLCA 4NIGA 3DYPA 4EYUA 1XYOA 1ZA7A 4N9IA 1IQAA 4XDQA 4C90A 3LDBA 4XJ9A 3K51A 4FTBA 1BHGA 2W5FA 5CADA 1NLSA 4AEJA 3WNKA 1EAH2 3FHAA 5F3CA 3MO4A 1ZBE1 2GZWA 1BEV2 1JOPA 5FK8A 1Q8OA 3MPBA 3ZYGA 1QQP2 1XE0A 3SHRA 3POGA 1ZBE2 2VNRA 3AKRA 4HG6B 4W8JA 2AH2A 3NMBA 5FYBA 3ZSJA 2ZGNA 4CCNA 3WW2A 4HSLA 4IEVA 1OF4A 5G04L 2J1RA 3AP4A 1GWMA 4W4ZA 5L7OB 2DVAA 4BCUA 4PBPA 1W8WA 5FMDA 1C8M2 3SKVA 1JOBA 3NJZA 1LGCA 5DUWA 4EV0A 4BQ4A 4YARA 2GMMA 1AUYA 2W1UA 4LQRA 5CKMA 2J7MA 2PHXA 4NPMA 4UF0A 3LFMA 3B00A 4XF3A 3ZIXA 2YC4A 2H0VA 4IV3B 4N9HA 4BU2A 3L2YA 5EHDA 2FZ1A 1CAUB 2XWJB 3JQXA 1F4HA 1S1AA 5T50A 4BOWA 3IAQA 4YW5A 2WN2A 1OLRA 4XABA 4XTMA 3M8LA 1R093 2EVXA 1VRH3 3WQ0A 3ZN6B 2ZGSA 5ABJB 4AYUA 1JU4A 2EA7A 1IKPA 1ND2A 2W95A 3ZYFA 1PMJX 4QB1A 4N43C 5H9QA 3UKNA 3EO6A 2AUYA 1UY4A 5I93A 3BPSA 4QDSA 4XILA 4AG4A 3BTYA 5DDJ2 3SITA 2JDAA 5FLIA 2JB8A 1S2BA 3S7IA 1COV2 2GMEA 5L9BA 3VBHA 3K48A 5KXDA 1UKGA 3CJIB 5L9RA 4M0HA 4RHV2 1JZ2A 3ECQA 3RS6A 5T55A 1OBNA 1V0AA 1OI6A 1O3RA 1BXHA 2GU9A 5A3PA 3JD71 2ZHKA 3ON7A 1HRV3 3KCYA 2VY0A 3QH6A 4RHV1 3ZXGA 4IEWA 5CFDB 4QQPA 1UYXA 4XJ8A 5LA1A 2XR4A 3H1MA 5FY9A 3LA3A 1OFSA 4LUKA 1DZRA 2LROA 3OBZA 3KCCA 3NNMA 2J1AA 2KXLA 3CEWA 1ALYA 5FZGA 1UMZA 1YFYA 1RITA 1QDCA 1UAIA 3J8F1 4HK8A 2AYHA 3R0RA 4A7KA 5F5QA 3CNAA 1GWLA 2K0GA 3GZAA 1PX3A 2YGLA 4BE3A 3P3PA 1OKQA 1PZ9A 3RSJA 3J8F2 3D4KA 1T6BX 2W91A 5EPAA 1WZXA 5APAA 3KLSA 3VD4A 4A42A 2JB4A 1TME2 5F2SA 1P8JA 2XMLA 3IAPA 4GWIA 3ME2A 5A6YA 3C8XA 1MVQA 3NV4A 4MH0E 3QACA 4AGGA 3RFRA 4IEQA 3I3DA 4Z92B 1SMVA 1JYVA 3T2QA 2V5YA 4IV3A 1UPIA 3EJKA 2EAAA 2JIGA 5A7OA 4CEWB 2P4EA 4QQHA 3UYJA 1IS4A 3H1WA 1WW4A 4A2UA 2KM2A 5CEHA 1H6XA 1JMUB 1LKNA 3VD5A 1HXS1 1F2NA 2NPIA 1AR82 1LOFA 4AZZA 1ZZ9A 2D93A 4XF1A 4Y26A 1RUD2 1VBB1 1FPN2 1XE7A 2WNVA 1N1TA 4CU6A 1LOFC 2WQ8A 3I3QA 4CDXC 4P02B 4CYDA 4I30A 1XRUA 4Q26A 2KD7A 3A0KA 1RVF2 3KS7A 5FMBA 3IWZA 1A8DA 1SLTA 5HCFA 5C5UA 4K8RB 4QXKA 4C1WA 4WM7C 1FMD2 5F9TA 2Q4SA 5EZWA 1JS9A 2HWE2 1HB3A 1ZZ6A 2P3JA 5IJRA 2RMU3 1Z0HA 1I3HA 1DGRA 3GCXA 3AZZA 2EIBA 3FE5A 1W8FA 1V6LA 4LK6A 2WNUB 2ZGQA 2CDPA 2HWE1 1RMU1 3BB6A 5LATA 2RS11 4JCKA 2ZGLA 3N7LA 2RVAA 3T2PA 2DVBA 3ZFFA 3NKGA 4BIOA 1DQ0A 2ILMA 3NV1A 2HJIA 5E16A 4IL7A 4BA6A 5GZCA 4CEYA 2ZABA 2Y38A 4TSVA 1FYUA 3PURA 4LBKA 4UFIA 5GZEA 3AKQA 3THCA 4BYYA 5A33A 1W8TA 2P3KA 2RJ2A 2VCCA 5FO8B 3I49A 1QH7A 1VJ2A 4NWVA 3B9CA 3Q8FA 4RS5B 4CDWA 4QWNA 1IPSA 4HN0A 2JENA 5JI7A 4XHBA 2YPJA 5JXGA 2DFCA 5GLZA 1CJDA 5BXXA 4NPRA 3TEZA 1ULFA 2ZEXA 4FT8A 3U14A 2D43A 1OVPA 1JBCA 1ZM1A 3A22A 4Q0UA 3VDCA 1A78A 2ENRA 1LESA 5IK4A 4WVMA 3J8F3 2YXSA 4IEUA 2XHNA 5AC93 3FC0A 1X8EA 4YWAA 4R9AA 3VZJA 4BQYA 4CCLA 1AYN2 3DYOA 3HEIA 5I0UA 3ZSKA 1DZQA 2Q8EA 3O1SA 2VVDA 2WZR1 5ERLA 2VZQA 3ZOIA 3IB3A 2DDUA 1Z7S2 3O0WA 1QGLA 5A3OA 3T3YA 4D6RA 1QQP1 2VZUA 5FTTC 4YW7A 2GALA 3I2HA 4A41A 3MI8A 4QHBA 1HIXA 1S55A 1Z7S1 5I8YA 5LY2A 1XYPA 3H3UA 3E6BA 1VBC1 2JKXA 1RHI2 3FJSA 3AM2A 4Q8LA 4Y4YA 1U5IA 2VH9A 3C7HA 2QZ2A 3V0BA 1V6MA 2GN3A 1JUIA 3NRUA 2QUOA 3I2KA 3K75B 2JDUA 3N9QA 4S2DA 5GZDA 5IVEA 1AVBA 4EN6B 4MGKE 1BKZA 4HVRA 3AZXA 1VBE1 3DN7A 5LA0A 1W2UA 1S0GA 1FMD3 1OA4A 5FKCA 1JZ7A 1UOGA 3HN3A 3BTXA 1PGW2 1V6OA 1WGPA 2XVLA 3MW4A 2X05A 1RVF3 4B3NA 4E9KA 4AI3A 3RZKA 1PZ8A 1K3IA 1ULPA 4IESA 2D6PA 3LKJA 1XBFA 4CDXA 1F5JA 1PK6B 4ZS2A 1DGWX 4NVPA 1ND2C 4XJZA 1JOJA 1KEXA 1RUE1 2GN7A 2A6WA 3ZFFC 2UURA 2W1QA 1RUJ2 4EN9B 2DCYA 3WG3A 2E26A 2VCBA 3LCPA 4IGQA 5HCAA 3J7MA 1KD7A 2NMOA 4H7MA 4QPGC 1W9TA 1COV1 3J7HA 4YW3A 2YU1A 3IDEA 4PLNA 4AFBA 1YCIA 2W9XA 3VZKA 1S0CA 4D6QA 1FNYA 2O8OA 5LW9A 3I2GA 1R1A1 5FZFA 4IXLA 2LTNA 3VBRC 3VL9A 3IN9A 3ZFGB 4DOUA 5IAXA 2VUJA 5A7WB 4OMDA 4E2GA 2CL2A 1YQCA 1NCRC 3ILFA 4IEYA 2R32A 4QD2A 2BVBA 1RTVA 4UYBA 3HNYM 5FZEA 3PUQA 3ZFEB 3IDCB 2GP3A 2QDRA 2SBAA 2VZTA 3P5BA 5H9SA 4CEYC 4WVZA 1HQNA 4A4AA 3KF5A 4HN1A 4J6GA 2A75A 1AL23 1FI2A 2HYXA 2ORZA 4NRPA 3LEIA 2XJPA 4PBOA 5JWPA 3VDDA 3WY6A 1OPMA 1DQ6A 3OGSA 5FMOL 5D21A 5T54A 4AAPA 4QT6A 4Z82A 1D4VB 2R6QA 4FI9A 5FPLA 2GSYA 2EIDA 4MZUA 5HXMA 3PJQA 4XJWA 4Y1UA 5FUNA 1GOFA 3KT1A 3UKVA 3SH4A 2D44A 2HWD1 3INAA 3LWCA 5FUPA 3T4VA 3S57A 1J3PA 1RUD1 2IUWA 1ZRFA 4E4HA 3LE0A 3I2IA 4UFKA 4MSVA 2BPA2 2P37A 2Q0AA 4GZ9A 2R041 3O1PA 2CY6A 3OJBA 4AVTA 4IGOA 3SLIA 4XFIA 1W0PA 3HWJA 1DDLA 5EYXA 3D5OA 3ZO0B 2JJ6A 4HMZA 4Y5Z0 3A21A 2XUEA 3THPA 4JGZA 5IK8A 2Y60A 3ZYRA 4XJUA 3VBHC 4RGGA 3S7EA 1US2A 1RXGA 3UV9A 1DLLA 2QQKA 1W0OA 2CHHA 3NNLA 4JV4A 4M00A 1UF2C 3POWA 4UBHA 1XNDA 3RPQA 1RUI1 1PX4A 3ZIWA 1B09A 2QZ3A 5F6LB 4IE5A 4XDOA 4IW3A 4XE9A 3VBUC 1WWYA 2DU1A 1OLME 1O8SA 4LE4A 2GMPA 3M3OA 4JAAA 1LHNA 3AC0A 4L11A 1HDKA 1EUUA 4ATEA 4BB3A 1S0JA 1M4WA 3POBA 5LRSA 1CWPA 2BQPA 3QOPA 2EAKA 3VBSB 1Q5OA 2TNFA 3VKOA 1CONA 2RS13 4EWEA 2AR6A 1BEV3 5EQUA 4HPKA 3U78A 2RDQA 2H6BA 2WNEA 1J58A 4BH9A 4LHSA 5ACA3 1CQ9A 2R062 4TTGA 4COWA 5LWBA 3USUA 2OUHA 1SDDB 4XQ4A 1K5MA 2BNNA 1NZIA 3GBFA 2R061 3OTFA 3ZKUA 3ZXDA 1MEC2 3NSTA 5ANQA 3PDQA 1AYM2 2D3RA 4RFRB 4LKDA 5T5LA 2A3XA 3H42B 4IQPA 1OXCA 4YW4A 4AQTA 3GZUC 1EPZA 4K9SA 4TWTA 1XNBA 2IXCA 2PQQA 2OS2A 2UY8A 3ETQA 3KVBA 4AF9A 4CP0A 4AI9A 4QKBA 4XMIA 1XXNA 2DCKA 2L9LA 1EAH1 2H0BA 3B02A 3CL1A 1POQA 1O59A 1XU1A 1YC61 4XEZA 4OQ8A 4JKLA 4YM0A 2HKXA 4MLOA 2WZR2 2HWC3 3F95A 4MGQA 1Y4WA 3WDYA 1BBT2 1MACA 2W94A 4XUQA 4IV1B 4Y5SA 4N8MA 1TEIA 2V73A 1KXGA 3RMXA 4JGYC 1W6NA 2YFZA 1WLWA 2I07B 2GNDA 3B93A 4FFIA 3H8RA 2XOMA 1Q56A 2ID4A 3BU7A 4S2GA 5FYYA 5CFCB 3ILNA 4UOJA 3ZFFB 3H8OA 4GA9A 3GYDA 1VP6A 1CR7A 2FCTA 3LPGA 4QKDA 1Y9GA 2XLGA 3O1VA 1V00A 1VBD3 1BCXA 4QGLA 2A71A 1UZYA 2A6ZA 2VO5A 4CPBA 1GZWA 2LS6A 1GZCA 1YUDA 3OF1A 4ISQA 4FOQA 3SC7X 4GB32 1EV13 2WNVB 2ZMKA 4CEWA 1UY1A 2X53S 4RD7A 3W9AA 4QX0A 4YVWB 1UO9A 3WG1A 4KG0A 5FYIA 4ZZ5A 4YFWA 2AACA 3SMHA 2RR13 4LA3A 4XF4A 5IUQA 3DEMA 1RUJ1 3EHKA 5LK5A 5FXXA 5JLVA 3JCIA 5JOZA 3WNMA 1S0DA 4CU9A 5A7NA 4OMCA 3ZX7A 5FZDA 5I8TA 2ZGPA 3KT4A 4PHZA 3TNQA 4ORFA 5JCTA 3S0MA 5GJ6A 4D6SA 4G9SB 5KBFA 4P9GA 1MZ6A 2WSUA 4YZ5A 1KDKA 2Y6KA 3TRSB 4FP2A 3W59A 2BZDA 2BV4A 4YGBA 4KL1A 2P34A 3ITQA 1NZCA 2VQ0A 4LHNA 4LKSA 4P5HA 1FXZA 2DUOA 4OVEA 4JGZB 1JYCA 1YLLA 5K0UC 4QXCA 1GP4A 1O7FA 3O7OA 2RM21 1NCRA 3GDBA 5FMOS 1UU4A 2MNGA 3LQCA 2ZX4A 5FPUA 5FP8A 2YZ4A 1YI7A 4CP1A 3OYWB 3WP6A 4IE0A 3K4ZA 3M7AA 1YI9A 1RXFA 4CU8A 1XSRA 1GQGA 4AI0A 4I0AA 4RS5C 1DQ5A 2YHJA 5FZ4A 1E5SA 5FIXA 2EXIA 3NQHA 4D3WA 1SACA 2BWAA 2V4AA 1F4AA 3DCQA 1RINA 3H1YA 3OG2A 3LA7A 4IUGA 3TN93 2WC2A 3AP5A 4QKFA 3MW3A 4I2OA 1OLMA 4KU8A 1HQLA 3I2OA 4HL0A 2WAAA 4NN0A 4KGQA 4RQPC 2XWBB 4ZU4A 3WF3A 1ULDA 5DMYA 1W2NA 5HXVA 5FP4A 4CU7A 4L0PA 1T6GC 1FV3A 3NAPA 4WM8C 3K2OA 4D8MA 5HV0A 2FDGA 1VBB2 4UBGA 3VBHB 2HWD2 2RJLA 4ZU5A 2F4PA 2WDBA 1AR72 3N9MA 2YUEA 4NAOA 1QY4A 3WW1A 1K12A 4FTSA 4HT1T 3QBQA 5FMCA 1QU0A 4DUWA 1NAEA 5A7PA 3CKHA 5L7OA 1JYNA 4F83A 4WZCA 4XIOA 1RVF1 2ZOEB 4Y22B 1ND3A 1H4GA 4YGDA 5AVPA 3JB8A 5L36A 3NO8A 2BW8A 4E8CA 3TWIA 2VNGA 1K5JA 4GXLA 5FOBB 1FX5A 2D40A 1G7YA 1LR5A 1KS5A 2HWB3 2W92A 4AI1A 1QHDA 1G6NA 4W6XA 2RS12 1KDMA 3WHUA 2VMHA 5JPMB 3GJBA 2PXJA 5HI0A 5C8CB 4QPIA 2WT2A 1NQJA 1LGBA 2WFF3 4DQAA 1WD3A 2E63A 1JYTA 3V0AB 4F3JA 2YV8A 3I7DA 1ODNA 3O5SA 1S2KA 1V70A 2W08A 4FPJA 5DABA 5FZLA 2XLAA 3PUSA 5IT6A 2WAOA 4HOOA 1LOCA 2RS32 1QOTA 2VZSA 3VLBB 2V09A 2W52A 2YROA 2RR11 5FPZA 4MXVA 4Y20B 3I3MA 1YFWA 5A1AA 1W8NA 3DGTA 1MPXA 2PHDA 2Q8OA 1WUVA 1JI6A 3VKNA 1RUH3 5JOXA 2FCUA 3OEAA 5M0TA 2E51A 2DF7A 5FZ0A 1OH4A 3IMMA 1JYXA 3I59B 4YPJA 3KV9A 4YVWA 2J1UA 1VBD2 1ZBA3 1AYM1 3ACGA 3AZWA 1AZDA 2UYAA 4CZSA 5GLVA 4XFAA 2BDRA 3P1IA 2UWBA 5BNPB 1NX9A 4LO4B 3H9AA 3V65A 1UN1A 3E5UA 3NJXA 1VBD1 1WCUA 1DBNA 1ZRRA 3KQ4B 5DZEA 4CCMA 1Q8PA 1BEV1 1QJY3 1WLDA 4Q4W3 4Q4X1 4Q4V3 1BZWA 4V2WA 4YW6A 1ZVFA 3VD9A 3SKJE 1OH3A 3MV11 5J09A 4YG6A 1JU3A 2VG9A 2O14A 2IFWA 2ET7A 3ZM8A 2ZA9A 2VTXJ 5GZFA 3WEZA 1MVEA 3HIFA 3MEPA 4KWLA 4QU2A 4FPGA 4PIZA 1AL21 1CZSA 4MXWA 4YSFA 4QXBA 2DTYA 4DY3A 3ZXFA 1H8TA 3TOJA 3D82A 1MS5A 1AL22 4XQWA 2XKOA 3ZKYA 2HYKA 3BOPA 3ZSMA 3U37A 4LPLA 3ZPYA 5CIRA 5A33B 2W68A 2VQAA 4GH4B 1QKQA 4AVAA 1LAJA 2E7TA 2YC0A 1D4M3 3CDZB 3OY8B 1CESA 1O4TA 3MPPG 1IG0A 2PTMA 2Q1FA 2CYFA 1SLAA 4W65A 3U07A 1UXXX 3AXDA 3BALA 4ISRA 2P1BA 3FBMA 4BQ5A 3DECA 1DHKB 1IS5A 2R30A 1Y7BA 3AL5A 3J7LA 1NLQA 3AK0A 1C28A 4ASMB 2A3YA 4NIAA 1CX4A 2VPVA 2DVFA 1PK6C 4R9DA 1C1FA 2XB6C 4UWDA 3VHRA 1E5RA 5FR3A 1URXA 2JE7A 3MIHA 3PVOA 4BIFA 2VULA 1TVGA 1H8TC 2HEYF 3M70A 4H3WA 2W47A 4CXWA 4LT5A 3JBG1 2VVEA 5KHIA
chains in the Genus database with same CATH topology
2YDEA 4RA0A 1R1A2 2B42B 3NV2A 2PA7A 3C2UA 3JBG2 2XBO1 1AJKA 1XNKA 2ZGMA 4FQ4A 4KNCA 2D3SA 1V6IA 4K7JA 2RMU1 1Q43A 2RM22 5B2GB 1H1MA 4DPNA 1QJU3 3V0BB 3ZFGC 1NYWA 4C91A 2WL1A 2B7YA 5JI9A 2AZ5A 2E53A 1K5MB 4OHVA 5JVVA 1C5IA 1RUOA 3JUUA 4LLOA 4AVCA 1GZWB 3LSDA 4AW7A 2CV6A 4G3YC 4FPFA 4Y20A 2HWC1 4P9YA 2EALA 1AL0G 1N3PA 3WP5A 4B7KA 4PF5A 3KGLA 4F8AA 4B4RA 4HK9A 1ZREA 1PHMA 2BEOA 1HV0A 4Q4V2 2DUPA 3H0OA 1BYHA 3U4XA 1C3HA 3OGJA 5I0RA 4K21A 1LHOA 2VMIA 3HD8B 4OUSA 5CA6A 1BQPA 4P9XA 2LUWA 5BUVA 5KHJA 1W6NB 1PNFA 1LEMA 4HVQA 3L9JT 2NYYA 4YW2A 2ZHLA 4DMIA 1SDWA 2RS51 3A0NA 2JXAA 1PGL1 1LOEA 4ES8A 4GH4A 1ONAA 1YIPA 3M3QA 5CFCA 1DIWA 2DV9A 3O0VA 5DXDA 4JVAA 1IPJA 3PLQA 2DCTA 4AQ2A 2NMNA 4CDXB 4ZKTB 2XLFA 3ZXKA 3B3QE 2XJQA 3IBMA 3R4UA 1EY2A 4FPCA 4IEXA 2EXHA 3AX4A 2X5IC 3KSCA 3ZYIB 1PM7A 2Z79A 2WNVC 4AHWA 3DV8A 4D94A 3AP7A 1UW8A 4OLLA 3W58A 4FBFA 1G9AA 3MIGA 2GNMA 3OD4A 4R8HA 1OQEA 1REEA 4A7YA 1N3QA 3H3ZA 4YGCA 4J1WA 1WBFA 1UU5A 3MDPA 5JR7B 3GNEA 2I45A 4UW3A 3SISA 2D7FA 1AR73 2QFEA 3FFZA 4CRQA 5KHHA 1FT9A 4LA2A 1S0FA 1Z7S3 3ES1A 1C1LA 3KCXA 3SXWA 4AI2A 1OD5A 2R072 4YZ3A 4FXGB 5A3LA 2XUMA 4JTOA 4M01A 3ZN6A 4DS0A 4LUMA 5J7MA 1UU6A 1OOPA 2A3WA 1QJY2 4Q4W2 3RQ0A 1LODA 3PHMA 1PNGA 4TLFA 3QH7A 2XJUA 4DRRA 4PIYA 5L19A 1QJY1 2JICA 2OVUA 4Q4W1 4A7ZA 2CGPA 1YNAA 2MEV3 1HKDA 1N1SA 3HR9A 3IPVB 2OW4A 1LTEA 1JW6A 5C4WB 3VHPA 5C9AC 4WVVA 4I02A 3ZVXA 2CWSA 2JEMA 3FX3A 3KGZA 4OZXA 4Z1VA 3T1MA 2ZX2A 3LSEA 4AQSA 4IETA 1HX6A 2NN8A 1H0BA 1Z78A 1ZYBA 2D98A 3VBUB 3SCGA 4DY5A 3ZDSA 1JXNA 1OA2A 2ZS6B 3HQXA 4RHV3 5LEKA 1NOVA 1VBA1 2ZAHA 4QQOA 3N4MA 2AGSA 3DKWA 4E4ZA 2WFF2 2HWB1 1VB2A 2LALA 1G9CA 4BPZA 2NP0A 2QJVA 3AYCA 1TE1B 2HWB2 1GNHA 4KU7A 4LLFA 3M3EA 3ZN4A 3E6CC 5A32A 5FDBA 1DGLA 3MICA 5GKAC 1TQ5A 3LAGA 4GB33 1F9KA 2WA4A 4ITCA 4FPEA 4M0NA 1AX0A 5JZGC 4D7SA 4LBOA 2ZMNA 1SLBA 2QE3A 3CU7A 1VAMA 2ETEA 1LB2A 4ES9A 1AXKA 1FPN3 1KJLA 2JDZA 2HWD3 4D7YA 3RMYA 1AR83 4KH9A 2DYCA 1UPSA 2JX9A 4QPYA 4HSJA 3WLUA 1POV0 1RUF2 2ZX1A 3DL3A 2XKPA 1QF3A 1KFUL 1C8NA 1JHNA 4BZ4A 1UD1A 3G7DA 4OHYA 1BBT3 2HWC2 3CO2A 2VW0A 3VHNA 1O3QA 2JG8A 2CNAA 5C33A 4YVSA 1NA1C 4Q0SA 4N90A 2R042 4YM3A 2XJSA 3B94A 4AI8A 1H30A 3WINE 1D2QA 3UJOA 4Y24A 2DCZA 2OA2A 3WVJA 4I01A 4ZXKA 4KQ7A 1F5FA 1WCKA 1LJ7A 5JOWA 1UCXA 3Q9OA 3LZZA 2O8QA 1AR91 3TYJA 2R063 1AR62 1MS8A 1HRV2 1IS6A 2RS52 2OIIA 3OY8A 4KBBA 3WDVA 1RGSA 2K9ZA 4RR3A 3ZXEA 1VLNA 1LEDA 2QVSB 1ND3C 1G9DA 2K2SA 2D6MA 2XG3A 2OPKA 4HBNA 5JIUA 5CG8A 5FLJA 5CAZA 1W6PA 4G4FA 4AFDA 1Q3EA 5E8AA 2RR12 1HRI1 1RUC1 4AQ6A 2A6XA 1OQDA 3N36A 3AMQA 4AVVA 1YXWA 2A5ZA 1HRI2 1RUC2 3VUOA 4URTA 4ONUA 3VBUA 1OLQA 2PHTA 5JSRA 1UIJA 2D6LX 2BVVA 3N3HA 3POSA 2PELA 2PN5A 2WSVA 4S2HA 1QJX2 5BNOC 2JG8B 4E4DX 2I74A 4Q29A 1MZ5A 4N53A 1C8M3 2IXLA 1OPOA 5K8SA 4Q4X2 2A7AA 1FAYA 3GBWA 5HBAA 1RJ8A 2ZJCA 1ULGA 4OI2A 2R1BA 1BBT1 1ZBE3 1J59A 1I6XA 5BPXA 3ATGA 1H2NA 4Z2WA 1N47A 2GC0A 1S0IA 5DUXA 4L97A 1NCRB 1IOAA 1EAH3 3MIBA 2R071 3B7MA 5FQ0A 3P3NA 3WCRA 2GDFA 2XJTA 3MIEA 1V6KA 1GNZA 2FMDA 2VUAA 4TZDA 3N7KA 1J3QA 2R16A 4C0HA 4GQ7A 2OZJA 4XFHA 4K6BA 4CDQB 3B5LB 5T5PA 1MEC3 4AGRA 1I5ZA 5ACA1 1SEFA 1D0HA 2QCSB 1LOAA 5J96B 1KQRA 4RQPB 1A6CA 5EXOA 1UKRA 2HWF2 3D0JA 3MYXA 5ACA2 5C4WC 2C0ZA 4LO7A 5C8CC 1JH5A 4EN8B 2GC3A 3MF6A 4M3CE 1ZRDA 4KWKA 5FO7B 1JN2P 1Y3TA 3S30A 3NW4A 1RUF3 4BQ1A 2FMYA 1WD4A 5CU1A 2MPFA 4IEOA 3S6PA 1ND3B 2PHFA 2B45X 2WFF1 5J36A 1BVVA 2WNUA 1W6OB 2ARXA 2VOWA 4E2QA 2P2KA 3N7JA 4U36A 1LULA 4CDUB 3WW4A 2IXJA 2PLV3 2XBO2 1JUHA 4J1XA 4BWOA 3HT1A 1CPMA 1GBGA 4IEZA 1ZZ7A 4HLTA 1POV1 1HRI3 1RUC3 2D6KA 3KM5A 2GNBA 1REDA 3NVCA 2BYVE 3EBRA 1G8WA 1MR5A 3DPRA 4HKLA 5BNOB 2ZX3A 5J3UA 1V6NA 1PIV1 3SCFA 3NAPB 4LO6B 4NHKA 3D6EA 4LBLA 1CAVB 1VBA3 1TMF1 3C3VA 4JDOA 4PDWB 4QPGA 1OHFA 2YMZA 4LO8A 5SV5A 3RI8A 1AR71 1Q8SA 2OYZA 3ZFEC 3CLPA 4HFSA 1J1LA 2GH2A 4FAGA 1AYN3 3ZYJB 2MEV1 4BMBA 4YVSC 4EWDA 4F7ZA 4HANA 4DFSA 1ZZCA 4WV8A 3VBFA 5I8SA 5JZGA 5K9YA 3KQRA 5GLTA 4DNYA 1QMJA 2MEV2 3LA2A 2CAUA 3WUCA 4O9EA 3BTAA 4FOYA 1AX2A 1NE4A 1X33A 2ZBJA 5T5OA 1ASJ3 3VDDC 1AXYA 4WM7A 1AR92 2P17A 1PGL2 2FQPA 2ZHNA 4FPLA 3H7YA 3PNAA 4XTPA 3SCHA 1HRV1 4QX5A 4N7UA 2FBEA 4LNVA 4LTAA 1ND2B 1SLLA 4YNIA 1RJ7A 1SCSA 2IC1A 1NXMA 4XETA 1GZ9A 5D8AC 4INDA 1QWRA 3UL2A 3I59A 3H8UA 1G9BA 5FRAA 5JDBA 1RUJ3 1MS1A 1YO8A 1HV1A 3MLJA 5AC91 1WLTA 4LBQA 3T2TA 1POV3 2CAVA 1CAVA 1MS9A 1B35C 3E5XA 4AVSA 3NV3A 1O91A 3GHNA 1CAWB 5BNPC 2G4IA 4N7IA 1B35B 3QD6A 4OULA 4I3PA 1SCRA 3LB9A 3RYPA 3ZN5A 4I0WB 4LBMA 2WS92 1K5MC 1VBC3 1X7NA 4CDUA 5JPNB 1XU2A 4JRLA 3ZFGA 4JTNA 1V6JA 3X29B 1IS3A 1RHI3 2DURA 2ZGRA 1MZEA 2EF6A 2WFPA 3ZXJA 3ROUA 1DG6A 2UU8A 3DUIA 1CIWA 3OD0A 1MZFA 3N7MA 3PTYA 2E6VA 4O9GA 3POYA 1KRIA 1UZZA 4AEDB 3RG0A 3TBDA 3RDIA 2VVFA 4YGEA 3ALQA 1C4RA 2WQZC 4RR3B 5TSWA 2RJKA 5KXEA 2WT1A 4FXKB 3VBRB 1TNFA 5DUUA 4DZGA 1VIWB 1YJKA 4WM8B 4Y1ZA 4L9BA 1I9RA 1WMEA 4HETA 4AGVA 4UXAA 3M1HA 1ENXA 4P9IA 1YFUA 4BLJA 1MQTB 5D8AA 1NXD1 3WQ1A 4GULA 4PIXA 4Y22A 1X50A 4L8QA 1GV9A 4K8FA 2QNKA 3AB0A 1GR3A 3AMHA 3H7JA 4HZFA 1O4ZA 4MGZE 4XFCA 4YZ2A 5GM0A 3RYKA 4NO4A 1GICA 1VBA2 4LEJA 2AENA 3NKTA 3WP4A 1ZZ8A 1D0GA 4GH4C 4H55A 1H1IA 3OYWA 4FOWA 4QGNA 1CAXB 3SH3A 4COZA 4LHLA 1COV3 2R49A 1QXPA 3VKFC 1X82A 2W0XA 3J9SA 3VN4A 4KGGA 5L7OC 1U0AA 2RMU2 4XMAA 3FLPA 5GZGA 1ZBA1 3HBZA 3GBGA 4QGMA 3VV1A 1EPWA 2HEWF 3AJZA 1LRHA 1SFYA 4AE2A 2PLV2 2XBO3 3I4IA 4HKOA 3RZZA 3M3CA 5JIAA 1DFQA 3VZMA 1RUD3 3VBRA 5FFOC 1OSGA 2B8MA 1O5UA 1RUF1 5GALA 2WLPA 2BBVA 3USSA 3G6JB 4C0BA 1VB4A 4MYEA 1O5LA 1DZTA 1TMF2 1B35A 1YHFA 4LR4A 1R1ZA 3AMMA 1DYPA 1QQP3 2ZCWA 4Q4Y3 1WMDA 1KITA 4Q4V1 4JDNA 4N43A 2DVDA 4Q1PA 5FCCA 2HWF3 1UL9A 2AREA 3MF9A 2BNOA 3T1LA 3LOBA 2BUKA 4RFT0 4Z07A 2X5IA 3VBFC 4OI1A 1LU1A 4JGYB 2PHUA 3AXEA 1FNZA 2WLQA 2B46X 2C1FA 5FAXA 4FVVA 1A3KA 4PCRA 2D3PA 1IPKA 3VBSA 1O4YA 4CDWB 1FATA 1SLIA 3WG2A 3EXUA 1CPNA 1DGRN 1V9U3 1AR61 4LO5B 1NA1B 4AWDA 1YIFA 2QQPA 1D2SA 5HCBA 2CWMA 4NOTA 2ATFA 3PVNA 4RGAA 2ZKNA 3HAGA 3TB0A 2IFRA 3IPVA 4H14A 4KWJA 4X8NA 5KXBA 3DPRC 4QM8A 4Q4X3 1C57A 1LU2A 2PHLA 1XQNA 4EROA 3NAPC 1WW6A 4WM8A 1H9WA 4JQRA 3URFA 4PDWA 4RQPA 1QJU1 4K1ZA 4M3CA 3B69A 5K0UA 3THTA 2OZ6A 2Z69A 4QPIC 1QJX1 4XIKA 3JBG3 3E97A 4EN0A 3IT8A 1AXZA 3AZYA 1LCLA 2PHWA 2H6CA 3RYRA 2WQ4A 1XYNA 3M4FA 1GQHA 4RSUA 5GLWA 2DTWA 1BJQA 2WS91 5JZGB 4DINB 5EWSA 4Y1XA 1PO13 5KXCA 4DRVA 4X6RB 1CVNA 4MGIE 4E4SA 1R082 2GC1A 3FFQA 3KD4A 4R9BA 3AMNA 2KA3A 1RUG2 2G9GA 1R081 1PIV3 1RL3A 2RS53 5DZGA 2XL7A 1ZZBA 3VDDB 5ABJA 3O12A 4EN7B 2P3IA 4XFFA 1ULCA 1SLCA 3HT2A 1NY72 3OBRA 4IERA 5FPXA 3KMHA 2ZAAA 3AJYA 1KJRA 3VZLA 2DU0A 1X8MA 5DG2A 3M3IA 1YWKA 1A8MA 3HMYA 2XH6A 1BMV1 3SH5A 3KT7A 4YVSB 4Z8BA 1TNRA 2BNMA 1DYKA 5KHKA 2PHRA 2R043 1VBB3 4XQDA 3AMPA 1VALA 4Q8KA 4META 5BNNC 5D1IA 3VBOC 2WA3A 1LOBA 1CAWA 4JRAA 3MZHA 4ASLA 5DUVA 3VBOB 4FQZA 3ST7A 1H1AA 3JD73 3ZYPA 3D0SA 5CB7A 1ASJ1 1WLCA 3UK9A 1RUI3 3V0AA 5AFBA 3RJRA 5C9AB 1RC6A 2Y26A 4KG8A 3MW2A 1CGPA 4R52A 2Q5TA 3BIWE 5LK7B 1NG0A 3R4SA 1S0BA 1IKQA 5JOYA 2O0OA 5A3MA 5IK5A 4NWWA 1GKBA 4DXZA 3TAYA 5J48A 4OHWA 2SLIA 4B4QA 3AKSA 3AP6A 3PVEA 4Q0QA 3IKWA 1PVC1 3OCPA 1Q8QA 3WXPA 2EXJA 2RS33 1LECA 2R0FA 1PVC2 3ZXAC 4AXOA 3IDBB 3BPZA 1NE6A 2Z42A 2WZPP 3PJYA 3WDTA 5BY5A 3JQWA 1OOPC 5FLHA 5ABJC 5C8WA 4UW4A 1DF0A 4JGZC 1AR63 1MQTC 4LHKA 3WG4A 1ZRCA 2BGCA 4YW1A 1EV12 2XJVA 4MXWB 4U2AA 3WHTA 4XFGA 5EFUA 5GLUA 1SBDA 1EV11 1YRZA 2OUJA 4LBQD 2PYTA 1WMFA 2X8KA 1W6OA 4RR3C 5JAXA 2Q30A 4C1XA 1G86A 4X8PA 4FPHA 1W6QB 1UX6A 2PFWA 5EV7A 4YZ1A 2GAUA 5FQ0B 1E57A 4RS5A 3WW3A 1OMIA 2GNTA 5LEJA 4FTEA 3V64A 2R073 1LHVA 1Q8VA 3FUOA 3TN92 2DWRA 2VXRA 3MLKA 4YZ4A 3FLTA 1DU3D 4AVBA 3MLLA 5FBZA 3ZSEA 5BNNA 3R4DB 4LBJA 1YYNA 3IIAA 2RE9A