5T5FA

Neisseria meningitidis factor h binding protein in complex with monoclonal antibody jar5
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
226
structure length
226
Chain Sequence
GLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Factor H binding protein variant B24
publication title Neisseria meningitidis factor H-binding protein bound to monoclonal antibody JAR5: implications for antibody synergy.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
total genus 53
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2016-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 5t5fA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5t5fA01
3V8UA 4O49A 2W80C 4O4XA 3HOLA 5EE2A 4O3XB 3PQUA 4O3YA 3HOEA 4O3ZA 4AYID 2Y7SA 4O3WA 2KC0A 4AYMC 2KDYA 4AYNA 4AYDC 2W81C 5T5FA 4U9CA 3VE1A 4QQ1A 4O4UA 3VE2A 2LFUA 4Z3TA 3UAQA 3PQSA 2YPVA 4AYEC 3KVDD 1YS5A
chains in the Genus database with same CATH superfamily
2W9EH 5EORL 3VWKA 3UZQA 5B39G 4OJDH 5JIDA 1AP2A 5IHZB 2OLDA 4FNQA 3H9YA 5GISL 3ZVVA 2EDOA 4HVBA 1R3HB 2IAMB 3JV5A 2VMFA 4JO2H 2GK0B 1P69B 3FQ1A 4MJ2A 3SKJL 2H32A 2ZIDA 4MZIA 3FFDB 3MR9A 1RLBA 1Q72H 4QMEA 3NN8A 5K9QI 1E3ZA 1KJ2B 1MI5E 1S5IH 3VE1A 2V37A 2XQBL 1XEDA 2BWDA 2UWEE 3BX7C 4KDVA 2Y0KA 4OT1H 1NGQH 3PF1A 2RFXB 2A9NH 4NUPA 4PYHA 2XIDA 5KSAC 5INCA 4OUUB 2HSIA 1CC3A 4PGCA 4FE9A 4U1NB 2NR6C 4M3HA 2IH1A 3ROLA 2A6KB 5ABDE 2BFVH 3QNYA 1G7QA 4H0HB 4OTXH 2E7BA 2ED8A 3RPBA 3BUPA 1AFVH 1J87A 1O6TA 4U1HB 3ETTA 3VGHA 3QISA 1ZGLA 2XNAA 1RJCA 2N01B 4NWTL 1TJHL 1Q0XL 4TL4A 1NGZB 1CZ8L 2CBQA 4PW9A 5A2CA 5IQ9A 3HMXA 1GHFL 5D5MB 3O11A 3SDDC 5ACMA 2W1NA 2GT9B 2UZPA 3OXSA 1CFSB 3FO1A 1MLBA 4HUXA 4NO0A 2MCPL 5F2FA 5C0CA 4I0PC 3G5XB 3TEUA 1XFPA 2BNRE 2I24N 4LBEB 4XX1E 4G8EA 3H7BA 1HZHH 4CN1A 3HE7C 2NXYD 1E5YA 2A6DA 3HE6B 1IC5L 1MY5A 3AXHA 3NH7H 1DBJL 1PBYA 1LWJA 3QH3B 4R0LC 3S6CA 5JXEA 1BG1A 2VDQB 4QRBA 4QHUA 3KD4A 1B0WA 4XOCA 2GG1A 5AFUL 1X6NA 2D7QA 1VZIA 5LCVH 3H42L 5JMRA 4RGNC 3PQYE 4FEMA 4OD2A 2LGNA 3G6DL 4FQIL 1IBGH 5EU6A 1BPVA 4LSSH 2XETA 3BSZL 3VFMB 3IS0X 1UXWA 1CBVL 3F7QA 5GPRA 1ZA3B 2Q0ZX 4KQ4H 5E99L 3T2NL 3M1CA 5HHVL 3MV8B 4AYGA 2PUQT 4YSRA 5D1XC 3CFIC 5E5UB 5LWYL 4AV5A 1QJ9A 3LN5B 3GXFA 3LHAA 4O4UA 5E5RB 4U1KA 4ZNEA 3D0VA 1T80A 3IJEA 4HLEA 1UB5B 4H1LA 4D0DA 1A7OH 1LGVA 2P5WE 5FECB 4WKXA 4JKKA 5C07A 3VACA 5CBEA 4JS7A 4DVRL 3N2JA 2H3KA 4IIQB 4WU5A 3RL2A 1DDHA 4OD1L 1RUKH 3A0BO 4ZFOL 3TN0D 5CSBA 5C08E 3DK2A 3FSAA 4KKQA 1MCQA 1BPLB 1AHMA 2XXFA 3KPSE 1AYRA 4G1MB 4N20A 1DUZA 3SJVA 1JHKL 3GI8L 4FTVD 4R4BA 3OPZL 3FN0H 1P4IL 2J8UB 4FTDA 3B2XA 4PRIE 3R7QA 3OJ2C 4R8WH 2AW2A 1DZBA 4G7YH 1MJ8H 1FAIH 4TULL 1OP5K 3SKNB 2CO7A 2W9DL 3DVFA 3X1NA 3W56A 1NBCA 1X4YA 2Q7YB 4BUHA 1IQDB 1BZOA 5C71A 1KBBA 3WNLA 5AW9B 4Y4KB 3P9MB 2I60H 2YQGA 3Q8FA 5GIRA 4JY5H 2JWYA 1E7VA 4AT6B 1CTMA 1MELA 1JGEB 3PHAA 5DT1H 4MCYB 4LSPH 4GLRI 4KMLB 3HZMB 4AYBA 2VXQA 5D1XE 3KWXA 2GUOA 1CTNA 5IBLD 3UGUA 4RFOL 1BIHA 3C5JB 4G8FA 4YSTA 5SWQA 1UZ8A 2JQAA 4Y5YA 2XQYG 3TNMB 1F11B 1IV8A 3TO4B 1U95A 5JA9A 1L0PA 2GTWA 2Y5TA 2B08A 3FU7A 5DZ9A 3WFEL 1NCOA 3RFZA 2ZYRA 1F2QA 3EJYC 1QSEE 5JLZB 3FB6A 4H8UA 3NJJA 4IJ3B 3LZFL 1QR1A 4LOUC 4KKLD 3AMLA 1RY7B 2JTYA 2RD0A 4G43B 1I1CA 4GI8A 5EOTB 4HMDA 3GMMA 3IU4L 3OTTA 4AXWB 3X3GH 1ORQA 3RZWA 4XB3A 1N8ZA 4G9FA 5G26A 2KH2B 3QDHA 4ZUTA 3GDCA 5H8DA 3ZSTA 4LRIA 2VLRA 5J1TC 5BRQA 3T4AC 1U21A 2CKBA 3OD3A 4PRHA 5D7KD 2QSTA 4JEGB 1YA5A 3BZ4B 3QJHA 5JPMB 1YMHA 4Y1AE 5J57B 3B34A 1V7ML 4J3VA 5FO7A 1QHOA 3VRJB 1VENA 4FG0A 2ALWA 4G82A 5BRZA 2XCMC 2MNWA 2VQ1A 4CU8A 4WI0A 2VDPL 3M86A 2DRUA 4M1CD 2FSEB 4TNEA 2UY7A 4LO9A 1YY9C 3V52L 4AJVA 3KLAB 5E9DE 3L5HA 2I9LA 1LNUA 4UDUB 5EH1A 4MJIA 4ZW6A 3ZBMA 1JK9A 4NUQA 4ETQA 4X6EA 1CD1A 1V27A 4S2SA 3IGAB 3JWNC 3VXRB 3VX1A 1UWXH 1LO4H 1URIA 4AQ8C 4XP9H 1I4FB 1JYVA 4KO9A 1E3XA 1MZYA 4NP9A 4YHMH 3SYBA 2H2SD 1HHJB 2EIBA 4QRPE 5DEZA 1O75A 1IKNC 1ZOXA 2PCPA 2JJVA 4CADB 1AS8A 3NIGF 5IB2B 4LCIH 2WD0A 1RURH 5K1JA 4AQZA 4AW7A 2J1XA 1CLOH 1PCSA 4EAEA 1WC7A 5AKSA 4NO0D 5C0CD 2CUMA 1K2DB 5F1SA 2N59A 3B1UA 1IAKB 1OPGL 3QARA 4JHAL 5FYLD 1JSYA 1X5LA 3DHMA 3VWKC 5IJDC 4Q9QH 2YMTA 1ACXA 3LQAL 2J4WL 2UVEA 1CE1L 4PJAA 2QTEA 3IETA 4NGHL 2P1YA 3ATEA 3LH9A 2HXAA 1UWGL 4PCTA 2E7LC 5JXED 1DBKL 2ZF8A 1QR4A 4DVBB 4YDKL 1T22B 4JUSA 1CFQA 1GFPA 4M1CC 3MRHA 5HYJE 5HDBB 4GYBA 3AA7B 5EU6D 2GEQA 4OZGB 4POZC 1UYWL 1BAWA 1Z3GH 3GSQB 3IVKA 1VLXA 3GBNH 2OJZH 4G5ZH 4KMQA 4F7TA 2H9GA 2N4IA 2WCPA 4AIZB 5L0QC 3WIIL 4HV8A 2CGZA 4PH8A 3QORB 4UOW1 3ECVA 4U1LA 1XB3A 4JCWA 4LIQE 1U8IB 3H1ZA 3L9YA 1FP5A 3GPEA 5HJGA 4BDVB 5EZOH 2H2SC 5E2WL 4NQEA 3L95B 4DO5A 2R7EB 3HN5A 4LU5H 3TL5A 3H9HA 4JKMA 4CL7A 2VRKA 4HGWA 4Q14A 1NCWH 4P23A 4XNUL 4Y7MA 4YFDB 4ZFGH 4G8GD 3U6RA 4G70B 3MRIA 5C07D 1VRSA 5K93A 2PTVA 5J1SC 3AACA 3UDWC 1Z9SB 4HUUA 3RPIB 3UGEA 5ALBH 4KHTH 4UOQA 3R06A 2DLEA 3MCG1 2Q86B 1XH0A 2BSCA 3BWZA 3RUGF 4JO4H 1MRDH 3NYKA 2NYKA 5ESVA 5DMJB 3IE9A 3QWRA 4RWYH 4U7MA 4BQ8A 2WPGA 4XCNB 1YJDL 1ID2A 1AD9A 3SJVD 5E5MB 4QRRB 3MLVL 4PJXF 5D7HA 5ESAB 4XI5C 5AVZB 5LXGL 1OARL 1OP4A 3RWHB 4PJFF 4YH6A 5LGYA 4QWWD 1JP5A 4FUVA 3MXVH 3T4YB 5I6OA 3U9PL 4BZ2H 4FQJL 4L4VA 4L2LA 2WQUA 1DUYB 3A5VA 4Y7OC 5AKTA 4NWUH 2XTJC 2XG5A 4M6OL 5JHDA 5IQ7L 1JV2B 4LSVH 3NIDF 2GITB 4J1UA 4XXDA 4DNLA 3H3PL 1Q9WB 3EHBD 3QQXA 4JANB 4FRXA 4NPJA 4HPHA 3GQFA 4LNRA 3SKUD 5JQIB 3GZPA 3EFFA 1IE4A 1DJHA 4N1CA 1DLFL 5I73B 2JKIS 4FQXD 1EDHA 3L4ZA 2VDNL 3VFTA 2PP8A 2E74C 4Y2DA 3EOBB 3VD4A 3CFCH 1N10A 1MXGA 2QQQA 3CLEL 1WBZA 1FSKB 5DK2B 4TMPA 2ZUTA 5I1HH 2D9QB 4Y8AA 4DAGL 1V3LA 2WNKA 1DJXA 3LHPL 5GS0H 1DQTA 3ARED 3M17A 2JKWA 1NPJA 1HH9B 3IF1B 2AGJL 2UZYA 3FSVA 5CLYA 2WAHA 2XTQA 2DQCL 3FUNA 4YXKL 3RJDA 2WLLA 2EO7A 5JOEA 5B21A 1S9XB 1R0AL 1I82A 2GB2A 5E8PA 1MHHB 5TGBA 4PJCE 1VPOH 2EVIA 1OCWL 3QDME 2YPLB 4DP0X 3B2UC 3WE6B 4FL4C 3IPBA 3N43F 4PRHD 1JNHB 5CWSB 5CUSH 3UO1L 4HMCA 3BE1L 3T08A 5JORB 3KYKL 3G6JE 5DUMH 1WA0X 2BVPB 1EVUA 3L3KA 3HAEH 3ZQWA 1A5FH 1U58A 2XX1A 3I9GH 5BRZD 3VG0H 5KSBF 3C09B 3BESR 3FU6A 4GI6A 3LDBB 3E2HB 3PWJA 2ENYA 4PUBH 1FYHB 4WFHE 2UX6A 1HAUA 2E6PA 1FBIH 1VGKB 5FM5O 3HS0A 1KXTA 3FU9A 2EDXA 4I4WA 3OKMA 3AAEA 1IKFH 2XRAH 3U30B 5LN8A 1UADC 2VL5B 1KJ3H 2ZFGA 3AT9A 2CDGB 5C0GA 3C5ZD 1RUPH 1KB5H 3BXNB 3NIDB 4Y5YC 5KYWA 1MCRA 3BVVA 5LGKA 4D9RD 1G7PA 1YNLH 3RIFK 1AZZC 4LLQA 5AENA 4XMZA 4UQDA 4UB8O 1A1NA 3RFZC 4Z7OE 1EFQA 3GD1C 1OPOA 1V7NH 4PTTA 3VDAA 3IDNB 1U8CB 3CGTA 3AW5A 5GJSL 4MD0B 5CEYB 2HUHA 2Z35A 4XNLA 4JFQA 1E4XH 2WK2A 4WV1A 4POYA 5AL0A 3O4LE 5ABAA 1LEGB 2DL2A 4M43L 5DGQA 5EU5B 4X8CA 4U2ZA 1T1YA 3U48A 5FDWB 4EEEA 2DIJA 2CPUA 2MTAA 2NDFA 3MUJA 1AS6A 3KPRB 5DJ2A 4NLHA 3MUY1 4G3YH 5C2BL 3LKOA 4I0KA 4HA1A 2VXUH 2ZPKL 1W72H 1ZD6A 3N9GH 4XB8A 4D9QD 1BV8A 2ZE0A 4A6YB 3ZT7A 5KSUA 3WFHA 2GQHA 3PNWA 2GJRA 4NIKB 1P84J 5ICZB 3EF7A 3GJFK 1A7BA 1HHHA 4GT7A 3O2DL 3WFCH 1WVZA 4CKQA 1T03L 6PCYA 1F6AA 4KX9A 3NRPA 4OZHA 2ZWZA 4X5QA 2FAUA 2FHFA 5FYJL 1QNIA 5F7BA 5KSBB 1HXYA 1L9OA 2WBKA 4GFTB 4U6YB 3B2VH 3KZ8A 4UANA 3GSOB 4GP5B 3MZGB 1DJWA 4JHVA 3K19A 1N12A 5A40E 4UILL 1JHTB 1NBQA 3EJCA 1DEDA 5DJCB 3B4NA 3FN9A 1CGSH 4M5YL 3WFDH 4Z3GA 3HG4A 3CC5B 4NJAL 4YHIA 1WBXB 4NP4H 1CYXA 2XN9E 2Y9RT 2WC7A 3WHXB 1Q0YH 4NQED 5C0EB 3WJLA 2AEOA 4XMLH 5EG6C 1JMXA 4HIHB 5JHLH 1S3KL 4QTIL 4M48H 5KTEL 1IO4C 3MUHL 3L3IA 4FNTA 3VRLE 4P23D 2ZX6A 3PGCB 4RBPK 2Y7NA 4WI8A 1BIIB 4RGMB 4ZFOA 4R97B 3DGGB 2MNUA 2WUBH 2YKLL 5B4MD 3PWVA 4CJ1A 4Q6IC 3DHUA 3CQPA 3KCPB 3TIEA 2WNGA 4X5WB 5EE2A 1ND0A 3KYAA 4Y2OA 2NY0C 5IK3B 5ENWA 5IR1A 3WTUA 1TDQA 2F68X 2W9EL 4PJ7E 3WN5B 2FGRA 1KDJA 1X4ZA 1SHXA 2P44B 3GMNB 3QWRD 1DVZA 2COVD 2EYTB 3CZSA 1KZYA 2QFPA 1LJMA 2E3VA 4IMKC 4M93B 3VFWA 4KKNA 1ZHNA 4XO5A 5KVDH 3AM8C 2AK4A 2ID5A 4FXKA 3N1QC 3QC6X 2BJMH 4CC1A 1CGVA 3FRPB 3TOPA 1SNRA 1DFXA 1EBPA 2Q7NA 4DTGH 4PJHB 1TT6A 3I85A 1SDDB 4HK3N 3SGDI 5I9QC 3PDOB 3Q5OA 1AQHA 4OT1L 3D69A 4L4VD 1IAOA 3CIQA 4MMYA 5BO0D 2A9NL 3DX3A 4L37B 4FERA 4UZSA 1T1ZB 5JHDD 4ZJ9A 3RVTD 5DL8A 2MWCA 5E5LA 3Q5YA 5F7AA 3LRGA 4BM7A 2QVIA 1JUFB 5AAWA 3MRQA 4KNUA 3DYMA 4OAWA 3PJLA 1JPSH 1Y07A 2BFVL 2FGZA 3V4VH 3S2AA 3IKCB 2CNZA 3KW8A 1AR1C 2Z93B 1ONQA 2VT0A 3JSSA 4WEBH 1AFVL 4PJ5E 4E5XB 1GJUA 2KDGA 4Y2DD 4YWGH 1IM9A 1AZNA 4CBZA 1OQOA 2ZXCA 4ADGA 3ZR6A 5I8EA 4NRYB 4Z0XA 4LKXB 1A4KB 3L54A 2Z7UA 1EGJH 4Y0GA 5IF0B 4HG4K 2NTSP 3FH8A 4GCQA 3ZOAA 4O3WA 1PLBA 1NGXB 3H2WA 3O6KL 4GHBA 4ZMZA 2HLEB 3L5XH 4YHLH 5DHVB 1HZHL 1AR2A 1W0VA 4F7CA 4DZ8A 1FNSH 4MNQA 1EEYA 3K2UL 4QRUA 5DI8A 3NH7L 2YQBA 3VQ1C 3VZWX 4GG6B 1TFHA 4KNSA 1UGKA 3ZE1B 3OLGA 2V9TA 5LCVL 1QFPA 5AVQB 1KPUB 2AXJA 2GFBB 1TKWB 3E3QC 4OZIA 5CXPA 3V4UH 1IBGL 4LSSL 3DROA 3HR5B 1SJVA 3BH9A 5IV2B 1SQMA 2RFXA 2BSEA 5DLMH 4UDTA 1BVNP 3P3SA 3ZKXB 3IMBA 3ETSA 2ITEA 4QF1A 3LZLA 3PU7A 1U2YA 4KQ4L 3HRPA 1OSZB 1GAFH 5HGGS 1SN2A 4TSAH 2IDFA 2XC8A 1Y0LA 1UOWA 2ADIB 3RX5A 3V6ZB 2HLFC 4JZJB 4OVUA 3EUUA 2Y4SA 5BQ7A 4KY2A 1TXKA 3I9AA 4RNRA 2KPWA 3QYCA 1U4FA 4PJ6A 2Q8AH 2LVEA 2VDOB 4Y2DC 2EIKB 2X2UA 4HJEA 1K9TA 5T1DH 1Z9OA 1A7OL 2GT9A 2RR3A 3QG6B 4HFUH 4ICWA 3RL1B 5KUKA 1XB8A 2NX5D 1L7IH 4X6CB 4HOZA 3Q8BA 4H8WC 4LBEA 1EMTH 1IGFH 3UTZB 2MQ3A 1IBFA 4L5FH 4IOFC 3ZW3A 4QAMB 4DP1X 1RUKL 3MBED 5HYSA 3IMSA 2NY6B 1IEAB 3HE6A 1KEMH 2GSIB 2DQTH 1U93A 2HT2D 2OJEB 1CIDA 4X4XA 2D31B 3B43A 3MJ8B 2E9GA 1MG3C 2PYEB 2G0LA 5DHEA 1G6RH 1SLVA 3PQUA 2OMVB 4BEIA 3LK2A 1PG7X 4P5MA 1HCYA 3FN0L 3O45A 5MI0C 5HPOA 2XXCB 4LZKA 4R8WL 2A9MH 2G9KA 1AZVA 3I74A 4G7YL 4X5PA 1FAIL 3C9NB 2WO2B 1A3RH 2DLGA 2AXFA 2ICWA 4UNVA 5GZOA 5D7IE 5TE6H 5CBAB 4OFVA 1W0YT 5DQDH 1SLXA 3CVCA 3LKSA 2VN3A 3BAEH 2F54A 3AQYA 4G8GB 5HGHA 3SDXB 2I60L 1ECYA 1UH2A 2HCZX 3MRLB 4L3EE 1PEZA 1L0YA 4JY5L 2QADB 2LT9A 3T0XA 4F2ME 1ZPUA 5DT1L 4AH2B 4IGBA 4UIKH 4LSPL 3HN8A 3HS0C 3I6KA 1WJ3A 2OTUB 3VAEA 4BFNA 1LMIA 4OLUL 1HOCA 1B6UA 4ILDA 4I5BB 3ARUA 4GRWE 5E23A 1HYRC 1UB5A 2FT8A 5J56B 1RXLA 2KS0A 2AXHA 4IRZH 2X87A 2WP3O 4NAMA 3BWAA 6TAAA 2FIKB 4OGXH 4YO0A 5CAYB 4OJFH 3KW7A 2BIMA 2XTSA 5DVPA 5IB1B 1HWGB 1LO0H 3L3GB 4QYOA 5DS8B 4U1IA 2O72A 1IGYA 3MPCA 3T8MA 4MQTB 2ERJC 3TIDA 1I9EA 3WTXA 2NY1B 3C60B 5AKVA 4F7PA 2QEJA 3KBPA 5FKPB 3LH2L 4P3DB 3X3GL 4G1MA 2AQTA 1L9TA 3OC5A 3P9WB 5FGBA 1ZT4B 1OSMA 2CO6A 4LQFH 4L3FA 1KFAH 1JVKA 3DPDA 1TLKA 3T2OA 3U0TB 4BWUA 2NUPB 2ADFH 4JPWH 4KXDA 2WNWA 1A4CA 3IGLA 1HJCA 3UG4A 2GY5A 2Y7QA 1VZHA 3WXWL 4RMBA 1E67A 3L1FA 3WGUB 1M1XA 3MNDA 4BIKA 2AK4D 1QFWH 3D3VA 2YRLA 5BVPH 1NTDA 2A74B 1F41A 1OP9A 3FUMA 4C56B 3CBKB 1A9VA 1L3NA 3FF8A 1D6VH 1KT2A 2FZ3B 5HHOA 3MRCA 1KXVC 4PJAF 4B50A 1KEGH 1PX8A 3LRKA 4HETA 1T0OA 3TO4A 3FQXB 3L4UA 4NENB 2ZWKA 2BS71 1ACYH 2IWGA 1XDTT 4XP9L 1T6VN 5JLZA 3OQ3B 1MG2C 2WJQA 1THAA 4YHML 2BOBA 2XJKA 2NMSA 1SBSH 4Z78B 2E7DA 2OR9H 3H2PA 2R89A 3R0NA 4G43A 3QZWB 2WV3A 3LVEA 3GXIA 4G42B 4FLOA 5DDHA 4DESA 1F56A 5D1QD 4AGMA 5CZRA 1INQB 4XVTH 3FO9B 5IB3B 4LCIL 1TJIH 1ED3B 2ITCA 1RURL 4NN7C 1CTOA 3DIVA 4XN4A 2FO8A 2ENPA 3GHEL 3VTTA 4FSOA 1CLOL 5FO9B 5AOKA 4FFVC 1A3QA 3H4HA 1WPCA 5JPMA 3NAAH 1M05B 1NL0H 4F20A 3EDFA 5C2UB 2EIJB 5F9WC 1TQBC 4Z5RA 4Q9QL 3C5ZB 3O3DB 1Y1DA 4A04A 1HH6A 4MNQD 4RCAA 2Y07H 4KRMB 5IUSA 1IC7H 3FT0A 4L8CA 3U0PA 1NEUA 3C6SB 1O6SB 1QSVA 2V17L 4TTDD 4HIIB 2Y6TE 2DICA 2JF1A 2PP9A 4HS3B 1THCA 1X7QB 4Q6YA 2FGQX 4AQ1B 3F6LA 3VD2A 4D64A 4KROC 4F58L 1EBAA 3CFJA 2YBRB 3IWVA 3FPYA 4BSWA 5K69A 2V4LA 4LSEA 4GG8A 3VXQB 1Z3GL 1D6EB 4HIEB 4CNIB 3GBNL 2OJZL 3NJFA 4BV1A 4DP5X 5EIIA 3MYZA 4QXTA 3PP3K 1RK7A 3CU1A 4X8JA 1OB0A 1WDAA 4A2MA 3HI1B 5EZJA 3KL5A 5FX3A 3RWGB 1MHCB 4O4XA 3BUDA 3LV3B 4JZOB 2ZTBA 3HUJE 3INOA 1XAKA 4FD0A 2GABA 2Y23A 2VITB 2JTDA 3QUXB 4GP8B 4Q4IA 2EE0A 5EZOL 2ENSA 3BFOA 4LU5L 3KM2A 2AV1A 1E0OB 5I0VA 1NEPA 1T66C 3DETC 4D7BA 1JYWA 2OMWB 4OIAA 4Z3TA 2YRBA 3VXTB 3TA3C 3UEZA 5CCGE 4F8NA 4YDLB 3SCMB 4FLHA 2XN1A 3B9KB 4GW5B 3GUTB 3KCWA 1KN4H 2NZ9D 2E5EA 2EAEA 3HS9A 4KHTL 5ALBL 4ODTH 1D5BA 4F33B 3UTPD 3CMGA 3U2IA 4JO4L 1MRDL 2IAMC 4AEHH 4N0UB 2BIIA 5HHME 5FO8A 4GAAA 2B3IA 2K7QA 3B3IA 3KS0J 1ZHZA 3PWPB 4LLYB 4HCGA 1UB6A 4MYPA 3Q9PA 4RWYL 1JZ2A 1FH5H 4NQDB 2NQCA 2OSLA 3VFOB 2WIIB 2J6EH 5F6IC 1DO6A 2BINA 4X4MA 1TTFA 4W68A 1EZSA 2J8HA 5HI3C 3AA7A 4PRAA 1NCTA 2ICCA 5EDXA 3ARQA 3TPUA 3FUFA 5DS2A 4Q9CA 2XSKA 4URTB 4ZX6A 5D2LE 4ZRGA 4Z76B 4BZ2L 1VCAA 3ULVE 3Q06A 4KFMA 1E42A 2F54D 5C0BB 4X5LA 1A2YB 1YQVH 4NWUL 4PRDA 4JQVA 4PJGA 2WNXA 1HEJC 4U3SA 1A6ZA 4LSVL 1Z5LA 3MRFB 5HY9A 1DQLH 4IGBD 4M5ZH 5GSRA 2N56A 5IOPB 1KV3A 2PCFA 1HZLA 5D70H 2R2HA 4NKMA 2DW5A 4I77L 3ZU8A 2IDTA 4N2OA 3U9UA 3UX9B 1K4CB 4WHDA 3EH1A 3EOAA 3GS4A 4OJAA 3QR0A 2N7BA 3WD5H 2Q20A 3CFCL 2HVKB 1VGEH 5I1HL 4ABWA 2F53A 4KJPC 3HBPA 4FG4A 4L9LB 3FFOA 5GS0L 2D4FA 4MAZA 5ESQA 4ELMB 3NEOA 1TO5A 2GJ6E 1RSFA 4Z8FH 3CZFB 4N6RB 3SPCA 3S8FB 5AALA 2YIHA 4KR4A 2FB4H 4N22A 3HE6C 1S6NA 2MKLC 3T5WA 4XNBA 2MKWA 2O5YH 4NZRH 1CK0H 5I0XA 1WWWX 4I89A 2GHWB 3BYTA 2W65B 5CZXC 3L3DB 5F3HA 1VPOL 1QNZH 3N41F 4AM0A 3MI6A 4ADJA 5I18H 3Q05A 4WTZA 2NNRA 3DV6B 4ZFZB 3F8UB 3H0TB 5IROA 2YKKA 3X12B 5DUML 1SJHB 1HINH 4RMVA 5GZOC 1F3JB 5ANMB 3UP1A 3K71B 2DDQH 1A5FL 4PS7A 3VG0L 1G9NC 3MLWH 3UP6A 2WZAA 2BDNH 3CUPB 4PUBL 3D3VD 3IMUA 1RK0A 4JFBA 5GZNA 2YGQA 1DBMH 3BQUB 2F7IA 4W93A 1FBIL 3BMVA 1EAPB 1YRKA 1NIFA 1UJ3A 4YLQT 1IKFL 2XRAL 4J3BA 2EUVA 1S7TA 4YFEA 3N5AA 5D5DA 1KIPA 1RUPL 1EIBA 1KB5L 5K1VA 1EPFA 1F42A 2VUYA 3ISWA 3GO1H 4FFWC 5D5ME 3WAKA 3BEVB 1B0GA 2Y1YA 3OKKB 4IIQC 1UWYA 2X9KA 3CFUA 3CSYB 4OZHF 1UFUA 5G4OA 3RB7A 1V7NL 4RAVA 5DEFA 2DQEH 4JMXA 5B38G 5IT2H 2QKSA 4HLJA 2AC0A 5EB9A 4WNSA 3WKPA 4XZ4A 4X6DA 1E4XL 1IB5A 5GRUH 5IMMA 4NC1E 4AGQA 4YBLB 1DBAH 2OPCA 5FGBC 4RGOL 4ZFQA 1MRCH 2PPFA 5PCYA 1E4KA 3BPLB 4GSUA 4LHUG 3RG1C 4G3YL 5LCVA 2NUTA 1C16A 4MLSA 1QACA 2HJKB 2VXUL 1U41A 4R6UA 5SWZB 1W72L 3N9GL 1R3KB 1LEKA 4AZ8A 3EFDH 1T1LA 1WBYA 1Z7JA 2HAZA 2OJ1A 4Y4KC 5HGAB 3Q48A 1BQ5A 3D87B 1W0WB 2E9JA 4C00A 2NX5B 4MSWB 3IGFA 4JPIB 3KWTA 3F2LA 4MCZB 1Q9LA 3WY1A 4C69X 3IGKA 2XACC 3IAGC 4PS8A 3G3LA 2CDGA 2IANA 2E9WA 3K6IA 4KDTA 4OFYA 4CN6A 3ABZA 4DGWC 4XB7A 2W88A 4ZTOL 5CFAA 2P47B 3TO4C 1C12B 1JPTH 3WFDL 1CGSL 5EOQH 3CG8A 4IU2A 3WN6A 1DVQA 5BW7C 1P5UA 4WEMB 1R47A 1BLIA 1W80A 4NP4L 4IJ3C 3QIWB 3VDBA 3RWDB 1O5PA 3L9RA 1D7BA 1Q0YL 1YYCA 5GGVH 1CDUA 4XMLL 1ZHWA 5JHLL 1SVBA 4M48L 4FZNA 1T7WA 2X4QB 2C1PB 3MOAH 2N2LA 5JW4R 2VQUA 5DURB 5IZ7A 4OCMC 3CJJA 3VE0B 2WUBL 1IVLA 1RQ5A 2WKOA 1XSOA 3P4MA 2J20A 1ETZB 5DWPA 4PBWD 5B1CA 3MBXH 3MVSA 3OJDB 4I48B 2PR4L 5JPMC 2UXTA 2NXZD 2WP3T 3ZHNA 5I1CH 1DJSA 4JKNA 4FNPA 1D9KA 1FZOB 5CLXA 2WXLA 3TBYA 5JHBA 3BH8B 3BFWA 3JTTA 5AVWB 5ETUB 1BLNB 1RIVH 4G7VH 4TLUA 1IQWH 4AVKA 1HHKB 4LCWA 3LKPB 4Y4FB 5DUPH 5KVDL 3DUSB 4R7NA 5FOBA 3KXFE 2BJML 3NJNA 3GSWB 4ZFFB 1DZ0A 1GMIA 4TRPH 3U6XA 4DTGL 2EYRA 4E9XA 4G8AC 1NBVH 4OZFB 4JGUA 5I71B 5JQ6H 4JFYA 1KG0B 5I74C 5IMLA 4WU7A 3FO0H 3UAAA 2YAEA 5DMGD 3Q2WA 2VW4A 1MHEA 2ICEA 2JCCB 2XWZA 4NO2B 5C0IA 4JAMA 1S9VA 3EKCA 4I8DA 4AQEA 3FQUA 3UTTB 4PVMA 4WTQA 3WHXA 4WHTA 2DEYX 4AGLA 3CVHH 1JPSL 1F4HA 3V4VL 3V4LA 3SBPA 2YK1H 5C0EA 2VRQA 4P46A 2Y7LA 3QCVH 2DQFA 5IIEB 5D2NE 4YWGL 1K8IB 2BIOA 2VJ0A 4Y4HB 4LSIA 3DGGA 3EYSH 5AW4B 5HYIA 2X0WA 3KCPA 4F1SA 4UIMB 2QJDA 3P4OA 4U9CA 2Q10A 3GGWB 1T20A 1EGJL 1QQDB 4QUOA 3S96B 2EDRA 1VEPA 2NY7H 1OTUC 4XZUA 3BGMB 3WTTA 2XPGA 3PFUA 3VFRB 4BELD 2X9XA 2VAAB 3L5XL 4YHLL 2MJWA 1QATA 5J1AA 1FNSL 3IFPB 1XGQA 3QUYA 4AVIA 4CVUA 3VD0A 1JZHA 1S9YB 1K4DB 4OIBA 4LPXA 4ETYA 3Q8CA 4DOHB 3QDAA 3RI5K 3IBEA 3K8KA 4YXLH 3V4UL 3RTQA 2JFCA 5IROD 3F62A 5FCUH 5D1QB 5DLML 4Y19B 4L37A 4NZ8A 3K0WA 4A1RA 5DMGC 4Z7VA 2W9LA 2M06A 3MFGB 1M6UA 3QORC 1DR9A 1GAFL 1AZRA 1FZJB 4JQVC 1HXKA 1BVLA 4N90E 4TSAL 3VXRE 2H1PH 1L6ZA 2FO4A 2FHBA 5KOVC 2QQNH 3VXUE 2P7TB 2KLRA 4OJYA 1RZGA 1G1CA 4U33A 5KG9B 5I5RA 4QXVA 1QTYT 4MKMA 3KDMA 4BH7B 4Q0XH 3MO1A 3TWYA 3I02B 3MA9H 1CICB 2FNBA 1DDTA 4GKLA 3QEUA 2Q8AL 3QJTB 1QLEH 2X0UA 2EIZB 3O8XB 4PP2A 1SJMA 3QS2A 5DUBB 3LK3B 5T1DL 3AMKA 4HKJB 5I0YA 4HFUL 3VTAA 4QJ5B 2XG6A 1BG9A 2VZ1A 2ZXEB 4HCIA 1MVUA 1EMTL 1IGFL 3THMH 1NWOA 2G2RB 4L5FL 4PGEB 4KKZA 1E5ZA 4JFFB 2D7OA 1NDMB 3KPTA 2F58H 1F1DA 2IDQA 1KEML 2DQTL 3V6OA 4PBVC 1N3NB 4GG6A 3QEHB 3ZE2B 1EXUA 4PTUB 3ESNA 1HC1A 5L88H 3K4DA 3DOIA 3VB9A 4LB8A 1INEL 1G6RL 1SRDA 1TKWA 2OX5A 4L8SA 5IW1A 3VMNA 3T04D 7CGTA 4P5TA 4JRYE 4JFED 2A9ML 4S0TD 4PAZA 5DO2D 2FJGB 4G59C 4P99A 5I76A 1A3RL 3HHRB 4OV5B 1U92A 5F0PB 4D3CH 3QQDA 3WS6C 4GQZA 4MAUH 5TE6L 5DQDL 3WJJC 1N70A 2OV0A 3BAEL 4N0CC 3VVWA 3WCYA 4F8LA 2GC7C 3JWNG 2VWEE 4HWEH 4D0CB 4J8QA 5KVFE 2MCAA 4MMZA 5GZNC 4UIKL 3H9SA 1JZDC 3BRDA 2WZPD 1J0JA 2R4SH 2IXQB 1ILUA 4QHNA 2IAND 2OMXA 3EYVA 3AU1B 3TZGA 4KKPA 1HAWA 4OFYD 3STLA 1OCZB 1KTDB 1ZV9A 3MRMA 4G7RB 4N0RA 3O9WB 2Z91B 5D4QA 1GA2A 4IRZL 3W9DA 3Q8AA 3QG6A 2DJ4A 5B7EA 6PRNA 4XHJD 1OGAB 2K0RA 4OGXL 2FYYA 5DU7A 4OJFL 3D8MA 2EKSA 3N1FC 3RA7H 3HB3C 3AA0A 1LO0L 4R7DA 1H8LA 4XWGH 1ZGLP 1QKZH 2K3TA 2XPZA 2LQRA 3L2NA 2DWEA 2YA1A 1TEYA 1ZT1B 3K8MA 3NIGE 4U1MA 3QRLA 3UU2A 3NPSB 1ZEAH 4ELKA 4F37K 5B3JF 4H88H 2QR0A 4MZ2A 2X5PA 1BGXH 3OMNB 5FK9B 5JW4Q 4ZPVB 4KO6A 4ZO7A 1KIQA 3E6HA 4FHKA 3S34H 2IPKB 3W5NA 5K9QG 3MTRA 4LQFL 4CILA 3GTVA 1BZEA 1KFAL 4XMXA 1D9KD 3C9NA 4XCYB 5DJAA 2DL9A 4JPWL 2ADFL 2IWEA 4E68A 5BZZA 1L3WA 4MAYB 4LPYA 3SDXA 3B2MA 3QEGH 2FBRA 3C09C 1YEKH 2C7FA 3U2SB 2R51A 3LDBC 3E2HC 1X5XA 4LCWD 3SPJA 4BZ2A 1J8RA 1UASA 4LPWA 4XP1H 1QFWL 3FFCE 4JM2A 4UV4L 3PE9A 5BVPL 1BZQK 4JNXA 1H3WM 1VHPA 4PV9A 3UBFA 3ALPA 4J4PA 4N8UA 5JW5B 3U30C 4MXWL 2QV4A 1D6VL 3E8VA 2XV2A 1MZZA 4TQ8A 3TFKD 1DQVA 3SGJC 2IIJA 2G75B 2V7HA 5J6GA 4EBQH 5DJ8B 2FIKA 1KEGL 5BCAA 3T0EB 3IN0A 2ZX8A 4LDLB 5EEUA 5DYOB 1UC6A 3GIVA 3BPCB 2HG5B 1ACYL 4LMQE 4BCXA 3K2IA 2ATAA 2OXGB 2FUTA 2Y7OA 4QXWA 3C75A 1U3NA 4P46D 4PI0A 3DWTA 3W0WB 5JDSB 1SBSL 3OG6B 4LCCB 5E00A 3F5WA 4L1HA 2OR9L 3B7TA 3NQIA 2WQ8A 5CP7B 3ZL1A 4EE2A 3ECUA 4PJIA 1AQ8A 3E1ZA 4W9KC 1GRWA 4XVTL 5L4IA 4F7EB 1TJIL 1WZLA 2D7NA 1AD0B 1XR8A 3QAQA 2Z8VC 1HILA 3WTWA 4RFEB 4XCFH 3II3A 5E1AA 2J3SA 2D3VA 1FIEA 4R7LA 1OB1A 1ZE3C 4UM9B 1KF9B 3MACH 5G5DB 3RUGE 4LLMA 2CGRH 5ID1B 4MNGE 2NUPA 1U8NB 1NL0L 4YHPA 3PWNA 1XIWD 2JK5B 4HIJA 2HPTA 4HHGA 4X2UA 1JMZA 3AA6B 2F6AA 4M4PA 2Y07L 1IC7L 4HUWB 3QUYD 4WEUD 1OZTG 2P5EB 4PJXE 4JG1H 4PJFE 3HAEA 3ZKQD 5JZ7C 1UH3A 1M9SA 2E86A 4ONGH 4WI2A 4R84A 4JJ5B 3BKJL 3SYSA 2HPOA 5IHLB 5F7YC 1HNFA 3M7FB 3PAUA 5EU4A 3QFJD 3CLWA 1KLGB 3T20A 1P84K 2E7HA 3K6SA 2FJHB 2XWTA 5DHDA 4O3XB 1CT8A 4JN2A 4PN6A 1LVEA 3NIDE 2CIKB 1NM4A 2BVYA 1KYAA 2ICEC 4P06A 1SJEA 5LAXA 5IW6A 3RVXD 3SN6N 2E6QA 1PNDA 4P2RB 4IKJA 3QIUA 4ZUVA 1KB5A 5GQBA 3QDJA 4GINA 3MYJB 5DL6A 4UV7H 2QPUA 1NKOA 4KJYA 2BMKB 4M56A 1R17A 5C0NC 4C58B 1SUJA 1P6AB 2K9UA 4Y5VA 3IDMA 4XE0A 3LPWA 1T0MB 3ULSA 3BVWA 3OAYH 3HJEA 1EAJA 4JFWA 3F7RA 2YC1A 2B9BA 5KVGE 1E4XI 4HJTA 3H8NA 4PJGF 3IDXH 4KZCA 1MFBH 1KN4L 4HXBH 1NWPA 4K7FB 2H5UA 3KPRE 4ODTL 2IFGA 3A4AA 1JWMB 3D18B 4ONOA 5FKAA 3O3DA 3RQ3A 3UG5A 1UURA 3CFDB 1BZ7B 4UUJB 3DJZA 2YO3A 2AZUA 3PPSA 1XZ0A 3V9EA 4AEHL 4M93C 5KS9F 4JM4H 2X4OB 4JDZA 1XSIA 3K5RA 1W72A 4HEME 4YBHA 3S36H 4YHZH 1FH5L 4OD3H 4TSBH 3UYRH 3VYOA 4AQ1A 2EABA 2J6EL 4BFKA 2BIHA 2P3YA 4K7PL 1NFIB 4N2DA 3SD5A 4U3CA 4P5TD 2O93L 1SZNA 3CE1A 4LVNB 3NCMA 1CU4H 4X99A 3RTQC 1E27B 2IH3B 2QSVA 4HIEA 2IMNA 3X13B 5KSBE 5DJ6B 3GMQA 1S7QB 3VFSA 2P8PB 1TEGA 1DCEA 1U8KB 2O6DA 1TFPA 4GEJA 3WTVA 1Q38A 2MHAB 3CCHB 1YQVL 2AJVH 3I6GA 4O2CA 4JZOA 5E8EB 3L1OH 4FTVE 5EO9B 5I6XB 1OVZA 5T3XD 1DQLL 3W2DH 4M5ZL 3H9SD 4U1SB 4X6FA 3KPNA 4NFDA 5AD0A 5I0DA 5D70L 2W0PA 1JS4A 3RWCB 1E2VA 3I9PA 2KKQA 2Z1KA 3HRZA 5FYKU 1ZPLA 3BAJA 1G1YA 3WD5L 2C9AA 2CK2A 3B9KA 1VGEL 5E6UB 5JHLA 4GW5A 3GUTA 3ZDZB 2GTZB 5I23A 2XG4B 3GB7B 5DA4A 1XWVA 4Z8FL 1NICA 3MCLL 4MCNA 2YN3A 4QT5B 4XNZB 3NCFB 4X8GA 2PWDA 2FB4L 3ZZLA 4C83B 1EX0A 3V6OC 1CD0A 5GRVL 2MQGA 2WTRA 2O5YL 32C2B 3D1MC 4NZRL 1CK0L 3TO2B 3EG9B 2EXTA 4MJ6B 1GKEA 1IAIM 5D96B 1FN4A 3IDGB 5FWQA 1MXDA 1QNZL 2ADJA 3FB5B 3VFNB 4L8SC 5DEGA 1X5KA 2ZWNA 5I18L 1TYEB 1JPFA 1V3KA 1X5MA 1KBGH 4PJHE 4P5TC 5KS9B 1ZVHA 4NN5B 1LE9A 3KWWB 3QUMH 3OC8A 3RIAF 4EIZC 5KVEH 4PREB 3ZKXC 2ZNWA 4JUTA 1HINL 4KZ0A 1ZLWK 1A2YA 4HJGA 4H2CA 2DDQL 4XMPH 4X6DF 2G4GA 2JKJA 3MLWL 4KKCC 1GOGA 2OXHB 1CFNA 1KYFA 2BDNL 2D8KA 2LE9A 3OLIA 4NCC2 5F93C 4AIOA 1G84A 4JM2D 4PJBA 5F0JB 1DBML 1Z1WA 4JZJC 2BP8A 4UQIM 5D7KE 5HDRA 3VH8A 3F12B 2X4RB 2CJTA 4PWGA 3SPVA 1L4IA 1SEBB 1GOFA 4E42A 4OUOA 3LN9A 2IWWA 5I1DA 3QAZB 3V4VA 5ADPH 1HK6A 1HX0A 2OMUB 1IARB 3QWNA 2YD2A 3MREB 5FM4A 5C3LD 4QOKB 3MLZH 4OF3A 1WK0A 5AB2A 3GO1L 2AS5M 3I3BA 4NQXB 2MQCA 1MCPH 3SPGA 3HEIB 1QLEB 4P2OB 5EULV 3NUKA 4CMMA 2DQEL 3MJ9H 5GS0D 2NY6C 4LLDB 5IT2L 3AG4B 2VGLM 4O51B 4RAUA 3NSFA 1EGJA 1CXFA 4I1PA 2IPUK 1WFJA 4JDVA 2R23B 4JRXA 1JZGA 5IQNA 3MJ7B 3AJ7A 1X7SA 1DBAL 4MA8H 4AL8H 2IG2H 5DFVD 2ZX7A 4F3FA 4AEIH 2IV8A 3T6QC 2PWFA 4WUUB 1MRCL 3EYFA 4CVXB 1H6FA 4ZSOB 3PLYA 5EBWB 4WY7H 1YDPB 3B6SB 4G9DB 3LX9A 4AI7A 3H0TA 3TZVA 1YEIH 2N3JA 1QLRB 1E8WA 4AKPA 3SO5A 3EXLA 2A1WH 4IMLB 4MA3A 5DJZA 5TQ2H 3EFDL 2CK0L 3P3RA 1OAQH 2E4TA 5DQJA 4ZNCD 2EEFA 5F8QC 2QADC 2YPKA 5FC9A 5DZPA 5I19H 1P0SE 3UAFA 5C0CE 5B7FA 2WKOF 2HVJA 1MCSA 3NSXA 3ILPA 4J4PC 5FYLE 3W39B 1JPGA 4LRNH 2H0EA 3SEPA 4YSQA 1A0QH 4ODUB 3LN4A 4RJWA 4AX3A 2Z4QA 5CEZH 1GH7A 4NJ9H 1ES0B 2XDHA 3MODH 4X98A 3S4SB 3BEVA 1VFUA 2EICA 3TEWA 5E03A 3QIUD 3CX2A 3UFIA 1NIEA 1WWBX 2JE8A 4XMKL 3QDJD 3IFLH 1XF2B 3GI9H 4UI2A 1K5WA 1WP6A 4JFEB 4X6CE 5EU6E 1OP5H 3VUAA 2R4NA 3NCEB 3PABA 3KPPA 3JCUO 1SFHA 3P4NB 5I17B 3RNKA 5ITFA 3CDFA 5GGVL 2VLKB 5KOMC 2NY1C 3C60C 2W0FB 3CFKB 4GF4A 4WEEA 3TBTB 4J7RA 3K1DA 5C6PB 1EHAA 2OKMA 5CR1A 5F88A 1I8MA 1PFCA 1JGLL 2LV4A 2WXMA 3HWBA 5IVZB 5AUMA 1P7KB 5I1EH 4PB0L 4X4YA 5FEBA 2VABA 1F0LA 1ODUA 3KR3H 3BSGA 4HYTB 3MBXL 3ZDXF 1KTLB 1XEUA 4DGUA 4PG9A 1G6RA 4ZNEE 5I1CL 2BOCA 2X4NB 1JNLH 2XYCA 5K33A 4G7VL 1HJBC 1KCVH 2VAJA 4JX0A 5TE7H 3T8XB 5ID0A 1BQLH 4UT7H 4G8GE 1PZUB 1UM5H 4RQQB 5C07E 4JPIA 5DUPL 3OKLB 3VFUB 2A74C 4UINH 1I8KB 1XGPB 2J44A 1NCCH 3BP5A 3PGUA 2F0CA 1BXUA 2D03H 4X5RA 4TRPL 5A43C 3M1BA 4PJEB 4LGPB 3ECBB 3GSUB 3QNXA 1G6VK 1NBVL 1BFOA 3FU3A 1T5KA 3IFOB 1YG9A 3NFSH 4Z9KB 1R46A 3AITA 4JGMA 4NYLB 3S35H 3SE3A 1T7ZA 3LIUA 3FO0L 4K3CA 2DYPB 5DEJA 3V79C 3DVNB 1C12A 4Q2ZB 4QKTA 3SJVE 2EVFA 3Q13A 1AO7A 3LB6D 3T0VA 1SY6H 3L3HB 1KGYE 3QIUC 1PF3A 4IRZA 5G55A 5C7XH 3VXMB 4WWNA 3CVHL 1MM4A 2YK1L 4MDIA 3DMMA 4QTFA 5IJVB 3QCVL 2DQ6A 4BFEA 4ODVH 2BVTA 2ED9A 2ROYA 4Y5VC 4ZMVA 4JDEB 2CHZA 1YPZB 2AMGA 1FFQA 2PPAA 3QNZB 3EYSL 4O2EB 4M6MH 4Z7VF 2R0LH 4QRTA 4OIIL 4ENED 3D85A 3BN9C 3DTXA 5BRPA 1IKOP 2X3CA 3NFNA 2KZ1B 1QFUH 3SY6A 1DVFB 4NQVA 2NY7L 4R26H 4YK4B 5ALCH 1G7IA 1ZANH 5ETUA 1O9VA 3UBXA 3UBXI 4PFEA 1IGML 4BFIB 4Y4FA 5EUOB 3UADA 1A3LH 2A4CA 5F7DA 4IHOA 5EPMB 4AQ1C 2R0KH 1S9WB 1XMEB 4HWBH 4V33A 4NM8H 3CSFA 3NCWA 4U1JB 3PWUA 3QXUA 1ERNA 5K9OA 5ACLA 4X0KB 4F27A 4M4RB 1OWRM 2OMZB 2CLRB 4MXVF 4YXLL 4PD4J 1KG0A 2XVLA 2YEZA 5FCUL 1G43A 3IDJB 2R4RH 2VDLH 1ZV2A 3MCKA 2YMOA 4GW4A 4YR6B 1IGIH 3V5DB 2BNUA 5IEHB 3HC4H 5HHNA 3CZEA 5B8CB 1B3IA 5D7JA 4S0HA 4K07A 3NP4A 3UOAB 3UTTA 2H1PL 4PRHE 1LP9B 5GGQH 4FFTA 3V4PB 4ZX4A 1UOLA 2QQNL 3QUXC 1XIWB 4DUXA 5EU3A 4O2FA 3V8CA 1X44A 5FFOA 4JBSA 1HHIB 3N42B 3NA9H 5B39A 5I1LA 1WV7T 4Q0XL 5F89B 2FUQA 3MA9L 4JGJA 1WG3A 5BRZE 4X7FC 2Q3ZA 4XH2A 2Z1PA 4ONFH 2MOVA 4G8IB 5DTFB 3LNHA 2L4OA 4Z7UB 3B9KC 5HI4C 2CHNA 3MSPA 2A9BA 2J57A 3RILA 2BS9A 2C4XA 3GGWA 3JV0A 1CJYA 5DO8A 3QJUB 1M57B 5CGTA 4N24A 3QFJB 2JJWA 4NN6B 1YAIA 3RLSA 2BH0A 2F58L 2KDYA 2X41A 4Y89A 4JRXD 5DVLA 5F9AC 4AUUA 2OSXA 2R29A 4R5XA 4XRCB 1K4DA 1QWNA 5HGBA 5MP6H 4D9RE 5ISZB 3PNRB 4UZGA 1MCIA 5L88L 1BBDH 4K7PY 5EDSA 2YN5A 3UPGA 1U3HD 2A6IB 2PMZA 4HIXH 4I2XE 3FQWA 3NRFA 2XA8H 3TZVD 2UXGA 4M5TA 5AW2B 5E94B 4EIGB 4TV3A 2NW2B 5IFHH 5IJBC 4D3CL 3MUUA 4MAUL 4QRQA 5JOPD 4HJIA 1AZCA 1COBA 2W60A 1SFDA 5I6LA 2J1NA 4J2QA 1CN4A 4FI7A 4XGZA 3BEWA 2C26A 1FNAA 1ZLSH 1MWAH 2R4SL 2ZYSA 3KL3A 4PJAE 1W2KT 2JQYA 4D9QE 1CICA 2ZLDA 3O6FB 2NY2B 4HH9B 5FPIA 1IBZA 1FAKT 2VB5A 2EIZA 4WW1B 4YZWA 3BAIA 3HOLA 2AQRA 5J6HA 4Q4EA 2VLMD 1DSWA 2WWKO 3HCVA 2XQ0A 5E2UL 4EZJA 2CLVA 4L9LC 4V1DA 1UEMA 2YD5A 4QHLA 3RA7L 4JM2F 4XWGL 2DLFH 3GMRA 1QKZL 3MV7A 2Y36H 3C12A 3D4GA 5LDUA 2OK0H 4A7SA 2OW7A 4GSXA 3KWVA 2EDHA 4H88L 3D06A 3VXSB 2X7LB 3VY8X 4EUPH 1BGXL 4Q56A 1AQDA 1SMOA 1JWSA 1ZXQA 1UD8A 2FD6H 5EOCH 1LWHA 4QY8B 3VXNB 4NQDE 3MLYH 3S34L 5CGMA 1FFRA 3EJRA 3G08A 2X42A 5DRWA 5BVJB 1OD7A 3RVVC 1H0DB 3QE5A 4NQEE 5EFIB 3I75A 4GUPB 1WO2A 2J6EA 1Z66A 1IAII 3EYOA 4BKLA 4ZMTA 3PGDB 5BZWB 5AOLA 4YIQB 3HZKB 2XWBA 1YEKL 3MKGA 4FQLH 1DQQB 1GZQB 3TF7C 3LNIA 4PJIF 4D0CA 2ZSVB 2FWOB 4JN1H 5DVNA 3BQUC 4ODWB 2WXHA 4XP1L 5AB1A 1G0DA 1U8LA 4N28A 1TTAA 2HX8A 1JK8A 1BAGA 3NJTA 5C09D 1KTDA 2WOYA 4RLBA 3OB0H 3WG7B 2D73A 4U6XA 4EBQL 4J5VA 3ARTA 4E2OA 4PLJC 2ZSWB 2PETA 2AV7A 4GQRA 1AO7D 1JZ4A 3K2MC 1UD4A 1DQKA 3KPOA 4J3OC 1HHGB 2OL3B 4TVUA 4GQQA 5BO1H 5IJCC 4N2MA 1OALA 3QJVB 3DMMD 4ZZFA 3VCLB 4L4VE 2P4AB 3MNZA 5EO0B 2EXWC 3P9LB 5LB1A 2KXPA 3LQZB 3TBCA 4PS4H 1A21A 1AHWB 1WHOA 2RQEA 5DD1L 5JHDE 5A2BA 1F4XH 4FXLA 4Q52A 4XXCA 3FONB 4XCFL 2DWDB 5GGUA 3D85D 3BPLC 4UF7C 4HKZA 3MACL 4XCYA 2CGRL 4YHNB 2DOCA 3J27A 4BKSC 2J5WA 3SB3A 1BZ9A 2FR4A 2IALB 4PRBA 1BREA 3FTGB 2OMTA 2Z8SA 5LXVA 2WHVA 3PAZA 5L2KB 3F7YB 5CZVH 1BD2B 3CFBA 2QSQA 2XQYA 3RB5A 4I13B 2PCXA 2F7QA 3FT3A 1Q8MA 4UOZA 4FMSA 3NVQA 5F1IB 4JZNB 4JG1L 4O02H 3LPPA 4ONGL 3NQKA 4ZQKA 5AKRA 3GSXB 4HCFA 4O3YA 3KWUA 4LP4A 1E4WH 3QEQA 4HBCH 2OZ4L 5HDWA 2YEQA 2CDFB 1UKSA 2GCYA 2H8PB 3CXFA 2ZUYA 3ARFB 4UOW0 5EC1A 4DQOL 3DOSB 4ZBJA 2QQKH 2BERA 5D7JD 4EOWH 1PDKA 3L7EB 4K3JH 1G7JA 4P2QB 4ZOAA 4Z0BH 5KBPA 4N6QA 2WQSA 3QIWC 4NKQB 4MJJA 1F1AA 1ZTXE 1MHPH 1B2WH 2R56H 4UV7L 4S1DC 5GGVY 5E1QA 2Z92B 5DYFA 4FEIA 1XO8A 4PGZA 5E6YA 4NS0A 4B6ZA 5CNHA 5CEXB 2HMIC 2ITDA 3FQRB 4Z7NF 4YUEH 5IM7A 4X9HA 4JFXB 3RY4A 2ZCZA 1AD0A 4TLSA 4G1EA 3VW3H 3OG4B 4OLWH 3UTQB 3BGAA 2BX5A 2WSDA 3IDXL 1MFBL 3CZLA 4HXBL 1KB3A 2ILLA 4NQUA 2DM3A 4W9ZA 3D2UA 5DLLA 1IGJB 5D7LB 3STZB 1JF1A 5KUMA 4JM4L 4Y4FC 3ILDA 2RA1A 3HJ0A 3S36L 3UYRL 4Y1SA 1CIUA 4JO1H 4OD3L 2E59A 2AEQH 4TSBL 1QPPA 5H94A 4E9QA 4YHZL 2NX5E 4DEUA 2F7OA 3LZPA 3DSFL 4UT9H 4LE8A 5HDQH 3VSQA 2OI9B 4CW1A 5FYKE 4FQEA 1Z5HA 1FL6B 3H53A 2QHRH 4LSRL 4LSUH 1KNOA 5I71C 4NKIH 3RVUC 3I6SA 3VD3A 2JLLA 3P4LA 3R8QA 2FBJH 5E6SB 3ZDYB 3QO0A 4ZS6C 4B9KC 3WDJA 1MFEH 2OMYA 5AOMA 2AJVL 1N5AB 3L1OL 1Z2KA 1XGTA 3BUYA 3MCYA 3MROB 3MYJA 3GS7A 3W2DL 1Y18B 2AEWA 3OGOE 4Z7WB 1QBMH 4Y5XA 1BJ8A 1E28A 2V6HA 1KLFB 2H0PA 2V5RA 1DBBH 3HN3A 5K9KB 1HEZA 1HDMA 1YAZA 2GK2A 4BSVA 1MY7A 4Y4HC 4K55A 4UAOB 1M9WA 1OANA 1BBJA 1DYZA 2PYFB 4UTCA 2HT3D 2H3NB 1XH2A 2YR3A 1EZVY 3OR7A 5CIPB 1ORSB 3EADA 2BIPA 1QLFB 1BZDA 1XQ4A 3HS8A 2ISDA 1P7HL 4WTXA 3QT2A 1MCOH 4K7FA 5KAIO 1FGNH 4PJBF 4PEEA 3ZMRA 4AMWA 2CHXA 3DX6B 4WW2B 2PTTA 1Q9FA 4HIPA 2BZ7A 3JWNH 4LIQH 1ZJAA 4JJOA 1ICTA 4X9GA 1X5ZA 3LSOA 3NJIA 3SGEH 5DSCB 2OCFD 1EUUA 5EO1B 3PAVA 1T3FB 4U6VH 1EUTA 4OCXH 2VN5A 4ODSH 2X27X 2VQ4A 1KBGL 3NA4A 4XWOC 4Z23A 1H3TA 2UUDH 4BH8A 4HJ0C 3QUML 3SPHA 5KVEL 3RY5A 4F5CA 2Q7AA 5I26A 4GXUM 4MBOA 4OQ1A 5BJTB 4XMPL 1UCBH 2H6OA 2PO6A 4KJWC 3TT1H 3UYPB 2JCCE 4A7QA 4PJ8B 1TNMA 3Q2CA 1A7RH 4KK8D 3SIKA 1JI2A 3GBEA 4B9ZA 4OGAD 3BD4A 3D25A 4W81A 2DZEA 4YZFF 3MLRH 1VFBA 1CICC 1OK0A 4C4VA 1KCSH 2B15A 1GY2A 1BW8A 1N26A 2H0JA 1WAAA 3CVHA 3O8XC 5ADPL 3QXTA 3AG2B 3LXUX 4DQAA 2AK4E 2WZ5A 4NQTA 2W94A 3MLZL 4JFTA 1X5JA 2RCSH 5EEWA 1TU2A 5LG6A 1MI5B 2H6PA 1MCPL 1OSPH 4M61A 3VQLA 2UWEB 3WY2A 4KUZH 3V7MA 5L0QB 3FCTB 2FQEA 4MVBD 2AKRB 3DX7A 4QHKJ 1RLWA 2EVJA 1BVOA 1TSRA 5BMFH 4Q8BA 3UJTH 2EEBA 3FL7A 3ULUE 4MA8L 1F6LL 4AL8L 2IG2L 4AEIL 4K4KA 5ADXK 2FLRT 3DX9B 3OHMB 1F6FB 4ONHA 4HULB 2WTPA 1PQZB 1MCWW 4FXGA 1NBZA 1D2PA 4IYKA 1MUJA 1XR9A 2IBZY 4WY7L 3UH8A 2ZCKH 1KYDA 4KKBC 3S5YA 1BMZA 3I3DA 1SOQA 3F7VA 2VERN 3EO9H 4KXBA 1OF2B 2A1WL 2QQLH 2B59A 4LSTH 4G6FB 5TQ2L 1WS7A 5D1QE 5HDOA 1YY8A 3CLFH 1KWKA 1OAQL 2IWKA 2H2PC 3DIFA 2OXHA 1R9FA 2ZAHA 3PGRA 4PHZA 5SX4H 5SWSD 4NSKB 4C54A 1X9LA 4KVPA 4E41A 5I19L 3RFRA 3CAFA 4F2EA 3VGGA 2I25N 1MNUH 4LDOB 2BNRB 3HG2A 4UU9A 4OGAC 1G4RA 3IB4A 3RWIA 1P4BH 3DXAA 4LRNL 5D4HA 3QEQD 1KSRA 2VZTA 4MNQE 1IGTA 2YUVA 1A0QL 5GV0A 3AA1B 3O9WC 3QR2A 4JY4A 4W4NA 4HKBA 1PKQB 1C8PA 5FUCC 5BZDB 3WMPA 5CEZL 4LSQH 4NJ9L 1ZIAA 3AB0B 4JO3H 3HPLA 3MODL 4MQSB 3BIKB 1P7QA 3PQYB 2VUKA 4RZCB 5B3NA 3GMPA 3IFLL 5FS5A 1QWUA 3N85H 5I8KH 4CMHB 3NPSC 3BVNB 2DQDH 4JFFE 4V11A 3S7GA 4PRPD 1U8QA 3PHQB 4HHWA 1IJNA 3MJ7A 4AQAB 5TDOA 4XBPB 1F90H 3ZE2E 4U6HA 5EN2A 4PGDA 3OX8B 4PP1D 3FCSB 1S7RB 3QQ3B 3T8VA 5CHNB 1TENA 1YVLA 3KR3L 1H15B 3MLTA 4NQQA 2OMFA 3SOBL 3VWJA 3QCUH 5JW4M 1BVZA 1O5DT 3RYMA 1GYAA 2GSMB 3T3PF 3JV4B 2WWKT 4MAYC 3D2UD 1JNLL 2BSRB 5HVFB 3ZGIA 2BSTB 3RNQB 1WA2X 3NFPB 1KCVL 5TE7L 5I28A 1BQLL 1UM5L 2V2WB 4AIEA 5MENB 4D5UA 2RAMA 4AEEA 3ASOB 2IFFH 4L29B 1J5IA 2KPNA 1AY1L 1K3IA 3P11H 4UINL 5ECGA 1NCCL 2D03L 3UTPE 2NY3D 2PXYB 4W9EC 1RUQH 3CVDA 2YSSA 4A67A 1M7DB 2DKMA 3NFSL 1FORH 5C08B 4FA8A 3S35L 3C6EA 4ZYKA 1ZA6A 2YAQA 3F58H 1DVXA 2VN7A 4FZ8H 3RGVB 3T0EC 1TPXC 5C0DB 5E0QA 4EI5B 1RZ8B 3WI9A 3ARGD 4J3UA 2AXGB 2Q6WB 1SXNA 4UQ2B 1OGAE 1SY6L 4AKRB 3E1F1 5C7XL 4PRIB 4ES8A 1OLLA 1I1AB 2FIRT 3OB8A 4LOFA 4XP6H 3QXAB 4LCCC 2VLKA 3LXCA 3P40A 2JIXA 2CRIA 3KYOB 2G5BB 2P5PA 4ODVL 1WD9A 1G7HA 1QP1A 2JJTC 5IVZA 2ZKYA 4HGKC 5E6ZA 3TJHC 2IPUG 3D39D 1A4JB 3SE9H 3QPQC 3QCTH 1A6TB 4M6ML 2R0LL 4KI5C 2JKXA 2EUXA 1A9EA 3PL6B 4TNGA 4WGVB 5GSVA 2CJUH 2A99A 3O81A 4PI2A 4WTZG 1QFUL 5C09B 4R26L 3VFPB 4FJ6A 2DLTA 1ZANL 1A1OB 2BNQA 1R3JB 2GEEA 3RY6C 3WMSA 4RQQA 2DJUA 1Z32X 1A3LL 3VFUA 1I8KA 2J7LA 2R0KL 4FFZH 1BOYA 2EADA 4KKAC 4NM8L 4L0ZA 2XWEA 2WLIB 1QSEB 4TPRH 1Q9OA 1NOAA 3CXDL 2I07A 4I88A 1NPUA 3MN8A 2H26A 5K39B 2R4RL 3D0AA 3L7FB 2VDLL 4WK0B 2WM0A 3U25A 3KGRA 1IGIL 1U8MB 2O1AA 4MRCA 1HOEA 4WFFD 3ZR5A 5AFUK 2PO6D 1AMYA 4R7XA 4WF7A 4JCLA 3JVGA 2H7WA 4M8VA 1NQBA 2GIXA 5AW5B 4EI6B 4YHYB 8CGTA 5GGQL 2FWSA 2VDMH 3CC1A 4Y5XC 1M56B 3IJSA 3EFOB 43CAA 3NA9L 3W0WE 3P30H 2YD1A 4HS8H 4JDEA 1IEBB 1YPZA 4KI1A 4MS8C 1S7VB 2FL5B 1P5VA 1R3LB 3R1GH 3FC8A 1FPTH 4O2EA 3C6LD 4P3CL 4B95C 1D5XB 4ONFL 1BA9A 3TCLB 3D3VE 2JB6B 3POCA 4TNFA 4TKWA 3HG5A 3QWOB 4P57A 4IBLT 4NOBA 4KI5E 1DVFA 4HUKB 2QHLA 2GSGB 5B3JE 3GJFB 4PW4A 3OKYA 1NGPH 2GKIA 2HFFB 5E9DB 1U30A 4JFPB 3PP3H 4I1RA 2X05A 4BFIA 2ENJA 5EUOA 1DANU 4L1LA 5K9JH 5AVTB 4F8OA 4WDIB 3HFFA 4M8RA 4LSHA 1TCRB 2P5EE 2J1YA 4JRLA 5MP6L 4KR8A 1UXSB 4HT1H 5F72S 1BBDL 3R4DA 4U1JA 2J5LC 4HIXL 4R4FL 4X0KA 4R90H 2CSPA 1I1YA 1IM3A 2OMZA 3FF7A 4IU3A 1K72A 1XD1A 1AGFA 2XA8L 4LEXH 4LVNC 4XAWH 4X7SL 3UACA 3DUHA 4XNKA 5GGRY 4P07A 4EO5A 1KB9J 4YFLF 5IFHL 4Z7AA 3G9AB 2ESVD 5HI5D 2ATKA 3F3HA 4ZO9A 2COQA 1WITA 5I6XC 3KLSA 4E41D 5M94B 5F3BB 2DQGL 3NJVA 3QJOA 5BNXD 4FJZA 3MFFB 1VA9A 3U0WH 2W07A 1ZLSL 1MWAL 3DXAD 2F8OA 1BJ1J 4MD5A 4AV0A 5LLIC 4Z3JA 2BCKB 1CD8A 1RVFH 5HPMB 3EGSA 2QTKA 5DZOA 1D7FA 4G6JH 5JXAH 4P4KD 1CBJA 4M1GH 3U46B 3G7GA 5EBGA 1QRNA 1P7QD 3CN4A 1YEDA 3I2CH 5HYJB 3ROOB 3VI3A 4CC4C 2DLFL 1Z3RA 2QMJA 4XNZC 3AXLA 1IZNB 2OK0L 1RJYB 2APBA 1CQKA 2X1OA 1A6AB 4LL1A 2P8LB 1FZKA 3DUUB 4ZXBA 2XZZA 1YMMA 5CD3B 2YHGA 3G5ZB 2A6IA 2FD6L 5EOCL 4HWZB 3C5SA 3QUZA 3MLYL 4W6YB 1EZLA 1LD9B 3VWJD 2WO4A 3TVMB 1GR7A 4WVRA 2EDLA 4FLRA 3NSGA 5BV7H 4NN5C 2NW2A 4OQTH 3RWFB 1URLA 3WI4A 4QHKI 3FTZA 5FIEA 4I9WD 1C1EL 5FLVA 3ZYIA 5JNYA 2EDNA 4NO3B 5IW3A 4YEEA 2FK9A 4NHCH 1XF5B 4HSCX 4FQLL 1H8NA 5GGRA 3A0OA 3GKWH 4RSYA 5ERWA 3P3UA 2JNZA 4JN1L 4YSSA 1P4UA 4DN4H 3CPLB 4JHWH 4PJ9A 3HLAB 5MEOB 3O6FA 3EZ8A 4HH9A 3D0LA 1B0RA 3QAZC 1I7RB 5D72H 3JV6B 2YWZA 1FFOB 2VR7A 3TXAA 5D9SB 4GUQA 5SX5K 1L6PA 1RZIB 4MNHB 3KJ6H 1EJFA 5BS0D 4RRPA 4WFED 3CHRA 2ZXAA 4JREB 3RWJB 4NPYB 4P2OC 5DC9B 5BO1L 2JIXD 1Q9KA 1TJMA 1YNTA 3ILQD 3V7AE 3VXSA 1GGCH 4ODXB 1XL4A 2VIRB 1EZUA 3GWJA 4PS4L 1TYRA 4E1TA 4PJGE 3L6FA 3VXNA 1F4XL 4X7DC 3FRPG 1ZWIA 4GRWH 2F9BT 2VR4A 3K8LA 2EC8A 2VLLA 4XPAH 1M71B 4QHMB 3T6XA 4Z3EA 1CS6A 5KYYA 1JI1A 2P48B 4QO1A 3W82A 1N68A 1X5HA 2GJJA 3KVDD 1HI6B 4WKZB 5AVSB 5KS9E 1PVHA 2O4VA 1NEZB 2NNAB 2BNQD 3HZKA 1DE4B 1N0LB 1QD0A 3MZTA 3TYFA 2VMCA 5CZVL 2O6FA 4E9VA 2DLIA 4A68A 2J43A 3QUMA 4B9IA 3UMNA 4ODWA 3SO3B 1PCXA 4O02L 1T83C 1RL1A 1R5IA 3EDEA 1H6S1 2P8MA 3ZHFA 1E9PA 4AG4L 5EEXA 4HC1H 2EDEA 4E5XG 4OI7A 1I3RA 4MA1B 5BOJA 5I0WA 4HOWA 3D5OF 3CDYA 4MXQD 2F7RA 4XMWA 1E4WL 3F65A 2WVTA 3Q2VA 3ZUCA 3TS8A 1DSYA 2KZWA 1SF3A 1FIGL 4N0YH 2G30A 4N3TA 4OBSA 4EOWL 1A8ZA 3DECA 2QQKL 5CU5A 4F9LA 3RGBA 1XF1A 4R4NC 3MRKB 1OZUA 4K3JL 2D2CC 2L3BA 2ZWSA 4KHXH 4Z0BL 4Z7IA 5KZCD 3BS0A 1MHPL 4DK3A 4GW1A 5ACZB 1B2WL 2R56L 1N6UA 2F18A 2X70A 1SYSA 3HKZA 3KPLB 3G6JB 2BVUA 4PJDB 4YUEL 1M7XA 1LQSR 3BLKA 4OM1H 4ESKA 1KTJA 1JZEA 3MJ9A 4HZLA 4BHUA 3FONA 4GCSA 1ANUA 2AERT 4J3TA 5H2FO 2YXFA 3WL9B 4DP2X 3BZEB 3VW3L 1EFXA 4OLWL 3UZVA 2O6EA 2V5MA 4WUUE 2QDVA 3VYPA 3FQTB 1II4E 4PY8J 2WMPA 1S3RA 1AGDB 4W1TA 2OSWA 2ODIA 2VLJA 4LEOA 5IMKA 5BOPA 3F01A 4L8DA 3BAWA 3FUHA 3EGXA 5AG9A 2F19H 1BYNA 2BP0A 2WINB 4GAYB 4NAQA 4Y9FA 2AEQL 3P73B 2QKIB 3LK41 4Q9BA 4UT9L 1Q1JL 1IM3D 5HDQL 4LSUL 4KC3B 1JRHI 2QHRL 2R39A 1ZSDB 3OR6A 4NKIL 3CXHJ 4NQCD 1FNEB 3BP7B 1OXYA 3LKNA 1M7IA 1KTCA 4MXQC 5CJ5A 1I7ZB 1A25A 2FBJL 2H8PA 2LU4A 3AVEA 1JF5A 4TSCH 1I7UB 1AXSB 3DOSA 2GTQA 4BSJA 1JOIA 2QGBA 1NDTA 1MFEL 3BKCH 3ZKND 3EGDB 2XKNB 4JFDB 3QULB 4NRZB 1NGWA 1GYUA 3RIKA 3SKOB 4JFVA 3NGBB 4B9JA 1XF4B 3LEXB 4B60A 4JG9A 4HHAA 3L13A 4HKXB 4JFEE 4Y16B 2A83B 5LO7A 5CEXA 5CF3A 1DBBL 4PGBB 4WJ5A 3S37X 4EIUA 5DD5H 1NMBH 4IEFA 3FT4A 4MHHI 5I66A 1HTYA 1A22B 3NCYP 1T4KB 4KK9C 4GKZB 1QAWA 3FQ2A 1EVTC 3FBQA 5KBLA 1QRND 1QI5A 4QIRA 4ZODA 2GJZB 1C7TA 3MLPA 4J23A 1WAEA 2IGLA 1A6PA 1MCOL 3QZPA 1HWHB 4LK4A 1DVFC 1FGNL 2YSTA 2IANE 4YK4C 4JFSA 3MUZ1 3SE8H 5DRXB 2E46A 1ZMYA 4D0BB 4LESA 4QAWA 4LF3A 4LIQL 2A7BA 1NCGA 4K3EH 3FU5A 5FUZH 4ZXBD 1WAAF 3ARGB 1A64A 4GAFB 5E4EC 3B5HA 5BUAA 3VXPA 5IB5B 3QUZD 5IWLA 4U6VL 1FGVH 4HMEA 3UZEA 4CU7A 5TF1H 1FL6A 3N44F 4OCXL 5C0FA 3G5YB 1T5WA 1SMAA 4PJEE 3TNNA 2BY3A 2BVOB 2X6MA 2NY4D 1RHHB 3IYLW 4XCCH 1RSYA 3Q43A 4ANWA 1UKTA 1GW0A 2GJPA 2Y6SD 1NINA 1SOKA 3D39B 1T1WB 4W70A 1F3DH 5B8CC 1WQVT 1UCBL 2VDKH 3TT1L 4PD4K 3RX8A 1S7UA 1U91B 4NNXB 5EV7A 3WJMB 1RIHH 3PWLA 3EYQD 4IRSB 5E0FA 1A7RL 3ABLB 1KGUA 1WFOA 4PJ9D 3VXME 2K1MA 1NAMH 4PJ7B 4JY6B 4HSQA 1SY6A 1I1FB 2DI7A 2VSCA 3MLRL 2BVQA 2WQXA 3D2TA 1GVIA 1KCSL 2PCYA 2C7UB 1DQJA 2CBOA 4NFBA 2VDMB 1OTSC 3QHTC 1QLFA 3X11A 1CXIA 4TUJB 4PRNB 3ULVH 2RCSL 2NW3B 5JQHC 3P0YH 1NFDA 2WVUA 1K5NB 3DX2A 1OSPL 1RH8A 4EDWH 4NN6C 3QI9B 3SKMA 4OFDA 3O3BA 1WA1X 5JR1H 2NLJB 2X10A 4L3CB 5C8JA 4MWFB 2Y25A 3L4YA 3FCBA 4KXZH 2ZOUA 3RKDD 3OKNB 4JKLA 5BMFL 4YS4A 1T3FA 4JO8A 3UJTL 1WYJA 1XF3B 1NC2A 4YNYB 3LTVA 5EC2A 3RDTB 2XVKA 2EE9A 3OKEA 2W59A 4HPYH 4K8RC 4MQXD 2WYIA 4FAAB 5T33H 4J27A 2ZCKL 4HWBA 4KNTA 5JO5B 5DJXA 1DJGA 4LVOB 3VI4A 5JW3H 3EO9L 2Z31D 2C4FT 3HMXL 3AXIA 4P9MH 1KLUA 4LSTL 3C6LB 3REVA 3SSGA 1P4LA 5EZLB 3CLFL 4QPEA 1KYOJ 4LL4A 1KBVA 1ZS8B 5I8CB 1AOZA 4PJ8A 3BVDB 4Z3FA 3C2AH 5I6NA 3UXFA 4UM8B 1J0IA 1OAKH 2WBJA 4P49A 1MNUL 1IRAY 4XOEA 6PAZA 1ZHXA 1AIFB 1QZNA 3HI5H 4PJ9C 3O6FC 2NY2C 1P4BL 1WF5A 2X2HA 3QXDA 1KPVB 4YLBA 1RZJC 1JDDA 1J5OH 1KJ2H 4LSQL 1ZHLB 4O58H 1PRNA 4JO3L 4Z7UE 3TTYA 4D2NA 1WD8A 2VNCA 5KN5A 2VO5A 5T1KA 3WE1A 1CDIA 4YGAB 1JD9A 3N85L 5I8KL 3BDBA 2XIBA 2Q5BA 1L5GB 3FQ4A 3QFJE 5K1NA 3FCTA 1QBBA 1YQ2A 3SZDA 2ESVB 4FS0A 5J12B 2DQDL 4NKDA 1FL5A 2FLMA 1XCTB 5FM8A 4Z7VE 1NCBH 2CLZB 1VSCA 3GLEA 3OGCA 2V2TB 3QUKB 4XN7A 3TBVA 4JO5A 3VMOA 1P6WA 1F90L 3II1A 5D1ZA 5A16B 4E0RB 1EFXD 3T2QA 2XWJA 1PQZA 3BUIA 3ESUF 2Z8WC 3N50A 3SY9A 3QCUL 3SOBH 4DKFH 3PJSB 2NYZA 3GXTA 3VZUX 1YC7A 3M8OH 1OF2A 2VLJD 1V10A 2HTKD 4JR9H 3P3TA 3IU3B 4WWKA 1HXMA 1SEQH 5LAPA 4HG4J 4FKHA 4P4KB 1M42A 5FA3B 3PGFH 3ETBF 3JQOB 3MA7A 2IFFL 5HJ3A 4JM0A 3VMPA 2BNRA 1E43A 3S88H 5G4NA 1YYLH 4YX2H 3BRYA 5EBMB 2VDQH 4I7ZC 1RUQL 4FA7B 3AA1A 1YZZA 3WDHA 1AMXA 1FORL 5IHBA 3F58L 1MWAA 4RZKA 2F1EA 1CDJA 1F00I 4MDJB 4JRFA 3U82B 4F9LC 5CEZD 1UVQB 2XBDA 4MJ5A 3WEAA 1JN6A 4MTMA 5DJ0B 5KYUB 3AAZB 4LHUA 4XP6L 3ZZQA 1G9NH 3FB7A 3CFEA 4IOIA 1N2RB 3FAXA 2WUCH 5D7IB 1CI5A 1AHWC 2CM5A 2A0LC 5KSAA 4L3EB 2CDEB 4N9OB 3SE9L 3SY0A 3GS0A 1SXZA 3HG3A 3QCTL 5T3XE 2ZKHH 4YGVA 2AF2A 1ACZA 2NR6A 3H9SE 4PBXA 2CJUL 2IQ9L 3UIYA 4AZLA 3CHQA 4EUPA 4KU1A 3ZYOA 3OHXB 3JV4A 3PV6B 4AL8C 1PG7H 3EBIA 3IFNH 1F58H 4RVBA 4X5XB 3HG1B 4LLUB 4NUJA 4JFOB 1JE6A 2WLNA 4QTHA 2P5WA 3MRRB 3RIAK 1R3IH 2JXMB 4Z3HA 2EIEA 3WEXA 1U8PA 4RAHA 3SDDA 3DRTB 4HUCA 3GK8H 4FFZL 3KYMA 1GYWA 4TPRL 5DVMA 5D6DC 3NABH 1D3CA 1T7XA 2K7PA 5C08A 2UZXA 1S7SB 3HE7A 3L5JA 3RGVA 2XZAH 3WGVB 1BYOA 3ARFC 2CXGA 4OVVA 1AXTH 1JXDA 3KPSA 4PMFA 3LKRB 2VE6B 9CGTA 1FVCB 4MZRA 3KPQB 3C8KA 3KEHA 5FA4B 2A73B 5A2FA 2EYSB 3COOA 1XMWA 1J11A 3CIAA 2R0ZH 5SV4A 2KLSA 2Z4TA 2VR6A 3OZKA 2XZCH 1YO4A 3C8HA 5DK3A 3NTCH 4GP4B 2X4SB 3K72A 1AKPA 5EA0H 3P30L 1MVFA 4HS8L 4KOCA 1LK3H 1MJ7H 4JQIH 5IGXH 1KJMB 1UWEL 4CVZA 1CFTB 2VISB 1FPTL 4AMKL 4FG6D 5DD6B 4V2CB 3WV0A 1AGCB 1DVUA 5D1XA 1MH5B 3FUEA 2WXGA 4DK5A 1EV2E 1NGPL 1A3ZA 3N55A 5FW7A 3WELA 2C1OB 4O4YH 5MEQB 3ATFA 3T0AA 5K9JL 2K0LA 2VMDA 1QA9A 2ATPB 4JVWA 4HT1L 1NC2D 3QJFB 5KZCB 5IWLC 3VJ6A 3GNMH 3R0MA 4BGDA 2OI9C 3MGTA 1VADB 3K74B 3UZEC 3QBTB 3WY3A 4MX7B 4R90L 4YSAA 4LEXL 3ZE0F 4O02A 2MQ0A 4XAWL 1J8HD 2W0KA 5IOKA 1TTBA 2PWHA 4PJIE 2DWYA 2EXYC 5J13B 5IKCA 4XNYH 3DVGB 4P5KB 1ESOA 3BZFB 2NYYD 3DURA 4IHBA 2BVEA 3GBDA 4J3OG 3MU3A 2E75C 2WBJD 3PIQA 4P2QE 1KCKA 3O3AB 5GS1B 3CFNA 4XBGB 3B83A 4IS6A 4Y1AA 4ZOBA 5PRNA 1YN7B 2N1TE 2OZNA 2WOBA 3U0WL 2DJMA 1HSAB 4OU3A 4K3BA 4XNMB 4MMXB 2FJFB 1R3LA 2A4EA 4MCMA 5IQMA 4E9WA 2EEAA 4AENB 1D5XA 4A7TA 1FVEA 2V5TA 3WXVH 3TCLA 4J39A 1RJZA 5JXAL 4G6JL 6CGTA 4M1GL 2YGNA 4BCYA 7PRNA 4HFWA 4K0OA 1T1XA 3I2CL 5T1KD 1CG9B 2VZ3A 4NQCB 4PV8A 1FC2D 1T21A 1EDYA 3KL0A 2K4TA 4WW2C 3SDAA 2CO3A 1R33A 2DQUH 2F5BH 2VYRE 4JFPA 3JT0A 1IZJA 4QLRA 3S5LB 3WIFB 1WICA 1RK1A 2PP7A 1TCRA 3U1SH 3M7OA 1NBYA 4FQQB 3VFVA 3ET9F 3QGVA 4QRSA 5DRZB 4N25A 4PCSA 3VX0A 4XPFH 5FV2A 1GCYA 3GHPA 3MX0B 3IPFA 1OE2A 5D1ZD 2K8QA 1XGRA 2DV6A 3QA3A 4G6AC 4N8VA 3QDJE 4FLSA 3HZVB 1TVBA 4DCQB 4QRPA 1TF4A 3MMEA 5BV7L 5FUOH 4IOSA 3L4CA 5I1IH 4OQTL 3ARSA 1K8DA 4GRLB 4UT9A 2ZP8A 2X4UB 1YNTF 4WWKD 5C0AA 3T24A 3WU1A 4G11A 1J12A 3VNZA 3CN1A 2FTAA 5CMAB 2IWFA 2F1CX 4ISVB 2EIMB 1M2VA 4LPTA 4PJ8C 2NYYC 2V9RA 3GKWL 3ZE0B 2Q76B 2UYLA 1FFPA 3T4AA 1IL1B 1A9BA 2JCWA 4DN4L 4Z7WE 5HYEA 3FQYA 3BKYH 4KK5C 4UYQA 4HH8A 1H5BB 4XCEA 5FW8A 5DK0A 2EH7H 1E9OB 2YJQA 3DSNB 4UQ3B 5D72L 4FMKA 5HGDB 3AY4C 3GSNB 1NAMB 5CLWA 2HRPL 4WZ9A 4EF3A 3FYXA 3U4EB 1WH0A 1RFDH 5HYJA 2DLHA 3VGBA 3WNOA 1S7XB 3KJ6L 5AVXB 4NO5A 1W9XA 4APQA 4Z7NE 3T65A 4LHUD 4NQSB 4ZUWA 1KWGA 4Z1PA 1RJYA 1KPRA 2GPZA 2JJSA 2QGDA 2YXMA 4P9HH 5D2LB 3KZIO 5JA8B 4C4UA 1QASA 2UY6A 4I0CC 3UBXG 4FZEH 4JPSA 1CXHA 4MB4A 1GGCL 5FV1L 5CD3A 2KYIA 1INDL 3KNBB 4M7ZB 5KSAD 1MCFA 1CURA 3D30A 4GBXA 4LLVA 5FHAH 3H56A 5AEAA 2NR6D 4AQ8A 2Y0SA 4XPAL 1URZA 4OZFG 3LRLA 4L4TA 1YEGH 2PNDA 1U8OB 2OYMA 1HQRA 2PW2B 2F7PA 2LAGB 1NCNA 5AZEH 3VRIB 4K7PX 2WXIA 3CDZB 1JZIA 3I6LD 2P5WD 3QDGD 1FJ1B 1QEWA 2ZXWB 1X6LA 1Z0NA 4H8WL 1BYPA 3SDDD 1XH1A 2M83A 1B2YA 1WZMA 3K6NA 4I0PD 2DQMA 4ZW5A 4HC1L 4ZUUB 4FQHB 3UTSA 3HE7D 4WNQA 2LHFA 2EDKA 3JV6A 5E70A 2HA1A 5IG7B 1DN0A 2AQ1A 3KPSD 4QRAA 3MRNB 3HHSA 1G7MB 3AB0C 2YBGA 3OF6A 4N0YL 5GGSY 4EQ2A 1HS6A 2E7LA 1J9SA 1XGUB 1RZIA 2R2BB 1MCCA 1RZQA 2YQ2A 2WVSA 3K46A 1G7LB 4WO4B 4A2DA 4PQXA 4RGND 1U8JA 3GZQA 4P4RB 1JWUB 4CMHC 4H13C 2Z31B 3HPJA 1YC8A 3QFDA 4FNSA 4K9EC 1BVNT 5J3HC 2K6ZA 4YDJB 3CZKA 2DTML 3IJ7A 3LYRA 4G80B 4PU2A 4D94A 4OM1L 2K4WA 1VDGA 2NTFA 4NRXA 1EEZA 3IDIA 4PJBE 4AW4A 2K78A 1C5DB 5D1XD 1WFNA 4BUGA 1E5CA 3BMWA 4WI6A 1SM3H 1HI6A 4HK0A 1IMHC 3ZHLA 1ZLVK 2C4FU 4LNVA 5KJ4A 2FX9H 1UQSB 3VD1A 3D4CA 1OSEA 4MDRA 3A67L 5AG8A 5CCHE 4G5AA 1LYQA 3B5TA 1LDSA 2F19L 3RX7A 3RU8H 4ERSH 4H26B 1WZAA 3BOVA 3UDWA 4PR5A 3V0GA 5AZ2H 3U83A 2KL6A 5CN2A 5D6CB 2PXYC 4ORGA 5SX4I 1FO0H 5PAZA 3T3MF 3UAJC 1FUNA 3FHQA 2BS8A 1VACA 3RGVC 4YDZA 4JRXE 3SZVA 1O0VA 3F7LA 3FB8A 4RDQG 4EI5C 2QBWA 1PKQE 3AAAA 4PJCA 3BKCL 1L9PA 2D7PA 3QDMA 4CA4A 1DQIA 5KEZA 3QK0A 5JOFB 3ZTCC 3ZYZA 1NCHA 2QMKA 1SGKA 4I18B 1U4EA 1I1AC 4YZFE 4AKQA 1T04A 2X40A 4Y1AD 3NZ8B 5GGSA 1UZ6F 4GSDH 2GHZA 4U0QB 4XNAA 5ADOH 2BHFA 1E30A 3OAWA 3KH4A 3FOMA 3BPOC 3MDJA 5DD5L 4AMXA 1NMBL 4N5EC 1ZT7A 3WS3A 5JOPE 2C9QA 2C3VB 2W0LA 1LO3H 5CD5C 5CS7A 1SVCP 3PL6C 2FNWA 2WVPA 2R1XB 5CGBA 4KRAA 2CCLA 4BINA 1SDAB 5FOJA 2EDYA 1AGDA 2IO5A 5CN3A 1PYWA 4NM4H 3SE8L 4YOKA 5IJKC 3K0YA 1EHLH 5TQ0H 4PIBA 4GPVA 4K3EL 5FUZL 3UPRB 3VQMA 2GE4A 1K6QH 2VLME 4PCYA 5EBLB 3ELQA 1F1GA 3P73A 4FG2A 5MENE 3STBA 3HC0B 2YPVH 1H8SA 1XH3B 1FGVL 1A1MB 1AS7A 1HNGA 5E56A 5TF1L 3EJYD 2QSCH 1PZ5B 1ZSDA 4IOSD 1NFDF 1JZFA 4LOUD 1G1OA 1XGYH 1MJJB 5KVGH 3CU7A 5C0AD 4XCCL 4L5FE 2KQMA 3KM1A