5T5FA

Neisseria meningitidis factor h binding protein in complex with monoclonal antibody jar5
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
226
structure length
226
Chain Sequence
GLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neisseria meningitidis factor H-binding protein bound to monoclonal antibody JAR5: implications for antibody synergy.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
molecule keywords Factor H binding protein variant B24
total genus 53
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2016-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 5t5fA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5t5fA01
4AYEC 3UAQA 4Z3TA 4AYMC 2W81C 2LFUA 3VE2A 3VE1A 2Y7SA 4O4XA 2KC0A 2W80C 4QQ1A 4AYID 3PQUA 5T5FA 3KVDD 4O49A 4AYNA 2YPVA 4O4UA 1YS5A 3HOEA 4O3WA 4O3YA 2KDYA 4O3ZA 3HOLA 3V8UA 3PQSA 5EE2A 4O3XB 4AYDC 4U9CA
chains in the Genus database with same CATH superfamily
1ZEAH 2R1WB 3LZQA 4HH9A 5DXWA 2FLBT 4IL6O 1KN2H 1TFHA 3IMWA 4ZW8A 2Q7YA 5CP7B 2VAAA 1QA9B 4YHNA 4ZMVA 1MFNA 3HI6L 4GBXD 3AFLA 2Y7QA 1I85C 2JSFA 4TTDC 4CDHA 1K5WA 3NZUA 5IQOA 2VZTA 4OLZH 4UTBA 5JHDD 2NDFA 3RE0A 1NAMH 5FUZL 4LLAA 3UEQA 5C07B 4KI5C 4HIHB 5FM5O 3QIWC 4K2UH 3WFZA 4GP4B 1HQRB 1HEHC 1MG2C 4XP1L 3AAAB 5E6IA 3PS6A 4JQXA 3EJRA 2VLRA 2MQGA 4W6XB 1T7VA 1E40A 2CA3A 3VXSD 1VEMA 3KR3L 3T65A 1UD5A 5DDHB 3ZMEA 5INCB 1T1WA 1OCZB 4K3GA 4Z3HA 3PQYD 1T2XA 2ZOTA 3GMOB 3LRSA 3OJ2C 15C8H 4BEIA 2C4FU 4JPVL 5CR1A 3VD0A 1VB9A 5J06A 3MUZ1 1FYTD 3C09B 5DJ6A 3TJHC 3CLEH 3IRCA 3Q13A 1TXKA 4PR7A 3C6SB 2VTFA 1OSMA 1N0LB 3V8UA 1FZJA 1NFIB 5EORH 5F1NA 1N68A 1F6LL 3RY5A 1WSST 7PRNA 3QIUA 4WY7L 4WFFE 4PJ5D 5HDBB 5CCJA 3RWIA 5HDLA 4L2YA 3MRKA 1TCMA 1CF8H 1ZS8B 4NOFA 3QDHA 2YXMA 1LQSR 1N2RA 2ADGB 2BIOA 5KBLA 3DNKA 3QHZL 3RNQA 3L7EA 2M26A 1CD1B 3LRGA 2Z31B 2EIJB 4N0CD 1BFSA 2AJ3B 5FO7B 2XICA 4EN3B 4PWHA 4YBQC 5BZZA 5DGRA 2IAMB 1PKOA 3ARWA 2PPFA 1SOQA 1DZ0A 3SQOL 5FEBA 3KXFD 2C9XA 3GM8A 3CSYA 4Y4FA 4Z7OB 3BEVB 1K4CA 5E1AB 1JG9A 3U4KA 1F1DA 3X1BA 2WGXA 5H37H 1V27A 5D2NB 2YK1L 2EYTB 3V7AG 3O3AA 2R0ZH 3WNPA 4OFYA 3MJ7B 3TO2B 5GZNA 2X41A 2HT3C 5D2LF 1JP5A 4OLXL 3ZHKA 3IMVA 4L4VA 1E67A 2JI1A 4JQVA 3SKNA 1CE6B 5FYJL 1E8XA 4G7QB 2DYPA 4KI5D 2OYMA 3TN0D 3BSHA 2YPKA 3B9AA 4HYTB 4UQ9A 3H4HA 3V0FA 2LU3A 3PFQA 3QR2A 3VE0A 2ZUQC 1MI5D 4LCUB 4J1UB 1KJMB 4GW4B 2GCYA 1CYXA 2O5XL 2CR3A 3T77B 3QWOB 3RU8H 2APBA 3FU0A 3RWHA 1EXHA 4EMZA 4LEOB 1ZEAL 5C6WH 5K9KB 4DAGL 2VW6A 4KX9A 3HNSL 3Q8EA 2NZ1A 5DRZB 1AZUA 1KCUH 4QRRD 3VFWA 4OZHF 3CQQA 2Y6SC 2VXQL 5IB3B 3TNNB 4K9EH 1QLEL 4YDKH 5AAWA 1F3JB 4NDMB 4OM1H 5CSGA 4HJEA 2C1PA 4RFEA 3UYPB 1X6LA 3U9UB 3LKOB 2K7QA 3UJTH 4BH8B 4Q6IC 2G75A 1BBDH 4X4XB 3BT2H 3GIZL 1QLEB 2O6DA 4FQLL 6PRNA 3T2NH 4OI8A 5F9WC 4EEEA 2ZKHL 1U3HC 1EO7A 3LEYL 2Q76A 4PY7A 3WFBL 1PCSA 3FFCB 2EZ0C 3IFLH 3WJLC 2Q10A 1JUFB 2R0KL 2VDQH 4NUJA 1QSED 1YPZA 3EFOA 2BVOA 3ILEA 1N19A 3TIDA 3GBDA 5I9QB 2Q86B 2AITA 1SBSH 3UO1H 4E9QA 3EBHA 4XVUC 3TEXA 2XVBA 4DO6A 3DDFA 4Z95L 1OGAE 3EDJA 1MCJA 3G5YA 2LABA 4AGMA 4OCSH 4LPXA 2BOBA 4U6XA 3HEIB 2EXTA 5IEHA 3CPLB 2AMGA 5JW4N 3D12B 1C08A 4MA1C 4PJDB 4ADGA 1FUNA 3KYOA 3TIEB 3S88H 3FQRA 1CE6A 2B08A 1KYUA 1NCDL 3CDGB 3MRLB 3QQ3B 2X53A 3B43A 1YEKL 3NQIA 5C6TH 3FMGH 3DBSA 3LIZL 4DEPC 1HIML 2ADFL 5LBVA 5KG9B 1UB5A 2Z6FA 3NK3A 3PJSB 5IVNA 4K8RD 3T2PA 4NJAL 4XBEL 3RVUC 1U8HA 3SDXA 4K23H 4LLYA 2DIJA 1P5UC 4PJEB 3RNKB 2W80C 5AVZB 2W9DL 3LNGA 3EOTL 2Z64C 3V2AR 5CINH 3CD4A 3VA2C 2F5AL 3QRFM 2DBLL 5C07E 4A6YA 5J57B 2A83A 2FRGP 2WNKA 4JPWL 2GJJA 1JWUB 5DEGB 5AOZA 1LK3L 4ZTPL 4E9LA 1F4XL 1IBGL 1U8JA 3BZEA 3MRNB 4LCCA 5CGYC 4EN3A 1ES0B 3IDJB 1P7KA 3NCYP 2XE2A 4ZMXA 3IK2A 1Z6JT 3GLDA 4IJTA 4UQ3A 4OV5A 3MUGB 4FYTA 3NVQA 4MDRA 1ZLVK 3D25A 2R88A 5KG9A 1JPSL 1JPFB 1EMTL 1O5PA 2DIAA 3KCWA 3ZO0A 4UOZA 5JXAL 1B2WH 3KEHA 3FL7A 3OKOA 3NZSA 1PQZB 1MCHA 3AXHA 4M8QA 1P7KB 4QAMB 2O1AA 5LDUA 2V3EA 3FQRB 3WXVL 1J86A 3V7MA 4PGBB 5CIPA 4JB9L 3HB3D 1UACH 3CZGA 3NCYS 1E3FA 2ZAHA 2YD1A 1INEH 1JPTH 2ICWI 5GRWA 4ZQKB 3PP3H 3MR9B 3CGTA 1J8KA 4OU3A 5AEAA 2X4QA 3O6FB 4RQQB 1MWAH 4PBDA 3DGDA 3LN9A 5INDB 4WU5B 4L8CB 5A16B 4X0KB 3OAYH 3G7TA 5C09E 3AAAA 2ZG3A 4YVUA 4F57L 4YSSA 3BZFA 3TV3H 2B4CH 3P9LA 1LXMA 1ADQL 1RJLA 5I30L 4L1LA 2CHXA 2VLJB 5FM4A 3K3QA 2SEBB 2PO6A 3RDTD 3G6AB 2X2YA 4PGDB 2BCKA 4WKXA 4J39A 2OXHB 4Z7QF 1W0WB 5CBAB 4Q7DA 3PQYA 2AK1L 3QEUB 1KFAL 4TUOB 2IBZY 3APNA 4JGMA 4PP1D 3B2XA 3ETTA 3QEGH 4M7JL 3JWNH 5D93B 2YAFA 3TIDB 2XKNB 4F9LC 1BAFL 1PZ5B 2HLEB 1BEYH 3WD5H 2P8LB 4FQJH 3IYLW 5H2FO 2Q6WA 4YXHH 1A7OL 3DWTA 3O6ML 2BJML 4PY7B 1G1YA 1CE1L 1F3RB 1ZHLA 1JMXA 1S7VB 4GXVH 3SN6N 1PJ9A 1TTGA 3FOLB 1IVLA 5E9DB 3S36H 2LVCA 3S7GA 2IAMC 4GBXA 1PYWB 4R97B 1O9VA 5H4ZA 2K78A 1RZJL 2J6EL 4PHXA 4TQIA 3BZFB 3C60C 5ISZE 1H3WM 2Z1KA 2VNCA 1P84K 1W80A 1KXVC 3VVVA 2QGBA 1QUNB 4WJ5A 5GRZA 2A77H 4Y19E 2F68X 2DJSA 3WO4B 4L8CA 1OALA 3LZFL 3PAYA 2YOCA 2ESVA 3LNFA 4L1BA 2EKSB 5AOKA 4NN6C 1XTLA 1GGBL 2VZVA 2X4QB 3O6FA 3DECA 2MPAH 4LBEB 1GGCH 5F8QC 2VDOL 2GCYB 3KJ6L 3OXSA 3CUPB 5T1LA 1XF3A 3GRBA 2VISA 4YHPB 1NCJA 1TZ8A 4K3EH 4KJPD 3L9EA 3GPSA 5I1AA 1AC6A 2Y7LA 3MNWA 3EYQD 1P4LB 1XH3A 2Z35B 3ME0A 5ANMB 4N5UA 4KDTC 4XXCA 4JFHE 4F4BA 2CGRH 4X7SH 1ND0A 1QSFD 3N85H 3U4BH 3WTYA 5FECB 4ZOCA 3GUTA 4FJYA 4HLZH 4OD1H 4JFQB 4AIZA 3H9SA 1N2RB 3SO3B 2GEEA 1T89A 3PWPA 3NUKA 4CAGA 1ZS8A 3VFGH 5I26A 5CCKH 4GFXA 2OMNA 3HHRB 3VI4B 2F1VA 4BKTC 2V17L 4F24A 4KJYB 2R8AA 4UU9B 2KC0A 3E7JA 4KU1A 3K6NA 2GBAA 2X9ZA 4ZMZA 3ESNA 3UTPD 3WFDL 4WWNA 1NC2B 3ZE0E 5IROA 1DQDH 1M53A 4HPHA 5LJYH 2VDPL 1YMHB 1IZNB 1NJ9A 3FO0H 3HG3A 4EN3C 4U6HA 1U8QA 1S7WA 1UA6H 1EFXB 1N18A 1MCKA 3C9NB 3L3IB 3QSKB 1IJNA 4LCVA 5E24E 2HKFH 4FQ2L 1BGXL 4JG1L 1ZMYA 3CMOH 1ONQA 1Q9LA 3VFMB 4QI3A 3BN9C 2XIIA 3CDYA 5LNGA 1TQTA 1LEKB 3H2QA 4MAZA 1EGJA 1ZPUA 2Y07L 5T1MA 2XT1B 5TQ2H 1TQBC 1DQMH 1YDPA 3TLRA 1J5CA 2AP2A 4M4PA 1JK8B 2W88A 1S4IA 2FBRA 2YD9A 2PXYB 1SXZA 3QDMB 4E9XA 2FH6A 2BFVL 3LHAA 4JR9L 1IQDA 3AA1B 2PO6D 4NO5A 1OGSA 1TEGA 2F2HA 1WA0X 4EIGB 1RZPA 2Y1YA 2KS0A 3SYBA 1OE3A 1M05B 4D9LH 3GMLB 4MJ5A 4JFBA 1JZ3A 1T1WB 1T4KA 3CU1A 3EO0B 2H4EA 5L88L 1F4HA 3EBGA 1CFVL 1TJGL 2AJXH 3FK3A 2ED8A 3KW8A 5JHDB 1KLUB 4XODA 4DP9X 5C0EA 4HJUA 4ZS7H 3ZBMA 3BP4A 5BZDA 2X70B 3L3DB 4HWBH 3FTZA 1LNUB 2E5EA 3AT8A 1XIWD 2DY2A 1YN6A 3BSZL 3U1PA 3TTYA 1WZ1L 2B1HL 3GBNL 1UM6H 5I75B 3DKHA 4GY4A 1HZLA 1PCXA 1H0DA 3EUDA 1BCIA 4OH2A 1NUDA 4K23L 4BUMX 1GY2A 2K3TA 4ZUVA 1KCUL 5H8DA 1Q9OB 5FOJA 3JVGA 2XVGA 3VNYA 4L1SA 4MZ2A 2NSMA 1G1KA 3U9WA 4ZFFB 4AL8H 4LVNB 4XCYA 1MCEA 3PIQA 1I7UA 3V4LA 2M2DA 3WFHB 3O9WD 2E7MA 4P0DA 3S6CA 3OPUA 5D1XE 2GTQA 4HHAA 1MCSA 4KH2A 1J0YA 1ID5I 3CZEA 1L6XA 4ORZC 4IDJH 4PJCF 4WFGE 2X42A 3CFCH 1NGZB 2YJLA 4N2IA 1ADQA 2DWDA 5FYKD 3KZ8A 3C5ZB 1AFVH 3O3EB 3G7GA 3QFGA 4P3CH 3VCLB 4XNKA 4LZKA 1LQBC 1QEWA 3E1F1 1G4MA 4IRZL 1BG9A 2Q8BH 3IAPA 1NMBL 3HLAB 4LL4A 3MREA 4KK9C 1FRGH 3Q3GA 5EV7A 2GJ6B 5I6PA 3ESVF 5L4FA 1UUNA 1PIFA 4LNVA 1L9OA 2IAMD 4TF4A 2VWEE 3W5MA 3O6LH 4NKQB 4CNIB 4OGAD 1G9MC 1H8OA 3RJQB 1L5GA 3HKFA 4FZNA 2FNBA 2DTSA 5D9SB 1D5MB 3IJYA 3MQIA 3U0WL 3P54A 4Y9EA 1WZAA 4P5RA 4XGZA 4FNPA 1BX2B 1DQDL 3ULUE 5FYKL 4LU5L 4GSQA 3MRBB 1UG9A 4HSAC 1AQHA 4S1SH 3UTTE 5HHOD 1U8PA 1ZLEA 4FLQA 2YD6A 2Y5TB 4N2KA 3ZZ1A 3X1GA 4C4UA 2HFGL 4TN9A 3ULUD 2PW2A 1A6UL 3FQ4A 4YGVA 2KDGA 2BMKB 2D0FA 2UV3A 1TZAA 4G1EB 4G5AA 1NKGA 4HKXB 1KB5H 3DXAD 5MP6L 1PLBA 2XUWA 1J1OL 5CMAA 1NGQL 1B4TA 2WUCL 4NC0B 2OMTA 4WUUB 4NKIH 3PGRA 3POUA 5D7HA 1NCUA 1TTRA 3OMNB 5F89A 1IC7L 3D2UB 2DQUH 4KHTL 1CBVH 4UB0L 1F8TL 5E23A 1PX4A 3DOIA 4FP8L 1T1ZB 3HE6D 3V0WH 4HW6A 5B4MC 4YHLL 1KG0A 2IDQA 1BQHG 3ISRA 4ZMQA 1JGLL 1KCSL 2OJZL 4ORGB 1YMMD 5AFUK 3FT2A 5INCA 1MAML 2F8OA 1FNGA 1W15A 3F85A 1RJZB 3NGBC 4MYPA 3NDYE 2R4PA 1FA4A 1LMKA 3PWNA 1AD9A 2IGLA 1E6JH 2HFFA 3QJFA 4DUWA 4HUVB 3GLZA 1MCPH 2R4NA 1OW0A 3ARFC 3AAZA 5HGDA 4QF1A 4XCFL 5ID1B 5GGRY 4Z7WA 4TM9A 5ANHA 4Z7WF 3ARDB 4TRPH 3QW9A 4TSCL 5IQNA 3QDJA 3WUZA 2HX7A 4ODTH 1S3KH 3INOA 1TTCA 2ITDB 4L9DA 4FNUA 4ZYKA 4RDQF 4P05A 4PJIA 2DQGL 4ZD3H 1NCBL 3D18B 3P9MB 4POYA 2H3NA 4FHJA 1YC7A 3D39E 4XCCL 5GS0L 4JM4L 2R1YB 4LSQH 4P04A 5D2LA 2B0SL 2CGYA 1HHKB 3S4SG 1XGPA 4GMTL 4LQFH 2XYBA 1IC4H 1DVFB 4ANUA 2Z93A 3VGFA 3MLYH 4JREC 1N59A 4BFEA 4EZJA 2X0UA 3QXDB 3HS8A 2AQ1A 1IBDA 1L6ZA 4L29A 2Z8SA 5KSBE 3JVGC 3L13A 4HFWB 4P8QA 4PJGB 2I32A 2AERT 2BY1A 3JWDH 5HHMD 4BFIB 3DSFL 1D5BB 5IB4A 5C09D 5CZKA 2YD5A 2GITA 3F62A 3KVQA 4UV4L 1QFWL 4PJXE 1KIQB 2OLDA 2LFEA 3V6OC 3JSSA 3NA4A 3RGVD 1Z5LA 4P5SA 2QMKA 3F58H 3FHQA 2OYPA 3ARBD 2A6IB 2R4RH 2APXA 4UTAL 1XCTA 4JO4H 4FLOA 4GKZB 4JZNB 4P2OB 4B7LA 4YK4C 1L3WA 2JTDA 2DMKA 4X9FA 2N3JA 3BISA 1MCQA 5DK0B 1NCHA 4B9CA 1U92A 2YC1B 4Y5XC 5HDWA 4NM4H 5KVDH 1N10A 4AKPA 4PRPD 5BQ7B 3B3IA 1AGCB 5KS9E 5DFVD 4PJ5A 4AKRB 3RVVD 3HI1A 3ASNB 3QUYC 4JKLA 5K9JH 1ZJBA 5D7IF 5E4OA 3TT1L 2OMVA 4OQTH 5I1KH 3L1EA 3R06B 2CIKB 3AROA 1QHOA 1MCFA 2AXWA 2PKDA 3FQNB 4L8SC 5FLUA 4YE0A 1TO5A 3KYNA 2VXTL 4AZLA 1OV8A 2XBTA 2NY0D 4M61A 3QRAA 4PVNA 4QAWA 3S48A 3RWDB 3C5XA 4QHKJ 1K4DA 4GCQA 3UCQA 5IF0B 3VD4A 1HSBA 5I1DB 2B59B 1FVCA 1TJIH 5IF0A 5T1LD 3ULSA 4AEEA 4X0NA 2IPKB 1I8AA 1N8OE 3RWDA 3IJSB 7CGTA 3STLB 2ZPKH 2DWYA 2OR9L 2J5LC 1OAYH 1MJ7L 4ZX5A 3V5KA 1BZ9B 1C12A 4WEBL 2GJZB 2AJYH 2DBLH 5B3JF 2B1OA 2BX5A 3HLKA 3AM8C 1J05A 4X9YA 5EUKA 4PSPA 1OK0A 4N9GA 1G6VK 1REIA 4K8RL 1AXSB 3ISYA 3CK0L 2VQTA 5HHPB 2ZICA 1SYVB 4P57A 4W93A 2FCBA 4AKMA 2P5WD 2ZP8A 1LO4L 3KE0A 4AVKA 3TNMA 4FJ6A 3VSQA 3TN0C 1GGBH 4L3ED 4LQ1A 1FWXA 4HJGA 4OKVB 4OF6A 4R7XA 1EQWA 4U4BA 5ITBH 4P4RA 1XCTB 3OJVC 4JRYA 4LCIL 4XP9L 1FE8L 4S0TD 4MQXC 4UV7H 1OTSC 2CHZA 4KJQD 3D3VD 4HDIA 1IGFH 3VU1A 5KYXB 1RZ7L 2P42B 1X7QA 2NY0C 1P5UB 1GC1L 4N4YB 3WNIA 4J6RH 4PJ0O 2D9CA 4I9XA 1LDPH 4ONGL 4UUJA 1TPXB 3P73A 5F7HA 1JGVH 1CK0L 3HRZB 3EUUA 5IW1A 4PI0A 1JZ7A 4UUJB 1TLMA 4XR8C 1PW3A 2O5YH 1CE1H 3BP6A 3M07A 4BA8A 4MNQB 5DHMC 2YWZA 4RGMB 5J8OA 2R0WH 2VDQL 5FB8A 3VRLE 3BKMH 1JGUH 1BEYL 4IRSA 3WD5L 3T8VA 4FA8A 1IAOB 1Q1PA 3FKUS 5CU5A 3GMPB 4I18A 3NT0A 5GJSH 1ZLWK 4ZS6C 4KBPA 4QRTB 4PJ7A 3TN0B 3VFVA 4HULB 5MEOA 1WTGT 2MJWA 3HN8A 4G8GD 3OKMB 4D94A 4GOSA 2QQQA 5E8DH 5EZLB 5C0AD 4M6AA 4XNZB 5MHSD 3WMQA 4ZUUB 1OCWL 1J88A 1BZOA 4YFDB 3S3PA 1IGML 3LD8C 4HS6A 1QRNA 1X5IA 4PD4J 5E2JA 4F9LA 2X9YA 1XR9A 1NGYB 4M93C 3H7BA 3BVUA 4XMTA 2X28A 4QRQB 2AW2A 2R29A 1ZVSA 5DJDB 2VXVH 3D39B 3B2VH 1X5LA 4ADJA 1ETZB 3FRPA 4P2RA 4OVVA 4Z8FL 4F7PB 1JNHB 2G2RA 4RISL 3QIBB 3U6RA 2QTVA 1A6AB 1A9BA 3HG5A 4IJ3C 3NJIA 3SDAB 1HXKA 5FKAA 4Z5RB 4OKDA 4U2YA 3N9GL 5DQ9B 4KUCD 3WY4A 2NYZA 4GG6B 5FO8A 1LK2B 5HHXH 5E8OB 2PYEE 1QTPA 1P53A 3ESPA 5F3HA 2J4UP 5I8OL 1YEJH 3P0VH 4KUZH 4J6RL 3LS4L 3IM1A 2P49B 1BFOA 1NGXB 1HI6B 3O2DA 5EU5A 5EU3B 1R17A 2IF7A 2J44A 3MJ8B 2CIKA 3VJ6A 2EH7L 4MAYC 5A7BA 1GFPA 4G82A 3WU2O 1A4KA 1Z9MA 2XV2A 4HJSA 3A6OA 4CBPA 4R96A 1OXYA 3BGAA 3QUYB 5C07D 1H6TA 2ZG2A 1XL4A 4HA1A 2QKIA 1QTSA 4FCAA 3V0IA 4KJPC 2DQFA 1BJ8A 2WKGA 4KKPA 4Y2LA 3TP4A 3GNMH 2P8PB 1J10A 5GV0A 3LPGA 2AEOA 2JJTA 3AC0A 1SBSL 5CJOH 3UO1L 3ZUNC 3EO9L 1EJFA 4X8JA 3B9EA 1U3ZA 1BDYA 4GG8A 1DR9A 2CJUL 4ISVB 3HE6B 4M6ML 1QRKA 5DUPL 3K81A 2IADB 5KYWA 2I5YL 3T24A 1AS6A 4PRHD 1S9YA 1MLCB 1JZDC 3VXOB 4JPWH 3P02A 1GXEA 1ZT1B 3QS3A 4WDIA 5D7SL 1ZT1A 3ABMB 3PP4H 2J5LB 3VG9C 4ZPVA 2AAAA 5H37G 1WFUA 1A1MB 3VNZA 3VXUD 4RWYH 1KENH 2K9FB 5DFTA 3T9WA 3SE9L 5TE7L 3BZ4A 3SYCA 1EZUA 2HWZL 4WO4B 1UXWA 5K69A 4PS4H 2VC2L 3UMNA 1BZEA 2K6YA 1A3QA 3ZT5A 2CWRA 3OKEB 4OI7A 4KNUA 3EYVA 2QKIB 3O0RH 4AMXA 2X7LA 5JORA 2NQCA 1NDMB 4FRWA 3T3MF 1MHPL 2F9BT 1TOXA 4DW2L 4J3OF 4M7ZC 5D8JL 4APXB 2A3TA 4NPYB 2HRPH 3I84A 4OD3L 3RI5F 1KCBA 1R34A 1O9ZA 2XZAL 2R23B 2F1EA 3L2NA 4DNLA 4P23D 4WGVB 1PMYA 3DVFA 3DXAE 3MLZH 3Q5OA 3QULA 4FG2A 4K94L 1FV1A 4FSPA 2NW3A 4C54A 4H0GA 1NPUA 5F7EL 4P23C 2KZBA 1BXVA 1EMTH 4QRRA 4M9OA 1TNNA 2DZEA 4ZNCD 1H8NA 4DQOH 1INDH 2JXMA 3RP1A 1JD9A 4DETA 1BYPA 3FUEA 4G7YL 2LLNA 2DWSA 4HBCL 4IDLA 1QD0A 3FU6A 3DJSA 3DSNA 4PP1C 5BZWA 5EN2B 2R2EA 4YSEA 1IGIL 1A1NB 3KPPA 1M3IA 3SDYL 2YMXH 1EO8H 5BRZA 3D4ZA 1FL5B 3AY4C 4WI0A 3ULAB 3TL5A 5BRZB 3WFCL 4BFGA 3GJFH 5DFAA 2XVLA 3KPLB 2Q3AA 4PRAB 4XTRC 2VJ8A 5M7QA 4YPGA 2LAAA 4MKTA 4JJOA 4UQ2A 5AAMA 4PJFA 5AVUB 4BHUI 1E54A 3IJHA 2X4RA 4K7PH 4N0FB 2XX1A 2J20A 3T4AA 4QOKD 4JVPA 5HBBA 2EVFA 5HTSA 1MCWM 2XACC 3IGFA 3GK8H 4U6VH 1K6QL 4QHKI 3P4MB 2DDQL 3VI3F 1FV1B 1E28B 2CLVB 4XI5C 5GTHO 4R8WL 4CL7A 2JJTC 4YSCA 1BFTA 3OPZH 3X12B 5D7JD 1ONQB 2ZAIA 3V9CA 4PJ8D 4OCSL 3OB0K 3QI9A 1KGUA 2DQTH 2V9QA 3EYUL 4E9RA 4HAGA 2JE8A 2D7QA 5FA3A 3HBPA 1RU9L 3DHJA 4XPHL 5E2WL 4RGNE 3WI4A 3P73B 5HHVL 2IMMA 4OZ4B 2EIKB 3SPGA 3OQRA 1G7IA 4P9HC 2D7OA 3LOWA 1Y1DA 3JV4B 5I5MA 2X4TB 3CVHB 2E75C 3GB7A 3BOVA 4X8GA 1IBYA 4HDIB 3F05A 1R3HB 2VMJA 1X9LA 2JCCE 4Y4HA 4NQEB 2GC4C 3WFBH 2MQ0A 4RVBA 5DK3A 2BSRA 2XWEA 3AVEA 4X5XA 5K9OA 4XNAA 2K3HA 1WRFA 1CN4A 3KLAA 1DVXA 3QNXA 3QCUL 4OFPA 1ZK9A 1YYLL 3KJ4C 1PZDA 1JK9A 3BPNB 1L9MA 4IOIB 3IN0A 3ABGA 2ICWB 3U36A 4QQ1A 2FR4B 2YPLD 2J2ZB 3WSQL 3CFMA 4JAMB 3MBXL 3BUDA 5KS9F 1PEWA 5AW4B 5FDYA 3ROLA 4N5EC 4YE4H 1U8MB 4GXUM 1AS8A 4LVNC 3IJSA 1MN4A 3LV3B 4X4KA 2BIHA 2OL3H 2H9GB 3JV6B 1KJVA 4L05A 4S1QL 2EDYA 2D0GA 3RWGB 3I9IA 2X4SB 3A47A 4PGJA 1LP9A 4OZIE 1FNAA 1JNNL 3MMEB 5BZXA 2XZQH 4RSVA 1ITCA 1VCBC 5G4MA 1BFOB 1NGXA 4J3OC 4BBWA 1GW0A 2BOCB 5F3HB 3LK3B 1NM9A 2Q8AL 3PORA 5EC1A 4HG4J 2C26A 4EN2A 2XIDA 4UT6L 3VXME 4NN5B 1AHWB 2N01B 4TTDD 4DZ8B 3C5SA 3DIFB 1Z9LA 2APTA 2R59A 3P30L 1J0IA 4YHMH 3W9DB 3P77A 5FOBB 1JZ4A 3UTTB 2WYIA 1RULH 1I4FB 3HMXA 1UD6A 1FFNB 1FE8H 1P1ZB 4DGIL 1EXGA 5HJ3A 2VC2H 1MEXL 1CXFA 2CJUH 3L1OL 1YZZA 1NDTA 2AXFB 5JR1L 4FNSA 4JFFA 3DC0A 2VN6A 3B8SA 2XETA 3B2PA 5I1EL 2XFGB 2HKFL 2GSIA 4FQ2H 2ZF9A 4XHQA 3NCXA 4K5PA 3SDAD 5L2KE 1DANT 3LKPA 4Y1SA 4AW4A 3PP4L 4PMEA 2LOEA 2Z4TA 4PGDA 3W81A 4CSZA 1EJOL 4OB5L 4KNQA 3CC5B 1J9TA 5SWQA 4Y9CA 1F90H 1AKJB 1YEFH 2Y23A 5CJBA 3B5HA 3QJOA 4RAVB 5L8JB 5A2KH 1KGYE 1WBYB 3P11H 3W1ZA 4Q9CA 3NH7L 3HE7D 3JCUO 1J9CT 1M7UA 3WNOA 3ERXA 4U1HB 2V5RA 1AC0A 4ODSH 3S96B 4FXLA 2KZ7B 2ZSWA 3IJ9A 1FG9C 1OE1A 3A5VA 4KJYA 3HRZA 4LLMB 3V6OA 3GZOA 4MA3B 3DV6B 4NN7B 2NZIA 4QJ4B 3BYYA 3QCVL 1QSFE 3ZW3A 3RA7H 3D8MA 4N0CC 3PDGA 4HJJL 5CM1A 2BDNH 3X3FL 3ECBA 3JTBA 5I1KL 4O02L 2X89D 2JKRM 3QUML 2TSBA 2ZWYA 3MYJA 4M3KB 4CMHC 2E8ZA 4PRHB 2FZ3A 2WLLA 1CDYA 3CVCA 4QRBA 3L4WA 5F0LB 3UJIL 4BUQA 4E5XA 4ADIA 3QBTB 4HUVA 3BKYL 4OJCA 3L17A 2LAGB 2JTYA 3ZKXC 4PYHA 1NC4A 1FIEA 4N3UA 4YHPA 1C5DA 2IEPA 5DHVA 1KTDB 4JY6B 4ZMAT 2FGZA 5F7UA 3F2LA 2J88H 4K7FA 2ESVB 4U1GC 3FOMA 5HYJA 4XMPH 2CDEB 4HJ0C 4X5RA 3V52L 4UOJA 3LJ3A 5JDSB 1UWXH 1GYVA 1RP9A 3FYIB 4L9LA 4C55A 2F1AA 1DJZA 3COOA 3PXJA 1KENL 2V5MA 4LPVA 2I25N 3WJJC 1T20A 3GXNA 2MNUA 3DWOX 4UT9H 1EZLA 3AUWB 5F97E 1YHPA 1V7MH 5DT1L 4YHYC 1EGJH 4O3WA 2CG9X 4R97C 2OMTB 4NQCE 3SDCA 2DICA 3KAAA 2JQAA 3FB7A 3UGEA 2YUVA 3ZR6A 4AEFA 5DQDH 4PIRF 5GGRA 3WGVB 3UPRA 4YOKA 3A4FA 4KAQL 3GKWL 3LKPB 4PB0H 3T4YA 1GGYA 4LL9A 3TT3H 1ECYA 1U3HA 2BIPA 4DEUA 4KRPD 3KLDA 4DKEL 5BVJB 1ASQA 5HYSG 4GKSA 1K8IB 3SJVE 3PUCA 3NTCH 1E9QB 1JGUL 1KBKA 1QWHA 5MI0B 3K72B 2WLYA 4E68A 1PZCA 2JKIS 1I7ZA 5FKPB 1N5YL 3C6LC 1EJ8A 4HHGA 5KYYB 1IM9B 3Q01A 4PWGA 5FFLA 3QJHA 1AQKH 5KVFL 1IBBA 4AE0A 5HJDA 5KANG 5TDOA 3T0VA 2N59A 5JYLA 3TBWA 3DI2B 4P9MH 4R4ND 4RA3A 2XFXA 2IFGA 3QIWD 3GHPA 1QJ8A 4PJ9D 4CUCA 2E9WA 4PLOB 1HVXA 1JZFA 1Z3GL 2DQJL 3L4CA 4KXAA 1WCBA 2VN7A 5I8OH 3RL1B 1KXQE 4XN5A 5SWSE 3MLTB 3EYFB 1HNYA 1OARL 1P7QB 2C5DC 3D39D 12E8L 5AOJA 4LRIA 1H6UA 3V0AC 1H15A 3BGFB 3BC9A 2JI3A 4NUMA 4GSUA 3V6BR 2HJFA 5GGTA 4N2CA 3MRJA 4Z8FH 1T20B 3QCTL 3H8NA 5JQHC 2Y5EA 1TZGH 5AL0A 3DX0A 2FUQA 3OAUH 3P2DA 5AVTB 2CKBH 4FQJL 1NIDA 4R7VA 1D5IL 4P2QB 3MX0A 5DQDL 4JVUA 1AD0A 1L9SA 5B7EA 2H3NB 4IMKC 5DZJA 5L2JB 3I02A 3REWA 2NY1B 5J12C 5A2JH 1S8DB 3FQWB 4N24A 3B2UD 3CDZB 4MS8C 3GIVB 3WHE1 5E51A 5EEXA 3VMOA 4PJGE 4YWGH 1TJIL 3LD8B 4PJAB 1KZYA 3PU7A 4ODUB 5D1QE 4U4IA 4ATTA 2WAQA 3BN3B 4JGNA 1AQDA 2MNJB 1DFBH 1AO7B 3Q8BA 5C0ND 5LGHH 4HS8L 4P4KB 5ID1A 1WEJL 4NQED 4L4VB 1J1XL 1QBLH 2VO5A 3JWOL 3MRCA 3TEZA 4P5KA 4JFUA 4FKKA 3ECBB 1QMUA 1RK0A 4G3YL 3P1VA 4TSBL 3ISWA 2O5YL 4AI7A 3L5XL 4EKJA 4OCXH 2FGQX 3IDIA 1MFBH 1A5FL 1ORSB 2EYTA 5AW9B 3SBQA 3VQLA 3S8FB 3UAAA 3ARRA 5TDOB 1MCIA 2UYLB 3QPXH 2XJLA 4L37A 5CFAA 3RHWK 3ZRFC 3TF7C 4RA0C 4YDIH 4JMXA 4FL4B 2IOOA 2PXYA 4WSGA 4C83A 5D1ZI 1E5BA 5KBPA 2IPTL 1LEIB 4EUPB 5F9JB 3TVMC 2VMDA 1HH6B 4BFBD 3Q43A 3D0AA 1D2PA 2ODIA 4AFKA 5FR3A 3A23A 3FFCE 3V10A 4WWKA 4YL9A 4JKPL 2ODJA 2CR6A 3FZUD 5ILTH 3UAFA 2N1TE 1VAHA 2DYPD 4PRPB 3E3QC 1S7RA 5F71A 2GABA 1D5IH 1ZT7A 1JYWA 1MREH 2X4OB 1Z0MA 4OFQA 7PAZA 3MA7A 2WVSA 3DA4A 2ORBL 3F04A 3ARYA 3SKJH 1I8MA 4YGAB 1X3DA 4CW1A 3MKKA 2XY1A 2MNWA 3GZPA 3QFJE 4KRMB 1UD4A 3HMWL 2LQRA 5C08D 1E4WH 3IU4H 2OP4H 4OCYH 4UU9A 1YYLH 2DV6A 4CVZB 4OIBA 2XTSA 2EXYD 2EDXA 3MCLL 2C3HA 4N2GA 3RAJL 4F8PA 1I9JL 3T6ZA 3AA0A 1AGFA 3L2LA 1GPOL 3FFDA 1M7IA 1LYQA 4PBXA 3BCDA 1E7UA 1OAUH 1YAIA 4Y89A 1SF3A 4PPTA 4JFQA 4ZS7L 1QPXA 2VDLH 2FECI 3RL2B 5HDQL 5D4HA 2VLRE 3HPJB 2P7TB 4KMQA 5B1CA 5K9JL 1AQDB 1KPVB 5D7KD 2R23A 4BFRA 5A3IC 5D5MA 3A6CH 4S0HA 4QXGL 1FG2A 4B5EA 3TF4A 3FONA 5KAFO 5KSBA 1F4YL 1QA9A 4NQCB 5D4JA 4XMXA 2W0FA 3WJMA 3RIAF 4CJ0A 1Q38A 4IRSD 1T1LA 5KJ7E 1C7SA 4UCFA 4P2QA 4HHAB 4BSVA 3SDCC 4IIQB 3DRTA 2GJ6E 3O41A 2A9ML 3KDPB 2YJQA 3SQBB 4Y5XA 2F0CA 4KZEL 3H54A 4XCYB 4GRLB 4QHUB 4XCNB 2D7PA 3N04A 2EVJA 1EAJA 3C8DA 5LGYA 3NH7H 2AGJL 1RHHA 5DRXA 4Z77A 4OIFA 3CC5A 2VM9A 1D3CA 3KLAB 3NJNA 4O2CB 1M6OB 4PRHE 5I24A 3BDYL 1VRSA 4Z18A 3T6QC 4NWUL 3MLTA 2JLLA 4PJ6A 1IUZA 1VACA 5E1HB 5IMLA 2EICA 3JTYA 4XMKH 3C08H 3ZY7A 2EDFA 2DW5A 4PIBA 4ETQB 4N9OB 4UB8O 1FH5H 1PKQB 2R9HD 3OXRB 2VZOA 1JSYA 2P28B 3QJTB 5HDBE 3SDYH 3MRMB 2YPLE 2EE3A 1C5BL 4OLEA 5DUJA 5IFJB 2BP3A 6PAZA 2NY2D 5DC0A 4Z0XB 3P77B 4N90D 4DAGH 1G7MB 5E4IA 3IVKA 5EG6C 4G5ZL 4XMZA 3ATDA 4U1KB 1CIDA 4NO5B 2JKLA 2IPUG 5KYYA 4WY7H 2PLTA 3T1WA 2BZDA 2RD0A 1KCWA 1NCTA 4JFSA 4NN7C 2JV6A 4BZ2A 3VXSE 1NA8A 3BAYA 1E6OL 3APFA 1DE4A 1AYRA 5JW4R 3I9GH 3RPIA 3H3PL 1KNOA 2L3BA 1DJWA 5J11B 3V8OA 4PRIE 4UBDC 3BPLB 5DJ6B 3KXFB 3ABZA 4LLUB 3MBWA 3UBXB 2XZQL 3ZE0F 1MCWW 2PYFB 2VZ1A 3UAJD 4A04A 5LQBL 3JT0A 4HCRH 1IC7H 2X1OA 2EE0A 5EU6E 4S1DC 3CZKA 3EHBC 1I8LA 4QR7A 4KY1H 4RWYL 3N0PB 3R18A 4RCAA 4UF7C 3WIHA 2R2EB 2UUDK 1Z9NA 1FL3B 3DSNB 3VDAA 1NGWA 1I7TA 1RIHL 3L95A 4KI1A 4IBQA 2XWBA 1DBMH 2WSKA 2ARJA 1RZ8B 5D7IB 1BVNP 2CBOA 2JCWA 3UAEA 1KDJA 4YXHL 3PF1A 2WUCH 5GXBB 5LO7A 1GFNA 1AY1L 1UADC 2DQHH 2R2CA 1XCQB 4PJ9B 3CFEB 2G3NA 3MUGA 2X6UA 3R1GL 4JDZB 4UQ3B 5DJZA 4OV5B 1WH0A 3EMNX 2X2IA 2I7OA 4I18B 4FQCL 2GY7B 3DO7A 4N2FA 5I0YA 4ZX6A 5F88B 1ZLUH 4KO6A 5DTFB 4C69X 2B2XL 2DN7A 5I15L 4HZLA 5ALBH 3H42H 4B0MM 2F54A 1E5ZA 4FD0A 4JRWA 2GT9A 5C0FB 3EGXA 4F58H 3MBED 4L3CB 4AGQA 5C9JB 1BM3H 3G3LA 5ACLA 5FYLD 3LSOA 4QYOA 2VUYA 3BP7A 2Y6TE 3UERA 3QI9B 3CVIL 4IK6A 1UXWB 3FTVA 1CGYA 3W39B 3GTVA 1SHMA 1FNLA 5K93A 1NBCA 1KY7A 3CWGA 3D33A 3VW3L 4A7GF 3AWEA 4GO9A 3MNZA 2RJMA 4FQ1L 1ZLWH 3H9HB 4LHUD 5H4YA 4MMZB 4BZ1L 4JBSA 3QPQD 4GS7C 5ITFA 1MI5E 3HTLX 3MO1B 4TULL 1GKOA 1WO2A 2AKRB 3GSNA 1QO3B 3CPLA 3N41B 1VFBB 1P84J 1XAUA 1KTJA 4AUYA 3GS4A 2WANA 4JFZH 3VXTB 2JIXA 4YC2C 4Y9GA 3WN5C 1UH2A 1KLGB 4L1TA 1T7ZA 5JIMA 2YKKA 1MAKA 5FUZH 1U8CB 4YN3A 4J3XA 4Z7NE 5IB1B 4YE4L 5E2UL 3TX4A 3QFDB 3TJEH 4LLWA 1QACA 3JYCA 4M1CC 1EVTC 3PRZA 3HI6H 1B0WA 2EIZB 1B4LA 3OHXA 3RX7A 3S3DB 5MENB 1C12B 2BPBA 1KB5A 4ONHA 1BZ9A 2R0LH 4XVJH 1EHLL 4NWTL 1I8KA 1RP8A 3QEUA 1VZHA 1TETL 2B15A 2X10A 1I9JH 3WEMA 1G4RA 2OTUA 3AB0C 3OL2A 5KYNA 2P3YA 4X80L 2ZX7A 5DEJA 1GHFL 2XBDA 1R5IA 4UQCA 2AXJA 5F2FA 3QEHB 4KK8D 5KTEL 3DGCR 4UT9A 2A6KA 1KTCA 5SWSD 1K4DB 3LZNA 4KXDA 2B7DT 1MFAH 1WCBB 2DQCL 2ZOKA 1NMAH 5CGYD 5DJXA 3DVGB 1WG3A 3JXAA 2R69A 3Q9QA 3WKPA 3MOBH 3BVNA 5TFSH 4ICWA 4W9GC 5CEXA 2AV7A 4XBEH 2FBJL 3K8LA 2ZZUT 5EDXA 1OGAB 1G7QA 3K5RA 2F15A 4L1DA 4KQ4H 3HI1B 5JZ7D 5JORB 3PDDA 1PAMA 4JQXC 3GRWL 3HJEA 2FT6A 1CPUA 4MJIE 4ZQKA 2RCSH 1ETZA 1OZTG 5T1KD 3QARA 5I71B 3HR5A 4O9HL 3VY9X 4ZG1A 3S35X 2YAEA 3VE0B 5DK0A 2VDRL 2VLKB 3UTSE 3ATEA 2YZ1A 3HC4L 1JWMA 3FB8A 3T5WA 4FCHA 4X9IA 2FJHA 4HUNB 1P69B 3CZSA 4KRPB 5CJQL 3D51A 4P5MB 2OTPA 2UWEF 4CSTA 2KLRA 4V1DA 3L5IA 3QPXL 3VD1A 3WV0A 1MIMH 4H8VA 3HB3B 2AXTO 3VB8A 1UJTA 4AYEC 2Y25A 1U8LB 4FNLH 4PJ7B 3A2SX 1IM9D 1AGDA 3MCLH 3PHAA 1WBXA 2DL9A 2YOAA 4DUVA 3K2UL 3O6MH 5I30H 1ES0A 2W0KA 3FO0L 1OT1A 3MOAH 4G1MA 2D3NA 4AZ8A 2C3WA 4DN4H 4KOBA 4ZPTB 1YN7A 1N59B 3PL6B 3IDXL 4JQVC 1LEGA 1TZHB 4RGND 4F2MA 3FOMB 4OZFH 4MMXC 1PL3A 1M6UA 5JUEH 3ZDWA 1TJXA 4PJEA 3MUUA 1OZUA 3D18A 1TTUA 1IRAY 3F83A 1AQKL 1G9MH 2CKBA 1BEXA 1LWRA 1P7QD 5DQJB 1ID2A 3LK2A 2BY2A 3NACL 3KYKL 2ZYHA 4IHBA 1F2XK 1JV2B 4RBPK 4XCEB 5AKRA 4LP4A 2DJ4A 2DQEH 5E7BA 5E9DE 5BUAA 4HJGB 4OKVA 3ZQ9A 4Z7AA 1M9SA 2VLMD 1PD1A 2O5XH 4DKEH 1JPEA 1SXAA 5ABAA 2HT3D 4YR6A 3PWNB 4GS7B 4XX5A 3TNMB 3C5OA 3GSUA 4KH9A 4ONGH 3Q05A 2W9EL 3SKMB 2AI0H 3ARGA 3CJJA 2EDHA 5E79O 1LO5A 1SJXA 1XIWA 4ORGA 1SEBA 4Y2OB 4AUUA 2CUMA 1M3JA 3LPFA 2VQ4A 4UT9L 2FX7L 3LZFH 4TL4A 3T3PE 3TBYA 1FL6B 3P4NB 5FCUL 1R24B 2DQIL 5CSBA 3CSFA 4A67A 3GMMA 4NKOA 4J4PD 3ALWA 4U7KA 2AJSH 5HDRA 1FNEB 1XB8A 1ZD6A 4OI9A 4ZW3A 3BSGA 1W9XA 4QWWC 2UZYA 2GUOB 4FZLA 5F72S 3DOSA 1E65A 3FTWA 2O93L 4U0QB 1B0IA 3V6FB 2DQIH 4TQ8A 4XNMA 3AG1B 3MLWH 5CILL 1D9KD 3M6DA 4NGHL 3NSXA 2P80A 4BH8A 1IFHL 1OCWH 3OKKB 2WBJD 2BNUA 4GI6A 2VAAB 3Q0HA 3QRCA 3V4UL 2DMGA 4K73A 1UCBH 3GMPA 4XRCA 4JQIA 5IB3A 2NYYD 3RFZC 4KK9D 5TH2A 2NY6D 5ESAB 5ICXA 4G7RB 1M71A 1E9OB 3BD3A 4LRNH 4NZUL 3TBSB 3L3HB 5EF2A 1DUYB 1J1PH 5AZEH 2HYMA 2B77A 2A9AA 4DKAA 2WQAA 2OSXA 1B9KA 5BQ7A 4IHOB 1BQ5A 1ET7A 3QORB 3AXLA 2QQNL 2WD0A 3C75A 3CFNA 3MV9D 2QR0B 3IRZA 5DVPA 5DWUH 3ETBF 2OULB 1MFCL 3EYOA 2XXGA 2XX0A 1G1OA 3BAJA 2QVFB 3K1KC 3Q3GB 3V6ZA 1E5AA 1VJSA 4V2BA 3KM1A 3LXAA 3EF4A 3N40P 5LN8A 1KIQA 3BQUC 3QUZC 2A9DA 4W9FC 4P06A 1F1GA 4JFED 3LQAL 2FE0A 4M93B 4FYRA 3NZHH 4AQEB 3OX8B 4LIQL 1J48A 5AW0B 4BCXA 4UI2A 3STZA 4PRDA 4QHNB 3HG0A 2H8PB 1WT5A 3B37A 3WEOA 1J8HB 4XP6L 5DRWB 1UWEL 2HJKA 4LKXA 1DVFA 2A6JB 5ESVB 3P3RA 2AJ3A 4ANXA 2XWTB 5JQ6L 4UT7H 1IGCH 1JYNA 3KBFA 2P45B 3WMSA 1KIRA 3ZTDC 2B1AL 2IXQB 3NACH 1X6NA 4HPYL 2DEXX 1BQHB 3DSFH 5IMKA 3U7AA 3RFZA 2CBQA 2JK5B 1RVFL 4ZXBD 1UD3A 2B59A 5DJYA 3O3DA 1KELH 4ODVH 2HVJA 1IC5H 1NGPH 3EG9A 4C56E 2G5BA 1S7UA 3BRDA 1YN6B 4L4TD 2D3LA 1HHJB 2GHWB 2JELL 2G60L 3O6KH 1PDKB 4BD4A 1TPXC 2AQSA 4YXKL 5TFSL 2D7NA 3V95A 2EH8L 3WKYA 5BOJA 3VW3H 4M03A 1NCWH 3ZN6A 1YRKA 3I74A 1BSIA 4LCYB 3RU8L 4ZZFA 3U6RB 1DLFH 2BS9A 3DYOA 1OPFA 5GGSB 2AQPA 4KV5F 1LO5B 2WCSA 1JCKA 1XGYH 4FTVE 4KNSA 4XT1C 4XVUD 3FN0L 3KPOB 4NFBA 1OP5K 2AVGA 4GIPD 5KANI 1ICTA 3AA1A 1OP4A 3NFNA 4P4KC 1RQ5A 3NEXA 4LASH 2ZSVB 2HUEA 5EZJA 5AW2B 5KVMC 2I9LA 4H1LG 4YHKL 4AJYV 4N20A 2NXYB 4HF5H 1YEIL 1NMBH 1RULL 1HKLH 2BP5M 5JDJA 1WFIA 2B0SH 4LSTL 4OJFL 4ENED 1QWNA 1CF8L 5SWSB 2ZQKA 3O2WH 1UOVA 2YFOA 4KKLC 4FQXB 2EEDA 5DEFA 4LSIA 4XBPA 1UKTA 3EIFA 1SY6H 4K3JH 5EC2A 3KWWB 4Z3GA 2WMPA 1MJ7H 3HUJF 3HZ3A 4OGQC 1BX2A 4PV9B 1HS6A 1D5XA 1E4XL 2BVTA 2WTRA 4HPOH 1TIUA 2R1YA 2P24B 1KMGA 2N7BA 4Z9KB 5EU6D 2MH4A 3FBKA 2CLZB 2A9CA 3UTSB 1WBXB 4ODHL 1X9QA 3ORJA 3RTQD 5KTEH 2FD6H 2OS7A 2YKLH 1SUHA 3HC0A 4PTUB 3ARED 5KS9A 3UZQB 5T3XL 3ILQD 4XX1E 2DQGH 2NR6A 5H2BB 3VXPA 1I1AD 1DUZA 1HX0A 43CAB 1N6QL 1IM3D 3BFWA 1B9ZA 3VRJB 1T21B 2FGRA 2WJQA 1H6EA 1JZ2A 2WOBA 1S3KL 1E4XI 5E2TL 1T5WB 3LXBA 2OR7A 3DK2A 1ZLDA 2ICEB 1TJGH 5C7ZA 4O02B 3TZVC 4S2SB 3IU3B 3ARUA 3NYKA 3QORC 5A2CA 2HRHA 4D9LL 5A2BA 5CJXA 2HH0L 1P4IL 4OZGA 3KXFE 4BWTA 2Y2TA 4NSKB 1XMWA 2WN3A 2PP8A 5B39G 1P6FA 3L4ZA 4I3RL 5AVVB 2ICEA 5GGSY 4G6FD 1XCXA 4MDIB 2XXFA 4YHLH 5D7LD 4KGJA 3U83A 4M8VA 4WTZA 3IPBA 5E03A 2CSPA 2NY3D 1PG7X 4AITA 4ABUA 3SCMC 4IKNA 1T21A 5K39B 2YA0A 5GIRB 1LGVA 2VDNL 5C0BA 4DESA 1PPIA 4AM0A 4ZMNA 1ACZA 1IC5L 1NGPL 3VD9A 2YA2A 3BAWA 1MHHA 1IAII 4FFWC 4LLVA 4KZCA 4FI7A 4N2MA 4WENB 4P46C 1A9VA 3QHTC 1P2CA 3CX2A 5IZ7A 5KYUB 4K5OA 5CGBA 3S8GB 4PQXA 4ZAKA 1GZQA 3NCBB 3TBCA 5KSBF 2JKXA 2JCCB 2XQYK 4N8CL 3T6VA 4BK8A 5BS0D 1CGXA 3REVB 4POZC 4A2FA 4LK4A 2FATL 4A7TA 3T3ME 1YYML 3ARDC 3OR7B 1KTLB 2ZXBA 3PFUA 1OGTB 3U79A 3ROOA 1U8CA 1L7IL 4FQQA 4AIXA 1MDAA 3V4VA 1LO0H 1OAZL 4WI5A 4UM9B 3OAZK 3MRRB 2UX7A 3S5LB 4FA7B 3F6IA 3T3PB 1KCKA 4XCFH 3VACA 2WQSA 4TPRL 5HHQA 2V7HB 2CRYA 2CGRL 4X7SL 4RLCA 3AU1A 3E9UA 4Y16D 1B0GA 2YAQA 3H9HA 1XGQB 5MERB 5DL6A 2HTLD 3EYSH 4RESB 4Y2DD 5DQ9A 2DL2A 4HCRL 3KPOA 3BRZA 2XN9A 1EEZB 2IGFL 1JZGA 4NQDD 3MNVA 4K71C 1RLWA 3LQAC 1JV5B 3RWJA 3EOYG 5KW9L 2EH8H 1FSKC 3LY6A 1CXEA 3CH1A 5F7FA 2GTZA 4U1NB 5EU4A 4G6JL 4K0OA 2F7RA 1AHMA 2ZYRA 1UJ3A 3IKCB 2E74C 3TYGL 1VKXB 3II3A 3LQZB 5DMKB 3L3KB 4FZ8H 4G8FB 4JFPA 2W60B 2F7OA 2UY7A 4Y7OC 3WDHA 3WN5A 3VTMA 4W1TA 3SBWC 2IFFL 3VXPB 5IR1B 3WTUA 4NKMB 2HT2C 4JFHD 5DJZB 1PIGA 1EHAA 1JMZA 1QR1A 5J6HB 3KLLA 4HETA 4BK5C 2WWMC 4QRTA 3TN0A 3VFVB 1AS7A 3CNKA 2D4FA 2I9TB 1W72L 1BECA 2ARJB 5D7IA 3ILQC 3SY9A 2BNRD 2WYZA 1ZSHA 4CSSA 1F1AA 5ESVA 2EP6A 3I9AA 5T1KB 3TM6A 2VLJD 1EEUA 2X70A 3L3DA 4G43A 4ABVA 1LEGB 4UAHA 1UURA 1WZ1H 2GTZB 1XBRA 3RWCA 1KULA 3BP5A 4TOYH 4AT6B 5BO1H 3GI9H 4XMUA 4XMKL 2MSPA 3SD2A 4NN5C 1FFOB 4H8WH 2X88A 5CGMA 2QTKA 4NPKA 2B1AH 5CU9A 3UXFA 3Q8AA 1CFSB 3HAEA 3D85B 2NY5H 5HD8C 2QFRA 3LH9A 3FB6A 4JZJC 4QRPD 5AUMB 35C8H 4H0IA 3IU4L 4J7RA 5J1SC 3C5ZC 3MZTA 2R8SL 1EZVX 3APMA 2VYRE 4H1LB 1OAXL 3FFCD 5FHBL 4M4RA 1A1OA 3F3HA 4XXWA 3LHPL 1KXQA 3GBEA 4U1MA 1NSNL 3AG3B 3ESMA 4MA7L 4PJEE 5K33A 3NZHL 4P3CL 4QJ5B 5E9DD 2CO3A 5FO9B 5CEYA 4R4FH 5EOTA 2ZUSA 1CXHA 1CICD 4RX4D 3QUMA 1HL5A 3NSCA 4Y1AB 1AO7D 3P69A 4XNUH 5GJSL 3C2AL 5KEZA 2WCGA 1G94A 1HINH 4RX4A 4CRPA 3FYXA 3EJZD 1RMFL 3C8KB 1ROWA 5F7WC 1U91B 3K4AA 3L8QA 7PCYA 4KKLD 2B5IB 4LCWD 4RH4A 3DZMA 5TH2B 5HHXL 2JCCA 1WAPA 4NQXA 1HSAB 2JJWA 5GZOD 3JTSA 1GZQB 2ZONA 1KB9K 4HKBB 2PR9A 3LDBB 2E7DA 1T5KA 5IMLB 4MAUL 1CB4A 1L7TL 4TL5A 1S7SB 1WFOA 4JHVA 4Z7WE 2CJSA 3THMH 3UX9B 3JWOC 3BW9B 1TYRA 3SGJC 4N2DA 2I85A 3D52A 4HT1H 1A5FH 2KQMA 3GUTB 3ZDXE 5FCSH 5FM5M 1I7RB 4LMQI 4TSBH 1ORMA 3S35H 2WVVB 2ITCA 3ZKND 1L6PA 1OOAA 4PJHA 1P4LA 1XH3B 2Z35A 3BMWA 3ME0B 4K55A 3H3KA 1PX8A 3GSQB 4WTWA 3X13A 3ZJAA 4YHZL 5DZVA 1W6WA 1CR9H 1FGVH 1ZE3C 3N06B 3NRPA 4NGHH 3PXLA 3LQMA 1NGZA 4XN4A 1XGYL 3JYBA 2IDCA 3WJMB 3UBFA 3ULUL 2VERA 3EDKA 5C0DA 4D8OA 3OM3B 3KJ6H 1CR9L 1GS7A 4E2OA 2Y9RT 5I1CH 4MJID 3CXFA 3U0TB 1QUNA 3HIZA 3LZOA 2V9RA 2GIYA 2OCCB 2WIIA 3PWLA 1DQML 2TAAA 1AHWC 1BVZA 3FQYA 4KROB 1QR4A 1NMAL 2EINB 2HP4A 3SKNB 2QSTA 3FQXA 5EO9B 2PR4H 1JZ6A 1PZ3A 4HXAH 5HVGB 1MM4A 2HPTA 3CAFA 4OLWL 1ZDQA 4FFZA 4FNTA 3A0OA 4HIIB 2MIZA 4AEHL 2VSDA 3KCPA 4L8SA 1F6AB 2AF2A 1JHKH 2HFEA 4J6IA 5IJVB 4LVOB 1MJJB 3IDGB 4M6OL 2LFGA 4X80H 5E6SB 1GJUA 1L9PA 3BUTA 3UTPE 4AYFB 4OZGF 3DPBB 1G6RB 2Q6WB 3H9SE 2R15A 1MFEH 4ABWA 3JTTA 3B7SA 3HUJB 3OKDA 4HZLB 3NSGA 5PRNA 4KTDH 1KZQA 1VIWA 1U30A 1UWEH 2COVD 4X7FC 2KXPA 4X5WA 2GJ6D 5FO7A 1FO0L 3QUZD 3TJEL 2PRNA 4LLYB 1P7HL 1MIEL 1O6SA 3E8UL 3NPSC 2VDML 4TMPA 1HCFX 4YJZL 1MCOL 5IJKA 4ZFOL 3NBNA 4PJHF 2XBZA 2XV0A 4NYLB 3RIFK 1OF0A 4QKXB 4N2OA 4XNMB 1THQA 4HKZB 5LG1A 4DP5X 2A4ZA 3BE1H 3BMVA 3E6FB 3WIFB 1NGWB 3F7LA 5IJDC 1JNLH 2R4LA 3ENEA 5CSZA 2RQEA 1V3KA 5IEKB 1AE6L 1S46A 3I50H 4HUCA 4FRTA 2ADIA 1IKNC 1QVOB 1U3NA 1XR8A 3IDMB 4M48L 1KJ2H 3QG7H 5IEHB 2CZNA 1I3GH 1YG9A 2MQ3A 3PQYE 1KF9B 3NJMA 3LB6D 4FTDA 1D6EB 4HCRA 5CR8A 2VLME 3G5YB 2HSIA 4L37B 3KPQB 1P4BL 5AYUL 1UCTA 4XBMA 1L9NA 2GVYA 3BHBB 1V54B 3NFSL 4X6BB 1OTUD 5C0GA 5BO1L 2AV7B 2LV4A 5IVZB 2VLRB 1SOSA 2ZWKA 1UM4L 1T6VN 2ZNXA 4GAJL 3MRCB 5DYOB 3D2UA 3EFOB 1SEQL 5D1QC 5C0BD 2Q7NA 4NUJB 4BSWB 4ZX4A 4L4TB 5FM8A 5B1KA 1R5WA 2YGQA 3E3QE 3HZVA 2Y1ZA 2ZUWA 4U1LA 1RH8A 2E46A 1CDCA 3EOAA 4NT6B 3G5VA 3PGCB 3ZSSA 1CL7L 4ODUA 5ACMA 5ISZA 3S8WA 1R3LB 3ZTEA 1EHLH 2FWUA 3HG2A 4YGVB 3T20A 5KWYC 1X4YA 2OXGB 2J1NA 3QEQA 1I1YB 2QGEA 3RY4A 3QUXD 4KKAC 4OT1L 4C56B 4UTAH 4FG4A 5MENA 2F19H 2X4PA 3TYGH 3ESUF 1JWUA 1J8HA 5DRWA 1ZANL 4KOCA 3ZE2E 4IIQC 2NNXA 3JV0A 2X09A 3ZTJH 3H53A 3JTTB 3QJVB 2ZKXA 1UWFA 3T77A 3KDMA 4H2CA 1QI3A 5IB1A 3MRJB 1GZHC 3QHZH 4Z3EA 2JKSA 1MHEB 1IM3A 2DS4A 3CHXA 1RUKL 4FZEL 4U1IB 2VDKH 5BRPA 4E0RB 5J9PA 1MNNA 3EDDA 1OF2B 2R0LL 4X98A 3B7RL 1CFNA 4LIQE 4XVJL 1A4JB 3DUUA 5I8KL 3VGDA 5DRXB 4HG4K 3TZVB 3I9GL 5G4OA 4KHTH 2RAMA 2L4OA 2VR9A 5B8CB 1TQVA 4IGBD 3EXLA 3EYOB 3OR6B 4LDCA 3OZ9H 2OTWB 2ZXAA 3HLAA 3QIBC 3KYKH 3PL6D 3OZKA 2A2QT 2OMYB 3HR5B 3NK4A 4QYOB 4L2LA 1AZRA 2VR6A 1ZHNB 3BWAA 3O2DH 3ZRSA 3ZL4H 1EBPA 1DVZA 2IMNA 5IFHH 5IQ9A 2F7QA 2NX5A 1TJHL 3AG4B 2QPFA 4JZOB 4DFIA 3MLVH 3MRHB 3TBSA 4TVSa 1DQLL 4OY9A 1A2YB 3TFBA 4R5VA 3RWEB 5LBSH 2RB8A 4DVBB 4HUWA 3H3BC 4O00A 1I7ZB 5FKPA 3U9PH 5JHLH 5DJ2A 3VRIB 4FYQA 3NPZB 1IL1A 1FNSL 4U1JB 1KPVA 2VRKA 1OB1B 5FHBH 1O7DE 4QHLA 3MOAL 5GHWH 3ASOB 4PRIB 2EDKA 2OXGA 3IS0X 2XPGA 3Q2VA 4NNYB 3L7EB 5PAZA 2YRZA 4F7KA 4P46D 4KDWA 2YRBA 1ZWIA 2J8UB 2XG4B 1K3IA 4JRXE 1FBIH 1S7SA 3MUY1 2HLAA 3SDCB 1HHHA 3G5VB 3OMAB 5L4MA 2XWBB 4XNLA 1NCCH 1CFMA 2J73A 3DOSB 2GUOA 3UYPA 1AR1D 4UB0H 3MLRH 1I8KB 3FULA 3M88A 3VXQA 3T0DA 3EF7A 3TNNA 3FN9A 3NIDE 5I6MA 4YVNA 4FTVA 3BCFA 1DANU 1OP3H 1YNTB 2K7PA 2VGLM 4FOZA 2D03L 4TLTA 4XNXL 1MCDA 5JZ7C 4ZW6A 4X6BA 4IQHA 3WNLA 4N1HB 2XV3A 4WCYL 1CG9B 4WSJA 1W72H 3BPOB 3I6GA 4OZIF 3BAEH 3KPQA 4OIIH 4CBZA 1AZBA 2UX6A 4QTIH 1F0LA 1D6EA 3O4OB 5F0MB 4ZT1A 3LX9A 1K5NA 2MHAA 3FMGL 3LIZH 4ZXBA 3M8OL 3QE5A 4B9PA 1DE4B 4AY0A 1A1OB 3KYAA 1HQRA 4M4RB 1T83A 3DIDA 4YXLL 1LEIA 4GRWH 4ZNEA 5A2LH 3MNZB 3MYJB 4LFHG 5E95B 1CQYA 2VDRB 4HKZA 5TGBB 5IWLC 5E2TH 2C9AA 3HG1A 4YDNA 3PCYA 4C57C 5T3XD 4UILH 5AOIA 3R1GH 2NTSP 5IW3A 1DBKL 2XZZA 4CADB 1GGTA 2NY4D 4ANWA 4FULA 1IARB 3NIGE 4ZOAA 4N8CH 3KGUA 4XO3A 1YN7B 2BNQB 2XPZA 1T7WA 3EH2A 5AW7B 5ACZB 1Q72H 4Q74A 2FSDA 1RUML 2WM0A 1BZ7B 2VLKE 2ZKHH 3PE9A 1KGJA 1YEGH 4L0ZA 5F3BA 3VI4A 4HJIA 5J3HD 4P2QE 4KVNH 1ZHZA 4HWNA 1S5HB 4I4WB 2QADB 1MFDH 1H3PL 1NBZA 1J87A 1RK1A 2VLKD 2X3CA 3HG1B 4HZ1A 5DJAB 2ZX5A 4KO5A 1GIGH 3GIVA 4JHWH 3L81A 3O2WL 1RHHB 2A9NL 3D0VA 1IAIM 2AAVA 3W2DH 2FJHB 2VXQH 1RZFL 3PRNA 2OMFA 4Q4IA 3H9YA 1QQDA 4W6YB 1JF1A 2AXFA 2O5NA 2XJKA 4G6KH 4HXBH 5I1GL 1A9EB 4IOFC 3QWQB 2HRPL 4C47A 3B5TA 3CXDL 4UYQA 4EXKA 1WZKA 4KNTA 3UG3A 1UWXK 1DN0B 1L3NA 2Y0LA 3B9VA 1WICA 3MNVB 4OLZL 4NIYE 1DBBL 2KLSA 1YEEH 2YNKA 1OGAA 4FL4C 3ZL2A 4A7QA 3MJ6A 2AJUL 3LRLA 3AY2A 1WWAX 3GSQA 4OCLC 4LE8A 4JFDE 1S6NA 4E5XG 4DEPB 5MI0C 5TK4A 2CNZA 3HAEH 3QO1A 4Y4FC 4GW5A 1X4XA 5E8PB 2Z31D 3HPJA 4B9ZA 3QO1B 2Q76B 5B7MA 5FC9A 2A6KB 5E99H 1BD2A 4M7KL 4EI5D 1A66A 2PYED 2P47B 1I9EA 3ZDXF 3HJ0A 4H8HA 4ZNEE 2N0MA 1M7IB 4KUCF 5CCKL 5ICZA 1MW3A 5C0IA 1ZWIB 4GAGH 4EIUA 1RZIB 4ZMLA 5HYSA 4MHHI 2FYYA 2Q7YB 4TUJB 2YQ3A 5D1ZB 5CJ5A 3W82A 2G9KA 3KL5A 4RFOL 4LGPB 3DJTA 4PV8B 3IDUA 5D70H 1KB5B 3BGFC 2YSSA 3DYPA 4ONHB 2R2HA 2VDNB 4FGMA 4TQPA 1NUFA 2VZSA 4NENB 3VFWB 3EGSA 2G3MA 3LEVH 1A2YA 3G6JA 4UZSA 3QIUC 2QLVB 3ZK0A 2QQLL 2WXFA 3PQYB 2E47A 4B27A 5CBAA 4WWID 5ERWB 5D1QB 5DA4A 4G9DA 2AHIA 1FIGH 2AVFA 2FEDD 1S7QA 5CCHE 5CS7A 4KJWC 4HWEH 1MHPH 4UNVA 5IM7A 5EN3A 4JO5A 1SHWA 4C4KT 4N0UA 5F44A 1SVZA 2VZUA 4DH2A 4LP5A 4RGOH 4G83A 1Z3RA 5CEZD 3QZBA 4P2CG 2GW5A 1I9IH 3B6SB 4LAQL 3DHMA 4UDUA 2BINA 5GSRB 1B88A 5B66O 4XCNA 3V4PH 5I19H 4WIQA 5GS2H 1EAPA 2IWGA 4O2FA 1SMAA 1VZGA 2VIRA 5GS3A 3TO2A 1BMZA 3TA4D 2XA8H 3IGAB 4JMNA 4OAWA 3FRUA 4YZFE 1B4RA 3V55A 4NC2B 4AUJA 5F6IC 4NSKA 1N5AB 2ZCHL 4FFTA 4JANB 2CO1A 3E6HB 1BHGA 1OT4A 3LS5L 5G38A 4ZUTB 2VDKL 3LZLA 1AE6H 2BP0B 3I50L 1J5OH 4IBUA 5IIEA 2HA1A 3GO1H 2NCEA 3JV5A 3LNIA 4FLHA 3OD3A 3B8YA 5IHZB 5TGBA 3QWRA 3TFKC 3GP6A 1FGNH 4V1DD 3O45B 4LARH 4E41A 4J3BA 3VXUB 1H5BB 4LSFA 1Z9SB 1ZIAA 2ZCZA 3FU9A 1UATA 3L1GA 1Y6KR 5AW3B 3GKWH 3NP4A 5JO5B 4H44C 4NHUA 5JPMC 1S7TB 3FTGA 1K72A 3AA0B 5IB5B 4UTAA 1KN4H 1GYWA 1IEAA 3OGCA 2ZP9A 5L9DH 5FYLL 5LXGL 5SX5H 3E1ZA 5IG7A 5B38G 1FZJB 1RUQL 3BEWA 3LRHA 1JRHL 2OJ1A 2OJEA 2ZWSA 2IBZX 4MJIB 1MQKH 3MA7B 5C1MB 4UNIA 1RD6A 4YHIB 1FDLL 1GGIL 1SN2A 3DETC 4FQXA 2DD8H 3OF6D 3EJSA 1HTYA 5CJXC 2MCPH 1U93A 3BAIA 3SJVD 2ZJSL 3QJSB 1Y18B 2MKWA 3MHZA 4WHTB 5J7CC 3EJCA 4IRZA 3FF7A 2BH0A 2XPGB 1XGQA 3T0EC 1QI5A 4KTEH 5LKNA 3N85L 3QP3A 4PRID 3U4BL 3PAUA 1KY6A 2BNQE 4RLDA 4EN3D 5I1IH 3OKYA 4HIHA 3GRWA 4YBLC 4WI9A 5AAWC 3MRRA 4XAKD 5DEZA 5AAMC 3EBAA 3RTLA 1PY9A 5TE4L 3RZWA 1DFBL 4UDTB 4BRVA 3D87B 2N0KA 4LSDA 3NA9H 4CC0A 1D7CA 4RETB 1H3VA 1BAGA 4J3WA 4WWKC 4LVHC 4ZUSA 5BW7A 3K6FA 2K1MA 3DIFA 5E9NA 4HWBA 3R7QA 2WO2B 5IJCC 3HZKA 4PU2A 5IK3A 1SXCA 1CVRA 2CUHA 1JOIA 1F4XH 4UM9D 4DP7X 3UEZA 2CA4A 1FO0A 5AW8B 1NWPA 1XZ0A 5I74B 3BPCB 5KBNC 1DL7L 4AENB 2MTAA 2AQ2A 1H8SA 1F90L 4N2EA 1KCVL 3HNTH 1E42A 4G8IB 5EU7C 4FXGC 1U8KA 1KBBA 1A4CA 2ZOOA 4LLVB 4TKWA 4UWQB 4DZBA 1LLAA 1Y0LA 5J9PB 3VWJA 2COQA 4MWFB 4TVPL 1BQHA 5EDSA 3FPXA 5L2KD 4JFFE 2F1TA 4X6CA 4H25A 1KIRB 1DL7H 3BZDA 4OW6A 2WBXA 2C1PB 4RFEB 1MWOA 4HQQL 1J8HE 1MLCA 4R0LC 3FT4B 1RMFH 4GQ9L 2IADA 4YSPA 3IAGC 4NRZA 4RMTA 2BC4B 3PAVA 3UG5A 1IZJA 1FYTB 2F54D 1R3KA 4MD0A 4ZI8A 4C56A 4JKKA 5DR5H 3QUGA 2GE4A 1N0XL 5CUSH 2CBPA 4C58B 5F0JB 4YHKH 3NJFA 2HJFB 2MEJB 1KTDA 1TF4A 1P6WA 2PP9A 2P43B 2KT6A 3F7VA 4JY6A 4UINH 2WZPD 3UPAA 3P30H 4YHML 5B22A 4JZJB 4P99A 4TVPE 2GIMA 4I2XA 2YPKB 5FGCB 4KI5E 4MQTB 4EQ3A 1ADQH 4ERSL 4TVPD 1U58A 5DLMH 4BSWA 2DTMH 2NY5L 3HMXL 4PJHE 2J12B 3U2SA 4A2GA 4HOZA 5I6KA 1DUZB 4XZ4A 4KVPA 1AZZC 2OR9H 4JFWA 5GJTL 4NJAH 2F53A 5ABZA 5KS9B 1IBHA 1T2QH 4O49A 5D2NA 1GRWA 2V5SA 2XSKA 2ZWNA 2OKMA 3OC8A 5I17A 2ADFH 3NJJA 1ACXA 2NT0A 4E41D 3THML 5CAYB 4L8DA 2IALA 3FO9B 3GUFA 3DPDA 2CCLA 3HFMH 2FLMA 4X9BA 1RPUA 1HSAA 4I0CC 3MGTB 2CKBL 4FKHA 1GCYA 4P2YA 4F7TA 2P4AB 1OPGH 4URTB 3KWWA 1QJPA 2Q2LA 2JKJA 4M43L 5AZ2H 4DN4L 4Z7OF 4G42B 4OFDA 1MVUA 5DEFB 5AG8A 2CLVA 1UXMA 2JB5L 5E6IC 2BSED 4HWEL 4CDGC 4Y5VC 4PR5A 1FIGL 2R2BB 4IGBB 3RNQB 3INUL 2O61A 5C6PB 3UYOD 4LB8A 2ATKA 5JIHA 3W9EA 3WYRA 1H5BC 2EDQA 4OM0H 1AR1C 3BLBA 1D5ZA 1G9ML 4DOHB 4APQC 1DVTA 1V5JA 4QHMA 1O6SB 3V6FA 1V55B 4NQCD 4HUUA 4D2NA 1F13A 1EAOA 2QZ5A 4J4PC 4XO4A 1UWGL 3S3JA 5L6YH 5CGTA 1QLFA 4O58L 4W9CC 2K0RA 1SHSA 2CHDA 5T5NF 5F1NB 2BSTB 3M1CA 3RDTB 4V33A 3CX5J 4QRFA 1FL5A 1MPFA 2Y3NA 4PGEB 4M56A 4ABQA 3K71A 3M17A 1Z32X 1KBWA 3VFSB 4EQ2A 4PP2A 1U8OA 1H3GA 3MV7A 4LEXH 3H2WA 1RSFA 2WVUA 3OSKA 2GQHA 3B9DA 2EILB 4PJ8C 3CCHA 4U6YB 5EA0L 3RRQA 3RZCD 5ADXK 3NSYA 5T1JA 4HEMA 1G1CA 3PXHA 4LSUH 4M9PA 3ZE2F 2YAOA 1MWAB 4LDOB 1ZHKA 2W94A 1PSKH 2WJ7A 2E86A 5ALCH 2E9GA 3FAXA 3K7UA 2L7QA 4JRYB 4IEFB 3IMRA 5DD5H 5DURD 2DMBA 1PY4A 3AITA 4YXLH 2WIIB 2PPCA 5A1AA 2HVJB 4PJAF 4F7EB 3NIFB 4PB9L 1LP9B 4NPYA 5DQJA 4NQEE 2LGNA 5DJCA 4I9WD 5MP6H 1JDCA 5J3HC 1NDMA 3DV6A 3E8VA 1UEYA 1U95A 2D4DA 3OKEA 4XP4L 4FFYA 4NWTH 5SWZA 1CICA 5F7BA 4K4KA 1PZSA 3S5ZA 3HE6C 4FMSA 2NUTB 4B5ZA 2QHRL 4LKXB 1M2VA 1MQKL 3VXSB 3NN8A 3U82B 1YUHA 3MV7E 4UMGA 1DCLA 4CU6A 3L9RB 5D5MF 1HYSD 2PTTB 4NAJA 3RWFB 4UTBH 3T4AC 3BPLC 5CNHA 1I8IA 5FK9B 1AOZA 2A9BA 1A7BA 4RAHA 5DZLA 4J3OH 3LKSA 1IFGA 3WUWB 4JFZL 2DLGA 3IMTA 1HL9A 1HH9A 1MAMH 1QFPA 2GBTA 4U7SA 2EE9A 3RBSA 1S3RA 4MQ7A 5HYQB 3WFEL 4YHOH 1NOLA 2YMOA 3QXVA 4TULH 3BKYH 3N3EA 5L4IA 3PAZA 5HHQB 3EYSL 1TITA 4XO9A 5D4IA 4LOEA 4OTXL 2V3DA 4ISVA 2H6PB 1FN4A 3TESA 3S5LA 2XZAH 2VDOB 4TNWF 4F8LA 3RVWC 4NM8H 5IGXL 4F93B 3HZMB 4MCNA 4W9HC 5LBSL 2RBLA 3CN1A 2WB7A 2EO9A 1P9MA 3QUMB 5FA3B 4M6NL 3VG9B 1QBBA 3H42L 4R96B 3M7FB 1Q0YH 1QNIA 2J6WA 4Y4HC 5ESAA 2Y22A 2VABA 5DJXB 4QGTA 3ECQA 4E9SA 3GZQA 5CWSB 1V10A 3RX5A 2QADC 5AKSA 3BWUF 5KVFE 4H8PA 4IS6B 4G9FB 1FVEB 2IANB 2HG5B 2F08A 2CLRA 1RUAH 4FQHB 3VFTA 3MCYA 5ABDE 5KOMC 4AM0B 5CFHA 2BSSA 2KBGA 1CCZA 2G2RB 4EDXB 2VMEA 3SIKA 3HG1E 4PRAA 3ULVE 2I07A 4HFWA 4TLSA 2AEPL 4MHHG 2BZ7A 2FIRT 3CHQA 2XWJB 4I0PA 5DF0A 1NEZG 4AM0Q 3NMEA 4BH7A 5IHWA 4NO0A 5JIQA 5JMOC 3D50A 4QY8A 4B0MB 2WQXA 3NN8B 4ZFOB 1JYVA 3A6BL 3MCKB 3IN2A 4GW1B 5HGAB 1MI5B 1NOFA 2R83A 4JM2B 5KVGE 3OZLA 3PGFH 3K0WA 1QRNB 4G70B 3GNML 5HDOA 2FK9A 1TQCB 2YD8A 5TQ0L 2GPZA 3AA7B 4IRZH 4Q9BA 4JY4B 4PLJD 3WE1A 4S2SA 3QYMA 4XPTH 4L0YA 4ELMA 1YA5A 1OP5H 3MLZL 3H3PH 2WKOF 4NCC1 1T1XA 3GRWH 2LVEA 4MB1A 4AKOA 5IR1A 5D6DC 2VC2B 1DJYA 1EJ6A 1NL0L 2XQ0A 5C9KA 2OSWA 5E2VH 4DW2H 2YBRB 3DTDA 2X0VA 2XTQA 1RFDL 3CVHL 3DBXB 3KWVA 3LQZA 1YAZA 2JB6A 4WI3A 5LB1A 1LHZA 1J5HA 1UM4H 4JHUA 4HV8A 4BZ2H 4XVOA 2NY5C 3LXUX 3EJZC 4FXTA 4Y4KB 3WS6A 3O8XA 4X99A 3BAKA 3EO1B 3NG5A 4AIEA 4F92B 3BIAX 2HWZH 1AQ8A 3UTZA 2LE9A 3OZ9L 5CD3A 2OSLB 4HIJA 5LAPA 5KYXA 2WMPB 1FH5L 4JL1A 1CLCA 4WLCA 1MKFA 2Z0BA 3WCYA 1TETH 4F33A 1IAMA 2ORBH 1QABA 2W07A 1WISA 1KELL 3MLRL 3IFNL 4G1MB 1SXNA 5D8JH 2E4TA 5FS5A 4NWUH 3GXTA 5HYJE 3W0WE 4AW7A 1NBVH 4X4YB 4DPBX 4M7LH 4UT7L 1WF5A 2GC7C 4NNPH 4P2AA 2PWGA 2PNDA 4KHXH 4PVLA 4XI5D 3VFTB 2FQEA 3APDA 3W9EB 2Z8WC 5HD8D 3CFCL 3VMPA 1S9VB 2XLLA 1AAJA 1OW0C 3OGOE 1WVZA 4IGBA 4JE4B 1S9YB 3QDGD 1I7TB 4KROD 5JW4M 2OSYA 3S2AA 4JKMA 2IJ0C 5BV7C 3MRPA 3P0GB 1T04B 1BXXA 3DETD 1YECH 1A7QL 2OMZA 3ETSA 4DP4X 4NC1C 3MU3A 3CLFL 5T8IA 5TQ2L 3V4VH 1A1NA 1OTTC 1U2CA 1TJHH 5F9AC 1N12A 1QLRA 4L8DB 5IQ7L 4HUKB 4D0BB 3UFIA 4HUMB 4ZAKB 5JXED 1ZHWA 1SVCP 1JTOA 3O4OC 1OOWA 4LCYA 1KPRB 3IDYC 1CK0H 5EU7E 2IV8A 3MFFA 3SJVA 1XD1A 1COBA 2DWEB 3PJNA 2XWXA 4S11A 2ZKWA 4G9FA 3QUXA 4P2OC 5GGQL 3U2SB 2H1PL 2FSEA 5F21B 1KT2A 1HEJC 1U58B 3BUQA 2PPDA 2HZHA 1T22A 3DRQA 4NZDA 5T3XE 3N44F 2KHAA 1OCRB 3M8OH 1UFGA 5ISZD 1DBJH 3CMGA 3KEDA 4U1KA 4E9TA 1FFPB 3RFZB 2MCMA 4YLBA 1Z9OA 4Z3IA 3HZYB 4FEMA 1G7JB 2QGDA 4P4KD 3EYVB 1GS8A 2V9TA 4N22A 1RVFH 5C09B 1UD2A 4ZFGL 3RHWF 4AVHA 4UQAA 3ZT6A 4ODXA 5ICYB 1T04A 3QAZC 5I5RA 1R3KB 1AMYA 4X6CE 4WEBH 3CZFB 2AV1A 2YR3A 2ZJSH 4AC2A 1XF4A 4OZHB 4QIRA 4BHUA 1E2WA 3UJJL 4MNGB 4GB9A 3JQOB 2BWIA 4KX7A 3GS0A 4KPHH 2PCYA 1A14H 1WC7B 2DD8L 4MWFA 1HXYA 5K9OB 3VWJB 1FPTH 2V4LA 4NP4L 3B2UC 2VXVL 3AQYA 3SDDB 3BVTA 1I8IB 4WO0A 1KYAA 4IU2A 4NI6A 1Q9KA 1AJ7H 1II4E 1AIFB 4IRSB 3RB5A 3N41F 1W6LA 3ARDD 1T6BX 3HI5H 3GM0A 4JDTH 3DROA 4KQ3L 1JZJA 4L29B 4XNYH 5FYLH 5DRNB 1TNMA 2Z93B 3QPKA 1OWRM 5AW6B 4CMHB 4OD3H 3D69B 1OSZB 5J1AA 1G5AA 3KW7A 5DGQA 5SWZB 3D09A 4WI2A 4MJ6A 4V2CB 4YZWA 3TZGA 3EGXB 4WJG3 1G0YR 1Q0YL 1W0VB 3KNBB 5E8NB 4JKPH 1GZPB 2HLFD 2IG2H 3T0EA 1FG2B 3U7WL 2VKWA 3RQ3A 4PGEA 1L4IA 1FZKB 4M48H 2JB6B 1QPPA 5D6CA 5LAXA 1ITBB 1MRCH 4MMYA 3RGVC 2UY6A 3H0TB 4WW1A 2P7TA 3H7LA 4D8PB 3OHXC 2WQ8A 5B39B 3TCTA 3ZGIA 1HCVA 1QZ1A 2H0JA 3LVTA 1E8YA 2ZSVA 2MNHA 5I76A 5I0WA 2GK2A 9PCYA 3U4EB 4Z5RA 3SGJA 2A73A 4JS7A 2V37A 5BJTB 3C9NA 4NQSA 5FXCH 1NLBL 4Q6KA 4CGTA 1KG0B 1N0XH 5AVQB 4KX8A 4BKLA 2E7BA 1ED3B 1AHKA 5LGKA 4L48A 4EZMA 2IQAB 5I1JL 4DGWC 2ZNWA 4GUPB 4LVOC 3WI5A 1Z9PA 4PUXA 4F8QA 3N0AA 4LF3A 1JXKA 1FPTL 1A64A 1C1EH 1FYTE 1WEJH 3KMDA 4C8XA 1SEBB 2FYVA 3E0GA 3NSFA 4Y2OA 5IROC 5ESQB 5I17B 3VY8X 2BY3A 2BSSB 2X2JA 3OVUB 2WLJA 3ULSB 4ENEC 1CLYL 1HSBB 1G6RH 2DWTA 2Z31C 3WG7B 1SYSB 2E76C 2FL5B 1WITA 4MJ4A 1OPGL 3S5YA 4AIZB 1BT9A 1RFDH 3CVHH 1SXBA 1YEKH 4W9KC 1PX3A 5C6TL 1T0PB 1JBJA 1OAYL 3PDOB 1RZ7H 1OO2A 2D3JA 5I0DA 1URLA 1UM5H 5TF1H 2CHWA 1S9XB 2E0PA 4XNBA 4APXA 4KITB 4UT6A 3ML8A 5IBLC 2IANE 5J6GB 1B2WL 3NSJA 4PJXA 4IBWA 4M7KH 4Z7QE 2VSMB 5GZOA 3SODB 4E42A 3UAJC 3ARFA 5C0NC 4X5LA 4WO4A 4Y5YC 5KSUB 1O7SA 2A6DB 4HWUA 2F1CX 5LVEA 1MPAL 5IKCA 1IBGH 2NY2B 4J28A 1AO7A 4ZPVB 4RSYA 1JDAA 3QC5X 2VL4A 5HY9B 1MRFH 2YGVA 2XTJB 5D2LE 8CGTA 4O58H 4YDJA 5E9DA 1C16A 3GKZA 2QR0A 2HUHA 3VXUE 1H9VA 1ZTXL 2AJZB 1DSYA 1BVKA 3DX8B 1CTMA 5HHPA 3I6SA 1GSKA 4Y8AA 1XF4B 3MX0B 5FYJD 4JN2B 4X6DE 1A7QH 2I60L 1X5JA 4GG8B 4I48B 4Z7NF 1PZAA 5D96B 2QSQA 3F58L 5I71C 5E4EC 1P5VA 4J3VA 4Y4KD 5L9DL 3S4SB 3LNDA 4M43H 1TJMA 3WI9A 4WUKL 4DVRL 1WHPA 5G2NA 1DQJA 2XRAL 2BNUB 2ROYA 4ZYKB 4OZHE 1H15B 2RCSL 1LDPL 3CHOA 2WWKT 2CKNA 2B9AA 2HG0A 2V2WA 3MSPA 4H1LH 4LLDB 4QXUL 1DSFL 1GC1C 3VGAC 4O51A 3QRGH 3B9KA 1RK7A 5AQ0A 3UJIH 2VL5B 3VFUB 3RUGB 2CUAA 3GBMH 3D06A 2WQWA 1KIUA 3EDEA 5E8PA 1BMGA 2VE6A 3GMNB 3KH3A 3VXNB 5C71A 4TNVF 3FQ1A 4ENZA 2BHUA 3ZZQA 4UILL 4UM8B 8FABA 2AEQH 4ELDA 4O3YA 1A9BB 1AXTL 3G5ZA 1ASOA 4N85A 3Q1SH 1ERNA 3GMLA 5FLVA 2KL6A 5D96C 3WTXA 2M07A 2BSEA 2DQDH 4HCFA 5BRZE 3ARGB 3IXTB 2FEEL 4PP2B 2PTUA 2EUWA 2OM5A 1IM9A 4KQ0A 1KDIA 2MOQA 3DWNA 3L6FA 5KJRH 1FAIL 1DQTA 1TVHB 1LE9B 2QHRH 2QDWA 1F41A 5DFWH 1BXAA 1RZQA 1JK8A 2FAUA 5D7EA 4AYID 5HVWA 1XX9C 2UUDH 4MNQE 1KCLA 1S7XA 1IVTA 3LCYA 5TPWH 4L4JA 1RIHH 1EO5A 4KV5E 1DBJL 1JGDB 3OKLA 1DDHB 2OI9C 3QUKB 5FF6B 4FADA 5L4JA 4OUUB 2D9QB 1F2QA 2F6AA 3POXA 4UZGA 4ZO7A 2DYRB 3ABKB 4PR5B 4LHUB 2JMRA 5K1VA 4QT5B 2Y4SA 5B1JC 2NY3C 3L2MA 4LKCA 2NCMA 5ACZA 2WXJA 1U8JB 2LTQB 3BZEB 2IO5A 4G71B 5EULV 2XNAB 1O9WA 1JFHA 4BKSC 1YEGL 2FO4A 2P5EE 4GINA 1JFQH 2EABA 4R5TA 4HIPA 3I6KA 4X6DF 2PXYC 4ZDHA 1RUAL 1UUSA 4HWZB 4LCCC 5KW9H 3IMUA 5AD0B 2F7PA 3K19A 5DO8A 1JCVA