5T5FA

Neisseria meningitidis factor h binding protein in complex with monoclonal antibody jar5
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
226
structure length
226
Chain Sequence
b'GLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Factor H binding protein variant B24
publication title Neisseria meningitidis factor H-binding protein bound to monoclonal antibody JAR5: implications for antibody synergy.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
total genus 53
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2016-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 5t5fA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5t5fA01
4AYID 3KVDD 4O3WA 4O4UA 2Y7SA 4Z3TA 4O4XA 2YPVA 1YS5A 4AYMC 3HOEA 4O3XB 2KDYA 2W81C 5EE2A 2KC0A 4O3ZA 3PQUA 4U9CA 3V8UA 4QQ1A 3PQSA 3HOLA 3VE1A 2W80C 4AYDC 2LFUA 4AYEC 3VE2A 4AYNA 4O49A 3UAQA 5T5FA 4O3YA
chains in the Genus database with same CATH superfamily
2WZPD 1UA7A 5JDPA 1P4IH 2NNCA 5D7LB 2EINB 2PO6B 5T8IA 4BCXA 5J1AA 3NQKA 4KJWC 1DBAL 4LKCB 3W11D 3MNVA 5HHXH 1AXSA 4D7BA 3FQWB 5AEAA 1F2QA 4JQXA 3DKHA 4NQCE 4QRTA 5F21B 4CKVX 5IB5B 3L3KB 1NIBA 4YMPA 5CBAB 4MD0A 4OZHB 2GUOA 4WTXA 3R18A 3I6SA 2XVLA 1UZGA 2RFXA 3H2PA 3A6BL 3FYIB 1U2CA 3BSZA 1K4CA 3IKCA 1I9IL 1IM3B 4GEIA 5K59E 5TFSL 3EDEA 5D71L 2VN5A 3ZDWA 1UWXK 3VFSA 1JN6B 2OW6A 4JFDE 4P9MH 4XBEL 3VFPA 4YSRA 4OZ4A 3J7HA 2ZOOA 2WGXA 3L5XH 3FO2A 4G8FB 4KUZL 4NHCL 2X2IA 5CF3A 3HAEH 3LZQA 4FKKA 3CHXA 1MREL 2MQGA 3ASOB 3PJSB 5HHMD 4KROC 2WYZA 5KAFO 1WISA 4TSBH 1GZPA 1ZHYA 1TZAA 4G1MA 3QO0B 2WYTA 4OLVL 4FN0A 4X6CE 1UATA 1WWAX 3VFGH 3N41F 1PCSA 2OCFD 2XKSA 4JKPL 2YBRA 2VDOB 3QVAA 4YL9A 3MRLB 4ZUSB 3VWKA 3TU6A 4PJDB 5GZNA 4KO7A 4PS3A 5GGQL 3O6FA 1HL8A 1UA6H 5BJTA 1AYRA 2P5EE 2C7FA 3B7UX 3K8MA 1LK3L 2G4GA 1KULA 2NY4D 1A3RH 1JHKH 2F1CX 1JUFA 2VC2L 3ZL4H 2X70B 1QFWL 3BAKA 3KCPA 4UM9A 3U7YH 2PUQT 5KBKA 1DVZA 5T3XL 3BPOC 1JZHA 1PLAA 3HG0A 4ANKA 1RLWA 5AB1A 2IANE 4PJEF 1FZJA 2OMXA 3L4YA 2KLRA 3H2QA 1R4XA 3BZEB 1AGDB 3D4ZA 3NEEA 1A47A 3QEQB 2AXGA 3BWUF 4WFHD 3VXUE 5IVZA 3BJ91 3O0EA 1ADQH 4NO2A 2B4CH 1U58A 1QJPA 2FH8A 1C5CH 1YUKB 4JN1L 2C7UB 2E0PA 4J6IA 4B9IA 2UUDH 5ADOL 2AEPL 3TYFB 1F97A 2NUTB 4PJBF 3CFUA 5EU3A 1FWXA 3RVWD 5AW1B 1T0NA 1ZLSH 3DHUA 4P48A 2NUPA 3GPSA 4BZYA 3KD4A 2YPLB 4M8RA 4HH9B 4EXKA 1A7OH 5KVDE 1A1MA 3QR2A 2P5WE 3UJTH 2J6EA 1N64H 1U3HC 2MKWA 4WJ5A 5A2LH 4KMQA 4LHQB 4O4UA 2VITB 1CZ8H 4A39A 4LPYA 1HH6B 1H3UA 2VXUH 2DQ6A 2WCPA 4HU8A 1A8ZA 1I8KB 3D0VA 3OHXC 1CK0H 4G1EB 4C00A 4HPYL 3RDTA 4Z3IA 1LO2L 4ES9A 4ZXBA 4B27A 4F15C 4Z7VF 3HHRB 3MBXH 3FQTB 4NQSB 3BOVA 2FVNA 1ZLDA 3N9GH 4XC1L 3K71B 1AG6A 4FGMA 1U30A 4K71C 1H15A 3MODL 4ODUA 4XVTL 5H37H 3SJVA 2GHZA 2XVBA 3KVDD 2GFBB 4POZD 3ZDXE 2PR9A 7PAZA 5BS0B 3ZO9A 2B1HL 2Y6SC 3VAEA 3MLSH 3DOSB 5B1BB 1MCBA 3RWJB 4OD1L 4LEXL 4J5VA 3MV7D 1BZ7B 1IT9H 4FOZA 1PS3A 1TTAA 4GCQA 3L7FB 4MSWB 4WAFA 1KZQA 3OKYA 4PRID 4UQ9A 5CP7A 4Y5YA 3PABB 5HGHA 4FG6D 5MERB 2NY0D 1YEHH 1AO7E 3HLAA 4XTRC 3H3BC 2V5YA 5T1JA 5IK3B 2R1WA 3I6KB 3MRMA 1E9PA 3MMEB 1B4TA 4AIOA 1GKOA 3Q2LA 3MLPA 3MV9D 3E6HB 4QMEA 4PRNB 3KXFA 5I6MA 3V52L 4AYFB 3E9UA 3EJYC 1YEWA 1UH2A 3WTSA 5C0AA 4XVOA 1OAQL 1ZV2A 1OGAE 2CR0A 2F1EA 3DYOA 5TE4L 5I15H 1ES0B 4GSDL 2HT3C 2G2NA 4WI6A 3BVXA 5LN4A 3I02A 3M6DA 1VZIA 4CMMB 3CVHA 1WEJL 3NMEA 1MCNA 2CM6A 1HSAA 2W07B 5FX3A 3T2NH 1V27A 4JO2L 4OIBA 3OMZA 4EEEA 3VD9A 2F6AA 3QNZA 2R0ZL 5ESAA 5KAIO 4F9PA 3PPEA 3K3QA 2RB8A 2BFVL 5I17A 3CFIC 4X8JA 3QZNA 5BUPA 5GGRY 2MCMA 5FYKE 1XZ0B 5D1QC 3L9BA 3RKDD 4KNQA 3CBRA 3L3IB 1A2YA 1OZUA 4CDGC 3SYCA 4DO6A 3MNWB 2Q6WA 3SYSA 3S35X 1OHZA 1FFTB 3EFFA 1E4WL 3SQOH 1AGBB 5ISZE 2H6PA 3RNQB 2A83B 3AAZA 3M88A 4GW5B 3ZTJH 3GI9L 3HPJA 5BZDA 5EU6D 4POUB 4KFZC 4ZW8A 5DYFA 1KJ3L 4KTDL 2AGJL 2FJSA 2R4RL 1KBKA 3FONB 1ZAGA 3ROOB 3DSFL 1LYQA 3JV0A 4KK9C 4O2EA 4YX2H 5GSVB 6FABL 3HE6A 4V1DA 3GPEA 2O5XH 1UG9A 3SGDH 4YVUA 2BNRD 5EU4A 3RZCD 2DICA 3ZHDA 4ZFOB 4KZCA 1ORMA 3KPSE 4HUKB 32C2B 5FR3A 3TJHC 4XBPA 4UYPA 4WV1A 4TVSa 2LQRA 4BH7A 3MRQB 5FUCC 4M02A 1HXMA 1AQDA 3HPLB 5DHVA 1NPUA 3WNJA 1ZT1A 2H1LM 3D0LB 5EFIA 4AQ1A 4OZHF 4R0LC 4OV5B 4MJIA 1A6VH 5FXCH 2EICA 3VFVA 5FF6B 1MZYA 4XCEB 1KG0A 4XN1A 3RWDA 3ATDA 2ZXDA 3QUXB 3MRKB 3V5HB 3CE1A 5DURB 3P0VL 4Y7MA 1GGTA 2MTAA 3OPUA 1S5LO 1DUYB 3OXRB 4LP5A 1O0VA 1HHGA 2HRPH 3D4CA 1T66C 4G83A 1DSWA 2FTAA 1H6S1 3S36L 4BK5C 3CH1B 4IIZA 1M3JA 2Y3NA 4J3SA 4R4ND 3ZN6A 5HPMA 5I76A 1BJMA 1NGWB 5DD5L 3CXDH 3BZDA 1R6VA 4EI0A 1OAXL 3QG7L 1SYVA 3HRZC 4M1CD 4Y1TA 2VDLL 3QFJA 2EDXA 1WS8A 5DD6A 4I77L 5DQDL 4KRPB 1B0IA 1CXKA 5F0LB 3K6OA 1RZKL 4H20L 1TO5A 4PJDF 4NKDA 1ZGLP 2YAEA 4GSUA 3ARXA 1A21A 4UT6A 3B37A 4N3TA 1EAPB 4JO3L 1IGFL 5C09D 1CE6B 3D9AH 3K6FA 5DFWH 4NJ9L 3SE9H 4YSUA 3NJLA 2Y06H 1T5XB 5DHYA 3ILPB 3D12B 2HTKC 4Z0XB 5ITBL 2Q1EA 2XN9D 5D93C 4PP2A 4F7EA 4FC3E 1KEML 1IBGL 3L2LA 2CLRB 2JKLA 3OLEA 1DLHA 5CJBA 4WUKL 3LB6D 4OR1A 3MA7A 2YEQA 3MU3A 2NX5B 3OG4B 3WHE0 4L8DA 4YK4C 1G7IA 1TSRA 4P23B 2NY1C 2DIEA 4PJHF 4AEHL 5A3ID 2LVCA 5F7DB 3B56A 3K74B 4Y4HA 3O3DA 4N0UA 2OQJA 1BQKA 2WP3O 4IRJC 2NY6B 2UUDK 2IWVA 4PJ5A 2GIYA 4BFIB 3WTXA 1OWRM 1T1XB 5DQ9A 3U4BH 5GSRA 4F93B 4JM4L 4HJ0D 5K9QG 1MXDA 3AA1A 4JVPA 4ZTOH 4JG5A 1U93B 1U8OA 4LMQI 3BRFA 4MMXC 4OF3A 3N40F 2Y0SA 3N2JA 4OLUH 2EC8A 2MJWA 2F1BA 3O45A 4LSVL 4RESB 4BK8A 3Q8FA 5F72S 1LP9B 2VXQL 4FADA 1HQ4A 4GG6E 3ECBB 2E4FA 2YUXA 4XPGL 4ZPTB 4OCSH 1NL0L 4U3XA 1TVBB 4BZ2L 1OTSC 1F86A 1ZA6A 4Y19A 1MCQA 4NS0A 4HWBL 4E9SA 5E24E 1ZGLA 4IMKA 3ESOA 4XCFL 3OKNA 2JB6B 4BHUI 3QCUL 2CWRA 2AABH 4LSSL 4MQXC 5F9OH 2K6WA 1DQVA 1H6EA 3AUVA 1NLDL 1AGEB 3I2CH 5BVPL 4HKJA 1OARL 2HCZX 4J3VA 4UZUA 4KXBA 5E4IA 5FHAH 3TNMB 4YSOA 5BOZG 4PWJA 1AZVA 5KOMC 4MB3A 3DJZA 4U3SB 2J4WL 1OD7A 2IXQB 4XWOC 1MFUA 3FO9B 1JPFA 1XWVA 5DVPA 2J88H 5DGQA 5E7BA 3LKSB 5E8OA 1EO8L 1NGPL 4ODTH 2DYPB 2VIRB 5C0CD 4X50A 2FO4B 4QRQA 3EJUA 3H6JA 4HX1B 3EMNX 3DVGB 1Q0XH 4CC4A 1GYAA 4MCZB 1HWHB 2ZNWA 3KLLA 1GOFA 4FP8H 4GO6B 5AALA 5SWZD 5FM5O 3U0TA 3T0EC 3CX5J 3QDME 1MDAA 4C47A 4NQQA 3WEAA 2NYYD 3UAFA 4TUJA 5FGCB 2ZUTA 3IS0X 4KXZH 5IB2B 1XF3B 4B9YA 5A2CA 1OB0A 4XNMB 4BKTC 2ZCHH 5F88A 3F7PC 4WTWA 3EXLA 4LRIA 5GGSA 1K4DA 3B2PA 4CW1A 1UHVA 2XWJA 2GT9B 3KGUA 2YC1B 4RGNE 4HJJH 1VKXB 3BIKA 4FOMA 5DJDB 5E2TL 5HDQL 1TPXB 4OCXH 3KWWB 4N9GB 5BRZB 4DKFL 1Y6KR 3SGDI 4OJFH 2YRPA 2C3VA 1MW0A 3GRBA 3UBXG 1S7XB 3ET9F 1EXUA 4LMQE 2E7BA 2VXVH 1XTLA 1Y6NR 2DI7A 4N8UA 2FJHB 5F70A 4ZFQA 5I1AB 3T77A 5IQ7H 1TEYA 2BM3A 1Z6JT 3UX9B 1GFPA 5D6DA 2GITB 5C9KA 1A6AB 4G72B 3NIDE 1CD1A 1U91B 1CFTB 4NFDA 4RRPG 3T71A 2DQUH 2AI0L 1DQMH 4PRPB 1PZAA 3KPPB 4AKMA 1LMIA 5KW9H 1ZJAA 4QRRD 5DFTA 1UT1A 3SYAA 5A6IA 3LEXA 2JJWA 3KLQA 3OZ9L 1F8TL 3D33A 3TO4D 2NQCA 4N68A 3EZJB 1JGUH 1ZVYA 3QDGD 4JREB 3TFKD 4CADA 3M1BA 4DK3A 3SCMD 4OTXH 3VFNA 3UJJH 5I1DA 1MOEA 1DANT 3BFOA 4M7LL 2Y2YA 3DO7B 5KVDL 3PQYB 3CLFL 5FC9A 4K3JL 3DX7B 1FPTL 3P69A 4PCKA 3ZL2A 1VFAA 1T83A 1QZ1A 4JL2A 1B88A 4ZQKA 3AQDA 3NT0A 1KB5H 2YQ3A 5B1JC 4F57L 1SXCA 4PJGF 4B9ZA 3H42H 4ZW7A 4XPFH 2ROXA 3L4UA 4H40A 3W5NA 2X88A 2AANA 5EF2A 5HI5C 1MIEL 1TOXA 2E86A 1EDHA 5MENA 1UWFA 4M4RA 4NQEA 1W0WA 1MJJB 3C8DA 1D5ZB 5EN2A 4NUGH 1JNLH 3CZUB 4LO9A 5GS0H 2VMFA 4BINA 1PEWA 5LCVL 1JFHA 1OAUH 2CO1A 2R29H 4MNQD 4TL4A 3ASNB 2X6AA 3F12A 3NVQA 2VJXA 1BWWA 5IW1A 3EYUL 3MRBA 2CLZA 4FDWA 4JJ5A 1EUUA 2CALA 3QIUD 3NTCL 5A2JH 2KZ1B 4FRTA 1LD9A 1VPOH 4ZTPH 3UAEA 4MB4A 4Y89A 2HSIA 3FPYA 5E2VH 4FYQA 4DZ8A 3JT0A 5LWYH 1Q0EA 3IDGA 1IQWH 1IAIL 3HB3C 1ZVSB 3ULVC 3NIFB 5L8LB 4GBXB 3VFTA 1PW3A 2FATH 5AYUL 3EXJA 3MA9H 3ZYOA 3RQ3A 3O11A 1U92B 1BSIA 4D7PA 2Z92A 5MI0B 4AIEA 4N28A 4N87A 3MUUA 1HWGB 1YEKL 4UDUB 1KGXA 3R4DA 4Z7UE 1YPZB 4ZX4A 2BSBA 2J6WA 2PPAA 4FI8A 1OGAB 4K8RH 3CCHA 2A6KB 1ZPUA 2ZP8A 4YO0A 4PHZA 1HHJA 4E41B 3DWNA 3NFSL 1G9NC 1JGVH 3FUJA 2XRAH 4G6FD 1RVFH 1CTNA 5C07D 1D5BB 1CT8A 4UQ3A 1G7QA 3LZPA 5A6LA 1P7HL 2W65B 5JHBA 2VQ4A 4B3VA 2GSIA 4LHUG 4KQ4L 5EZPA 1NC2D 4FQPA 2OCCB 1J9CT 3A4AA 3ECUA 1GCFA 1NBYB 3LD8C 2P8LA 3ARZA 4BZ2A 4KITB 4P9HH 2YD7A 5FYKL 3RVXD 3MJ6A 4OUUB 4GRLA 2X09A 3GRWA 3QUZB 1RZ7L 1WE5A 3OKLB 4AIXA 4NZRH 4BCZA 4Z77B 3FQRA 2HKFL 4LDEB 3NK3A 4C56A 2KDGA 3OQ3B 4HT1H 1BT9A 5IP4A 1LP9F 2OV0A 3GNMH 3MXVL 2ZSWB 3NK4A 3MROA 4ONFH 3UTTD 4AGPA 1QATA 2GSGB 1D9KB 4HLEA 1TZGL 3EGXB 3QJTB 1K8DA 4C4UA 3NP3A 5HYEA 1E4KC 3KPSB 1EWHA 2CO6A 1UACL 1YMHB 1XH3B 1NEPA 4CBPA 4M4PA 2GCYB 5EBLB 4QHNB 3O6KL 3V4PH 1YSOA 1XMEB 4OLZH 4BCYA 1F90H 1E90A 4L29B 5T1LD 3HC4L 2OZ4H 1YEIL 4LAQL 2AAVA 4PWKA 3JV4A 3BVVA 3SBQA 2HX9A 3VXOA 1C08A 3HOGA 4DKDC 3NSCA 4MXWH 4XWGH 4G6JL 4RISH 3BN9D 2IH3A 3LHAA 5HBBA 4FZEL 1XB3A 3SPJA 3P4MB 1YEFH 2Q20A 3AA6A 4QRPB 4JCLA 1I3UA 5AYTA 5GQBA 5BO1L 4JANB 4ELME 4E2OA 4WFEE 2FHFA 3BUTA 4TVPD 4X4ZA 1WBXB 4PAZA 1CUOA 1KIPA 4XMWA 2FWOA 5HD8C 5IIEA 4JGUA 3K81A 4S0TD 4ONOA 2UZYB 2ZYIA 4YHYC 1AIZA 1IKFH 3HMWH 2OSYA 1MVYA 3LVEA 3BKMH 5LDSA 5FGBA 3QGVA 4XC3L 5BV7L 1KXVC 1L0YA 1MPAL 1Z9SB 2R2CA 2W1NA 1A1OA 1BZ9A 2A9CA 2EIDA 2QJDA 2WAHA 4OFVA 2EUXA 3DK0A 4BBWA 4XPHL 1E3XA 2FLBT 3B1UA 3LQAL 5E00B 4LVHB 1CDJA 4J28A 3EDDA 4U1GB 4U6VH 3WIFB 1P4IL 2A99A 5D2NA 3OC5A 2HLEB 1FVCA 4NN5C 1SN0A 1HJCA 1TCRB 4LGSB 1XO8A 1DBBH 4HUCA 5AKTA 1G1YA 2HT4C 3BP7A 3MJ7A 1J8RA 5HHXL 3FFCD 2QFRA 5T1MB 2QHLA 4WUUD 4AFKA 5E8EB 4C54A 1YUHA 5KN5B 1L9NA 1EZVY 4FXLA 1OPFA 3TIDB 4MAUH 1MHHB 2X1XR 3HUJE 1YC7A 5BUGA 4X7CC 1WT5C 5JHDB 5I23A 4JM2C 1XCXA 4A7QA 1F1AA 1G4RA 1ZHNA 2YWYA 4KBPA 3MRDB 3G6AA 1QSVA 5H2BA 5HVHB 4LP4A 3BPLC 4P9ML 1W91A 4Y9EA 5E1GA 5TF0A 5D8JH 4ORZC 2WINA 3L5XL 5CCHE 4NT6B 3FL7A 1MRFH 1KTRL 4JRYD 4MZ2A 4R8WH 3NABH 2DWYA 4GY4A 4XMUA 2O6DA 3E80A 5AB2A 1UXSB 3CX2A 4UTCA 4TSBL 4MA8H 1HNYA 4JFFB 4N5EC 5K1NA 4A55A 4PV1C 4W9GC 3REVB 2LTQB 3VFGL 2XACC 4Y5VA 5I73C 2AJUL 3QQ9D 4GG6B 2JQMA 4MNGE 4WI4A 3LKRA 2I5YH 3G6JE 5IB4B 1LWRA 5DRXB 4P5MB 2ZCKH 3IDJB 4MMYB 1UA6L 5JW4M 1JE6A 1BYOA 3GTNA 1BG1A 2KI6A 5DO2C 3UBXB 4QYOB 2QADC 1IGJB 4X6DB 1NMAH 1S7WB 4O4XA 4JZOA 4M8QA 4QD2E 1A3RL 4DZBB 1JHKL 2BW4A 3HNVH 5EBWA 3EO9H 3EGDA 4MXQD 3IF1A 3U2JA 3ZL4L 1AY1H 5AVYB 2F8XC 3U7YL 1TVDA 1CLYH 4P46A 5HY9B 4G5ZH 2BFGA 4J3OG 4R96B 1TJHH 1WFTA 5C0ND 3IDYC 1D5XB 2N1KA 4MA1B 1G7JA 1FSKC 1TIUA 1PX8A 3FUHA 5JO5A 4AYEC 2VZTA 5A43C 1BVNT 1MHEA 3AREB 3MO1A 4QRUA 1ADQL 1ACCA 2NTFA 3LXCA 2B4CL 3Q8CA 3TJPA 3QORA 1C5CL 2VQTA 2XBZA 2DBJA 1RXLA 1XCTB 3NESA 4H2AA 1OAJA 4ZMZA 3BS0A 5TF1H 3LK41 4XXDA 2IPKB 1QYGH 1Q9WB 2Y4SA 3FO1A 2E7HA 1SQ2N 1ZLSL 3WY2A 4H25B 4JO4H 1DQDH 1EERB 3GDCA 3DXAE 4F37F 2Z7UA 5IJCC 3LKOB 5JHAA 1A7OL 1BX2A 3O3AA 2YD4A 4NDMB 3RPBA 3VGDA 3OF6D 3UJTL 2D4FA 5L4FA 1N64L 1JZEA 4AQOA 1WUNT 5C08A 5FK9B 1CZ8L 5IUSA 4B9KC 2EDOA 3H56A 2VXUL 1YPZF 2XXFA 4MAYA 4J4PC 2GJ6E 4CTDA 4X4ME 5IEKA 1CK0L 3CC5A 3MV11 1VRSA 4PSRA 4Z5RB 5EEVA 4XMVA 4TSCH 2JJVA 4O51A 1YEGH 2Z8RA 3CIAA 5HJ3B 5CJQH 5T3XD 1XQ4A 3MBXL 5D1ZC 1G6RH 2HJFA 4V33A 5EOTB 4HIPA 3N9GL 2YGPA 5C7XH 1E4XH 2G5BB 5ICYB 1K8IB 1TENA 2VR8A 2O5YH 3VW3H 1X5KA 3GRGA 4IK6A 3T20A 3S48A 1JI2A 1T7YA 1C8QA 4HULB 3MLSL 4N75A 1NGQH 4KFMA 1NCHA 4ZUVB 3QEQD 3NIDB 5CWSA 5FOBB 1FAKT 1MELA 1IT9L 1QLRA 2BDNH 2H3NA 3LKPA 5CU9A 1KXTB 1UD5A 1QSZA 3HS0B 5F93C 4JFPA 2IPUG 2VZVA 2IWFA 3NDYE 2VLLB 3TO2A 1YEHL 2RCSH 3WLBB 4NEHB 2I07B 3MNZB 4KTGA 3DIVA 4XN7A 1SMDA 3GJFA 1KLFB 5BOPA 4AG4H 2KLSA 1I1AC 2ZWSA 4D0DB 2YPLD 4I18C 2VO5A 3BEWA 3M8OH 2D7OA 4Y5XB 3DVNB 4HWZA 4DP1X 3VXSB 3LDBC 2B77A 1Q94B 1L6ZA 4GRMB 5H35A 1G87A 4H0IA 5I15L 1RSFA 2F74B 2BMKB 4OGAD 1WBZA 4KC3B 3FT0A 3IJHA 2CGYA 3L6FA 4XXCC 3WTTA 3EDFA 2JF1A 1W9XA 3T2NL 4Q9QH 3QWOA 3BAWA 1ORQA 1PZDA 1SF3A 3LX9A 3IFOB 3CSFA 5KVEH 1U0QA 5TH2B 2WLHA 1J5CA 3IRPX 5HDBB 1NCOA 1MLCA 2XYCA 1A14H 3B3IB 3MQIA 3CUPB 2EVIA 3VB9A 2VERA 4WHCA 3A22A 4K7PY 4Q6KA 1BP3B 2BSDA 3SQOL 5B3NA 3FQUB 1XIWA 4APXB 4AZ8A 2VXSH 1SHSA 4GS7C 1TCMA 2IFFH 4ELDA 5I16A 2EC9U 2PKDA 3L3OA 1TQVA 4AYDC 3TH3T 3WN5B 3DGDA 2FZ3A 2WXLA 3QUKA 4YDNA 5GGUA 2BX5A 3C5ZC 5E56A 4YN3A 1NBVH 2G60H 4I85A 3BGFC 4F8TA 3ULUC 3DMMC 1RSYA 4YX2L 5KYUB 2ROYA 3CHOA 1OGTB 2WWKO 4W9DC 4XCYA 4E9VA 2O5XL 5J56B 1I82A 3WFBH 1T2JA 3ARTA 2B0SH 3CZFB 3TZVA 4Q6IB 5I8OH 1W16A 3QJHB 1BH3A 4AYGA 2CBOA 3TBTA 2Y7OA 4P59H 2M2DA 3PJLA 4ZQTA 2VDQB 3HAEA 3HZVA 3ZDZB 5AVTB 3S3BB 3NPZB 2Q7YB 1OGSA 4LLYA 5IREA 3G04A 1A6VL 5GRUH 5HHNB 2YLHA 5F9JA 4IL6O 1PD6A 1E2WA 3RIAK 2D7MA 3PWVA 1YG9A 2CR6A 4AENA 5IT2H 4WNSA 3MYJA 4P5TA 4QHUA 4QOKE 4LSIA 3C6LA 1NCWH 3QEHB 4NFBA 1LEGA 2HRPL 2V7NB 2WLLA 1AS7A 3CU1A 4B61A 2G5RA 3QFDB 3D7PA 4JRXA 4AVJA 3AWEA 1LO0H 1T1YB 4DKTA 3ME0A 4LLWA 4JG9A 4J39A 2P44B 1L9SA 4JGJA 1VESA 3VD5A 3CXDL 3VD4A 3LPOA 4Z8FH 5DJCA 1MVFA 2Z6FA 3AT8A 3NFNB 1AD0B 1ZOXA 5KYXA 2XWEA 1T03L 5CGYD 3UG3A 3RI5F 5HVGB 1HEZA 4GG6F 4QJ3B 5J1AB 1QRNA 2VLKB 4U1KA 3MNVB 1AXSB 1A64A 2XPGA 3D09A 4J12A 1G9ML 4QI3A 2OJEA 3NBNA 4YQXH 2FEJA 4FCAA 1M05A 4QRTB 1DDHA 5KYYB 3S88H 4GPVA 4D3CH 3RVUC 2GUOB 4G8AC 4X6DF 1YYMH 3D9AL 3NJVA 1Z9MA 3WEBA 4MA3A 5A40E 1B3IA 1E5ZA 2RFXB 2R7EB 4CJ1A 4NPJA 1K4CB 2Y06L 3IKCB 3VG0H 3VXRD 1FYTE 5HYSA 3TEYA 3UH8A 3C87A 1CFNA 1FP5A 1VHPA 5M7QA 1G94A 2RMNA 4ZYKA 2NXYC 3VFPB 2VLME 2XTJB 3FO2B 4LLAA 4C59B 1BF2A 5ENWB 1S7QA 2AEWA 4BE5A 4ZO8A 3SKMA 4LQ1A 4JFVA 4HOXA 4LCUB 5AVQB 3QUXD 4G80A 4G2AA 4P2RD 3UP6A 3WENA 1GZPB 4G1MB 4GCPA 4ELMB 2BO0A 5CAYB 4R7DA 1E4XI 3RWHA 2OYPA 3ARUA 2KZ7A 2VO8A 1T2QH 2YBRB 1U95A 4WO0A 1BJ1J 2AQPA 3U4BL 1RAMA 5I0YA 2EECA 4M6OH 3O6FB 4ZTOL 2DAVA 2DMKA 3QZOA 5BJTB 1O75A 1VZHA 3H9SE 3DPDA 2X2YA 3UIYA 3NUKA 4OLUL 3MXWH 3JT2A 3SBPA 5B4MD 4WKZA 4YFLF 4KZEH 2BY0A 4LDOB 1BAWA 5HHOA 2YOAA 3IGFA 1SY6L 4M3KB 4OCSL 3KCPB 1F11B 1CL7H 5H37A 4X5RA 4UM8A 4PW4A 3TIEA 1H0DA 3WFEH 4NFCA 3DBXB 4N0RA 3AT0A 3ISYA 4GAFB 5K1JA 1FZJB 2OMXB 1S9XA 2AABL 3VDCA 2A9AA 5F9OL 2AXGB 3I2CL 1O9WA 1P7QB 3GMLA 4RSVA 1TTFA 3E7JA 1ND0A 4XH2A 2P80D 2DJSA 1BYPA 5L2KE 1RZ8A 4N86A 2JLLA 5FHAL 4YSEA 1TJGH 3WEXA 3Q2WA 3QCTH 3U7AA 2BHYA 2NX5D 3HG1E 4JHUA 5F7AA 5EU3B 3KYKL 1IARB 1AC6A 3DBSA 4B9FA 1T0NB 1YN7A 3NIDF 5IBLD 3FU6A 4BHUA 1Y1UA 3AADB 4HK0A 3X1GA 2TAAA 2J88L 1A1MB 3NPSB 1ASOA 2NY6D 4WI3A 4ODTL 3RX7A 4RX4D 3P73A 4F4BA 1QI4A 3GKZA 4WJ5B 3CD4A 5FYJE 3U7WH 5J4MA 3VFUA 3BH9B 4N2MA 1Q0XL 5GS1C 2GABA 4FP8L 3AAEA 3D0VB 3ESVF 2PW1B 1JPST 3AXIA 3Q2VA 4Q74A 1A66A 3RDTB 4YIQA 2OMYA 3BO8A 3PYCA 4ODXA 2NCEA 1WGOA 1JHLH 1R75A 2XY2A 2XV6B 4ZXBB 4KTEH 3HG3A 4LDLB 1GFMA 1AS8A 3HHMA 2ZCHL 3CHSA 4FG0A 4X6EA 3L4WA 1T20B 2EDYA 4TLSA 4Y88A 2EUWA 4J7RA 1H15B 4G7QB 4PWGA 3TX4A 3LH9A 1J9RA 4HJJL 1QW8A 3T65B 1EPFA 4OCXL 1N4XL 1LLAA 3D18A 4R97C 4M48H 2P1YA 3GJEA 1W6LA 1YJDC 3TL5A 5BQ7B 1KDJA 4OJFL 4LESA 4K0OA 1ZXKA 4NQCD 2F15A 3NN8A 5FS5A 4WJG3 2VXVL 4PGDA 4Y5YB 5CP7B 2DEXX 5HDBF 3NGBC 5HGHB 1EANA 2FJUB 5I75B 5IQ7L 3NCMA 4MQTB 3RUGA 4U2ZA 5AB9A 3HLAB 3PE9A 4IOSD 2QLYA 3OKKA 2R9HD 3K1KC 4OCWH 1URZA 2Y7QA 3ARGA 3BVNA 4JFDD 4KPHH 3MRMB 4LF3A 1E9PB 4P4KB 4JKKA 2K4TA 4KKCD 4HXBH 2DQUL 1DQML 1PFOA 2A5UA 2EVHA 3EHBB 5LLIC 1EIBA 5KW9L 2HFFA 4GIOA 4YAQA 3N44B 3KXFB 4P2QE 2DMHA 2DH2A 4LOUD 5DT1H 1VSCA 2B59A 5JNYB 1X5ZA 2DQCH 5KJRH 4ZO6A 3AGWA 1JGUL 1Z5LA 5ESVA 3LKNA 5HI3D 1AACA 3SZ6A 4HG4J 3I02B 4GP4B 1KYOK 1TZHA 4OTXL 4KK6D 3UJJL 2Y2TA 1DQLH 1YRKA 8PAZA 1AAJA 4Z7UF 1FNHA 2VN6A 1P6FA 1QABA 5FFGA 1KTLA 3QNZB 3SDXE 2X89D 3V5KA 1XXFC 5I17B 4X8JB 1ONQA 3QNYA 2WWKT 1KB5L 3ZDZF 2BP0A 1FE8H 1A2YB 2FGWH 3H42L 3B1TA 5KVEE 1AZUA 4XPFL 2Q6WB 3SO3C 3JTYA 3U79A 3TBCA 2WVPA 3EFFB 3LHPH 3QQ4A 2H6PB 3DETC 4ZO9A 3CZLA 3AAZB 2ZF9A 4N2DA 4NUGL 1J0IA 1JNLL 5GS0L 2CNZA 2IAND 3HPJB 5BZDB 1FNGA 5AZUA 4F92B 1DYZA 3KBEA 1J86A 1GY1A 1JF1A 3VXUD 2R29L 3KLHC 1ZHKA 5GZOA 3BC9A 4HLZG 2A7BA 1LO5B 1SN2A 2IQ9H 4M9OA 1IZNA 1VPOL 4JY4A 2B20A 4ZTPL 4O2EB 3HE6B 3BVWA 4V1DB 3F3HA 5E2VL 5IG7A 1RCYA 5LWYL 1ETZB 2J56A 2ZUXA 3OQRA 4AGLA 1IQWL 4QJ4B 4AMWA 2V8MA 3BDBA 3RNKA 2MQ3A 2WGNB 1Y0LA 4XBPB 3TCLA 3TC9A 4WV1B 1G7LA 2FATL 2Y0HA 4Y1SA 5HHVH 2VXTH 3MA9L 1A9BA 4G7YH 3RWIA 4HJEA 1R46A 2HWZL 3O9WD 1AQDB 1H5BA 2P5WD 3BHBA 2ZE0A 3II1A 4NC0B 4OGXH 5DHVB 1ZT1B 5EFIB 3WNKA 3RX8A 5LGKA 4WW2C 4MJIB 4ANVA 1JV5B 3U30C 5E95B 3VFVB 1KN4H 1CO1A 1KG0B 3AC0A 2WW8A 3RWDB 5LAXA 1BXWA 1E3FA 4POZC 5J1TC 1D3CA 3H54A 1BQ5A 2K8QA 2H9GB 3WS3B 1JGVL 2EXYD 5DJ6B 4WK2B 2XRAL 5FM8A 1HHGB 2B1AH 5DF0A 1HESA 1RVFL 1H6UA 4AXWB 1OW0A 1VIWA 4C58B 3CZNA 5AQ0A 1ZSDA 5I76B 5I9QC 2R2HA 2O4EA 4G42A 2X4UA 1FI8C 1N12A 4FG6C 3U4EB 1RUKH 2NY0C 5JIDA 4FUVA 1SYVB 5I6PA 4ELMF 3PL6D 2QGEA 3NJMA 5DFAA 3X3GH 4YJZL 5DD6B 2P8MA 3CSGA 5DS8B 2ZKMX 4H0LC 3MBWA 3PAUA 3T3PB 3EADA 4P9HL 1M57B 4FYRA 4IRZH 3PWNA 3U2IA 3A21A 3DO3A 4NKDB 1M3IA 3W9EA 3UJIH 3DO4A 1JNNH 4NZRL 2CGZA 1AO7D 4XP1H 2A6IA 1IRAY 1ZY9A 4G8GE 3L9EA 4ONFL 5DHYB 2IIJA 2Y0KA 1IM9A 5DS1A 4Y8AA 4J3OF 3U1QA 1GOGA 5EF0A 4UZGA 2VL5A 3F58H 5CJXA 3MA7B 4WK4B 1NBZB 2Y1AA 3IT8D 1NINA 5KUMA 5CEZH 1D2PA 1QKZH 4L8DB 4Y4KD 3FC8A 1FNFA 4J8RA 3ILDA 3D34A 1WAAE 3RKDC 4Y8DC 1OGAD 4N6RA 2KQMA 4Y4HB 4D8PA 2PF6A 3O3DB 3V4PL 2H6UA 2OQJB 5HPOA 4IBUA 4OLZL 1F90L 3QCVH 4DWHA 2OZ4L 4PJ5B 4PRHE 4BELD 3B8YA 2G2RA 3MLTA 4UYQA 4PJXE 1THAA 4MXWL 1I7RA 2BZ7A 2ZWZA 3GSRA 4PGCA 4RISL 4XWGL 3EOYG 1ZD6A 4B9CA 5JA9A 3AA1B 1JPGB 2XFXA 3GS0A 5LAPA 3NCBB 1YEFL 1U8OB 2I25N 2APSA 3PGCB 5FYKD 4CRPA 4DVBB 1X5GA 5JXAH 2D3JA 4PVLA 4ODWA 1QPPA 4QTIH 3OKDA 2VLRA 1HQ4B 4YL4A 1QNZL 1SHXA 4XMLH 5TGBA 3KYMA 2IDFA 5ISZD 3VE1A 3PWPE 4I5BB 4GCSA 1J5OH 4Y19B 4G8IA 1IKFL 5LBGA 1WZ1H 1Z66A 3HMWL 1HFUA 4RSYA 3CG8A 3BKML 1ZGLB 1Q90A 2DQJH 4W9CC 3NSXA 3EW3B 5E51A 3PHAA 1PGRB 1FZMB 4QGTA 3W0WB 7FABH 2IAMD 3N1GC 4HKJB 2ITCA 3STLA 3UMTA 5EOCJ 3LS5H 3SKUD 3WFCH 4UMGA 4MX7A 2OR9H 1MAKA 1NA8A 1HH9B 1PVHA 3I3DA 4U6VL 2CAKA 2ERJB 2N3JA 2NY3B 4AM0A 3KPSD 3B5TA 3VX0A 1DBBL 5EZLA 3V55A 3PWUB 1CS6A 3SQBA 1JPFB 1O7DC 5ALCH 1T3FB 3QW9A 1QLFB 4JFOA 5TDPA 4G7VH 1BMZA 1JGEA 4IRSD 4MAUL 3MVSA 4X5WA 4XN2A 5D96C 2YZ8A 4TNWF 2WYHA 3TEXA 1HHHB 3ZUNC 4Y2NA 2G3MA 3QWQB 1DJSA 1IEAA 4ZMAT 3TTSA 5D8JL 5G26A 1MCLA 5EO9A 3ZE2E 3QBTB 2HJLB 1VFMA 4FCHA 4BWWA 4ZPVA 1MRFL 4TUJB 2BP8B 4R8WL 3AM8A 3NABL 5KYWA 3N44F 3Q44A 5E6YA 1PD0A 4UNUA 2YSTA 1AP2A 1C12A 2WO4A 4W93A 4HBQA 2B2XL 3H9SB 4YNYA 15C8H 4MA8L 5GGSB 4X4MA 3QIBA 3T4AA 2XWJB 3WMQA 4KOBA 4CW1B 5B5EO 2WANA 1SN5A 3SGJA 5J13C 1VGKA 4A2MA 5EEUA 4NQVA 3ZKXB 2I5YL 2N0MA 1OPOA 4QIRA 1RIVH 2NNRA 4L3CA 4OBSA 3SOBH 2C3VB 2ZCKL 5KSAA 2JJSA 2ZXQA 3EG9A 4MHHI 3TWYA 1DR9A 4N1EA 3US1A 4PGZA 1SF5A 3SDAC 1FHNA 4JPIA 1NMAL 2XLLA 3T77B 1PZ2A 5DZ9A 5A3IC 3HNTH 3SDCB 3GXDA 3HNVL 3H6AA 2GTZB 3GS4A 3EO9L 3BP6A 3ARWA 4K5OA 1IIKA 5H8DA 1EEYA 1AY1L 1CD1B 5ICXB 5L2KB 2JNZA 1E2ZA 4G5ZL 5BZXA 4A6YH 2V2XB 1KCRL 3LYRA 4UQDA 4HJ0C 2EKJA 3ZMNA 2UY7A 5FW8A 2PXYC 4WI9A 4XNXH 1A6TA 3LEXB 1QI5A 4ZDHA 2BY2A 3UPCA 3ZR6A 4ZG1A 3EKCA 2DMGA 4PGJA 3FCUB 2GY5A 4KXAA 4DJMA 5E9DE 4CADB 1X5HA 3M1BB 4Y2DD 3VFNB 5TF1L 4YHPB 4JPWH 1JG9A 4XNBA 4ELKA 2Y36H 4O58L 3W57A 3SBRA 4JO4L 1DQDL 4K94H 4ONGH 1G1KA 3QB7C 3UPRA 1MW1A 1GL4B 4NYLA 1WA2X 3MBEB 2N2LA 2HX8A 3Q9PA 5JYMA 5ACLA 1RU9H 4Z78A 2O26U 4HUNB 1N5AA 3QNFA 4I9XA 5SV3A 2KBGA 3H3PH 4AMXA 4AL8C 5CSBA 2C1OB 4Q4EA 3I9AA 2X4PA 4NQEB 4HC1H 1W0WB 4HMCA 1ZK5A 1QSEE 4JPVL 3IDXH 4AW7A 4TSCL 4BXVA 4LCWE 4X9YA 4FZNA 1YEGL 5CJQL 1BD2A 1QHQA 1B0GA 2YAHA 1G6RL 5KVGH 2WN3A 3U0WH 1QSFE 4IEFB 4PVNA 3CMGA 2CLZB 3MRBB 4JJ5B 4PCSA 5C7XL 1E4XL 2ZXWB 1BFOA 1QOKA 3CDFA 3G08A 3GHBH 3BDYH 2O5YL 1AR1B 3VW3L 4OY9A 2VLJA 4AKPA 1R3LA 4DZ8B 1UQSA 2AFNA 2AQ2A 3IDGB 3ZTNH 3T3PF 3RFZA 2D7QA 3VFTB 3KPRE 4PY7A 2WVVA 2NYYC 3LZFH 3EJJX 3FQ2A 5AW5B 1R24A 5IOKA 4M7KH 3IXTA 4XZUB 2Z92B 1CC3A 4ALAH 5AFAA 5CN3A 4O3XB 3GC3A 5GS2H 4J27A 3H85A 2RCSL 1WIUA 4Y16C 5EE2A 4JE4B 5IMOA 2XPYA 4J3BA 1NMCB 3CCHB 4AG4L 4ZNEA 2IBZX 3CN2A 4WSGA 4N5UA 3IK2A 3PDOA 2JWYA 2A9MH 1HHJB 3VXMA 2V17H 2BXYA 3T2LA 3IFPA 3O2VH 2W8CA 4ZFFA 1TQCB 1P7BA 2XG4B 1E28A 3M8OL 1GYCA 2MKLC 1CT8B 4JRWA 1G7QB 4NIYE 3FHAA 3R06A 2FEDD 4MLSA 1P0SE 3O6LH 4KRAA 4B53A 5CHNA 4NQDA 1E5UI 3LQMA 4RGND 1U2HA 1UM4L 1YY8A 3QO1A 1KIUA 5G3AA 3QUMB 2P8LB 1I8UA 1THQA 3ZDYE 3FTGA 2D4DA 5D1ZI 4AUYA 3L95A 4KJQC 4Q9QL 5KVFE 2JJTA 4FERA 5KVEL 1YQVH 1K6QH 3FQRB 1EJ6A 1CN4A 1A14L 4MA7H 5J12C 2I85A 2KL6A 3C2SA 3OHXA 4A2EA 3ECWA 1GRWA 2ZX9A 1H9VA 2VR4A 4NQXA 3CQQA 3V4VB 4LSRH 3PGDA 4R3SA 3MROB 4FL4B 5DEFB 3TFKC 2N01B 5CR8A 4BA8A 1KYAA 2VXSL 2UZXB 2C5DC 2IFFL 3ZE1E 1K8DB 4JZJC 3UBFA 3HG2A 3RRQA 4CSZA 1AH1A 4LL4A 5D1XE 4PRAB 5E08H 3TZGA 5H4ZA 4F58H 2YPVH 3I84A 5K93A 1MHCB 4LVNB 1NBVL 1O9VA 2G60L 1HZKA 4PG2A 4QRSB 3WIAA 1IV8A 1FYTA 3D3VE 1BWMA 5CEZE 1RUAH 4NI6A 3O2DA 3F7QA 1SJEA 3SDDD 1ZDQA 1PX4A 3VD7A 2QZ5A 3FDWA 2B0SL 1X9QA 1C08B 2X6BA 2ZXGA 3N43B 4J3TA 3VXSD 3WKQA 5I8OL 5CCKH 4P59L 2IH3B 3VGAB 1DJXA 2AV1A 1XGQA 4XNYH 3AA6B 2EACA 3HAEG 3K5RA 2EAEA 5B66O 5DZLA 4ORGA 5GRUL 4PJFB 3O41A 3VSQA 4KXDA 5I1HH 4WU5A 4XBGA 1NFAA 3CZEA 3DX9A 5D4JA 3QPXH 2DL9A 2FWOB 1KPRB 4PJAA 1AE6H 4V11A 4WI5A 5IIEB 5IT2L 1AXTH 3UZQB 1U8HA 5E4AA 1NCWL 1EFQA 2GYSA 4OAWB 4HIJA 1CBVL 5I82A 3HKZA 3T24A 1LO0L 3QRAA 1KACB 1C16A 3H2WA 1HE8A 1A1OB 1BZ9B 2HVJA 4MASA 1JXDA 1GTFA 4RFOH 5I6XC 3PWLB 3RGBA 2SEBB 3HE7B 4HK3N 4LLDA 4NBYB 4Z8FL 4Z7OE 1LMKA 3GMRA 1B4JH 2ZOUA 1JZ4A 2XX0A 5D2NB 1RZFH 4NUMA 3V6OC 1YEEH 1FVCB 5PRNA 5D1QA 4GLRH 3MJ7B 2DWEB 3ESUF 2XJKA 2JCCE 4OGYH 3VWKC 3ZO0A 5GZNC 4YQXL 1YUHB 1Q72H 5SWQB 2MPVA 2H1XA 3S88L 2PYEE 4G9DA 5CMAB 4D3CL 1YYML 3SPCA 1KC5H 1FL5A 1QFUH 1G84A 4GAJH 1JXFA 3D69A 4LBAA 3HG1A 2F53E 5HYSG 1DVTA 1KFGA 2NSQA 3G6AB 5H2BB 1G43A 4YS4A 5JYLA 1R3JA 4K23H 4U4IA 4BSJA 4C83A 2Y0LA 5I6LA 2GSMB 2V9TA 2WINB 2BNQE 2YAOA 2OXGA 4PM1A 5I26A 3RVXC 2AC0A 3BQVA 3GSQA 5KUKA 3U1SH 4KK5D 2YD9A 1EDYA 2P4AB 3W5MA 3LOWA 4PY8I 3LTVA 3MYZA 1P7KA 4KKNA 1KV3A 3QJFA 3LSOB 1JCVA 5IBUG 3J07A 1PAZA 1X7QA 3L48A 4GSQA 4N2OA 5DVMA 2F8VA 4K3HA 3MJ9A 2HJKA 4AH2B 1IAKA 4J1UA 3GSUB 4L4VA 4Y1AA 4Y5VB 4Q9CA 1XF4A 3RTLA 1ROCA 2FNBA 2QMKA 2Z7WA 2D0GA 4JY6A 1OAZH 2UZIH 1RZIB 3LKRB 5G4OA 5E1IA 4OLXH 2JIXA 2GBVA 1DVFD 4CILA 4M6OL 4R0LA 4LIQE 1GMIA 2RA1A 4K3DH 4F1ZA 3QYNA 4Q2ZA 5K33A 3TT1H 4XPAH 3KPMB 2F19H 2EC9T 3MXWL 2RACA 5ABZA 3CSPA 4JZOB 2Y2WA 4NCC2 4KZEL 3NPSC 3AITA 2G0KA 2VLKD 2VERN 5EBWB 1BVLA 2YQ2A 3EGDB 3VFMB 4KX9A 1UURA 5H37G 1CL7L 4HIXH 2Y1VA 2ZUQB 4L2YA 2P46B 4ZAKD 4BK5A 1A22B 2FSEA 3CFKA 4QHLB 1YAIA 3UPAA 1Q0YH 3V0JA 5ICZA 5AW9B 5I5RA 3WFEL 5C7ZA 3V0AC 3BN9C 2CCWA 2Z31A 3HRZA 5L0QC 4P06A 4X5XB 1S7TA 4FRWA 5JO5B 3BGMA 4L4TB 2BZDA 4BIKA 4FNSA 1WQVT 1MHEB 2VDMB 3MO1B 2ADFH 2JXMA 2NTFB 4QRUB 4AEIL 3QORB 4LKXA 1K9TA 1NC4B 4L37A 1MJ7H 2X4RA 1HOEA 1TJGL 1F6AA 2C1PB 2IADA 3QCTL 1HVXA 3L13A 1GS7A 4XXDB 5I18L 1URIA 3KBFA 5B7FA 1LNUA 2W9EH 5LUMA 2PCXA 1S7RA 3DV6A 3FO1B 4LXFA 4U4BA 1N19A 5DL7A 1YY9D 5HYQA 3SKJH 1XB8A 4JVWA 4P8QA 3KL5A 2EEDA 5E9AA 1T5WA 5I66B 1ZEAH 2ICWB 4WFED 3O3AB 2EE0A 1MNNA 5JORA 5B1CA 3VD2A 1FIEA 4KOCA 3U7WL 5C08B 5I1EH 4CBZA 4PJIE 5FA3A 3UG5A 4U6XA 2LABA 5FKAA 4MAYB 4EBQH 5HJGA 1GC1H 2CU9A 5IEKB 2DYRB 4NN7C 5EZJA 1I85A 4OW6A 4D9RE 5DI8B 4EI5A 3B9EA 4PVBA 1DUZB 3CQFA 1JHLL 4R9HA 3GM0A 1GZQB 4KTEL 4D0CB 3IDIB 5C0BE 3KLKA 5IQ9A 2P45B 2HJFB 4IRJA 1OOWA 5EC1A 1UH4A 5J57B 5KVGE 1EXHA 3KJ4B 4BXSV 1WICA 4NO3A 3MLVH 2IVFC 4M48L 1QWNA 3BLBA 3Q3GA 4MMXA 5TDOA 1NUNB 2VOTA 3ZTJG 2UWEE 1JZ6A 2YAQA 1P7QD 2YIHA 4BKSC 3FUKA 4XNUH 1QLRB 3LKPB 1GPOH 4PHXA 1Q9KB 5C0DB 5CLYA 5J3HC 5IJVB 4JFPB 2Z3FA 3ABKB 2JVUA 2DPKA 1H6FA 5H94A 3TO2B 5I19H 1UWEH 4H1LB 4QT5A 3KWTA 4XNZC 3GJFB 4OCWL 2WOYA 3KVQA 4KPHL 4JO8A 1WC7A 3R0MA 1IGCH 4C4BA 3BUYB 4HXBL 2NPLX 5EOQH 3QE5A 1LQSR 4GI6A 3OGOE 3SIKA 3BEWB 1UUNA 2N1TE 5KSBE 2X42A 2X41A 1T7ZA 4R6UA 4JFZH 2X1OA 3HZ3A 2NW2A 4ZSOA 5DT1L 4OD2A 2DQCL 5DEGB 5KJRL 1DJYA 5C0JA 2A73A 2NR6D 4MXQC 3QDJB 4ZXBD 2EVJA 2HMID 3SYBA 4D5UA 1DQLL 1HHIA 2O72A 3N43F 3FUEA 1YEJH 3QWOB 2GJJA 1ORQB 1WHOA 4GLRI 3HR5A 4MJ6B 3S5YA 1XAUA 5EU7E 1OIOA 2Z8SA 1MLCB 1FE8L 1BEYH 2FGWL 2PYFA 4PN6A 3V0FA 1J11A 4PJFF 4AQ1C 2OR7A 1QSFB 4A1RA 3P30H 2R83A 4XZ4A 3LHPL 3MFFB 4EO5A 2VRKA 1XIWB 2X9YA 4CN1A 2X10A 3RGVA 4E5XA 3MR9A 5LHDA 3O3BB 2AHIA 5AG8A 1MZZA 5IROD 4TQIA 3L3OB 1F1DA 1RQ5A 4D65A 1U8LA 5GGUB 2XTSA 1ZRUA 5ACZA 1J0YA 3CQPA 4PTUA 2HTLD 3NEOA 4OFQA 5I2IA 4G8GA 4P4KD 2IQ9L 1BJ8A 1GIGH 3CFBA 1PQZA 1CDHA 2IGFH 4MZIA 2QTKA 3JTSB 4X7SH 2Q76A 5BXFA 1J8HA 2Z35A 3A3YB 3HS9A 5GJTH 8FABA 2R1YA 5E6IA 2MHAA 3TH2T 3TBTB 3DXAD 3T04D 3POUA 6CGTA 1KY7A 5HHVL 1OVZA 2VXTL 4G7YL 2HUHA 4OGXL 3HZVB 3WTWA 3DSNA 2AK4E 3AU1A 3SE4C 4FQJH 4LASH 4ZODA 3NJKA 2OSLA 3G04B 4LLYB 4RGMB 4NRZB 5F9JB 2CCVA 1KN4L 2CO2A 1AC0A 5ILTH 1ZDSA 1CD9B 2GJ6D 3VMNA 1HE7A 1KYDA 2CHNA 1IKNA 3PWVB 3VI3A 4AENB 4NNYA 3MYJB 4QHUB 2Z1KA 4XX5A 3C6LB 1QR1A 2R4LA 1SXSA 1LEGB 2B1AL 2N7BA 2WLLB 2P24B 3ZDYB 4JRXB 5G5DA 3R4RA 3GSOA 5AW8B 4PJXF 4Z7WA 1NIAA 5GS0D 4LLWB 1RPUA 1MCJA 2Q9OA 1QFPA 3BD5A 4J3WA 4HIIA 1I8MA 1RUKL 2Q8AH 1AD9A 3HVNA 3D30A 4PH8A 4GP5B 3WNPA 4G76A 2VSDA 1O5DT 1EBAA 1SBSH 4BH8A 1HEZB 2XY1A 4QXVA 4U1KB 4IRZL 4GW4A 2QELA 4MXVF 3NCJH 3N1MC 3BYTA 4IJTA 4TRPH 3BRDA 1X44A 4H8PA 4UIMA 1M05B 3UJIL 3AY2A 1DDHB 1JNNL 1SHMA 2XQYA 5D1XB 1EAQA 2CO4A 4NPKA 4XP1L 1QA9B 2XKNB 4MA3B 4HUUA 3FCSA 2K78A 4I48B 3S3CB 5F1OB 1A6WH 5HYSB 3NSJA 5FDWA 4OGAC 1E4JA 1CFNB 2VL4A 4H8WH 5GGRA 2WZ5A 4ZYKB 4FA7B 4HHAA 1JF6A 3RIFF 5CZVH 1UD6A 4OJEH 3POHA 2FIKA 5D72L 3F58L 5F7BA 5HGAB 1Y18B 1S7QB 2DJUA 3SKMB 5KAQG 5CEZL 2NQ3A 1JBJA 1QKZL 5FPIA 4ZMNA 5BMFH 2R56H 1OCZB 3NOIA 1GH7A 3WIHA 4F7KA 5L2JA 1Y07A 2NZ9C 4G80B 2JKJA 3C12A 4GXVH 5IBUB 2Q10A 4I4WA 4FQHB 4HUMB 3NSDA 3QCVL 4HZ1A 4JM0A 2I26N 4R7DB 2FWLB 5HTSA 3FB7B 3C5SA 3KDMB 4DPCX 1OTUD 5E4OA 1FZKA 4TMPA 1E27B 1WDAA 4NZJA 4RA3A 1E2VA 2NSMA 2Z1PA 5CIPH 3HBZA 5F3BA 5JXAL 3DTXB 4QTIL 1ED3A 1ACYH 3DJSA 5HHOB 4XMLL 4HGWA 3EDKA 3IDMA 5AVSB 2OMTB 1J5OL 4XX1E 3PS6A 4TYUA 1S7SA 4HEMA 3TIEB 1MCSA 1WZ1L 1H0DB 5HDLA 3KZ8A 2ENJA 2ZTBA 1UC6A 3S3SA 3E3QC 1IBFA 1PY0A 4DGWC 3X17A 2K3TA 3IMRA 2X7LA 7FABL 4PP1D 2A2QT 4Y0GA 1ND0B 4DGUA 3LS5L 1ASPA 2DWDB 3T3MB 2PYEB 1RZ8B 3L1FA 3WFCL 4F8NA 3JWNC 2OR9L 3C6SA 3GO1H 4LRIC 4AIZA 4BFRA 5AW2B 3I75A 3QWNA 3DUHA 1M9WA 2R2BA 3D25A 1YN7B 5TQ2H 4QKTA 2WB7A 3J27A 4HK0B 3MRIA 3N42B 5ALCL 3GUTA 3BIAX 4BYHA 1B6UA 4G7VL 4GQPH 2UVEA 4I1PA 3S98A 3QI9A 4YGVA 4S10A 2JQAA 3P73B 1AIFA 3VFUB 4KGLA 5K39A 2RH0A 2L7EA 4JO1H 2XCMC 4K4KA 2CKBH 2ZP9A 4RJXA 1KCWA 1WTGT 3Q48A 5CGYC 1L7IH 4L9LC 4UUJA 3AAEB 4KR4A 1E4KA 1FVDA 2BSRA 3OV6A 4QOKD 4LEBA 2RJMA 3HC2A 3SE8H 1C5DA 4YIQB 3ZKMD 4K5LA 1KY6A 3BO8B 1EAOA 3L5WA 4F8PA 1ZHXA 5DFVD 5AAMA 4PCYA 4JUTA 1A9EB 1OTTC 4X6EB 4APQA 3TGXA 3VE0B 15C8L 2CRMA 3ZIYA 2AMUA 2VQUA 3MOAL 1QVOA 4N20A 3ZZLA 1YNKH 4DNLA 1S8DA 3K46A 1FAIL 1UB6A 1MWAH 5FCSH 5GRYA 1HU8A 1KGCD 1V10A 2EO9A 3PP4H 1QJ9A 3D18B 2O5NA 3GJEB 3P3TA 3QDAA 3OKEA 1UM5H 7PRNA 3W0WD 1ZLEA 2ZUWA 3SOBL 1E67A 5D2LE 4HPHA 1PZUB 4I8DA 1N2RB 5AOIA 3GTVA 4NBZB 2W59A 4KKPA 4PGDB 2CPCA 3A4FA 2NY3D 1T83C 3RUGB 3HNTL 3GXMA 4PU2A 1L3NA 1T04A 1BPLB 4KRNA 2LV4A 2Y7QB 3ARGB 3AB0C 3BVNB 4LF3B 5IESH 1HIMH 3MUGB 4E9WA 1KXVA 2OX5B 2EUZA 1BG9A 1WIOA 2VLMD 4A6YL 5DRZA 3MV9E 5D7JB 5FUZH 1QHPA 3PF2A 4MRCA 3ISRA 5I71B 1RZKC 4XNXL 4JRLA 2OJZH 4HS6B 2KUTA 4MGXA 3UAJA 3H9YA 1FJ1A 2B59B 4S0HA 2BWQA 5DC4B 3QA3A 2YNKA 1ACZA 3VNZA 2KYIA 4U3CA 1HL4A 2C34A 1Z5LB 5ESVB 3LKNB 4QY8A 3RPIA 3ARVA 4LAJH 4S0SD 1HX0A 2Y22A 3D07A 3TVMA 2MNWA 1EGJA 4I0PD 5ECGA 4JPWL 3UTSA 2YS4A 4F8QA 3UTZA 2Y36L 5CZXC 3LZNA 2JKRM 3GZQA 4ONGL 3H9SD 4LSTH 1KTLB 1QJ8A 5FHBH 2EDHA 1EX0A 1KV7A 1BGXH 2DN7A 3GSNA 1ONQB 4X5QA 1WZAA 4PRBA 2D8KA 1RU9L 1WD9A 1O6TA 4ERSH 2G3XA 1ORSA 3AGVA 4JQVC 3H3KA 3H3PL 4B3EA 3QQ4B 2V0AA 3L9RA 3PHSA 4JQIH 4K3CA 3IPBA 3NJTA 2Q3ZA 4YVNA 2JKIS 4ISVB 3ZXAC 1FL3A 3MRHA 4HC1L 1PLBA 5EU6E 3RBGA 3IDXL 1UOKA 2R23B 4JCHA 1FNGB 2BRQA 4LLUB 4X4KA 1FH2A 3SDCD 3ZDYF 4NQUA 5KVGL 1ZHKB 5FV1L 1T7WA 3U0WL 3D1MC 1KPVA 4O02L 4PJ0O 4ICWA 2IWGA 4MMZB 4DTGH 4HVBA 5L2KD 3GHBL 4JY4B 1ZIBA 2BWIA 2R0LH 3BDYL 1HEJC 2VB5A 3O0LA 5IG7B 3S5ZA 1ZIAA 2WQWA 3LQZA 1AKJB 1RY7B 3ZTNL 2A6JB 2AJZA 4OZGE 3QIWA 4HCFA 3RNKB 3NSFA 1NQBA 3QHFH 3CJJA 1G7LB 2VDKB 3AQZA 3LZFL 1ZV5A 1MDTA 1JTOA 2C9VA 1A9BB 3M17B 3RWIB 1MPFA 4M7KL 4GRLC 1H5BB 3BHBB 4ALAL 2A77H 1MF2H 4OV6F 5FYJD 2PPCA 4POYA 1XCWA 3NJGA 3QWRA 2OK0L 5DJ8A 4ADIA 2FLRT 2Z93A 4NZDA 4A63A 2JK5A 3CFNA 3A6CH 1B0RA 2COVD 1XSOA 3MBED 2V17L 2DWTA 1F3RB 1R5WA 4MDIB 1J5IA 1BIIB 1KMGA 3P4OB 1CU4L 4AVHA 5BRQA 4L3EA 1ZSDB 3L2MA 4NHUA 4UQ2A 4G42B 2OAAA 3HMXL 2DZEA 3DX6B 1NDMA 3BH8A 3O6LL 5EUOA 2C4XA 1SDDA 3RL1A 2F7OA 1TU2A 5G39A 2P8MB 1F4YH 1I8LC 3FF7A 5D5ME 4KKCC 3B34A 4PGEA 4NO0D 5CFHA 2GQHA 3PWNB 2OSXA 3W9EB 4F2ME 2AQNA 1YQVL 4LOUC 3LN9A 1K6QL 3VRIA 5ABAA 2JTYA 4MA7L 4B9GA 1NCDL 1TITA 2DQFA 4QF1A 4L4JA 5JOEA 2EJ1A 2ED7A 2H6OA 4W4OC 2K0LA 2Y72A 4M56A 2IOIA 2F58L 1EEUA 1IM9B 4KK6C 2X12A 5D1ZA 4O2CA 1FNEB 3TTYA 3K0WA 4HJTA 3SYPA 1X4YA 2VL5B 5I5JA 4P2QD 3WXVH 3RE0A 3V4UH 5E08L 1DFXA 4F58L 2YPVL 4OIIH 2A9BA 4E42B 1W72A 5JIHA 1X5LA 4J8RB 3VUAA 4C55A 1PG7W 2DWSA 5BW7C 2F53A 3WELA 1UOWA 2JCCF 5J6GA 1PLGH 1RUAL 4D8PB 2P8PA 4ODBD 3S8GB 3GMMA 4YHNA 4LDCA 4AGOA 2WXMA 4JMNA 1MY5A 2BNQA 5J6HA 2FT8A 2G2RB 1J88A 4PGCB 1DO5A 3GSRB 4LB8A 5CCKL 2BVEA 3K91A 1E3ZA 4OFPA 3N42F 1BHGA 4XNYL 2VDRB 4RMVA 3O4OB 1J0HA 4ODWB 5AWNH 2R88A 4WI8A 3C5JA 1I1AA 3GMPB 3OKDB 4FXGC 4KQ3H 5I1HL 3F04A 4NUQA 4XCNA 5TGBB 5FUCE 1QTYT 4NC1E 1KUMA 1RIHH 3THMH 3QPXL 4YUEL 1W2KT 3A4DA 3FHEA 1AE6L 1WTLA 1FV1B 4MQSB 1ITCA 1AXTL 4G8IB 2P52A 1JYVA 4CVWA 4HDIA 4EUPA 1W8NA 2H5UA 3WOVA 1JYWA 5DS2A 5FB8A 2CIIA 3O9WC 1WV7T 2J8UA 4ATWA 4IGBB 4RFOL 3WNLA 3LJ3A 1UKTA 2NW3B 1J48A 1EA9C 3ERXA 3AXLB 4XXCA 5FO9A 3TV3H 4MX7B 4NP4H 4ZFZA 2XWBA 1B4JL 1WAEA 4AM0B 1NFIA 4XB7A 1RZFL 1YEEL 1V05A 5JPNB 1DSFH 1KNOA 1NLBH 2QSVA 5DDHA 4QRBA 4LSPH 2EXYC 3JWDH 5K9KB 5EBMA 4QO1A 3GZKA 2B5IB 3QHZH 4OGYL 4JFOB 3MTRA 1Q72L 5TDPB 1KIRA 1JGEB 1OK0A 1KENH 3SY7A 3MAWA 4N6QA 5C0CE 5FLVA 1KC5L 3FB6B 4GAJL 4X5WB 5CUSH 4CA4A 1UJ3C 2JKWA 2KH2B 4OQTH 3RUGF 1JZ2A 4FD0A 2X1PA 3ARDB 3BD4A 3PL6C 1MFEH 3FU5A 3OVUB 3WS6C 1YQ2A 1ZMYA 1Z0MA 1GCYA 3FOMA 3N06B 1IEAB 4K2UH 3C5ZA 4K23L 4ZZKA 5D4QA 3NJFA 4P46C 4R2GC 1U3YA 5EO9B 4CSPA 3ZGIA 4ZPVB 1S7VA 1C5BL 1RL1A 3DMMA 4N2FA 4X6FA 3U1SL 5C86A 1UB5A 5KYWB 2ETWA 2X3CA 1KCSH 4AC4A 1XH2A 1LL1A 2K4AA 2WXJA 1C12B 4PJIA 2O5ZH 4YNYB 3U25A 4GKSB 5MEPB 3QIBB 4TKWA 1TQBB 3T4AB 5BNXD 3TEZA 2XG6A 4DQOH 2HXAA 2CKNA 3VGFA 5J11B 4JFXA 3WD5H 1VGKB 3MLZH 5E5LA 3LRLA 1LE5A 4NQVB 1OAZL 2UZIL 3G6DL 4LU5H 4QHPA 3ZHKA 1BLNA 4OLXL 4L3CB 2F54B 1AYOA 3AS3A 1PKOA 2P5PA 3HE7D 4K3DL 3TT1L 4XPAL 4NENA 1NCCL 3CTTA 4Y4KC 4YR6A 2GBTA 1YDPB 2F19L 4JPIB 4JFEE 2NNAB 3BAXA 4IS6A 3D48R 4A67A 5KS9E 3BP6B 2R4NA 1EEYB 4U1IA 2UWEA 2HG5A 3VI4A 4LT7A 1Q0YL 5CD3A 3IKKA 3V95A 1TSHA 5DRNB 4EN3B 1WSST 1T0MA 2APTA 1JNHA 2UY7B 3HI5H 2GK0A 2AP2A 2L3BA 3OJMB 3OWRA 1A6TB 2V3EA 1KGUA 2TRHA 2YQGA 3V9CA 2EIKB 2F18A 2VUOA 1OT1A 4ZDHB 2MCAA 2ADFL 5JPMC 2MNJB 1IFGA 2GAZA 2Y7LA 3QDGE 1OSZA 3P3YA 1I3GH 1NICA 4XI5D 1MJ7L 4OZIB 2WTRA 4PRHD 5IVXA 2DY2A 2CZNA 5BPPA 4IU3A 1OAYH 2W9EL 4ELKB 2ZXEB 4GQRA 2FWUA 2XC8A 2YEZA 1HHKA 1ET5A 3UPRB 3I3EA 2VDOH 5DUBB 3SKJL 3FMGH 4PBXA 1QEXA 1ZEAL 3KL3A 3CSYB 5KSBF 4F7PA 2IAMC 1LK2A 2B7DT 3KPQA 5HI4D 5I1EL 5L88H 3L4CA 3PWPD 4GO8A 2GTQA 5LG1A 4FQEA 1P5UA 1VB9A 3MLYH 5T3XH 1DQQB 2FD6H 4L3AA 4EBQL 1GC1L 1YMMA 4AV0A 5DC2A 5IMMA 1FORH 3GSWA 1P2CA 2DLIA 4KROB 3CK0H 1G4MA 3WFDH 3GYRA 5FM5M 3FQYA 1DO6A 4MNQE 1BD2B 3LN5B 1I1RA 1B0GB 3WJJA 1WVZA 3CPLA 3T0EE 4IRSC 4WU7B 4Y9FA 1CFSA 3V79C 4Z95H 3FXIC 3IJ7A 1BFOB 3O4LA 3WI4A 2UV3A 3PG2A 3HOLA 2BS71 2VLJB 5D7IE 2OTUB 4ETYA 2G2PA 4RDBA 3WAJA 1UQSB 5CEXA 3MLVL 3QP3A 1CICD 1X3DA 3IU3A 3ARFC 2OW7A 4L4TD 4PY7B 4JS7A 4XNUL 2JKSA 4N2AA 1GPOL 5E0FA 4HZAA 2NXZD 2X87A 1NC4D 3L54A 3IXTB 1Z32X 1AQMA 2APBA 2ZT9C 4GAYA 5SX5H 5BV7C 3DRQB 5I19L 4AYSA 4GUOA 1UWEL 2ORBH 5L4JA 3P3SA 3LV3A 4FFWD 2WMPA 3BPOB 3DA4A 5IMOB 1UT9A 1WCBA 4PLKC 3FQ1A 4ZMWA 4UWQB 4HCRH 3WKNA 3LQAC 5D7EA 1IGCL 2ZAIA 3B6SA 4HUVA 3VXMB 1QWUA 1CXIA 3IFPB 5EOQL 1BYNA 1Z5HA 3FZUD 1E28B 1CDYA 1AGCA 2E9GA 2Y6TE 2MNUA 4JFZL 5IR1A 3G7TA 1GA2A 3D06A 4AQEA 5KAQF 3MRGA 4HS3A 4MAYD 1E8WA 3U0PB 4CGUB 2NSXA 4YSAA 1F13A 3CGTA 4U1MA 4YWGH 4F3FB 4NQDB 4WWKD 2VR6A 3KPLA 4LFHD 1YY8B 3E1F1 4PJEE 3QO1B 1KIUB 2GTWB 2FDBP 2WQSA 5DJ0A 3BCFA 3F5WA 3AAAB 3HBPA 3KW7A 5DMGC 2EE3A 2KS0A 2NY2D 4OKDA 5DVOA 3L95B 2BVPA 2G9KA 1FG2A 1YEJL 2JB5H 4KMTL 3TZVC 4DO5A 1U3HB 4LPWA 4Y4FA 2P42B 3MV8A 5GS1A 2ESVA 2WZPA 1GSKA 2A6DB 3HJEA 1PHOA 1BEYL 3OHXB 5LGJA 4Q52A 1BQSA 3DV4A 2QEJA 4HMDA 4NNXA 1KB9K 4NQXB 3FB5A 3PGDB 3P30L 4R3SB 1ZWIA 3GXFA 3RVVD 5LKNA 4Y2DC 4E5XG 4F15B 1GY2A 2V3DA 1CI3M 4OFIA 4P5TC 2LU4A 3EDJA 4L9DA 2GEEA 4KI5E 4K71B 4CU7A 2IOMA 1EQWA 1OAQH 4TNVF 3RVTC 2BVUA 3UMNA 1ET8A 4G9FE 3BKYH 4CVXB 1BZDA 1GIGL 3ROLA 1KT2A 2WUBH 1SJEB 2IGFL 3JZ7A 5E9DD 2F8OA 4OT1H 2G0LA 4ZUWA 4Z7VE 4X7SL 1TNMA 5ESQA 2WOBA 5GJTL 5I0XA 5K9JH 1PFCA 4XE0A 1XVSA 3Q2NA 2FO1A 4KDTA 3ETBJ 2AV1B 4R90H 4TUUA 4X99A 3RIKA 3WJMB 4TSAH 3TEWA 3W81A 2PABA 3QDJD 4FQJL 2V5RA 4LASL 3PHOB 4ORGB 3O41B 2B15A 4B96A 2NRDA 4WU5B 4TS6A 4XBGB 3DX9B 5ILTL 3P2BA 2B4CC 1M42A 1IQDA 1T4WA 1ULVA 4PJAB 3VO0A 2WLMA 1QSED 4FHBD 1U8HB 1T1ZA 3K6NA 2QL1A 4LCWD 5KSVB 1UXWA 3LIUA 4N22A 4HIJB 3D51A 1RJLA 3BPNC 2CD0A 3ARBC 4JVUA 1C16B 5LXGH 5FECB 1QSFD 1MUJA 1M7XA 2OMFA 6FABH 1XIWD 2KZKA 2ZX7A 3O6MH 4N0FA 4U0RC 2Q8AL 3SPVA 4DFIA 4O02A 1BAGA 1HILB 1HXYA 1SBSL 2KMWA 2VDPB 3F7YB 3ZQWA 3KPRD 3DPBA 3X11A 5D1QB 1ZE3H 3MUJA 3T1WA 2WB1A 1XSJA 3NCJL 2CBQA 2O6PA 1DE4A 4TRPL 1IGYA 5EUKB 4W70A 2ICEA 4FHKA 2XQYG 2CIKA 3L4XA 2FEDC 1FL5B 4R4BB 1V55B 3VRJA 3L81A 5JDSA 5CP3H 4RGNC 2ZD0A 4G82A 3REWA 4WWID 1A6WL 1PZ5B 1CE1H 4U33A 3HZYA 4RA0C 3R7RA 2WXIA 4A7VA 4H8WL 3CLWA 2CM5A 4FA6A 4E9TA 4C83B 3TONA 3BLPX 5CZVL 1SMAA 4JRYE 4YDLC 2OXGB 5KOVC 3KAAA 3GSQB 4JPSA 4AT6A 1HK6A 3ZRSA 2BSSB 5BMFL 2R56L 1DN0A 3SZVA 2AJYH 3ZY7A 4GXVL 2VKXA 5FW6A 3W56A 2VW7A 1HT6A 2HJKB 1IAKB 2XE2A 4J1UB 4L4VB 1LILA 4Y1AB 4OZIF 1XF4B 1RJYA 3M1CA 1OPGH 4JY6B 5JOFB 1CQYA 3ILQD 1ZJBA 3GSXA 2JIXB 2YARA 2RTTA 4R0LB 4WW2A 2WD0A 4Q2ZB 4Q89A 3RWEB 3ZRFC 5D7LE 2E7MA 2WQRA 3PORA 1ZHLB 4UNTA 1GFOA 3VXTB 1ACYL 1NCJA 3OTTA 3KHOA 3JXAA 3MRFA 1SJHA 4MJ4A 5AAWC 2BHFA 1E9QA 2AEQH 1RJCA 3SDDC 3BVDB 3MV7A 5EEWA 1CYGA 1NAMB 2EO7A 3FRUB 3JVFC 2FSEB 5I28A 4OZHE 4MD5A 4TUOA 1ZT4A 4PRIA 4IBYA 4CSTA 2WSPA 3IJSA 5D1XD 5F3FA 5KSUA 2Z31B 1MFAH 3HRZB 5JA8B 2WK2A 3GF8A 5FUOH 3LNIA 7CGTA 4PWFA 1NAML 4QCIB 1HINH 1KJ2B 5I0WA 2EDFA 3D3VD 4OJDH 1AR2A 3TLRA 2E56A 5ICUA 4LKXB 4K7FB 2ZKHH 1NGZA 2F7PA 2UX6A 1Z5YD 3GO1L 5B3JE 1V7MH 2IADB 2YGNA 3MV9A 3QRBA 2B3IA 3VSVA 3PF1A 2PMZA 4Q7DA 2LHFA 4CN4A 5DMKA 1S7RB 5TQ2L 2KERA 3PNRB 4RAVA 3IM1A 2ADIA 2JI2A 5DSCA 4FMKA 2ZLDA 1T5WB 2OM5A 2DW5A 3NIGB 5EPMA 3HI1A 4QXTA 5JORB 4FKHA 2B39A 3BMVA 5F6HI 5SX5K 1CDBA 4PJDE 7PCYA 2WZ6A 1I3RA 5D93B 1J8KA 4JO1L 3QC5X 3H7BA 2CKBL 4XHJD 5FA3B 4U6XB 2BNUB 5FKAB 3RWCA 3WAKA 1L7IL 4D9LH 1MCFA 4M61A 3P3RA 1Q38A 4LL1A 4YK4B 1DCLA 3ESNA 4LOEA 1QNIA 3FW6A 5EZJB 2NY1B 3SE8L 4PRDA 5I0ZA 3OB8A 3QCUH 1BQHA 2FYYA 1KTDA 2BERA 3LZRA 1CGXA 4LSEA 4IRJB 1IC5H 2XN0A 4HUXA 5EC1B 1A25A 4WF7A 2EYSA 3ARPA 3UTPD 2CK0H 1PTZA 1YNKL 3UCQA 2XE3A 4B97A 2EE2A 3OJDB 1MWAL 4OJAA 3QUYC 5E1AA 5EU6A 4NO3B 5T3ZE 2YN5A 5B3SB 2WSKA 4HH8A 1MVUB 1VFBA 3QEQE 4JFSA 4MMXB 1BAFH 1UM5L 5SX4H 3WU2O 2A74A 3NAAH 2EDEA 4KKAD 3HS8A 1FYHB 5F1KC 2PYED 4LCCA 3D87B 4N0YH 4K9JA 3ZHFA 5IJBC 2YFOA 4GKNA 2X9KA 1SRDA 2BNRA 3F64A 4H5SA 5H94B 3RZCA 5B1AB 4RMQA 2FT7A 2E6QA 1D6VH 1R17A 4OZGA 1HZLA 1HYSD 2DF3A 5KANI 4NKOA 5IESL 1HIML 4L1LA 1WC7B 1HCFX 5F97E 1DVFC 5FUZL 3GMOA 2C3HA 3LXUX 3LK3A 4OZFB 4AEFA 2BSCA 2OJZL 2NW2B 1OQXA 3MRNA 4ZSOB 3IMUA 3L9YA 1CDIA 3WFHA 4OD2B 4P4RB 2QR0A 1Q9LA 1HYRC 4JAMA 4OF8A 1Y6MR 5GRWA 3OZLA 3OLIA 5C0JB 2A73B 2QVMA 5G55A 3O8XD 2DBLH 3E8VA 2VSMB 4AUJA 4HXAH 1URLA 1NDGB 1QFWM 2HLFD 5DJYA 1KTBA 1HHIB 4ZAKC 2H8PA 4NSKA 4EKJA 2VDNB 1KXQA 3LPFA 3BW9A 4LSTL 1QLEB 2LGNA 4KKRA 4IOIA 2K7PA 2F9BT 1BGXL 1QMUA 1QUPA 3HR5B 1JVLA 3SY9A 2HPTA 5BS0E 3I9PA 2DOCA 3MI6A 3D4GA 4ERSL 2YMXH 2EDRA 1QLEL 3T0EB 1GYUA 2QGCA 2EE6A 5E03A 3QG6A 4E9QA 5A7BA 2Z8WC 3K6IA 3QULB 4JQIL 3AMLA 3G9VA 4ZMOA 2XT1B 5BQDA 4PJAF 4MJJA 5KYNA 3MR9B 1MRDH 5J8OA 5E8DH 1UADC 3V0IA 4AGNA 5IUCA 2XZCH 3S4SA 3GMQA 1BOGA 5C09A 1OT4A 2OS7A 3FCTA 4GQQA 1KJVA 5I2IB 3VTAA 4AQZA 2JTDA 3KGRA 4DTGL 4FXKC 1DN2A 3T09A 2XN9A 2BLFA 5DJAB 3VTTA 1PQZB 2R0LL 5DZVA 3HFFA 2WCGA 5D7JD 2WHVA 4TUKH 3KS0J 2G9HA 2Q76B 4AQAA 5BXFB 1YC8A 5DZOA 3RU8L 1J8HB 3IRZA 2FJGA 2X3BA 2IH1A 3DDGA 1MCCA 1RZJH 8FABB 1FPTH 1OKEA 2MHAB 5E6IB 4P3WA 3MJ8A 3WDIA 4Y2LA 3CXHK 3M1OA 5F3HA 2OXHB 1J8SA 1FVEA 4OF0A 4W9ZA 3BZ4A 2A77L 1MF2L 3DSNB 5AZEH 1KOAA 1OF0A 2W91A 4WLCA 3SODB 2G3ZA 1A4KA 1IUZA 4DEUA 1K2DA 1R5VA 2VH5H 4D9RD 3A6CL 3K6DA 3DX3A 4PI2A 4N90E 1QR1B 2ZUUA 2QQLH 2K7QA 5C0BD 1UZ8A 4HGKC 2WXNA 3GSOB 4JBSA 5G5DB 5CLZA 3N85H 5GGVY 2K3HA 2R8SH 5DUMH 2ZWNA 3O81A 4GINA 2EYRA 3O2WH 3LS4H 4HIIB 1I8MB 1AD9B 4MD4A 2Q8BL 2X4SB 4HV8A 5I24A 3RFRA 1NOAA 5F96H 4DW2L 5IW3A 2R0KH 3WJLC 1F4YL 4RL9A 1ZHZA 4BH8B 2JE8A 1PNDA 4A2LA 4BZ1A 1XGTA 4GW4B 3I9GH 3Q6GH 1M56B 4UIMB 5GGSY 3FTYA 2X28A 1DHKA 4FX5A 1AKJD 2WQUA 5EC2A 4UI2A 4HUUB 3FCSB 1NKOA 2AITA 2A9DA 1KB3A 5FDWB 1MCPH 1G1OA 1IBHA 3TA3D 5GGRB 5JZ7D 4HHAB 4TTDD 1TKWA 4PS8A 1D7BA 4B5EA 3CFJA 3WXVL 5IVNA 3V4UL 2NDGA 1NUDA 1T89C 4OIIL 1N26A 4KQ4H 5L2JB 1SYSA 2OPCA 2ZZUT 3RWFB 2IMNA 3C75A 2VUKA 3E8UH 1PLGL 5SWZA 1X7SA 3HB3B 2QKIC 3KE0A 3TFBA 4I4WB 4N2EA 4I2XE 2CE6A 4TQEH 3ULUE 4HIEA 3G5XA 2VISA 2Q86B 1HSBB 2BSTA 2ENPA 3QNXB 5BZWA 2C3XA 2R8AA 3C5SB 2ARWA 3KWXA 5IROC 4UT9A 43C9B 5GSRB 1CYWA 1FZKB 4N2HA 5B38A 4MTMA 4PJ7E 2HTLC 1W15A 5GJSL 4H2CA 5AWNL 5T1DH 1ED3B 4QTFA 1OSYA 4KQ3L 3ZPDA 1U8KA 2HRLA 5IMLA 3INUL 2R4PA 1LWHA 2UX7A 3THML 1RIHL 2WJRA 3IDMB 3U6RA 1JF5A 4KY1H 1S7SB 3KPOA 4OIAA 4XN4A 4EUPG 1P4LA 2H0EA 4M03A 1B90A 4ZMTA 2ID5A 4GP8B 3JTTB 1BV8A 4YC2C 1CGWA 3AM8C 1F2XK 2X7LB 1S9WA 3LD8B 4MJ5A 4PWEA 3VYNA 5KS9A 1JZDC 3TV3L 4JGNA 4NP4L 1TZIB 1XF2B 3QIBC 3H0TB 2NX5E 3BKJH 1M9SA 5FDYA 3T4AC 4AIZB 5JIIA 5CZRA 4LBEA 4QRRA 2R27A 4UQCA 1DSFL 3VWJD 1NLBL 1NCIA 2R2BB 3D25B 3NFPB 4LSPL 3JWDL 2W92A 1THCA 2BVTA 3L5HA 3MRIB 1S2EA 5DLMH 3B8SA 5KSAC 2E7DA 2DYSB 3QDGA 4L1DA 2AK4D 4U1JB 5GS0C 5BZZA 5IHBA 1KENL 2LU5A 4HLJA 4YGVB 1INEH 4NKQB 5G4MA 3SCMA 1TFPA 4BKLA 1AIFB 5CUSL 5B8CC 2LLNA 4OQTL 4JZJA 1MFEL 1JZFA 4HAGA 1FVDB 2BSRB 1PL3A 1S78D 2EIBA 4K2UL 2AV7A 3QRFM 1LP9E 2V7HA 3MCLL 4GH7B 5DHXB 2XE5A 2WN2A 5DZPA 3FT9A 1L9PA 5DEJA 1A6ZA 4XB8A 5EIIA 1KCSL 3SKOA 3F7LA 2J73A 2O5ZL 4B41A 4IKJA 1P4TA 1A6PA 2FHBA 2WWMD 4EZLA 1QVOB 2BHZA 3P77A 4DQOL 1S8DB 4AZLA 1UB6B 1DQJB 4AJYV 3WD5L 3MLZL 4GRWE 1M7IA 3LVTA 4LU5L 2ZIDA 5AOZA 1OANA 4E36A 3OKEB 4FQ1H 4K8RC 2QPFA 3OZKA 3BP5A 4IGBD 1EXGA 1XX9C 4ZMXA 1YVLA 2XZAH 1A6UH 4DK5A 3QIUA 2AXWA 4OVVA 2DWXA 4I88A 1X5YA 3APCA 5FVNA 2E6PA 5IB3A 2UYLA 5ETUA 2OKMA 3V5DB 4XNLA 5EZOH 3WKYA 3U36A 4YHYB 4LOFA 4HHGA 1T04B 3I6GA 1PDKA 2ZYRA 2LU7A 2HRHA 3FU7A 2DQHL 4L3FA 4QHKI 3RG1C 3PWJA 4FMSA 3H53A 2OTWA 5DRZB 3NCEB 5D7IF 2ZPKH 2AAAA 4MLIA 2JKXA 1YYCA 3HI5L 4P9HC 4D2NA 5JXEC 4TTGA 1XZWA 3ARDD 1GGIH 3N6YA 5I1GH 1KLGB 1UKSA 2X0WA 4B9PA 4AJ0A 1YNTF 3V6OA 3AFLA 4IOFC 1I3GL 4NN5B 2AJUH 3R8BB 2XXGA 1PZ3A 1SDAB 1KBWA 1PLCA 3RPIB 1NCBH 5FGCE 2XDHA 3X1FA 3JYCA 4ZO7A 5C07A 1IAII 1OAYL 2BVOA 4M6MH 3QT2A 2EILB 2G4EA 4U2YA 3AG3B 2Y25A 3IPFA 2VDOL 5T5NG 2BCKA 4JM2B 3RFZC 1J05A 4YGAB 2IDUA 3FMGL 3GSNB 1NC2A 3KW8A 4PRBB 1F4WH 35C8L 3VFRA 5BRZE 4X7DC 3LEVH 2B9BA 3B43A 3EYOA 3IEAA 1OP4A 2UXVA 3BPLB 1ORSB 3DX1A 5L88L 3UPGA 2PWDA 4U9CA 1SOQA 3B7TA 3MLYL 2MOGA 3FU3A 1E6JH 1OB1B 3JWOH 4AX3A 2FD6L 2F54D 2P28B 3PGRA 2WC7A 1FORL 2ZCLH 3MRHB 5AW7B 2ICES 4WHTA 2YGVA 4QXUH 1A8JH 1NFDE 2BC4B 3ULSA 3CK0L 2OMWA 3WFDL 5FFLA 1N8ZA 3RWGA 4PJBA 4HKXA 4FABH 4MCNA 2FQDA 1T6VN 1A1NA 3FF8A 5D6CA 3UTTA 5I73B 1KPVB 5T5FL 5KBLA 2W0KA 4Z95L 2PW2A 3VX1A 4JFWA 1JJUA 4PRPE 1B0WA 1H8SA 1R5IA 4EN3D 3LQZB 2X1QA 4KNTA 1HWWA 1GSMA 5DQJA 4ADJA 2FLMA 2EDDA 2QADB 3IVKB 2W38A 4Z3JA 3ZKMC 1U8MA 5DU7A 5EA0H 3BEVA 2EIMB 4K5PA 1LM8V 1MFVA 4HUWA 5DFVC 4J2XA 1O9ZA 4NRXA 4AK2A 2JJTC 4PG9A 3GUFA 5LQBH 5T1LA 2HFEA 4F37K 3OC8A 4KI5F 2YR3A 2ORBL 3L7EB 1VZGA 2ZKXA 1PMYA 3KCWA 3KH3A 3QISA 3FQNB 3PQYE 2C3GA 4EIUA 2OYKA 2ZXBA 3IDYB 4R7VA 4KO9A 1RURL 3CFCH 3IFLL 5FKPA 3MGOB 2EIEA 3FQ4A 1L0PA 1ZA3A 4HCRL 2JK5B 1FSKB 4LARH 3WCYA 1IFHH 3VB8A 3RY6A 3S3JA 1R5WB 2DTSA 4F7MB 2KQNA 1ZSHA 1MIMH 1U8QA 1VF5C 1YCSA 3BUIA 5AKSA 2IEPA 4NLHA 3GEFA 4JFQA 1D2OA 3PPSA 4RLDA 4L3EB 2C9AA 2DQDH 1TQWA 4NHUB 4UQ2B 4KXCA 3F2LA 3D39B 3K8KA 1C1EH 3DIDA 1BQLH 5EUOB 4YWGL 4PG2C 3T4YA 1SDDB 3RL1B 3U2SA 4KY2A 4BDVA 3ULVF 1EFXD 2L7UA 2QV2A 1TU2B 1S3KH 2WKLA 4N8VB 3V2AR 1GGUA 1AOZA 1FN4B 3C09C 3RURA 2IGTA 1EZSA 1MI5B 3Q1SH 4PGEB 5AOMA 2PCPA 3P9WB 2JB5L 2CLVA 3NZUA 1I1YA 3RTQD 4JHZA 4AJVA 2BWDA 2HLAA 2IBGA 2A1WH 3QJOA 3NIFE 1FO0A