5T5FA

Neisseria meningitidis factor h binding protein in complex with monoclonal antibody jar5
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
226
structure length
226
Chain Sequence
GLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neisseria meningitidis factor H-binding protein bound to monoclonal antibody JAR5: implications for antibody synergy.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
molecule keywords Factor H binding protein variant B24
total genus 53
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2016-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 5t5fA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5t5fA01
4AYDC 4AYNA 3PQUA 3VE2A 2YPVA 3HOLA 4AYMC 4Z3TA 4U9CA 4O3XB 3HOEA 5T5FA 4O49A 3V8UA 2W81C 4O3WA 3UAQA 4O4XA 3VE1A 4O3ZA 3PQSA 1YS5A 2KC0A 4AYEC 2KDYA 2W80C 5EE2A 2Y7SA 4QQ1A 4AYID 3KVDD 4O4UA 4O3YA 2LFUA
chains in the Genus database with same CATH superfamily
1RAMA 4JQIA 5EF3A 3VTMA 4O2EB 4DAGH 2IXQA 3FT3B 5DYFA 3W3BA 3UTPD 2YGPA 1F56A 5DZLA 3LKRB 3UYOD 5ID1A 4KQ0A 2E27H 4PV1C 4OF6A 3VA2C 1XDTT 3ETBF 3NSDA 4JO4H 5EUKA 1KYUA 5FGCB 2AXWA 3I50L 4X5QA 1RU9H 1B0GA 1HWHB 2RA1A 5HVFB 3RZWA 1Q72H 1Y07A 2QVKA 4IU2A 3Q8AA 4PJXE 2ICWJ 1MCCA 3SQBA 3HNVL 3DJRA 3OKEB 3LZPA 3CFMA 1E50A 3EAKA 3OAUL 1MFBL 2YLHA 1BVLA 3BWAB 1RUKH 3PGFH 3SDCD 4ANKA 4HHWA 5T8IA 4LEEA 2PO6B 4APQB 1U8JA 3V0FA 4ABQA 2EYTB 1IZNA 3HFFA 3VXOB 1N19A 3E9UA 4J3OC 2EILB 1LP9E 4J12A 4Y16A 2PW2B 2FO1A 1T3FB 4N25A 3UMTA 2ZUUA 2NW3B 3L4TA 2CKBH 5AZUA 3FBQA 3EJYC 3G5YA 3SEPA 4BA8A 5C0CD 4XP9L 5I0DA 1NH6A 2LQRA 2X1QA 4L4VA 4FRTA 4YBQD 3NSJA 5AOIA 3GB7B 4YFLI 4JO2L 3GSVB 1XVSA 5E8DH 4P48A 4Q14A 4HA1A 5IFJA 3QDMA 3BGFB 4AWJC 4GW5A 1DBBL 1CF8H 2W38A 2ZONA 2HVJA 5FKAB 4TVUA 4Q9RH 2XWEA 2V6HA 1FNSH 3ARPA 4X7SH 4JRYB 4HBCL 4AGMA 4LASH 3ROOB 5GJTH 3H8NA 4OLVH 4YIQB 3BVXA 3M1OA 2BCKB 3L5XH 1T04A 4YZWA 4F8QA 3L4ZA 1YEKH 2AQQA 2YK1H 5FKPB 4AZLA 1CLZH 2IWGA 2ZXAA 3O2VH 3F8UB 1E43A 1SN2A 1Q9OB 3HZYA 3T3ME 1X4XA 2IBZX 3FT2A 1QEWA 1I4FB 1ZIAA 1I3VA 4AUIA 1F45A 1AG6A 3EYSL 4PJIE 3QYNA 1UM5H 3CK0H 5F72S 4EVNA 3IE4A 1IGCL 2IH3A 1PFCA 4HDIB 1KXVC 5ICZA 3P2DA 2RCSL 1A9EB 2YPLB 3W57A 5HYFA 1NGXA 1J9RA 3F5WA 1M56B 4F15C 5C0DB 4HS8L 3WMQA 1CZ8L 2ADGB 3QJXA 4FXLA 4HHAA 1HQ4B 4NQCB 4NUQA 5DHDA 5HGDA 3DSFL 4G43B 4PGEA 4V2BA 3MBED 4ONOA 2BNRB 4M00A 4GBXB 3F7VB 3RTQC 2Q8BL 4H8UA 4AUJA 2WXRA 1GGTA 5E6IA 2HJLB 3EJTA 1QNIA 4IMKC 2ZOKB 3KLHC 2HFEA 1EEYA 3LH8A 5LG6A 1FSKC 1XSKA 2AK4E 4G7YL 4M48H 5BPPA 1ETB1 3D05A 5F6HJ 3S96A 4XN9A 1ZANL 1TJHL 4FFZL 5AYQA 4XCCH 4M7JL 3O6FA 1P4IH 1OT4A 3VD3A 5I8KH 3VXME 4PGBA 3IDUA 2VW6A 2J4WH 3CXDH 4NRZB 4O4UA 4GB9A 3UCQA 5JIPA 2CDFB 1A7NL 1P7HL 3DKHA 4PP2B 4P46D 2QHRH 3TVMA 2GTZB 3AA0B 1J12A 3SY9A 3R06A 4UINH 3MJ9A 5F1IA 5DD0H 2NXZD 1XF3A 2VABB 5H35B 3X12B 2B8OT 2YKLL 5L4JA 1MLCA 1DBML 4ZMNA 4ZUTB 4P3DA 1A5FL 1UG9A 2X89A 2Y7SA 2H4EA 2NLJA 3CZEA 4HFWA 4U6VH 4WNQA 1A7NH 4EZJA 4YSAA 5C3IA 4WI9A 2GEEA 1PLCA 1TKWB 1U30A 2EUXA 2R1YB 1BZ8A 4FQHB 5FCSH 1JD7A 2MCMA 5D1XB 5LVEA 3GM8A 2E5EA 3JV6A 4P2QD 1YEFH 4LESA 3DRQA 1NCWH 4DESA 4MD5B 4HKBA 3ET9F 4FFZH 2M06A 1RUML 3QFJA 2VN3A 1KTRL 3DOSA 4NNXA 4M48L 1E65A 4OGXL 2W1NA 4EEEA 5E8NB 3BEVA 2CD0A 1UZ6F 3MRQA 4YSPA 1A4BA 2EDXA 4U1JB 3VFOA 3CMOH 1MSPA 3IJYB 3DGGA 1IBYA 2HKFH 4D9QE 3Q1EA 4O9HH 4Z8FH 2EKSB 32C2B 1KV3A 4Y1AE 4Z77B 1MCPH 1H5BB 3LRSA 3QUMB 3OAYK 4B3EA 4G1MA 1KULA 4N8CL 1K6QH 4K73A 2DQTL 3U0TB 5D70H 4F9PA 2JKWA 5C6TL 4LL1A 3B1TA 4M5TA 2AMGA 4YSDA 3N0AA 2X4RA 2C5DC 1H3WM 4KU1A 4P4KA 4L23A 2GTWB 3BMWA 4GY4A 3AS1A 2NT1A 4BFIB 4ZZFA 2ATPA 2X7LA 5B1KA 1CLZL 1U92B 5ICUA 1FZKB 5C0CE 1D6EB 3PF1A 2BWDA 4WHTA 3G6AA 2PCFB 2HFTA 4KKCD 1FFNA 2ZOLB 4I0KA 5ESAB 5KYXB 2CLZB 2DWTA 3D18A 2MCAA 3LKSA 1QRNA 2D7OA 5G26A 4JFYB 1HC1A 5DHXB 3QZLA 2IAAC 5AEAA 3VH8B 2DY2A 4YAQB 3QJQB 5LQBH 3UX9B 3BKJL 1FRGL 1IC5H 1MG2C 2QFRA 5IMKA 4AYSA 4EVNB 1USQA 5INDB 2BSTB 3KVPA 3LXAA 1IM9B 2V3DA 1YO4A 3CZFA 4S1DC 1LE5B 1VRSA 1KCWA 1HIML 3LIUA 5DVMA 1EAPB 2WWOA 3RX9A 1TYRA 5TFSH 1GFQA 3AG3B 1LP9F 2G60L 2XVGA 3MV8E 3WKNA 3ARGA 2VDPL 2FT8A 4RRPG 2EDKA 1EBAA 2X88A 4DKEL 4DQOL 3QQ9D 2X4UB 2YUXA 4I77L 1YMMD 1ZA3B 5HPOA 5DLMH 4NJAL 2EXWD 2IQAB 4K3HA 5HD8C 3OPUA 3RWIB 1EMTL 4MD4B 1FLRL 2YA2A 2BJMH 4DGYL 4PCSA 1HEJC 3VW3L 4R4NC 5AB9A 1KTKE 3C5ZA 4XCYA 3DMMA 1E0OB 2FDBP 4UOQA 1MHEA 3MJ9H 2WK2A 3RIKA 4Y89A 2NOYA 1J0IA 2Q3XA 2X0UA 2XX1A 2BRRH 2JI1A 3U79A 2P80A 3CXHJ 3KLLA 1AHWC 1N4XH 3K4DA 3VXQB 1ZT4A 4YDKH 2AC0A 1DLFH 2LLGA 1AFVL 5F93C 5I6KA 3UTQB 4K0OA 3I50H 2V7NA 2V17H 4Y16C 1BIHA 4FZLA 3NPSB 4GRWB 4MVBC 3QJHA 5FA3A 4HLZG 2N1KA 3ZKSD 5LDSA 1H6TA 2UZYA 5F0LB 1MRDL 4JJHA 2YZ8A 3CVIL 5TPWL 1N8ZB 2A74C 1QBAA 2ZF8A 3T3PF 2AK1L 3JVGA 1A1MA 4R3SB 1V7NH 5ACZB 4IBQA 1V3LA 2H0EA 4PGDB 4AITA 4YHML 1LMIA 3FCUB 1MHPH 4FOZA 1S7XB 2YEZB 4ORGB 5SWSD 1YC8A 3LEVL 5DC9B 5DWPA 3LPPA 4E9VA 4CADA 4F2EA 4TVSa 3L1EA 1BD2B 3BKCL 2AEPL 2JCCB 5FW6A 4PJXB 4OQTH 5F6IC 3SE8L 5E2JA 3SZVA 2C9QA 3OKMA 1CGUA 4B97A 2NTSP 1YNLH 3KPRA 3EGSA 3GKWL 5D5MB 4WWID 3MRPB 5T1KD 2W07A 5C7XH 1QG3A 3FUJA 1D2OA 1EJOH 2F18A 3FQWB 2KMWA 4JVPA 5DJXB 1AQDA 3CFBA 3RYMA 1XSIA 2JJVA 4WV1A 5HYJE 5E08H 2PYFA 2LOEA 5IB3B 2EP6A 4X4XA 2B14A 2D0HA 4WRLA 3K81A 1RL1A 3EJZC 4DP1X 5IMMB 1EFXB 3UC0H 3ZJAA 3MREB 1KMGA 2DZEA 2FECI 2D2OA 2HJFA 2PTUA 1N6QL 3MLTA 1ORMA 1DN0B 3VFNB 3T3MF 3VDAA 2Z92B 1OOAA 4WVRA 3VM7A 3TP4A 4XE0A 3D07A 4X83A 2KC0A 2PXYC 1P1VA 4GQZA 3RVTC 1FV1A 4PSRA 1OARH 1GOFA 2EVGA 2LT9A 3VB9A 1UZ8A 1IC4H 1EV2E 4XRCA 2FQFA 1TTAA 2WYHA 3O2DH 1GZQB 2P28B 3NFNB 3T0DA 1K5NB 4M8QB 3WNOA 5F3BA 1WC7A 4JKKA 1PL3A 3EYVB 3N85H 4XBGA 3RIFK 4ENEC 2BS8A 2D7PA 1KIRB 2FK9A 1F13A 5KAQG 4V11A 2P24A 4QXGH 3CDYA 1NC4B 3MRDB 3QCVL 1LO3L 9PCYA 5BO1H 1NGYA 1HK6A 4Y5VC 2XVLA 3VGAB 3GSQB 4XP4H 4X50A 4JFZL 4QF1B 4E9XA 3QG7L 1Z6JT 1O9VA 1RZIA 2ESVD 4X8CA 5K1JA 4U31A 2Y25A 2V2TA 4XN4A 1KNOA 2ZE0A 2WWKO 4FQJL 4BKLB 1S9VB 1IB5A 1MIEH 3I9IA 1KB5B 2Y2WA 4AYGA 1T5XA 2R29L 2YHGA 2WYZA 3I3EA 4MX7B 1BECA 4ZPVA 5HI4D 1PFOA 1GA2A 3QJOA 1JPTL 2OMZB 4YHNA 1JVLA 4GEJA 4JBSA 2VSDA 2ESVB 2GI0A 4X99B 3FTYA 3WHE1 1TU2A 5JOFA 1TYJA 4NKQB 4UU9A 5TH2B 5IBLC 3G5ZA 4BINA 5DWUL 3P54A 5DYOA 5HYSG 5HJDA 4UAHA 2QLYA 3INUH 4X5XB 4JY5L 1DFXA 5D4IA 4UU9B 4Z78B 1N7MH 4G5ZH 2VWEC 2CPUA 5LNEA 1RURL 1MJJA 4L29A 4W9IC 5CHNA 3VGDA 4JHAL 1EIBA 4JCHA 1OB1B 3IT8D 4KAQH 3IU3A 3D1MC 4MJ6A 1IAOB 3NOIA 1FL6A 2OFQA 2EIZB 1JZHA 3S6CA 4GS7C 1LEIB 2UZXA 2XETA 2H2PC 4FXKA 1MFAL 3A0HO 5KYUB 3DVNB 1TNMA 2CJTA 3LSOA 3II2A 2ICEC 3SDCC 1A3ZA 3WFBL 1GGBL 2ZX6A 4JG0H 3L1FA 3LK41 3FO2A 4ZQKB 5LAXB 5FR3A 3SO3C 1DJXA 4S0SD 2H6UA 4XH2B 4JFSA 3H3PL 2DJUA 2O72A 3ESVF 3IGFA 4QRAA 4DP7X 4KRPC 2X4TB 3RPIB 1F3JB 2X3AA 1ETJA 5E1HB 1PZDA 1JGLH 2VZVA 1T21A 4NEHB 3TBVA 1IQWL 3K74B 1OEZW 5TQ2H 4J3SA 3JTSB 2BVPA 3DARA 3U30B 1F1AA 3ZX1A 5SWSE 3V6FB 4M6MH 4Q0XL 1ZT1B 3QFGA 3WKYA 1EJ8A 4Y88A 1AMYA 3WGUB 4XNBA 3P4NA 1FL3A 2XUWA 5DK2A 1HZHH 3MNVA 4M1CD 1IC7L 1R19A 3V7AG 4I4WA 1IJNA 2A6DA 1E8XA 4AH2A 1MH5A 1FFQA 3X3GL 1CL7H 3BAJA 3HAEB 5FGRA 3QQ3B 1U3NA 4M56A 1RZ8A 1AIZA 4Z7VB 4HJIA 5DR5H 3JZ7A 5CJQL 1VFMA 3RDTC 3KDPB 4PD4K 4QTIH 3U36B 3WLWC 3DBXB 1JV2A 3NFPB 5TQ2L 5ESVB 2PWEA 4PJHA 4B9PA 2HJFB 3NZSA 4LNRA 2OJZL 1ZAGA 2HKAA 4XZUA 1N0LB 1D5BB 2ZKHH 4PWIA 3IBEA 3FF8A 3PWUB 4KKRA 4X6DA 3B2DC 1TCRB 5DFVC 2H9GA 4AH2B 1MCJA 1DEDA 4Y9CA 4OIAA 3BGFC 4JRXA 4XVUC 1BZ7B 1GHFH 1WISA 3KPLB 4K7FB 3UTTE 5BVPH 2K4TA 1QKZL 2R15A 5I1KH 4OJAA 4OU3A 4NSKB 3FU6A 3CFEA 3QRGH 4K3EL 4JFFB 43CAB 1HXTA 4CU8A 4WNSA 4GG6A 1VADB 4Y1SA 3VO0A 1M7IB 4GF4A 1SOQA 2VR7A 3DGCR 3IFOB 4A2GA 1QASA 3V5KA 4XP5H 3TS8A 4FTVD 3FAWA 3AS2A 3O4LD 4CGTA 1AE6L 1QABA 1IQDB 4S10A 3DTXA 1R5IB 2PO6C 1E3ZA 1S3RA 2YBRB 1IEHA 4XCFH 2X4PB 2A1WH 1PZBA 3VVWA 3N50A 1JZ8A 3SDAD 4Z18A 2MSPA 4HJTA 4O2FA 4RFOL 5FWRA 5FDWA 2CMRL 1TETH 3QFJD 4L0PB 2WANA 5CILL 3DXAA 4PVMA 4TQ8A 5ID0B 1I31A 2BOBA 3WLBA 1WFMA 4YX2L 3NH7H 5E9DB 4MS6A 1ZA6A 4E9YA 5GHWL 2XWZA 3K6FA 4LB8A 1NQBA 3RFZA 1E54A 2J2ZB 1XH3B 3NAAL 3THML 2J88H 4JJOA 2X9WA 2XX0A 1XB3A 2J73A 2R56H 3BZDA 3D33A 3EYQC 4N8VB 5KVFE 2EO1A 2H1PH 1AP2A 4ZS7H 3M45A 3TCXA 3S4SB 1L9RA 1GY2A 3VGAC 4D9RD 2F53D 3WFEH 4ODVH 1RZJL 4XMTA 3IGKA 5DMGC 2PTTA 2ICEA 3ME0A 2CCVA 3DX8B 4GIPD 4UANA 4LSHA 4JN1H 1VB9A 1CTMA 2MIZA 2BOCA 4JDTL 4AVHA 3K1KC 4M4PA 5ICXA 3LRMA 4LSVL 1UA6L 1QO3A 1JMZA 1DDTA 1UYWL 4PJ8A 1GSMA 1PVHA 2FL5B 3GBDA 3E8VA 3LN4A 5CNHA 2JNZA 4X7FC 4I8DA 4C59B 1CQKA 4KKLD 5AOKA 2RTTA 5DF0A 2YAFA 1QFWH 2VL5A 3NFSH 1XH0A 2IH8A 4GAGL 1G6RL 4UIKH 3UEZA 1E30A 1ZVSA 1T22A 1ZT7A 1H6EA 1AD0B 2W92A 3EYUH 3VGFA 1XIWB 5FFGA 4PR5B 4LSPL 1CDJA 2EEAA 1BZQK 1A4AA 5D5ME 3QZMA 3TJEH 3VRLE 3UIZA 2N4IA 1GZPB 4NS0A 3ALPA 3OAZH 1HESA 1GYVA 4F8LA 1RFDH 1S3KH 4B0MB 4PRHB 2ZT9C 4LLMB 4BSJA 5IT2L 2MQCA 4N28A 1JNHB 1FYHB 2C1PA 4TNGA 1N64L 5DEJA 1D6EA 3V10A 5IJVA 3HG1A 5I66A 3WKPA 5IOPA 4WK2B 5EEZA 4PY7A 3NFNA 4F27A 4KVNH 1CD8A 3L3HB 4R7DA 3DV6B 4MXQC 1VZGA 4LCIH 1UCBL 2XZAL 1A6AA 3QXDB 4P4RA 3GF8A 2OMTA 4W6YB 5DT1H 3KLDA 3OKLA 4CGUB 1DANU 2VYRE 5LKNA 4M62H 2X9KA 3K71B 5CEZL 1EAQA 4FHJA 1Z2KA 1KB5H 3KNBA 32C2A 5FW7A 2YMOA 1B0IA 2EVIA 3QO0A 1E9QA 1FZJB 2YOCA 5C0FA 2QVTA 4OCXH 2QTVA 4OF0A 1PY9A 1EFXA 2JJUA 3VFOB 1BQKA 3CH1B 1LK2A 1BQLL 2BC4A 4L5FH 4X4XB 3O6KL 2H2SC 1F58L 4YHMH 4HWNA 4L4TE 4LOEA 3F6LA 2CIIB 4LU5H 3S98A 1U4EA 4UM8A 2AK1H 4YDMA 2X2YA 3HG0A 2R2CA 3FFCE 1BF2A 1KPRB 2JKIS 4R0LA 3RUGB 4TRPH 3MZGB 3UADA 4Z7QE 1L9SA 4DQAA 2GSIA 2P44B 5CM1A 1S7VA 2W07B 1S5LO 2CO3A 2X4OA 3KL5A 4NXSA 3P0VH 5I2IB 1J9QA 2R4RL 3JV4B 2AV1B 2M2DA 3V4PA 4O4XA 5DSCA 4P9ML 1RLWA 2JI3A 4PJBB 4J6IA 3LX9A 5I1EH 3MV11 3DBSA 4JRYE 5IYUA 3NEXA 1S7XA 1TVDA 4ORGA 4C4UA 3QSKB 1HYSD 4C47A 5E1AA 1A2YB 1F42A 1UENA 3BIAX 3HZVA 2PPCA 1BX2B 3C6SA 1CFNB 3RWJB 4JQIH 3TBTA 3FH8A 4JGMA 1TEFA 4P9MH 4JM4H 4UMSA 3WY4A 5GGUB 2DM3A 1C1EH 4K71B 3WSQH 43C9B 3HNTL 2Y0LA 4QHMA 5EZLB 1WWAX 2P8PB 4Y4HA 1TTCA 2CE6A 3Q2CA 3MYJB 4LVHC 4PJAE 4QXTB 4ZO6A 1BM7A 2CSPA 3WFCL 3FU7B 3GXFA 5KSAD 1IX2A 1K5WA 4JNXA 1J87A 2JK5B 2WKOA 4Z7UE 2MWCA 4RRPM 3BJLA 5LQBL 2H41A 4Y19D 5JIKA 4HX1A 4PB0L 5F0JB 1YYLH 4A6YL 3ZLQC 5I1LA 4YK4B 4NKOA 3K2IA 4KVCL 5J9PB 4LVOB 2I25N 4YWGL 4Y16D 3ZHKA 1REIA 2QSCH 1KB5L 2DYPD 5FGCE 1QSEE 4LOVA 4NHCH 5AOLA 1T2XA 5LDUA 4MAZA 4DVRL 4BK5C 4B9FA 4EE2A 4F8OA 2DQFB 1NBZA 4AQAB 3BD4A 4JY6B 4NO0A 2K6WA 5GIRB 3WYRA 4X8JA 5LBSH 3CN1A 3P0YH 4X5XA 5F7FA 3Q2WA 3WE1A 1NBZB 3FO0L 3DA3A 1YNTA 1BZOA 2GI7A 4JFEE 4PMEA 5D70L 4GG6F 3QRLA 4DGVH 3KCPB 2AFNA 2DJ4A 3GMQB 4RRPA 3BAKA 3WD5L 4U2ZA 4HV8A 4L37A 1T04B 1TT6A 1ZHKA 1BQ5A 2N7AA 1TMQA 5CINH 4XVJH 5KN5B 5IT2H 2D7TH 4NN7B 1KZQA 3ARFD 4LSDA 3LN5A 2OM5A 2VQUA 3TC9A 3FQYA 4NAQA 4JFHD 4BFEA 2VDLL 4XTRC 3UTPE 2IPTL 3WN5A 4KO6A 5B38B 1R24B 4KRPB 4B9CA 3QH3A 5FO2A 5K59F 5E5RB 3GZOA 5KVDL 3HRZA 2FWSA 4OGXH 4GAGH 4PBVC 3Q5TA 4FP8H 5IBTL 1PF3A 4CL7A 2FIRT 2PABA 4HC1H 2FEEL 3GHEH 4HBQA 4E5XG 3T8XA 4D5UA 2XLLA 4MJHA 1QBMH 4YLBA 3T1FA 1N5YL 4GRWH 5E8OA 1MJ7L 4TQEH 1FYTB 2AJ3A 1N12A 2BFVL 2R0WL 2LFUA 4PJAF 4PWJA 3S34L 1OPFA 4G9DA 4Y4KC 4N8PA 3MA7A 3HW7A 5KANI 3FRUB 1MCHA 2P5EE 3OKKB 4OJFH 2TSBA 2OMYA 1WC7B 4Y9GA 4PHZA 4N24A 1J05B 3OC8A 5FECA 1A7PL 3UYRH 4OZHA 4Z3FA 2NY3D 4X98A 4YHOH 3HZKA 3OAZK 3TBSB 4PPTA 2ZX7A 5D2LE 5MENB 4OLWH 4Q56A 1KC5L 3FT0A 4RIRB 1ZLUH 4CJ1A 1DBAL 4JAMB 1O7DE 4L9DA 4QHUB 4CN4A 5E9AA 2DTML 3MC0A 3MRFA 3LOWA 2Z8RA 2PCPB 4A7QA 1IKOP 2E8ZA 5GHWH 1XXFC 5I75B 1B0GB 2J8OA 2XQBL 2ED6A 5MHSE 2BSED 1H3UA 3EXJA 3OR7B 3TA3D 5EUKB 4XTRD 5I71B 2KKQA 5EO9A 1IEBB 1Z9NA 4LEOB 2IDSA 3KMDA 3IKCA 1E6OL 3KHOA 3WHXA 2F7QA 2L7QA 1QJ8A 3WFHA 2JJWA 4O2EA 5TTRA 2XWCA 2ZUWA 3LHPH 3L4YA 2HRPH 1KJ2L 1E6JH 3MRRA 4BZ1L 1H6S1 1E9OA 3CFBB 3D4CA 5B1AB 3SE9L 1R5WB 4E9RA 4N3UA 3ESUF 5DMKA 3MRPA 1HKFA 4AV4A 1E3FA 3FB7A 1E4HA 2ZPKH 4G9FA 4HWBL 5F9WC 2XE2A 3HS9A 3W2DL 2GJJA 4JREB 4KMQA 4GAYA 4IM8A 1Z9PA 1HH9B 2Q76A 3GD1C 1AIFA 3RGHA 5I18L 4J3TA 5CJOL 4MZ3A 5E2WH 5IP4A 3K71A 3UJIL 4XVSL 3SBQA 2P26A 5JMRA 3QDJB 2Q5BA 1EEZB 3UMNA 2NX5B 4IRZH 4Z7OB 4TYUA 5HPMA 2ZUTA 2HJKA 2PKDA 4LBEB 3TBSA 4P0DA 2NY6B 2VJ0A 5CU5A 4Z7NB 1XF2B 4PY7B 3S8FB 1M9SA 1LWHA 4XO8A 2ZKHL 2YK1L 3K2KA 5ACLA 3ATEA 4DZBA 5BOZG 3LNHA 2G5BA 3G08A 3IRZA 1Z0MA 2DIEA 4GP4B 1ICTA 2DEYX 2G9KA 3TBYA 1AYRA 4G9FD 5SV3A 3LRHA 4Y19A 1GZPA 1MCRA 2NQCA 1UHVA 1LO4L 2PYED 4QXWA 4L0YA 4Q9RL 1HXUA 1U8LB 4G7RB 1FIGL 1MHEB 3RY4A 1F2XK 5C9JA 4K71C 3AREA 3WUWG 4PTTB 4X5LA 4JN2B 2NY5H 4J23A 3FOLB 3SKUD 1J9CT 3UAEA 5T3XL 5FV2A 5GPRA 5KTEH 3SPCA 2VDQL 3BDYH 4HMEA 3HI1A 3WN5C 1GR7A 1U8NA 2CGRH 4JFOA 1KT2A 2XZCH 4JKLA 1XZWA 1WYJA 2ZYSA 1PY0A 4P46A 3W5NA 1RK1A 3BE1H 1G5GA 1Q0XL 5I5RA 1D5XB 3U30C 1V3JA 4LLDB 3ZDZE 1JGLL 2FT6A 3BQUB 1KT2B 1J0ZA 3VI4B 1EEQA 1T80A 3RX5A 1FZMB 4GJTB 4QKTA 1MCOL 5C0RH 4N22A 4OLXL 3PQYE 2E6QA 1UB6B 1KPUA 5BRPA 1A6VH 3ZZSA 2DLGA 1MFBH 2OSYA 4G8EB 3QR1A 5DGRA 2H6PB 4ZFZA 1JS4A 1AMXA 2ZWSA 1X5KA 2B15A 2OZ4A 1ZLWH 4IK7A 1H3VA 4ZUVA 3WNLA 4OZHF 3WOVA 4JM2F 1PLGH 5IK3B 1FDLH 2R1XB 4U1IB 4HJJH 1E5ZA 3QCTH 4GCPA 1AGFB 1NUDA 2VCOA 4FFYH 4H5SA 4NENB 2BVEA 2OJEB 3BD5A 3E1ZA 3T4AC 3AAEB 1P7BA 2DQJH 1U8OA 3FHEA 4HJ0D 4OFQA 1T5KA 3FCTB 2VXQA 4BBWA 4HCGA 1OPOA 1PS3A 1WWBX 3TYGL 5KYWB 2X27X 3K46A 4O02B 1U42A 5DJ2A 3HG2A 2AANA 1ES0A 4BCYA 2E3VA 1HH9A 4PRAA 3P3TA 4GUQA 3GZKA 1ADQH 5EUOE 4P46C 4EKJA 2V9TA 3GT6A 4LLWB 3KW7A 4PJCB 1I7ZB 4G2AA 2DWYA 3HI6H 3JWDH 4NGHH 1JXJA 1DVFA 3UYPB 1T1WA 2GC7C 1GVIA 2HWZL 3HG1D 1IC1A 1TZHB 5L9DH 3WFHB 1ZXKA 1UKQA 5HGBB 1S7TA 2DJSA 4DOHB 1SPDA 3J07A 3ARDC 2R2EB 2VXTH 3MACH 4GCQA 4ODTL 1A65A 2JJTA 4A2LA 3UPRA 3GJEA 3Q9PA 4L4VD 1WDAA 3X1GA 5DZNA 3QUML 1E4WL 5I28A 3QEQA 4HH9B 3PV6B 3HE6B 3UCRA 1BFVH 5I75C 3WS3A 2H0FA 4MMYA 2Y2XA 2YAEA 1BM3H 3RAJL 5ETUB 1W0WA 5DZJA 4PH8A 1DQLH 4YC2B 2B59B 4OLUL 3IDMB 1L5GB 2AJSH 4MA8H 5E9DD 1IC4L 4M3JA 3HMWH 4M4RA 5JR1H 4WO4B 2AQNA 3QEQD 1ZT1A 2GBUA 4GQQA 1TQBB 1UGNA 3TT1L 1DJGA 3MBXH 2WTOA 3FQTA 1Q8MA 2QFPA 2YGOA 1HFUA 1UXSA 5CWSB 4Z5RA 3WNMA 3SDYL 2JCCE 4ERSH 3SBWA 2O6PA 4KJYB 1OQXA 5JIHA 3VA6A 3WEMA 2Z31B 3GIZL 2VXTL 1MG3C 1RP9A 4ODTH 5FOBA 4OGQC 1TVHA 2AJXH 2YN5A 4OKVB 5E5MB 2JB6A 4HIJA 3RBSA 4E9SA 1DVQA 4XX1G 1J86A 1KIPA 3F01A 4A66A 1A4KA 1BVKB 2X42A 1A6TB 3MLUL 2IMMA 1X5IA 2Y6SC 3P30H 4YK4C 4UDUB 4BHUI 1F97A 3QWRD 4AQEB 3SQRA 2J71A 4TUOA 1OZTG 2UYLB 3BRGC 4LCVA 3LNIA 1L3NA 5CEZE 3QH3B 1EFQA 1NMCC 2ITDA 3HG1B 5CD3A 1ZHXA 2PORA 4KOBA 5DMGD 1FORH 3A4EA 3DVNA 1IBDA 3QUXA 3GKWH 3CLFH 2YO3A 4PRHA 5JMOC 4Y19E 5FUOH 3AC0A 1GYAA 3H9SE 1T0MA 5GRJH 1HHHA 2GSGA 2IBBA 2YSSA 2Z7WA 1TPXC 4Z1PA 5FYLE 5AAPA 6FABL 3DPBB 5DEFA 1CLOL 3S3DB 3WXVH 4AK1A 1CFVL 5JXAL 3GTVA 4BJLA 5EU6B 2NY2D 5E99H 2G2RA 3IGAB 4HSCX 1K2DB 5KVFL 2QDWA 4M9PA 5EN3A 5JOFB 3FQXA 3VFVA 2ZCHL 2F5AL 3DYMA 4XP1L 3L4VA 2DM7A 4U1HB 3ZR5A 4PI2A 4HMCA 1MQKL 1VEOA 3AFLA 4P2CG 1PYWB 2VH5L 3M6DA 2ZSWA 3BSZA 4IHOB 3MRJB 4FNQA 2P46B 4Q6KA 1CMOA 3BPCA 1DJYA 4JY4A 1XF5A 5HYJB 4N6QA 1LXMA 3MRJA 3IJEB 1ADQA 4MQXC 4J3BA 5C0BD 1AVAA 3S4SA 3QDAA 2DBLL 4IEFB 3ESPA 3WAJA 4DERA 3KLQA 4G6FB 6PCYA 2DQUL 2UXFA 4LP4A 4WSJA 2W9EH 3GB7A 5AVUB 4JPKH 1S9WA 4B5EA 4DT2A 1N18A 1OTTC 5E6IC 1BZDA 4TNVF 1L7TH 5IROC 3SE4A 1J0JA 3BE1L 4GRWE 7PRNA 5KVGE 3HEIB 3RL1B 4ES9A 2DBJA 4XNMA 3TBTB 3T24A 1YEEL 5D55A 1XL6A 4KJWC 5IG7B 3LDBC 3FO9B 4ODHL 5FO7A 2A9NH 5KAQF 3RWFB 1T7XA 5J6GB 1L4IA 5L8KB 3QDJE 3ALXA 1C5CH 5B39B 4OFIA 3UGUA 3SBRA 1YNKH 3RDTD 2EVJA 3M1BB 4FQ1H 1NCAL 5KG9B 2DIAA 3CAFA 5IBUB 1YZZA 4CSPA 4FZNA 1Y1DA 1DJWA 1OE1A 4E9QA 3MJ6A 1SOKA 1DUZA 1H3PH 5JW5B 1HE7A 3T20A 1MWAL 2P8MB 4RSVA 3B8YA 3O3DB 1XZ0A 4MAYB 3T2NH 5DJYA 4RWYL 3HRPA 3VXRD 1BHGA 1M7IA 4UT7L 4CMHC 3KPSA 2HZHA 4PS3A 4BQBA 3OD3A 5CGBA 1EGJA 1X5YA 2P1YA 1ORQB 3RVUC 5J4MA 3MLXL 2MEJB 4KKAD 2OAAA 4GG8A 3EF7A 1P6AB 3IXAB 4KQ4L 3T0EE 4P57A 5F9WB 5EIQA 3QDMD 1LDPH 1QNZH 1MM4A 3QARA 4MQTB 2X44D 1PX3A 2AI0H 2YPVL 5ISZB 2CIKA 4N8CH 2VLRD 4AUYA 5I18H 1G43A 3F12A 2O4EA 2PMZA 3ML8A 1HSAA 1Z5HA 2FGQX 3R18A 1CO1A 3P40A 4FEIA 2MTAA 4Z8FL 4QTHB 4IRSA 5I1HL 2HKFL 1JVKA 2WCSA 3DLQR 3S5LB 1EO8H 3LPOA 2XE1A 1HINL 2PETA 3HE6A 3GPSA 3TTYA 3RIAK 3DA4A 1RK7A 3QORD 3QXDA 4P4RB 3UAQA 1EFXD 5LGJB 1OSPH 3I3BA 2WWKT 4TLSA 2X4QB 3QHFL 3FB6B 5DL7A 5FB8B 1E6OH 3RKDC 3VYOA 4WFED 2FJGA 2I7SA 3MQIA 5DUBA 4ZK8A 3H9ZA 1ULVA 2F53B 2IWKA 4OJCA 4X5WA 3RPBA 5DGQA 4WNJA 3WO3B 1H8SA 4G8FB 1TZGH 5LO7A 1JNJA 1XX9C 1VFUA 1ZSDB 2IFFL 3N1PC 4OZIB 3C5ZC 4KHTL 5M95B 4XXDA 5GSRB 1YJDC 3S5YA 2CK0L 4WLCA 3NN8A 4M5ZH 1DBMH 4PB9H 2ZUSA 5EC1B 4XNQA 1DBAH 4PR5A 4XZ4A 3NP4A 3ZE2B 1DYZA 1V55B 3VQ1C 1CE6A 5JPMB 4FN0A 4XBEL 2FZ3B 2Z91B 3GMLA 4MS8D 5E7BA 3FPXA 2VDMH 3ZRFC 2CNYA 2NNRA 3MKKA 4PJEF 2VMDA 5JQ6L 3APDA 1EHLH 1IGYA 3F65A 1UUSA 3MV7A 4J3WA 1U8HA 4HYTB 1KPVA 3DDGA 2BNQD 2VLRE 3CN4A 1MVUB 4F1ZA 3RZCA 3DETC 1NMCB 4AIXA 4PGJA 4KKBC 3EOTH 5FYLH 3MU3A 5D71H 1G9ML 5BZDB 3KWVA 1ZMYA 3ME0B 3PUCA 1OM9A 5ELIA 5KUMA 1ACYH 4HALA 4MKTA 3SJVA 5DUPH 4XBMA 5EOTB 5SX4H 4AEEA 1NCUA 3GSRA 1J8KA 4U1LA 4YHPB 3SPIA 2XYBA 4U0RC 4NO2B 1RIUL 5EEVA 3B2XA 3BYTA 3DPBA 5DEFB 3T71A 5IMKB 4JFVA 1NIEA 3ARFA 5E1IA 3W81A 1IGIL 2ITCB 4P2RD 1A02N 2BSDA 1U6AH 5GZOA 2Y22A 3O3BB 1PQZA 3GXMA 2W0FB 4FYTA 4N0UA 7CGTA 1KSRA 2A9DA 4HFUH 2QSQA 1UB6A 2HG5B 4YDVA 4M8UA 3HPLA 4UQ2B 3FUKA 3SKNA 2ZYIA 4BK4A 5D5MF 3VRLF 2MCPL 3B2MA 3UTTD 2FBJL 3MOBL 1WT5A 4YPGB 3WD5H 3HR5B 3TO4B 3CSGA 2VQ1A 4LMQI 3TO2A 3BWSA 3SJVD 1G84A 2F9BT 3MX0A 4FMFA 2LVCA 4QRPD 5TDPB 3GQFA 2BXYA 2FWLB 5DO2D 4UNIA 1RZIB 2R4OA 2GK0A 4L2YA 5MEPB 1NCJA 1QHQA 5AVWB 3RVXC 4PY8I 1DUYA 3FCSA 4PW3A 3B1UA 3FKUS 1ZHBA 1KEML 5LNDA 4G76A 1B2WH 3V4UH 1U8CB 1ZLVH 5H2BA 4X0KB 2HTKC 2WIIA 4JN2A 3L5XL 4LDOB 4QRSB 3IAGC 2WJRA 1I9RL 1OAYH 4RWYH 1E27A 4YE0A 3D39D 4JCLA 4ZW8A 3ZE2E 5IFAH 4FNRA 3JUZA 5D93B 5C08E 4NQCE 5DLLA 2IPUG 2BZCA 3CUPA 4HWUA 3E2HC 4KGLA 1YG9A 2UY7B 1G7MA 4JFQB 3VXMA 4NO5B 5BZXA 3WV0A 4UB0L 4WI4A 2BP3A 4AQ1B 2ZCZA 3DOSB 3SY0A 1N70A 1HL5A 2FYVA 1SLXA 3GXTA 4MMZC 3IXAA 5F6IB 2FLMA 1TCRA 1XWVA 3KLAA 3WS3B 4HK3N 4M7LL 5B1BB 5T5FH 2B4CH 1NGPH 1E4XH 4H8WC 5D4JA 2A9MH 5D7JA 3WIIH 4ZFOL 2R8SL 3MPCA 2GY5A 4GRWF 1I3GH 4RMTA 4JQXC 4JM4L 1J88A 1L7TL 3VM5A 5ISZE 1NL0L 4D9RE 2B39A 3VYNA 2BHUA 4MAYC 3D0AA 3TO4C 3VVVA 4JLRB 3DVFA 2MPAL 2DQUH 3HAEG 2Q7AA 2BH0A 1JGVL 1NAMA 1EX0A 4FZEL 4NI6A 3QZWA 1PJ9A 1MW1A 1K4CA 2CDGB 4WFHE 1QVOA 3HNVH 4Y4HD 2H47C 5A6MA 3L1OL 3QZWB 4AEHL 3LN9A 3BWUF 2KLSA 2AV7B 3QFJE 3GI8L 1KBBA 1HCYA 2WLKA 4MZ2A 4M5YL 3NCCB 4GHBA 3OX8B 1UH4A 4OVUA 3PWPA 4NZTL 5K1VA 3CN3A 4DUVA 1EDYA 4UYPA 1HKLL 3D0VB 2CHXA 4G7VL 5D1QA 3UG5A 3R7RA 2AK4A 3OBAA 4NX0A 1NEZG 3L81A 1R3IH 4KZ0A 4ZSOB 1H8LA 3A4AA 5ACZA 4WWKA 1CDGA 2UWEF 2KLTA 3CFKB 3PDGA 4AEHH 4Y8AA 2HSIA 4A2HA 3L1OH 3LRGA 3RX8A 4TVPH 2OJEA 4JM0A 2OMFA 3W37A 2FSEA 1NKRA 4LCUB 12E8L 1F1GA 3V6OA 2WLLB 1EHNA 1TQTA 4GAJH 1AZRA 1XH1A 3F7VA 5GRJL 2OV0A 1OAJA 2ROXA 3K8MA 4I1RA 4MAUH 2MQ3A 3UTQA 5AOMA 4AEIL 2P5PA 2FWOA 5E4EB 3F00A 4G6KH 4Y2LA 4ABUA 3T4AB 4DP2X 1J0HA 1U41A 3VGBA 1UOKA 1I3GL 2NNCA 4ZUUA 4XGZB 4HQQL 4KNTA 1WTLA 1UVQB 1YMHB 2DLTA 3AUVA 4M6OH 3VGHA 4RA0C 3MROB 4F7PA 2P9RA 5JHDE 3VDBA 2OLDA 1X6LA 2BXZA 4KRAA 3ASNB 1DVUA 2BP8B 4KKCC 1YQ2A 2FX9H 3BPNB 4PW4A 1QPXA 3LB6C 2XG5B 4GI9A 3QA3B 1CDHA 1EWHA 1QTYT 3E8UH 2VT0A 2NY7L 3DETD 2QQLH 4JRFA 2HUHA 4G8IA 5D96B 2X9YA 4LFHD 1MHHB 1ADWA 4NBZB 4WKXA 3N1MC 1B90A 3V0WH 5T33L 1MW0A 3ARRA 5I8EB 4HIHB 4I18C 3ZIYA 4JL2A 4Z0XA 5D1QC 3FOLA 4U6HB 1O6TA 4IGBC 5INDA 2HFFB 1OAXH 1RPQA 1YEJH 1JG9A 4OFDA 2ITCA 2D2CC 5FYJD 2XPGA 4YGVA 1CGWA 2P43B 4MFHA 2HLFC 1WEJH 4WJG3 4Y19B 4G5AA 1UA6H 1BQUA 2APWA 1YMHA 3CX2A 1BV8A 3KW8A 1NC4A 1VJSA 2JKJA 3AWGA 2C7FA 3K6NA 3HE6C 4JDTH 4DHLA 1G7HA 4GI8A 4KKZA 1FIEA 3JWNH 5BZDA 4GT0A 4XBGB 3ARTA 4M93B 3D85D 4WU7B 3SO3B 2F0CA 1NFDB 2ENJA 1OE3A 4UTAL 1P7QB 2MCPH 3A67L 4U6TA 1XTLA 3Q2LA 5DFAA 3AABA 5HJGA 4DGIL 1W72L 4QLRA 3SO5A 5IGXH 3LXUX 1MVUA 2KS0A 1QUNA 4WO4A 1OALA 1BVLB 2F5BH 4P4KC 5D2NA 1PSKL 4HT1L 4ZS7L 2H0JA 2DAVA 5AFUK 4RX4D 4MASA 4WSKA 3HLAA 5IB4A 1FGNH 1SFHA 4WW2F 3MNMA 2FZ3A 3GMLB 2BERA 4H8WL 1WIUA 2VDKL 4YDJA 4NQXB 4PJIF 3FU7A 3TWCH 1U93B 2X9XA 3QDGA 4LKXB 4NQED 1FNFA 3VD4A 2YWYA 1A9VA 3SGKA 1ZS8B 5AD0A 1IO4C 4K9EL 3G5VB 4N2HA 1ZJBA 4FRXA 5D7KE 2WNWA 3QNYB 5L4MA 4HCRA 4P2OC 1W72B 3PXHA 1NGZB 5FFLA 5DUBB 4J39A 5DA0B 2EE6A 4LCYA 2CJ3A 4GSDL 2Y1AA 4PY8J 3WL9B 4HJGA 3LEXB 3QCTL 3Q8FA 1L9NA 2CQVA 1AS7A 2DQIL 2HT4D 2YGNA 1CCZA 5EF0A 4OBSA 4PCTA 5D5MA 3QXUA 2N2MA 5FYKL 1CDYA 2VLRB 3OKMB 4GFXA 3AU0A 5GRVK 5HI5D 3GBMH 4WNQB 2WVVB 4LLQB 4YHKH 4APXA 1Y6KR 4PCKA 5JHDD 2WUBL 1LO0H 4JRXD 2CBTA 2JKTM 3JTBA 4LAQH 4CRPA 1M05B 4NFCA 2VW7A 4TSBL 5KYWA 3N91A 4IIZA 1ED3A 1MJ8L 1A6VL 2L3BA 1QUNB 3ATAA 5FPIA 2CGYA 4X98B 2B7DT 1FA4A 5GGRA 4DSYA 1KELH 3WS6C 2ZAHA 3MGOA 4NWUH 1KPRA 2OMYB 1XCTA 4AQOA 3ZT6A 1UJ3C 4X7TB 3HZ3A 1MHCB 3MJ7B 1Z5LA 1QLFA 4MDJB 4OZFH 1I1YA 2APSA 4ZPTB 5CJQH 5HHOB 2BINA 2OTWA 2MNWA 4N0FB 3PL6C 4JO1H 2NCMA 1WFJA 4K3GA 4MBOA 3U4KA 5ABDE 1IE4A 2EIEA 5A2KH 4XMWA 4K3JL 2P7TA 5E7FA 5LLIC 2NNAB 4NXKA 3MUGB 5SWQB 1VKXB 2Y07L 3O2WH 5CXPA 1OB0A 4AYEC 3CC5A 4HOWA 3A6BL 1OCWH 1KPUB 1HOEA 5H2BB 4BQ6A 1V7MH 2VAAA 1EUTA 3GRGA 5AW6B 5DL5A 2XRAL 1SXZA 3AVEA 1JCKA 1LDPL 3S88H 1WCBA 1KXTA 1Q1PA 4QHKJ 4WFHD 3PE9A 3S3BB 3U0PB 1A0QH 1B4JH 1DQDH 2QQNH 5C1MB 1U91A 5FF6A 1IQWH 4G8GD 5CSGA 3O9WA 1I85C 4FNSA 5IOPB 4TNWF 4XNMB 2WXPA 3MRMB 5DUML 1ZD6A 1IM9D 4PJ7F 2X6BA 4ZRGA 2YXMA 5BXFB 1KXVA 1KELL 1ITCA 3PQYB 1WF5A 4LLMA 3R4RA 4UQ2A 2OYKA 3SKNB 5JW3L 1LE5A 2W94A 2FTAA 2CCWA 4GSXA 4UZGA 1NLBL 2F15A 3AREB 3GI9H 5IF0A 3QQNA 4TSBH 2DD8L 2BY1A 4HF5L 3T4AA 2WUCL 4OFYD 4X4YB 3OHMB 1SOXA 4M43H 1U3HB 5DEGB 3T6VA 2HMIC 3VQMA 5GISL 2ZQKA 2IC2A 4PP1D 2FWUA 3ISYA 2ZPKL 1QLFB 4HWBH 1XR9A 2WAQA 4XWOC 4EAEA 1UA7A 4MA3B 1YEEH 3AA1B 5I0WA 5IW6A 3X11A 1FE8L 3B2VH 1NFAA 5BV7H 4PN6A 1WQVT 4OI8A 1NPJA 4F7EA 3TJHC 3X17A 4GSDH 1WBXA 3DUUB 3UDWA 4OZIF 2ZX8A 5F1SA 2IGLA 4GI6A 4HKXB 2A6KB 3GHBH 4A2FA 3I6LE 4KHXH 5IKCA 2K45A 4IGBB 5HI5C 3K2MC 2BRQA 1ERNA 5HDBB 4ENZA 1PDKB 2WVVA 3COOA 3L7FA 4FD0A 5AW5B 5GXBB 2EKSA 3LDBB 4BE5A 5ESQA 1JDDA 1F4AA 5FM8A 2R29H 1FJ1B 4WWKC 4PJGB 1Y6MR 5AVTB 4RFNC 4NAJA 4WW1B 2CDGA 4JFUA 5HHOE 4WEEA 5D2NE 1ZSDA 1UD2A 4IDJL 3O3EB 4XNZC 2C3VA 3AAAB 2RFXB 4XCNA 2BVOA 4FJZA 1TTUA 4FTVB 2ZCHH 1JRHL 1A6UH 3ZE0B 1O9WA 2X0WA 4FNTA 5F7BA 3HC4H 1BDYA 5KS9E 3CFCL 1QFOA 2BNQB 4WQOA 2D4FA 2I07A 2QKSA 5A2CA 7PCYA 2A99A 3O0RL 3ARVA 4FQHA 5KANG 2JQZA 2CBMA 2IDCA 3MI6A 1PRNA 3S8GB 3NBNA 2ZXWB 4W6WB 3LKRA 3ERXA 5JHLA 4R9HA 3FUEA 3IFOA 5TF1H 2K78A 2MFNA 2W0KA 3ABMB 1I9JL 5D2NB 5JPNC 4Z76B 1XF3B 4QPEA 3GSOB 2YLKA 1XIWD 4NSKA 4TULL 2WLIB 4OV5B 4JFBA 4QR7A 2B9BA 3CXFA 4KK9C 5DURB 1AR1C 4A67A 2QQKL 4OQ1A 4XNYH 2ZYRA 1BVZA 4XPGH 1S5IH 3PWUA 5DXWA 4CVZB 2OPCA 4QY8B 1TJMA 4XZUB 2C7UB 1CC3A 3QEQB 2WOYA 4NZJA 4FQQB 4AG4L 5EIIG 3RHWK 2I07B 3BIKA 1TZIB 2J21A 4U1NA 5LGHH 1RZ8B 5I8CB 5LHDA 1Z66A 2VQ1B 2AJZB 5JOPD 2AXJA 1ZGLP 1TZHA 3VZWX 1CD9B 3HG4A 1A8JH 5DD3L 4D64A 1RJLA 2ORBH 4UM9B 4H20H 1I9JH 1SJEA 4RBPH 4JHWH 1IL1A 2VJXA 4QRBA 3RWFA 3TEYA 4QTFA 4UZUA 4OQTL 1HH6B 3RNKB 1YYLL 1HEZB 5H2FO 3U9UB 1BLIA 4J6RL 4R4BB 4EO5A 2YEQA 1GOHA 4KFMA 3RE0A 3NACL 1KN4L 1RJCA 4U49A 1A6UL 2A6KA 2Z64C 3VXSA 3FK3A 4TL4A 2GE4A 1TVBB 3QVAA 3RI5K 4PJFE 4FMVA 3QNZB 5IR1A 2CR3A 1KCUH 1EHKB 4UOW1 2FX7L 4HH8A 4DN4H 5BMFH 5LWYL 2XG6A 4M5SA 1P0SE 1G9MC 1SNRA 2CKBA 1I8LC 3CZNA 3G04B 3NZHH 3SCMC 5IK3A 4KZDH 5HHVH 3F85A 3O6MH 1HNYA 2AQTA 3T0ED 5BV7B 4WSGA 2ZSWB 4IHOA 4IJTA 4C56D 2C26A 2DYRB 4Y1TA 1CFSB 1E28B 1VCBC 3KJ4B 3FL7A 3PYCA 5E6SB 1ZE3C 4XNQB 3GSVA 3MCLH 4FXGA 3ZPDA 2BSSA 4FL4B 2P8PA 3F64A 2Y0KA 4Y4HB 3WTTA 1ZA6B 1MXDA 3KYAA 5EZOL 3VXUB 3PWPB 4OZIA 3V0AC 3PQYA 1GFNA 5GGUA 4H44C 2R4RH 3IMBA 3P0VL 4L48A 3WIIL 4ANWA 3L5IA 4H88L 1FE8H 3B2VL 4QYAA 1TCMA 2K9UA 3D3VE 2EICA 1UGKA 4L8SB 4URKA 3LK3B 5KSAB 1OHZA 5J11C 5GRVL 1VFOA 4UQAA 1U8NB 3ZE2F 2V4LA 3KPNB 3L3KA 2Q20A 2YBRA 3EO9H 1NDTA 4L8CA 3MRNB 3S2CA 5LJYH 1VESA 2AJZA 2IVFC 3KXFA 4RISL 2JJTC 3O6LL 3S36L 1FL5A 3C5XA 1SY6L 3MV7E 2VLKD 4PLJC 2C3XA 4A2MA 4G1EA 4HK0B 1LP9B 5L7XL 1MREL 5DU7A 4HCRL 1U8LA 1JGEB 4I0PC 3T6QC 4ZMZA 4XXCC 1E90A 3ZOAA 1QR1B 1HCZA 5EDSA 2XQYG 1AO7D 2BWQA 3TN0D 2BVUA 4E42A 4CVZA 4MDJA 3CNKA 3MRDA 4R0LB 3VQLA 3PWJB 3QGVA 4QRRD 5DJ8B 1A0QL 1B4JL 3VWKB 1TEYA 3BVNA 5IVXB 5A2LH 4X6BA 1X5ZA 3BUYB 5DQDH 5CCKL 2XV2A 4EIUA 2QVIA 4D0CA 3RKPA 3QPXH 4QRFA 1D5BA 4HG4K 3ZDZB 1K6QL 3CBKB 4NRYA 4Y4HC 3X1EA 3GSOA 4KK6D 3UPAA 2NSMA 4BFKA 1GYWA 3QO0B 4Y9EA 4JKMA 2GJRA 1S3KL 5E2VL 5DS1A 2PPDA 3BZ4A 4JZJB 4OLZH 1O5PA 5AB1A 3CSFA 1SF3A 4Z7VA 1A6ZA 3WI9A 4X0KA 2IFGA 3W5MA 3HAEA 5FYLD 4GINA 5I1GH 4YLQT 2BP0B 1UWXH 3QZWG 4PJBE 4ZFGH 1RVFH 1ET7A 1Q9LB 1MRFL 1T2QH 4HKZA 3QHTC 2HX7A 1HL9A 4HUUB 4I3SL 5DDHB 3U4EB 2IAMD 5H4ZA 3MRRB 3D50A 2Z35A 3PL6B 4IU3B 5D71L 3VWJB 2QPFA 4HS3A 2ZXBA 2BIHA 4EI6B 1SYSB 1XD0A 1DDHB 3CSTA 3IDIA 1YJDL 4D3CL 4YFLF 4HUVB 4ZOAA 3ZKQD 1BAFL 3UJTL 4QNPE 4U1KB 1MCBA 4M6NH 3JSSA 3O3BA 3RQ3A 4LKXA 3GBML 5C0BE 5KW9L 1YY8B 5JQ6H 1EHLL 4MNGE 3WFEL 1NKGA 2YC1B 3ZGIA 1RZGB 3W0WA 4OLYL 5DTFA 5C0AB 2JCCA 4L3AA 1IM3D 3AG4B 2DQHL 3FSVA 5E8PB 4PJ8D 4ZX5A 2X6MA 5E2UH 3JYBA 4ZUSA 3PNWB 1QHPA 3LN4B 5MENA 1C8QA 1II4E 4J3VA 3R8BB 2G5UA 1LK3L 3FCTA 1PTZA 1NAKH 4NFBA 2J6EA 5C07D 5CJBA 1UZ6E 3H4HA 1OV8A 1WV7T 4N2MA 4S1DD 4WU7A 2UZYB 5CILH 2W60A 1CT8A 2DEWX 2GABA 3QEQE 3UBXA 3M8OL 1B6UA 3PDDA 4OF7A 2WD0A 3MRLA 3O41B 4MCZA 1GOGA 1ZV5A 1JYNA 4EBQH 1NCBH 2WZPA 4IOSA 3KHQA 1SQ2N 4PRIE 4PRHE 35C8H 4GMTH 3VD2A 1OWWA 2N01B 2EH7L 5TGBB 3FZUC 4KJPC 4CSTA 5J6HB 2DTMH 4CN6A 2VRKA 5JLZA 1FGNL 1TU2B 4TNWK 5E2UL 4EN3D 5EC1A 2W9DH 1TO4A 2H6PA 2K0RA 2YSSB 3KPRD 1GL4B 1QOKA 3MRGB 3ZZ1A 2E7LA 1JL8A 1S7UA 4OLYH 5TE7H 4RLCA 3N04A 3S0PA 1IL1B 2DLEA 3DOIA 3U7WL 3AMLA 1O0VA 1OIOA 4L1LA 4PU2A 4ATWA 1J5DA 1A7PH 3QUYD 1EO7A 3UYRL 4X6EB 2EDRA 3W39B 5DQ9A 4QRTA 2YWZA 3VXNA 1CXEA 5DJAA 2OMXA 5DO2C 3US0A 1QPKA 4TLTA 1KCVL 3ETTA 3ZL4H 1MHHA 4BM7A 2FQDA 1KNOB 1YJDH 2VN5A 4JDZA 5FDWB 3T0EC 4YSEA 4JJ5B 2BFVH 2R0WH 3ULUC 5E0QA 4KNQA 3BX7C 4UUJB 4QWWC 3SSGA 3GEFA 3GRWA 4NT6B 2CK2A 2NQ3A 4FXKC 3UC2A 2W65A 4AZ8B 4R7NB 1VFBA 4OZFA 3P73A 4OZIE 2YQBA 4R4FH 4QY8A 1B3JA 4F58H 4MJID 1FO0L 4OM0L 2R7EA 1KGWA 5G4MA 4ZFGL 1E2ZA 1VPOL 4I88A 4ZUWA 3PP4L 5GGSA 3IRPX 1L9OA 1P9MA 4XNZB 2NXZC 3L48A 4HBCH 1VADA 4R90L 1B6DA 4FLSA 2VDLH 3EIFA 2X1PA 4M8QA 5MEOB 3G6JE 3KBFA 3X3GH 1I1YB 2WJ7A 3DIDA 2YAMA 4HAKA 4PVNA 2J72A 2K70A 2RD0A 4TNVK 5G5DA 4IBVA 1U8PB 4XVJL 4CC4A 2N7SA 5EO0A 1M57B 4J3UA 4ZFOA 3ABLB 2IDTA 2NY4C 4HKJA 2YZ1A 3ECVA 1UM4L 2ADFL 4KQ3L 3FQRA 4GG8B 1U92A 2FRGP 2F2HA 1H9DA 5J11B 1R9FA 1NGQH 1KGJA 1TJIL 1XGRA 2OTPA 2P3YA 4BD4A 5C0EA 5LBSL 2VSCA 2WQXA 1C7SA 1Q9WB 3MUHL 5E5LA 2DMGA 3BP6A 5ESVA 3QDJA 5FYJE 1F86A 3DX7B 4ETQB 4CILA 2Y4SA 4DP6X 1S78C 1BEXA 1AIFB 2OW6A 4N74A 5BRZD 3Q0HA 1DVFD 3BH9B 4HCRH 3T0EB 4I89A 4YHZL 1BGXH 1W6WA 3CQQA 3MMEB 3O3EA 3TPKA 5EV7A 2ICWA 4UOZA 4YSOA 3GBNH 4ZS6D 1RUPH 3OKDA 1IILE 4K9JA 3VXRB 4AGQA 3ULSA 2ZP8A 3CH8A 1A2YA 3MMEA 2H2SD 4HJSA 4CVXB 4NUPA 4G6MH 3SOBH 1FZOB 4H25B 4QHPA 1QFWI 3Q3GA 1ES0B 4M1DL 1QFHA 1ZS8A 5LGKA 1INQB 2YD9A 4PJEA 2F5AH 3JV4A 2R27A 3MJ8B 1NJ9A 3L3DA 3QDGB 4G82A 5CJ8A 4K94C 4F37K 4V1DE 4ZMPA 2CM6A 4MMXC 5EEYA 4OTXL 3IFLH 3KGTA 4G9FE 4KR4A 1VFAB 1JRHI 2GPZA 1YUKB 4JQIL 4NIYE 1CICC 3CGTA 1I8MB 3OM3B 4PS8A 5CSZA 5FWQA 1DANT 2X09A 1HILB 3MCLL 2G3MA 3KGSA 1FVCA 2BC4B 5FUOL 4TVPD 3OR6B 2J8UF 4Q9QL 3X13A 3CWGA 3NCWA 1SQMA 4H0HB 5LWYH 4U1HA 1DQML 3VQ2C 4BZ2H 1BFOA 3UO8B 2ERVA 1SYVA 3CMGA 2WV3A 1QSVA 3ZQ9A 3MCYA 3MBWA 5CEXB 2MOVA 3LPWA 2WIIB 2H8PA 2ZG2A 5DC2A 5IV2B 3D30A 2B4CL 3W1ZA 4BUQA 5IW3A 2K3TA 3I02B 1FUNA 4GUPA 5IW1A 2XPGB 4YGVB 2CR0A 3NACH 1A6AB 3BQUA 4EIGB 1EBPA 3NA9H 4JM2B 3OSVA 1F58H 3L3JA 3SDYH 4MYWB 4Y8DC 3IEAA 2YQGA 4PRID 4C4BA 3X14A 4B3VA 3QIUD 1PPIA 5C70A 4JFDB 4CMMA 1NSNL 2CO4A 4X6EA 3W39A 5ADOH 2BNRA 5TF0A 4XN7A 5CP3A 3TJHD 2J8UB 2LHAA 5KSBF 3P9WB 3N40F 4K23L 2D3NA 1VGKA 3T0AA 5CGMA 1CIDA 2F7RA 2IDUA 3SDDB 3K80A 2BVYA 4LE8A 2XG5A 3V4UL 4WEBH 1U3HC 1XIWA 2VB5A 3TVMD 4K7PX 2CDEA 1XGZA 3H85A 5IVZA 4OKVA 1BXVA 5E1GA 1JP5A 1PLBA 4PBWD 4KI5D 3QUZC 5DC4B 3V6BR 4S11A 4W1TA 4GKOA 3FT2B 3OB0H 2LLLA 3QUMH 4MLSA 2HH0L 2BNUB 3K6OA 2H3XC 3FQTB 3S36X 4BEIA 3VE2A 3MOBH 2BMKB 1FAIH 2Y2YA 1IBFA 3MGOB 1U3JA 2A6JB 4PJGE 3IDGB 2CRIA 3PHAA 4YIQA 1OCCB 1F1DA 3ULUF 1KTDA 3FQUA 1UZ8B 4QIRA 2VRQA 1EEZA 3D25B 4DVBA 3S2AA 3LK42 2GC4C 1S9XB 1YMMB 5AVSB 3FB5A 5KBKA 4DGWC 3CXHK 3V5HB 3U0WH 3EYUL 3MV7D 3B9DA 4APXB 5C0AA 2X2JA 1G6RH 4N8VG 3II1A 4NQDB 3KH3A 5E2TL 4AYBA 4I2XA 3D85B 4WTZG 4WWKB 1T1XB 1CVSC 4AYDC 2VLRA 3LEYH 4G11A 4KJQD 4ZMOA 3IDJB 1KTLB 2C3GA 3H0TA 4MCMA 4N2BA 5TJWK 5I1IH 4BQ9A 3OJDB 4O2CA 3EOTL 5FYLL 4I0PA 1D5IH 4LSVH 1FN4A 3Q3GB 3ZDWA 2PPEA 4HUVA 1OLZA 4XVUD 4LSRH 4B9IA 3MYZA 2Z35B 3PL6A 1FAKT 1KENH 4IU3A 4TXVB 2FJGB 4UQ3A 4YN3A 3HR6A 1UD8A 3SYBA 2YQ2A 4RDBA 2XE3A 1WA2X 4GFTB 1SMAA 3TTSA 5AVQB 4UTBH 3LKNA 3B56A 5DFVD 4MMXA 4EPSA 3QUYB 3L3OB 5H37G 1GRWA 1EGJH 4M9OA 4NN5C 4U6YB 3S8WA 4Y4FA 1LDSA 1FP5A 4HFWB 4U3XA 1A6ZB 5CBAA 1NWOA 4P07A 1MFCL 2ZXCA 4BKSC 2W59A 1OCZB 4BGDA 4X6CE 1OGSA 1NDGA 1ZLEA 4NQCD 3HBPA 3VWJC 4GG6B 3Q48A 4I9WD 5CN2A 2XXMB 2X1WL 4XMLH 1USZA 3RRQA 5C0RL 4OI7A 3KLAB 4R7DB 3ESMA 2BIOA 3FRUA 1SN0A 1E2WA 3OKKA 2JF1A 1HL4A 2EECA 2ZKWA 3DK2A 2ITEA 2XKNA 3DROB 2ZX9A 3EBGA 1VA9A 1FYTA 2AJ3B 5I5IA 5F21B 4BSWA 4E42B 4ZUVB 1TOXA 2NT0A 4FNPA 4O3XB 4NKMB 1ZTXH 4ZTPL 1LE9A 1FZJA 2YSTA 2YIHA 4AGPA 2YS4A 2K1MA 4B5ZA 4IOFD 3QJUB 1GS7A 4KDTA 2GUOA 3BSZL 4XCYB 4WK4B 3WNNA 5J6SA 2D0FA 2VLJB 3BS0A 4TNEA 2WKLA 5T1DL 2DMKA 2VQTA 3KXFB 3WTWA 5C09A 5L4FA 5I6NA 2DI8A 4Y1AD 2FGWL 2ZOKA 1W8EA 3P73B 4AEFA 3OZ9L 1YMMA 3FN0L 3GI9L 2NY1B 1AZUA 1D5RA 4MYPA 4KXZI 1HHGA 2OK0H 4J2XA 1CG9B 1IGML 3ZTJH 1ONQA 4TQPA 4PTUB 4LDEB 3CPLB 5LN8A 4HEME 3CFJA 1TSRA 3SKOB 3ML9A 5GZOD 4X9BA 5KN5A 1E9PB 1LNUA 4DW2H 1RZJC 3GMQA 5AVVB 3NIDB 5B3JF 5KSUB 3ZHDA 3E1F1 5DUMH 4XPBH 3HI1B 1JUFB 2EDBA 4Z7WE 5A2FA 2BPBA 3AWFA 3CBJB 1M7DA 2XOTA 4PEEA 3VWKD 2N1TE 1I4FA 4XNUL 4LSSL 1ZS2A 1AC6A 1CLVA 3IETB 2EADA 3O9WD 4XVSH 4JPVL 1SLUA 1JAEA 4TL5A 3N9GL 3RZCD 3P69A 2VLKE 1ZXQA 1BVOA 1HXYA 2LU4A 3LS5H 5T1DH 3KWTA 1JVOA 3HE7D 3OB8A 5DVNA 1QLEH 3W2DH 1QRNB 3QK0A 4PJBF 1NAMH 2A9NL 5TK2A 3ULUH 3I2CH 3LQZB 4ZW5A 1RHHA 5DMIH 1MNNA 5AW7B 1YLBB 4W9ZA 2VDNH 1DP0A 1CT8B 1OY3B 4FXKB 3X14B 4FG6C 1CS6A 2Z3FA 4P4KD 5IR1B 2VXVL 4I18A 3NIFB 3O11A 4HXBH 5F3HB 1XTMA 3I3DA 3GIVA 4LVNC 2UZIH 4XMPL 1RUMH 4U05A 2Y1VA 3KR3L 1DVSA 3HE7B 2EDOA 5IW1B 3RBGA 1JF1A 5IB5A 5E8PA 3GBLA 3P3UA 3LQMA 1J11A 3OX8A 4ONFL 1SGKA 1WCQA 5E6YA 3TU6A 2XWJB 3V5DA 1IKNA 3ES6A 1J0KA 4H0LC 4L05A 2WXOA 1HEZA 3FB7B 3ZR6A 4YJZL 4L3ED 5LXGH 5IB1B 1TZAA 3IAPA 4GLRH 1SFDA 1Q9FA 3QDJD 1N3NA 1KCBA 2VITA 4O02L 4P2RB 1QFPA 5AFAA 3OR6A 4LVEA 1J5OH 2H0PA 1PU0A 4P5TA 3ZDXE 5CGTA 3CHOA 3LS4H 2YQ3A 4YHOL 1MFEL 3GJFH 4OGYL 1WUNT 4JLRA 2K4AA 1BPLB 2KZBA 2UYLA 2VXUH 4YE4L 1DN2A 2W9LA 5GS0C 2NPLX 1E5AA 5PRNA 1FH5L 3PABB 4NKDA 2GK2A 3APFA 3QWQB 1BVKA 1AOHA 3U9PL 4HD5A 3RILA 3S34H 3QDME 3ZMRA 1NJ9B 4QAWA 1CXKA 1TKWA 5D7JB 1N5YH 4FQLL 5EMYA 1U95A 3QWOB 4TLKA 4QAMB 1FCCA 2CU9A 5B1CA 4CU6A 4F33A 2PF6A 3S5LA 3IFPA 3IK2A 3V5KB 4YEFA 2FJFA 3NSFA 3ZTCC 4QOKE 2G5RA 4DZ8A 4DWHA 2XN9B 3ELAT 4JFEA 3F7QA 3PG2A 2VABA 4OV5A 1D2PA 4YL4A 2H5UA 4DP0X 1EAOA 5L2JB 1C16A 4D7PA 3LKOB 2C1OA 3VXRA 1OSZA 4R2GD 2IPTH 1IAIH 4N2IA 1PSKH 3DURB 4K8RH 5B66O 4WTXA 1Z5YD 1L5GA 5L6YL 3B9AA 2ZUQB 4OT1L 4OVVA 1Q38A 4JFZH 5CINL 4KMLB 4HS8H 4K3DH 3FCGA 5CIPH 4U1SA 4ZX6A 1HDMB 3M46A 3O6FB 2Z92A 3VZTX 1JGEA 4OCYH 4QXGL 4F93B 4KMTH 2DWSA 3U36A 4DTGL 3MKGA 5AKTA 4YGAB 1CFTA 1X6NA 5KEZA 1BPVA 3SPJA 1XGRB 4DFHA 2K9FB 1AY1L 3UP1A 4LK4A 3LB6D 5I5JA 1AHKA 2R2BB 5GRUH 4B96A 2ED7A 3MCG1 4NHCL 5F89B 4GUCA 1OAQL 2AABH 3LAFA 4Y2DA 3HMWL 1ND0B 3EH2A 2XTRA 4GO9A 3P4NB 3OGCB 4N2FA 4Z7UB 1RERA 4JGJA 1X9LA 2J1XA 4OLVL 4PGEB 1DQLL 4L8SA 1YECL 4LASL 1AGDA 3GGWB 4ZBJA 3NCMA 1FNSL 3F5WB 3QDGE 3KPRB 2H1XA 5ESQB 4UV7H 1JZFA 1SVZA 4L8BB 1E4WH 3M17A 3KVQA 4ZUWB 4I5BB 5GGSB 3UPGA 4XNKA 1BD2A 1D6VL 1Q0YL 2DMHA 2XI9A 1I1CA 3PWVA 3DC0A 4JMXA 2D9QB 1WHOA 1IBZA 1JN6A 4KH9A 5BJTA 5IVXF 1NDMA 1F90H 2E7MA 2ZKMX 4YEEA 2ADJA 4PHXA 2HT2C 5D9SA 2EJ1A 2HB0A 1VERA 3ARFC 3PIQB 3QXTA 1KLUB 2Z65C 4KY1H 4PS4H 4W9EC 5LG1A 3SHSA 3UJJL 1CBVH 2UWEB 4FADA 3RVXD 5CJXC 1DQMH 1PZ5A 4BZ2L 4OKDA 1KWKA 3EKCA 1WD9A 3G5XB 3EO0B 5C3TA 2NY3C 1S8DB 3VI3E 1L9TA 4BH7A 2WVSA 4HLJA 3QNZA 2YFOA 2R4SH 4YDLB 2NY4B 4JO3L 3QUKB 3KLSA 5GTIO 3F58L 1KJ3L 1HHJB 3GEWB 2H26B 3PGCA 5K9KA 1YN7A 2QR0A 4HC1A 4H2AA 1WK0A 4XXDB 3QUXC 1M7DB 3PGRA 4R4ND 3RB5A 5F88B 3MRLB 2CLRA 4K5MA 1F4WL 1LM8V 5H4YA 1OP5H 4N6RA 4EZMA 4MAYD 5FX3A 1FDLL 1CDCA 2H3NB 3E0GA 4E41A 1PLGL 5JZ7D 3SGDH 4U2YA 1E5UI 4PTUA 4YDKL 1E7UA 1SJEB 1J5HA 2CA4A 1CGSH 3BCDA 4HOMA 3O6KH 2OBGA 3WJLC 3QUGA 3B9KD 2VLMD 3UAAA 2VAAB 5DHVB 5C6PB 1RIHL 2R9HC 4W4OA 5DJDA 1NOLA 1DL7H 3H3BC 4JO5A 1T4KB 1F5WA 3VH8A 5I2IA 3G6JA 5FO9A 4W9JC 4YR6B 3PWLA 3GGWA 1OGPA 1Y18B 3TZVC 5CEYB 2Z31A 5LCVA 3ZMEA 2CIKB 3QEUB 4XAKE 3RBHA 1JK8B 1Q0XH 2RJMA 2BVQA 3C6LA 2DMCA 1T03H 3VWJA 2G60H 1MCWW 4NN6C 4YOKA 4UNTA 5KOMC 1SF5A 3SYCA 4WUUB 3TIEA 3TV3H 3ILDA 2ATPB 2X7LB 2JTYA 5DDHA 3DWOX 1CFTB 5T3XH 1D6VH 3ZK0A 5GRWA 1N64H 2X4RB 4HIXH 1XD1A 4P99A 4XPAL 4C58B 2NX5A 1CE1H 1WBYA 2VLJD 2Y5TB 4MCNA 4IBZA 3AXLB 1FVEA 1A4CA 1DQIA 4W9FC 1UFGA 4POZC 5L2KB 1M53A 3IPBA 3H3KA 2GBVA 4HUCA 3QQ3A 2RQEA 4R7XA 5F7UA 4KPHL 5AVYB 3UH8A 4NB7A 1MH5B 4BSVA 3D0LB 5AFUL 2D9CA 2G4GA 2LE9A 4B9JA 1UWEH 4P2YA 1SY6A 2MQGA 5DMKB 3LKNB 4F58L 5EH1A 1K72A 3APNA 3BUTA 3IXTB 4P23C 1B2WL 5K9OA 1C16B 1SJMA 2XTJB 5GS0L 3OKOB 2X5PA 4KBPA 4LMQE 3L16A 1FBIH 1SN5A 3B3IB 2EEDA 3IS0X 3KCWA 4B9GA 1IIKA 4Y1AA 1KXQA 1IM3B 5INCA 4X6BB 1PKOA 3BUQA 3QNYA 3IMTA 3DSNB 3TT3H 4MD5A 3ZL4L 2C34A 1ZKAA 4NUGH 2R88A 1HXXA 4TF4A 5HYJD 1JV5B 2HLEB 1TIUA 3MCKB 3PWLB 2FQEA 1EPFA 5D1XA 3ZQWA 5HI3D 4N86A 2HVKA 2XFXA 3HJ0A 2JKNA 4X80L 1IBHA 2B3IA 4MD0B 4DNLA 5KJ7E 3PJNA 5GRZA 4QQ1A 3BSHA 3IJEA 3VWJD 5B1JC 2VL5B 4JAMA 2R56L 3IS1X 5JIDA 1IGIH 5DRNA 4PAZA 3FU5A 4FSOA 3L4WA 5GGSY 1QEXA 3U1SL 3MRNA 3CTTA 4GMTL 1IT9H 4HKXA 3ULVE 4KKPA 3P4MA 4L9LB 2ZJSL 3ZUNC 4Z7QF 1L6PA 4NENA 2GTQA 1ACXA 3AROA 1MRCH 2BNUA 3BUBA 4FQLH 3PV7A 4PJHF 2CJUL 1XIWC 4RAUB 3VGGA 1MFDH 3GBEA 3V0EA 2OMBA 2VW4A 3BQVA 5E95B 1ZT4B 3VNYA 2ZUXA 3LH9A 4XCFL 1AR1D 5DRXB 1TTGA 4UV4L 1A5FH 1UFUA 4U1MB 5GSVA 4PGZA 3O9WC 3GSXA 1MFEH 1Z3RA 2ZSVA 2C8NA 5IF0B 3BRDA 1XH3A 3WXWL 3OKYA 4QHLA 5HHNA 2V5YA 3PGDA 1XGYH 2BLFA 4YSCA 3SYPA 1J5OL 1GY1A 4NP4H 5DVPA 2AJUL 5E9DA 1P4TA 1R24A 4PB9L 3J8F7 3ECBB 5JHDA 2CK0H 2XPYA 3DXAB 1FPTL 1HU8A 2E7BA 3IJHB 2NY2B 1R0AL 3MRMA 4LSTL 3PS6A 3KYKL 2WVUA 3WE6B 2XCMC 1MJ7H 4TQEL 1XF4B 2OMVB 4ONFH 3SE6A 1S9YB 4Q2ZB 2WWMC 3A6CH 1A6TA 1FFPA 3DIVA 4NBXB 5EOCL 2X4PA 4BE6A 3C9NB 4F57L 2JH2A 2IPKA 2BP8A 2P4AB 4NPYA 1S7QA 2ARJA 4I3SH 2QTKA 3O3UN 5F71A 1WJ3A 5D7HA 4PRDA 5D8JL 1EDHA 1VIWA 2OJZH 2VLME 4G7YH 5CJ5A 4H1LB 5KJ4A 3TGXA 5KVDH 1EZVX 4S1SH 3NSXA 2PWGA 3EYVA 3HKZA 5D7IE 1KOAA 3Q6GH 4EUPA 3RNKA 1HNFA 2ALAA 2DWXA 3JUYA 5I1HH 1ET5A 1B2YA 3V6ZA 3BH8A 4LO9A 4DK6A 3CFDA 4F15B 4NZ8A 3SKOA 2D7TL 2IJ0C 1HZHL 4N0CD 2VTFA 4W9KC 1YSOA 3GLEA 1GS8A 2WO2B 4ZOBA 4UBDC 3T09A 3TH2T 1H3GA 1XGTB 2HVJB 2YR3A 1FV1B 5FKAA 2BCMA 2BSCA 1JF6A 2X38A 2YPVH 3FO0H 1LO2H 2WKOF 2XG4A 4XC3L 2HTLC 2WIMA 4KRLB 2A9AA 4XNUH 1V5JA 1FSKB 3VXSE 3L5HA 4NQTA 3BP7B 1I7UA 3L3DB 2V2XB 5FCUL 3K4ZA 3DBXA 1OTUD 2X89D 4FQQA 4Q6IB 3CSBA 1PAZA 5C2BL 1YEKL 2P52A 4MCYA 1F8TH 2Z1KA 3VU2A 1U33A 2KPWA 3SYSA 2NY2C 5HGBA 2EYSA 3MGTB 5IIEB 1RY7B 4I7ZC 4NQQA 1JZ4A 2C9VA 4R97B 2AQ2A 2IDQA 4XPHL 3O6LH 3IJYA 4JG0L 3FN0H 1NBVL 1SM3L 4PYGA 4NKIH 1QYGL 5JHAA 3WL9A 5J3HC 1YNKL 3UTOA 4LLWA 3BEVB 3S37L 3EJJX 3FW6A 2VO5A 1BIIB 2XN9A 3BSZH 1YA5A 3G6DH 1BFTA 4OZ4B 4AL8L 5HVHC 4X6CA 1UD6A 1MN4A 2PO6D 2GAZB 5T3XD 2QVMA 5ITBH 2JXMA 3KJ6H 2ZICA 4C4KT 3C5OA 2WYTA 4MHHG 3S9DB 4Q9CA 3EFFB 4ZXBB 4NERA 1MCQA 1R5VB 4ZQKA 3MRFB 3RUGA 5HHXH 1A9BA 4NHUA 5JYMA 1P4BH 3QZBA 2YRZA 3DI3B 1OGTB 1E67A 1JPTH 3G6JF 1U8PA 1B88A 2C9RA 2COVD 3KPMB 5TE4L 1JFHA 4WUKH 1OXYA 4Q6IC 5IQOA 5KZCB 1FFRA 5EZPA 3E7JA 5BOJA 3UZQB 1AKJA 4FQJH 3NSGA 2SODB 1RU9L 1YYCA 3D2UB 4HIEA 2XWJA 4NQUA 4QRRB 4XHQA 3E9TA 3QUZA 4AVJA 2ZOWA 4NRZA 3T3PB 4UTBL 4FKKA 4KUZL 3T1FB 2AQ1A 1NWPA 1YMME 2K6ZA 2BDNL 4D9LH 3GS7A 1ZHWA 1MJUL 1S9XA 4YVNA 3WLWD 2OMTB 4AJWA 2FR4A 2X0VA 4OFYA 1KTDB 2X4UA 4Z7NE 1CYXA 2Q86B 4A6YB 2VJ8A 4JFED 2A6JA 2WXHA 3ABKB 5EZIL 4IRZA 5CBEB 5I66B 4XVOA 4JFTA 4Z0XB 4L5FE 5HVHB 3N85L 1XGPB 3RNQA 4UNUA 4EI5C 2NCEA 1D5MA 2I24N 2IMNA 3PJSA 1DQQA 2KBGA 5ADPH 3S3PA 1XR9B 4MJ2A 4L1HA 3CIAA 3HPLB 3CZFB 5FHBL 3RFRA 5F96H 3FYXA 1R3LA 4G8IB 5IQ9A 4J27A 3BLPX 3QIWC 4FLQA 3L9YA 1WFIA 1WUZA 4KI5C 5IVZB 1OANA 1QBBA 3AY4A 4P2QE 2D3LA 2P80D 1BQSA 3EBHA 4PGCA 4QF1A 3T1WA 3WELA 1RH8A 3O81A 3UP6A 2GJ6E 4AQZA 3Q9QA 2VUKA 3TNMB 2DQMA 3DMMD 4N5ED 1X5XA 3TBYB 4ODUA 2CLZA 3O41A 3TIDA 1ET8A 1QWNA 1K8DB 2FL5A 4L8DB 4YNYB 1DBJH 2LAGB 2V37A 2Y36L 3KBHE 3UC0L 2YEVB 1QO3B 3CZJA 1ZCRA 3DX9A 2UZPA 1LNUB 3L3JB 4YQXH 4N2KA 1U91B 1RFDL 2OYPA 3V0IA 3FUDA 4MLIA 2TRYA 4FA8A 2XZQH 3UROR 1BMGA 2XWDA 3TJEL 3VMNA 3VFGH 4KX8A 3CDFA 1I9IL 4BYHA 4HZLB 1AR2A 2JK5A 5I19H 1WIOA 1MCIA 3BVDB 4G8AC 2AJSL 3VSTA 1P6WA 4P2RE 5TF1L 3NZ8A 4WU5A 1UADC 2F1AA 3TZGA 1NSNH 4ZTEA 1EZVY 3NIFE 2BX5A 1BFVL 2HLAA 3QORA 3UG3A 4N2GA 4C56E 4ZPTA 1E9OB 3LEVH 5D5DA 2E0PA 4J7RA 2QJDA 2OYLA 3NA9L 1NA8A 4O3WA 3PDOA 4LLYA 2GCYA 2ZCKL 4E1TA 1S7WA 4ISVA 4O58H 1JRHH 5E9NA 5I8OL 4C69X 5J1AA 4NQVB 1VFAA 1IC0A 3BZ5A 5D7JC 2YA0A 3DJSA 1QFUH 2CO1A 3EGSB 5C71A 4BUMX 4IOSD 4AE0A 3HI6L 3JWDL 4R0LC 5EOQL 3TPUA 2E9WA 3S5LG 1S78D 2CO6B 2J88L 5HY9B 3ZYOA 1QSFE 2Y2TA 1X9RA 2OR9H 5I76B 3IRCA 4ZMVA 4QHUA 3V0VA 1A1NA 4R6UA 3IE9A 3TPUB 3TJPA 4LSQH 5EULV 1KEGH 4MZRA 4PGDA 3CPUA 1U8KA 3OLDA 3VXRE 4PJ9A 3BSGA 5CMAA 4B7IA 5C0GB 3QI9C 1LQBC 5EBWB 4FNLL 2PXYA 1F02I 1W72A 5MP6L 4JFDE 4FCHA 3BH9A 4ZD3H 4KVPA 2WWNA 4B6ZA 5I24A 2WBJC 1HZLA 4XB3A 3V0HA 2JJSA 3WTYA 4WWNA 3T8XB 2MOGA 3BP4B 5J12B 3NJTA 4JG5A 4JANA 5TFSL 1G87A 1KTCA 2AK4D 4OZGA 4X4ZA 2E59A 5FUCE 3KPSB 4WHYG 3V4LA 1JV2B 3MLRH 3NFPA 1RULL 1HIMH 3SOBL 4W9GC 3H7BA 4X5PA 1YUHA 3HS8A 4AIOA 2E4TA 2XNAB 4I1NB 4XE5B 2FH6A 3BRZA 1MI5A 4KC3B 3GRWL 4NKIL 3OGOE 2DD8H 5HGGS 1RUPL 1WBZA 3OMZA 3RG1C 1NUFA 2VMFA 3FUHA 5D72H 1M4KA 3L3KB 3LN5B 4DCQA 2X28A 4UT6H 4HLEA 2EE0A 1FI8C 4NOFA 5CIPB 3GP6A 4RGMB 3JV5A 3RGVD 3DECA 4EUPB 3LNGA 1AO7B 5SWZE 4AKQA 4JZOA 2J1KA 3GUTA 1T21B 3TBVB 3IKKA 4PRDB 4NC2B 1JPEA 5GIRA 4BFGA 1HJCA 4XC3H 3FDWA 5A3ID 3RJDA 1JK9B 2FEDC 1SRDA 4I85A 4LGSB 2DQTH 5DUJA 5AAMA 1EK3A 1GGIH 1IRAY 3IMWA 3A6BH 4KXAA 4A7UA 2DL2A 1MCPL 2XIDA 5JNYA 1JZEA 2X6VA 3HLKA 1NICA 4XO4A 3GSRB 4G42A 5KYXA 1TO5A 2XQ0A 4V33A 3VI3A 4Z7OF 1ZPLA 1D5MB 1MQ8A 4R90H 3FTUA 3CMOL 5D4HA 3LKPB 4PREB 1YHPA 4LVHB 3VX1A 4NYLB 4F2MB 4XO9A 3FRPG 1WZ1H 3SPVA 1PKQE 4L3EB 1J1OL 3QQ9C 3F7YA 1PX8A 2D0GA 3LKQA 4JM2A 3RZCB 5D8JH 3VXSB 3DX8A 2OX5A 3JWOH 3C60C 3D2TA 4LSFA 3WEXA 3R0MA 5J6HA 1AD9A 4AYFA 4M02A 3U83A 3AZUA 4TNFA 3I6LD 3Q8BA 4M6AA 2VZUA 4JZNB 5CS7A 4YSUA 3LRKA 3P9MA 5C0IB 1BQHG 4OGAD 2EDEA 2XWRA 4DP8X 4J3OG 4D65A 4NPKA 3DX2A 1R0AH 2A74B 2I32A 4Z95H 4HGMA 4GRMA 2KQMA 1NBYA 2XYCA 3EDEA 4J4PD 3SDDD 1N6UA 1BJMA 1CF1A 1AZCA 1CGVA 5L8LB 5FGBC 4APQA 5KVGL 3IPEA 5IHZB 2VDOB 1NPUA 5F1OB 1OVZA 4IMLA 5JUEH 4GO8A 1OGTA 2XJKA 3PHSA 1A9BB 3AXHA 1MWOA 4ZI8A 3SQBB 4BZ1A 5I8CA 4UV4H 5G4OA 3N40P 5DTFB 2GIXA 4YXHH 4JY5H 3LHPL 5LGJA 1NCBL 5IEHA 4D94A 1XGQA 5C08B 2ZOTA 3TZVB 3EG9B 3MNZB 4K9EH 4WF7A 1TVHB 3CXDL 1TF4A 1V3KA 2PPFA 3KYOB 1MCLA 5DRWA 2VXQH 3AA7A 3FO1A 5JDPA 2P24B 3NSYA 4S1RL 3F7RA 1FZOA 2XQBH 4JDEB 3PHOA 2A4CA 3KPQA 1KYAA 5EZJA 1M2VA 1KCRL 4QMEA 2DIJA 4ESKA 3C60B 4DK5A 1IKFL 4F5CE 2OKMA 1JGDA 1JD9A 1KC5H 5JUEL 1A6PA 2F5BL 3LMJH 2LV4A 4X80H 3HOGA 3KPPA 2V9QA 1N68A 4FG4A 1L9QA 4M3KB 4XP4L 1Z9SA 4HWZB 4OCNC 3VCLA 4Z95L 1XR8A 1I7RA 4QUOA 2DI7A 4MRCA 1AZVA 1IGCH 2MH4A 3HCVA 3K3QA 1VDGA 3CK0L 3K91A 1M7UA 1DN0A 4HJUA 3NCYS 4LRNH 1QHOA 1Q9WA 1ZHNB 4JKWA 4NRYB 4QI3A 1R75A 2HFEB 2NSXA 4IBTA 4HUWB 3ARYA 2R1WA 4LHQB 3OLGA 3VD5A 1T1WB 1EO5A 3LNDA 5EWIL 5T1MA 4XP6H 1U3YA 5FK9A 4ZMQA 3QI9B 3V6ZB 1Y18A 1TZ8A 3IU4H 4QYOB 1QR1A 5T33H 3POHA 4N85A 3V6FA 2BIQA 5E6UB 3N06B 1PGRB 2KXPB 1ZHLB 4LOFA 5DK3A 4OR1A 3LVTA 1LP9A 5ICZB 2JQMA 2QQLL 4MNHA 3FPYA 3E8UL 5J12C 5IWLA 2F1VA 1ETZB 2PP9A 5TQ0H 4RMWA 5K5YA 2EUZA 4H40A 1T0PB 3RGBA 2FATH 3MLSH 3BAIA 1DZBA 3BIBX 4AXWA 2APVA 4XODA 3B4NA 1JPSH 5J7CC 5DMYA 2P48B 3FQNB 2CKBL 4NBYB 1INDH 1EEUA 3UERA 3GZQA 2AJYH 1KLGA 5ANME 3K6DA 1YPZF 3MXVL 1AANA 4RBPK 3K1DA 1G7QA 4UIMA 2V7NB 3ZDYB 1N10A 1U8QB 2IV9A 4NO0D 4QRUA 1MREH 2OMWA 1MCKA 4FFWC 3LZFH 4GKZB 4OFPA 4MAUL 1AJ7H 2OTUA 3VXUA 5A3IC 3GHPA 2IQ9L 4Y0GA