5T5FA

Neisseria meningitidis factor h binding protein in complex with monoclonal antibody jar5
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
226
structure length
226
Chain Sequence
GLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neisseria meningitidis factor H-binding protein bound to monoclonal antibody JAR5: implications for antibody synergy.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
molecule keywords Factor H binding protein variant B24
total genus 53
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2016-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 5t5fA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5t5fA01
3HOLA 1YS5A 4O4XA 4AYEC 4AYMC 2KDYA 4AYID 2W81C 2Y7SA 5EE2A 4AYNA 3VE1A 4O4UA 4O3WA 2YPVA 3PQUA 4Z3TA 4O3ZA 3PQSA 2LFUA 4O3YA 2W80C 3UAQA 5T5FA 4AYDC 4O3XB 3VE2A 3HOEA 4QQ1A 3KVDD 3V8UA 4O49A 2KC0A 4U9CA
chains in the Genus database with same CATH superfamily
1G1YA 5E6IB 3GO1L 3AABA 3TO2B 3UH8A 1HHKA 5EO9A 5KSAB 1I8AA 4X8XA 4JCLA 2A83B 1KC5L 2K9UA 3BUDA 5HGAA 4GP5B 5EU6E 4Q9RL 3GSRA 5JYLA 1DQML 1ETB1 4PQXA 3QNZB 4Y4HA 4WO4A 3UYRH 4HKZA 1NMAH 1F6AB 3RILA 3KEDA 4Z7QF 5AW3B 2N1KA 5GRUH 5JO5B 5JPMA 1Y6KR 2EDMA 3RNQA 5B3JE 5HVWA 4WEBH 1RK1A 5D2LF 4CA4A 5JW4M 4N2AA 3WNOA 1Z5LA 5DZPA 3HG5A 3KGUA 3PJNA 1HOEA 3GMOB 4KPHH 1TZIB 4L9LC 3M17A 3JTTA 3KPMA 1G9MC 1L7IH 2UY7B 1X9LA 5A6LA 3CSFA 3V9EA 1TQTA 4IDJH 4XBEH 3LTVA 1ZGLB 3K5RA 1AFVH 1THCA 1FYTE 5MI0B 2XTJD 1YY9D 4DFIA 4IMKA 1HHGB 2NY2B 1EUTA 1CDYA 4UIKL 4GAAA 1DQVA 2Q3AA 3FF8A 5IR1A 1Z3GL 4W9KC 3LOWA 4FXKB 2HMIC 1JL8A 4P46C 2IH3A 2UXGA 2CUIA 3VFOA 2KXPB 4BH7A 1BFTA 3H4HA 1FAIH 4D7PA 3S35X 2V7NA 1Z9LA 2PR4L 4IHOB 4EDXA 4WEEA 2BVOA 4IOIA 1X5IA 2QMJA 1KGCD 1T89C 4XX1E 3WV0A 5C09E 1WS7A 5SWQB 1IEAA 2YS4A 1SDYA 3LEVL 4HXBL 2YD3A 3KPRE 4P2OC 1RHHB 1T2QL 2R29L 3O3UN 3TH4T 5AZEH 2YAMA 2IMNA 2XACC 3U9UA 2JNZA 4K2UH 4OLZL 4ZS6D 3KPTA 1K9TA 3MRNB 3LNDA 1AXIB 2Z31D 3LDBC 1S78D 2NQDA 3FUKA 1XXDC 1X5ZA 1CYXA 2AEQH 4BGLA 4YHNB 4D9RE 1DBJL 4X5PA 5GS1A 3QDGA 3NCYS 3D30A 1Q8MA 5BCAA 1OQOA 2ZTBA 2HPOA 2FGQX 4GAGH 1ZANL 5BZWB 2DL9A 5L7XH 1DQDL 4FKHA 2WXNA 3SQOL 1IC4L 2G5RA 3NCEB 4PEEA 4YHNA 5AVUB 4V1DE 1UZ8B 2R2EA 3CZJA 1MVYA 3O2DH 1UURA 1DLHA 2ZUYA 2DF3A 3KHOA 1ZRUA 1MNUL 5J11C 1T6WA 1HXYB 2NX5A 3KGSA 1ES0A 4HX1A 1BYNA 4U3HA 4ZW7A 3HN5A 5DVKA 1BPVA 2PCFA 1NCOA 1XF4A 3U0WH 2VR4A 4YSPA 1RZFL 4PP2B 4GYBA 5TF0A 4K3DH 1MF2L 4NUGH 2ITDA 5IUSA 1D5XB 1YPZE 4ONHB 3ISRA 5ADXL 5D9SA 3BWZA 2ZX9A 3W5NA 2DQCL 2H6PA 2IPUG 1XGYL 3MLVL 1Z5LB 4JX0A 1GHFH 2DLHA 5JQHC 4HT1L 4K15A 3GSQB 3GBNH 4LGRB 1ZGLM 4BUHA 3T8VA 1N5AB 1WYJA 4AEHL 4Q9CA 3D05A 4NQEE 4GKSB 1CI5A 4LLMA 2I85A 4KO5A 1GSMA 3NJLA 4HHAB 1SJHA 5BRZE 2BSED 2VXTL 3IF1B 3O3DA 2JQYA 1IRAY 2JELH 5D72L 3TS8A 3T2NH 3O6KL 1GMEA 2VDNH 2CLVA 2H26B 3OLIA 5DL5A 3NSXA 3PWPE 3C12A 4PV8A 1Q9OB 2ARJA 3ESNA 4LCUB 2AKRA 4IRZH 4LLDB 4KFZC 3WTYA 5ENWA 4BSJA 2XFXA 2YKKA 1P5UA 3V79C 4MB3A 2Y5TB 3K6FA 4JG0L 3QUMB 4PREB 4K5LA 3IMTA 4Y4FB 2FCBA 4OFKA 3IDNB 3P0VL 3AAZB 4MA1B 3PRNA 3ABMB 3NJVA 4WSGA 1J0ZA 4H8PA 2YWZA 4A7QA 5C7ZA 2K7QA 1XF5B 3CUPA 5IQ7H 5A2AA 1UA3A 5JUEL 2YD6A 4NQTA 3WO4B 2B0SH 4L8CA 5DHEA 1DE4B 1ET7A 5FC9A 2X2YA 3EG9B 4B5EA 4AKRB 5CUSH 4XGZB 3WKMH 1HKLH 4Y9FA 1WFUA 3ML9A 2WIIA 4KTGA 1A7QL 5IHUL 3I6SA 2FO4B 3KGRA 3S2AA 3ME0B 2KZBA 3LHPH 5EU6B 5F9OL 2XWTA 2B8OT 1XV8A 3OM3B 3K71B 3VSQA 5IGXL 4XGZA 2FUTA 1ZHKB 2J55A 2V2XA 3DVGA 2FD6L 4NM8L 1EAQA 3T0XA 1N9PA 3BZEA 1WT5C 4OW6A 3HZYB 2D7TH 3S2CA 1JZ2A 2XYCA 3EO9L 2BLFA 4IKJA 3BGFB 4F3FA 1XMEB 5M95B 3VJ6B 2YGQA 2J1YA 4AYID 2H9GB 25C8L 5K9KA 1E9PB 4L29A 5GGTA 1KJ2H 2XZCL 3NIGF 3IPFA 2BNQA 3EYQC 3GJFK 5DMIL 2QFRA 5EO0A 4DKTA 4B9CA 3L5IA 1VAHA 3IJHA 4QXTA 4UBDD 3NBNA 2NY3B 3QXWA 4BXVA 2GY7B 1CURA 4PJAE 4LASL 2Z0UA 1S7QA 2MNWA 3BAEL 3FULA 4XOAA 5AYQA 4LP5A 4K8RC 4NS0A 4WY7H 4MQXD 5DHVH 4WTZA 2DM7A 1YYML 5MENB 3TVMA 3O6FB 3V0HA 2JKLA 3HE7D 2D3NA 2CK0H 3J7HA 3VXSB 3US1A 3V10A 5KWYC 1KLGB 4O3XB 1TMCB 4ZFGL 4MMZA 3ZDXF 2HVKA 2J1ZA 3AT0A 5HD8C 2BNQE 5JLZB 5B3JF 3ULUH 4IBUA 4P57B 3OPZL 1R5WB 3ZTJH 4OV5A 3CZUB 1SY6A 4I18C 3RAJL 5EUKB 2UY6B 3T0EE 1B2WH 1F13A 3PDGA 2JLLA 2GIXA 2LAGB 4H1LA 2Z91A 1W8OA 3VW3H 4YFLF 4B7IA 5FDWB 3LN5A 4PYGA 3VY9X 3CC5B 9CGTA 3IDXH 1RVFL 4HHAA 2ZUUA 4NQVB 1M3IA 1OAZL 1A14H 3HLAB 5FA4A 4HCGA 2Y1YA 4ZAKB 2WSKA 4MJ6A 4MDIA 4NUQA 2IQAB 3QQ3B 4KVNL 4MGXA 1E0OB 5KVEL 1G9NH 1U91B 4Y4KC 2G3ZA 3BP4A 1ZSDA 2QTVA 2DIAA 4GKLA 5C09D 2CBPA 2V3EA 1KJ2L 1IO4C 1CZ8L 1OHZA 2UYLB 1W72H 2UUDH 4JNXA 5BQ7B 1KCUH 2IFFH 3C60D 3WNIA 1MJUL 2VRAA 5DUJA 3V0AC 4N2NA 4U3XA 1E27B 1PKQA 3LRSB 2BVYA 1RV6X 3X17A 1NKOA 2NY3D 3Q01A 4GW1A 5F71A 2YD1A 3BAYA 3VTTA 3ZMNA 4E41A 1IGTA 2EAEA 2R4RH 3K2UL 4YDIH 2FR4B 2P80D 3DUHA 3PDOA 4FQJL 3C08L 2Q3ZA 3VXNA 2D0FA 3K2KA 4TULL 2XWDA 4FQPA 2O5ZH 1BOYA 4X4YA 2DMGA 4JL1A 2WXKA 1PCXA 5CLYA 4JPWH 3M1BA 3W81A 4WI3A 5JO5A 1UOVA 4G7RB 3GXPA 4GMSH 4B5ZA 3APDA 1T4KB 2Z8VC 2FIKA 3MTXA 1DBAH 2L04A 2BW4A 4AEIL 1Y18B 2R2HB 3SZVA 2HG5A 5BO1L 3S88L 7FABL 1F4XL 4G70B 3PAUA 5JHMA 3SDYH 4FQEA 1RQ5A 2KUTA 1SGKA 5IQ7L 4FNTA 5FYJH 3PWJA 4NAMA 3SYAA 8FABB 3HVDA 5D7JD 1M57B 5MP6L 4K3BA 4GQRA 2H2PC 5FX3A 5FCUL 3G5ZB 2ADIA 1EJ6A 4EI6B 3P3RA 4ODHH 4P2YA 4XCFH 4ZMOA 5KAQF 1WAAA 5JPNB 1YAIA 5JHDA 4ODXB 2VMDA 32C2B 5JHAA 1FORH 1RUPL 5TDPA 3ZYZA 4A2GA 2B1AH 3QZMA 3LX9A 5CEZL 2I07B 2P44B 1GAFH 3MRLA 5DR5L 4FZ8L 3RL1B 3UYPA 3TTSA 3HFFA 4AQ8C 3VWJA 2HJKB 2HKHL 4WTQA 1QPXA 3HJEA 5DEZA 4KJQC 4TYUA 4MNHA 4MA3A 3BO8B 4MAUH 5CGMA 3VH8A 1T0NA 4GW4A 3UMTA 1EFQA 1G9MH 3ALXA 3RX7A 1QA9B 3T08A 3K91A 5TD4A 5C9KA 2BS71 3TC9A 1GC1L 1CXLA 4KZEL 3VDAA 3ULAB 3WLWC 3SYSA 3A0OA 3OZ9H 3P1VA 4OLXL 5LXGH 1VZHA 1T0MB 2AV1B 3ELAT 4M43L 5E2JA 3MAWA 3GMNA 4AIXA 1AR1D 2DYSB 2DQDH 3W56A 1G5GA 3E80A 4C4UA 4NSKA 5D8JL 1NWPA 1Y07A 3TO2A 1RZIA 4TVPH 3EADA 2VL5A 1A47A 3A0BO 3CZEA 4HWZA 3AA0B 3EH5B 5AW2B 4ZOAA 5L0QC 3HWBA 4JMXA 2ADJA 4PRIA 1GIGL 5DJ2A 4OZHB 1R0AL 4Q2ZB 4XPBH 2NY4D 3V52H 5C0FB 2AK4E 3OB0K 5T5NG 4TKWA 4Y19E 4HKZB 3Q2CA 2P28B 1MDAA 1BEYH 1DJZA 2NY3C 4Y8AA 4L8SC 2EE0A 1LDPH 4U4BA 1WBXB 4TLSA 2AJSL 4ZS7L 4M93B 2FO1A 3CMGA 3WIFB 3ME0A 3K71A 1NJ9A 2Y5EA 1NCAL 4PGCA 3IDYB 3VMPA 4XNLA 1U8MB 4QWWC 2MTPA 1YNLL 4KROC 3ARDC 1NIEA 2X89D 3T1FA 4K3CA 4U7SA 3RDTC 3VYPA 1LDSA 1A7PH 3ARDA 3CWGA 3MPCA 5D1ZA 1JGEB 1AZCA 3SYCA 2ZUQC 2XWBA 1NM9A 1HWGB 4L2YA 4OCLC 2VL4A 3FQYA 2V2TA 1E28B 3MV01 4UANA 4DTGL 2H0JA 1TYRA 1TO4A 5DFTA 1FZOB 4N1HB 1J5OL 5ESVA 5F89A 3N5AA 3GKZA 2BVQA 1YNKL 4I18B 3KAAA 3VMOA 1KB5H 4YBQC 5T1DL 4JVWA 1YNTB 4PTUB 3FQXB 1KUMA 2IGFL 2WBJA 3QBTB 1OWRM 2RHEA 4ZX3A 2G75B 3KL3A 3QORD 1VGKA 1OP3K 3IMUA 1LO4L 4G3YH 5D2LA 4PB0L 3MA7A 4QAMB 2YNKA 4KKCD 2YRBA 3OHXA 4PU2A 3U79A 4I3SL 2W91A 2CMRL 1YPZA 4J4PC 3LPPA 3S37L 1F42A 3U7AA 1G0DA 2DYPA 4G8FA 3KXFE 2Y7QB 3T1WA 2V5YA 5GJSH 4YSCA 1SXZA 5H8DA 1A1NA 4KXAA 1R0AH 1LD9B 3HHSA 3BRFA 2BNRB 4YXKH 4KRPB 1Y18A 2R15A 4L05A 4HG4K 4JRLA 1VEOA 4GIPD 3OC8A 3TP4A 4NQEA 3MBEA 3HNSL 4HBCL 3GSWA 4JW3A 4AYGA 3BKJL 5HI3D 1YJDL 1AANA 5HHPA 2X4PA 3VDBA 2CKBH 4Y1AA 4DFHA 2DBLH 1N59A 3DHJA 1PNDA 2KLSA 1IEHA 1DL7L 4GG6B 4JPKH 1XGQA 3DTUB 4BM7A 4PRPB 4M56A 4QXGH 4LP4A 4OJDH 4P99A 4ZYKB 4XBGB 4NO5B 4YMPA 5EEUA 5GRVK 3DJSA 3RYMA 1YEEL 3OC5A 5DJDA 3H9HB 3UDWC 3PHQA 1PEWA 4G6FD 4F7TB 3D39B 1X5LA 3NA9H 4CDHA 4HUNB 1AGCB 3D85B 4E9RA 4OD1H 3FRPB 5I24A 4OM1H 2EEDA 2XN9B 5I6KA 1BBJB 4OVVA 5CWSB 5C0JA 2FT6A 4WEUD 5HDRA 4F8QA 1IFHL 4XXDB 5AZ2L 3A47A 3L45A 5GGSB 4F2ME 3PWUB 4ZTOL 5ADPH 3KBEA 2GJRA 4PAZA 1ET5A 1TQBB 4IEFA 2WXHA 1PLGL 3FQNA 4J12A 2G2PA 4Q9BA 1JXJA 5DC4B 4Z3EA 4F3FB 4Y5XB 5LXGL 1BVOA 1U8KA 2NDFA 4BCZA 4YHZL 3IAPA 3C8DA 3UTZB 1HEZA 2WLLB 4PG9B 1LEGA 1MHHA 3KYMB 4HD9A 5KYUB 1OO2A 2XE3A 5CILL 5A7EA 4XN2A 4N2LA 5F7EH 5KVGE 4L5FE 3DV6A 5FYKD 1E65A 2VDPB 5AYUL 2P7TA 3IMSA 3FAWA 5HYSG 2X0WA 2APBA 2D03L 2BXZA 5IK3A 3P4NB 1S7RA 1XF3B 1I1AC 5T5NF 3MI6A 5C08D 5I1KL 4QHNA 5AVVB 1BV8A 1BQLL 3OJ2C 3QCTL 3LSOA 1O6TA 4KRMB 1WFTA 2IV8A 3GMLA 1Q1PA 4HCIA 4GG6F 4YHPB 2EC9T 3ZE0B 4UZGA 3ZIMA 2D9CA 3UJIL 1A6TA 4H13C 5FFGA 2NNRA 1OIOA 3BVNB 1MLBB 4NAQA 4YPJA 2PTUA 1PLGH 3O81A 2CGZA 1ZGLP 2C34A 1MJUH 1OK8A 4PJFB 1ZHKA 4ZMPA 4XOCA 2PLTA 3DX0A 4Y4HC 2JKIS 1QLEH 2LLGA 5KANI 4M00A 4ZT1A 3F3HA 1RK7A 3Q8CA 3PAYA 5DEGA 4LRIC 1SMAA 4AWJC 1KYUA 2K6WA 1RZ8B 2XPZA 1G9NL 1NUFA 4JKLA 2H3NA 5KVGH 2F8VA 4X9GA 2VW4A 1SUHA 3SKMA 4KI5E 1QAWA 3QG7L 4X8JA 5I2IA 1NEZG 1EFXB 2CHNA 5D2LB 1F4YL 4YBHA 3WHXA 4AM0A 1DFBH 1Z66A 4YDKL 3RWDA 1YA5A 4OV6F 4KROB 3K3QA 2DKSA 4GLRI 4W4NA 1V55B 1QLEL 1QJPA 3L3DB 5EPMB 3AXLB 1QEWA 4Z23A 2BVOB 4IOIB 2BFVL 5FVNA 3QUZA 1E90A 1MHCA 1PX8A 3BPNB 3F04A 4QXUL 5DHMC 5E5UB 5EOCL 2EUXA 5JXEA 4LL4A 1AHWA 4Y4KA 3WTSA 3GSWB 2M2DA 3PP3H 3QPKA 4RMSA 4LARH 5I8KL 2B3IA 3W11C 1U36A 4XO4A 1ZT7A 4D65A 3Q44A 2Y0KA 4GO9A 4ALAL 4OCSL 4TM9A 3H3PH 5GRVL 3SZ6A 2ZOTA 1J9SA 2YMOA 4R4ND 1XEDA 3BOVA 1DO6A 2LE9A 1O5PA 3PF2A 1ZHXA 4NBZB 2OXHA 3CH1B 4LKCB 4CVWA 1Q38A 3PQYA 1CR9L 4UCFA 3IK2A 1P7QD 1IAOA 3MX0A 4A6YA 3DX9A 3TBVB 1ND0A 3QEQD 1E5ZA 4PJEB 1LEIA 1O7VA 2A4CA 4ZO7A 2JE8A 2YMXH 1UD6A 1AGBB 4NKQB 1UJ3A 2BVEA 3MCLH 3CH1A 3PQYD 4IU3B 5DRXA 4YSAA 1AYOA 5HXMA 4E1SA 4G8AC 2FJSA 3RZCA 4GI8A 5DRNA 3FQRB 3M86A 1HAWA 3F7RA 3BHBB 1O0VA 4ZTOH 2BVPB 2X1QA 4A68A 2JSFA 1E4XI 3IJEB 4I0PA 5DD3H 5CBAA 2ORBH 2BJMH 3MLZH 1WBZB 4LLAA 5B1AB 4HPOL 3AS2A 5JMRA 2FD6H 4HMCA 1SBSL 4UV7L 4PLOB 3FFCD 1U2CA 1R4XA 3RVWD 3W9DA 3OX8A 1TT6A 3MQIA 4LCVA 1JZJA 3AS1A 5D6DA 4CC1A 5BOPA 3QUZC 3G5VB 3L7EB 5G3AA 1UTDA 4ZMQA 1AC6A 3BAWA 3UPRA 5DUBA 5G5DA 3S96B 3IU3B 1G6RH 3AQXA 3S6CA 1MJJA 2PWHA 3APMA 5EBLB 1IEBA 4PY8J 4X6DF 3MLTB 1FVDA 4LCCC 3FUDA 4N2HA 3O8XB 3UTQA 3HI1B 4KHXH 1HOCA 3B5GA 2OXGA 4Z0XB 3QUGA 2B1OA 4NUJB 4UBDC 3MRMA 3VM7A 3NFSL 4Y5YA 3OZKA 3QZLA 3LPOA 4PV8B 3KJ4B 4Z7WA 2XN9E 4R8WL 4V11A 4HLJA 4PW4A 3UO8B 2X09A 4LCIL 3TPUB 3QGVA 4FMSA 1E6JL 4R90H 2WPGA 2EQDA 2FLRT 2Y69B 3COOA 4JJHA 3DX4A 3W38A 3WELA 3JWNC 5HVHC 1A2YA 1ZEAL 2CH8A 3MRMB 4BSVA 3NCJH 5JIIA 3HC0B 1HXXA 1EEZB 1QR4A 2W65A 3H6AA 5D1XE 5KAQG 3OMIB 5DJ6B 4TSCL 2GVYA 3TEXA 4WKZA 4XNQB 2VCOA 1G84A 4EI5A 2APVA 2ATKA 1SLUA 5CGTA 5CEZD 3O6KH 2X4QB 3PYCA 5EO1A 1XF5A 5C3TA 4DSYA 4JDTL 1JDCA 3NH7L 5TE7L 4KK6C 1I9IH 1ZV2A 2YRZA 2B1AL 3FQTB 3ZZQA 1T1YB 3MLSH 3GS7A 4XNUH 1HHGA 4LCWA 4PVNA 1F97A 1G7JA 4ZFOB 3APCA 1UWEH 4K7PL 4FXTA 2CBMA 3L54A 3NSGA 3WJMA 3HC3H 3S3BB 2AXJA 3G08B 3QQDA 4AGLA 3AW5A 3IXTA 4G71B 3VWKC 5IW6B 2XG4A 2Q76B 1F3RB 2NUPB 1D6VL 5F7DB 4G8GD 5FYJL 3P0VH 2YAPA 4LSTL 2ZLDA 5AW8B 4FQ1L 5EDXA 3FCTA 3MN8A 3ZO0A 3A6CL 4HIIA 2LU7A 4DGIH 1R1CA 1SPDA 4ZMLA 1PZ5B 1TYEB 2TRYA 1WS8A 5DRNB 5JR1L 3DK0A 3F7QA 1TTRA 1RAMA 2YFNA 4NBYB 2EYRB 4JUSA 1GZQA 2OI9C 4K94L 3Q2WA 4NQDB 1CTOA 4WW2B 2IBZX 1FGVH 5DI8A 5F88A 4HWNA 4LL1A 3T20A 2C9UA 3SDAD 2IWVA 4WWNA 2V5TA 3HTLX 2H5UA 1RZKL 1KBWA 2GHWB 4H20H 3SPJA 1W72A 3BUIA 3WFDL 4CMHC 3PQYB 4N8PA 1WUNT 2WWKT 1OLLA 2J43A 4BUMX 1J8RA 2XVLA 4ZD3L 3JZYA 5CIPA 4K5OA 3HIZA 2DLEA 3U2SB 5J3HC 1KV7A 1PNCA 4PP1D 1JHTB 1OGAE 3P4MB 4XVTL 2XZQH 1E6OL 2WQVA 3Q3GA 4M7KH 4PRHD 5F6HJ 4K7FB 4PJ6A 1WA1X 3VFWB 3BLPX 1XSKA 4QKXB 2VLKB 2YMTA 2Q20A 1P2CA 3MLSL 4WU5A 3VM5A 1FO0B 2EDJA 4ONGH 4RMWA 3ZTJG 2EIKB 2FHFA 3OHXB 1QTYT 4N22A 5CBAB 4Z0XA 1KYDA 2AZAA 2MHAA 3NQIA 1ZVSA 4B41A 1LWHA 1TJGL 4L9DA 2NY6C 3KXFA 4MA7L 3LNIA 3VXOA 3IBOA 4G5ZH 2WXMA 3SGJC 1EZLA 2AP2A 3WBDA 3T4YB 2Y7LA 2VZSA 2EDQA 3ESMA 2DEYX 4MHHI 3X3GL 3EBHA 3FTUA 4RFEA 1BG1A 2A9AA 2P48B 4KK6D 4G75A 1GJUA 5LN8A 4P05A 4PJ8D 2X3CA 4KTEH 5I6OA 1DBKH 5GSVA 1IU1A 3TBTA 4LSTH 1THQA 5FCUH 1U95B 3WNJA 4PJCB 4BFJA 3D4YA 1T16A 2OXHB 4LKCA 5IB5A 1JGEA 2P47B 4GRMA 5B39B 2FB4H 1AY1H 1GXEA 4G6JH 5F93C 1DQJB 1MG2C 2V2WA 3GBML 3TIEB 1PMYA 3VRIB 2AV7B 2C1OA 5C0CB 4KKZA 4YSTA 2PTTA 3O0RL 3BUYB 4AYFB 4X9BA 4YDZA 1ACYL 5IVXA 4KJYA 2RALA 4ZPVB 2R1XB 4PH8A 5TQ0H 4NUPA 2O6CA 1AS6A 5F21B 3DSNA 2GSIA 2C4FT 3AG4B 4Z3TA 1N64L 1H3UA 2R1YB 2R2BB 3DMMB 4B9ZA 4IHBA 5IB2B 4U3CA 5T1LA 4FI7A 1ZKAA 2VLMD 4QD2E 3BZ4A 4FD0A 3RX5A 4AQZA 1R3KA 1KXTA 4J4PA 3IFPA 2R4NA 4OGQC 4R0LA 4WFGE 1XF3A 4M5TA 1AQ8A 1XB8A 4KRLB 3OKMB 1RZ7L 1A4KB 1VFBB 3BVVA 1AGDA 2ZSWA 3B2DC 1G7JB 4PMFA 4JFEB 4QGTA 4IOFC 2HJLA 4WCYL 1IL1A 2BOBB 3QK0A 2Q87A 3PAZA 1OAXL 1BVKA 2W92A 1WG3A 1HHIB 1QFUH 3MDJA 5KSVB 1RKRA 4JFQB 1FYTB 4GRWF 1YEIH 1TZGH 1KNOA 2BVTA 2JJSC 4EOWH 4TNVK 4FADA 3MC0A 1FV1A 1AO7E 4RZCA 4L23A 4XVSH 2OR8A 4LDLB 5DHYA 5HVHB 5F0PB 2FSDA 3FB6A 3M07A 4NRYB 3VWJD 5MERB 3QIBB 4B9KC 2IANA 1XR8A 1VACA 1BM7A 4HSCX 1J0YA 3HZ3A 3E6HB 5AQ0A 3LK2B 1HZHH 4ZO9A 2QBWA 4RZKA 3WCYA 5ANMB 2ADIB 3CVHA 2R8SH 2LW3A 5I5IA 2AITA 3FUFA 2O61B 4M1GL 3T4AB 1AMXA 5JW3H 1D5IH 1WISA 5TH2A 3AAAB 3MOBL 4OCMC 1FZJA 3VD7A 3KPRB 3MKKA 3HI1A 4OIIL 1A7BA 4LEOA 3MSPA 1VFAB 4MLIA 3ZK0A 5IREA 3UTSA 1KT2A 2XFGB 4AZLA 2V3FA 3T6WA 1JNHA 3LQAL 5DEFB 5FM8A 4YDJB 5LKNA 1BQLH 1OM9A 3PXHA 4AW4A 4D9RD 1J1XH 3SGDH 1S9YB 2N01B 3MJGX 1F2QA 3SPHA 3FW6A 4RL9A 2OSYA 1C1EH 4HAKA 5F3BA 5E1AB 3BP4B 3QWOB 1V8HA 3GIVA 4MQ7A 5HVFB 1PJWA 3SOBH 4JRFA 3TX4A 1RUML 3D51A 4CUCA 2IFGA 3KS0J 5AL0A 1V7ML 4NSKB 2GC7C 1TUPA 1U9KA 1E40A 3KPRD 4WW2C 5F0MB 1RJZA 5DRWA 5FIEA 2Q7YB 3WIHH 4X6DE 4GT7A 4V1DB 3PWLB 1DVFB 4UDTA 1P6WA 3POXA 1NUGA 3C5ZC 4MSWA 5D1XD 3ARDD 2LV4A 2HFTA 1AI1L 1U8JB 1EHKB 2FQFA 2ITCB 4FNRA 5FW6A 5IMMB 4TQEL 3JYCA 2FWUA 3V0FA 2IXQB 1S5IH 3AS0A 4KXZH 3IU4H 2X87A 3IDGB 5DDHB 2QGDA 4RJWA 1CGSH 1RZPA 2V0AA 3BH8A 1Q9KA 2FBJL 3BKCL 4MXVF 4X5XA 1QRND 4N0CD 2MNHA 4OF8A 4OKVA 3L1GA 4CGTA 1KCLA 1A4KA 3ZPDA 2WLIA 4D5UA 2YJQA 4PCSA 5BS0B 4PGBB 1CIUA 1R3LB 1ES0B 3OGCB 5INDB 1S8DA 5IMOB 1MCNA 3DYOA 3I2CL 4LO9A 1IGFH 1YN6A 2E6QA 3TVMC 3HKFA 4DPCX 4XN7A 3WKML 1G7HB 1ICTA 5IFAH 3SJVA 4GF4A 4OV5B 2JKRM 5E6ID 3KPLA 1GMIA 5ESAB 2KZWA 4O51B 1NGPL 3DWTA 1NGYB 2WINA 3HZKA 1T2JA 1BFVH 2MNJB 3WS3A 4XRCA 1DEEB 1QEXA 4GEJA 1MH5B 1BXVA 2E27L 2X4SB 3FK3A 3B7TA 4Z7OB 2X10A 4BELD 3OKKA 1J05A 1O6VA 3MYJB 4PJFF 4YSDA 1DJIA 4JREC 1RPUA 3CFKB 4U1MB 3WE1A 4MJIA 1F1AA 2OFQA 4ELMB 1PG7H 3HB3C 5CMAA 2PKDA 1UWYA 1Y1DA 2IF7A 2VW7A 3W1ZA 3WGVB 4PJBF 4PJCE 1NEPA 3AAAA 2GSGA 3CFJB 1Z9OA 4IOSA 3QCTH 3KLHD 2IV9A 3B3IB 3LK41 4ZDHA 4BE5A 3TGXA 4PB0H 1M3JA 4L4TD 5DVPA 4JQXC 5I6PA 3SBWA 3I2CH 3TTYA 4FLRA 2FWOB 4YDLC 3FCUB 1PZAA 1F4HA 1NFDF 2XN1A 1FN4B 3HMXA 1MZZA 3MOAL 1I1AB 1XDTT 3BH9B 2ZWSA 4W4OA 2DDQH 1CD1A 1DZ0A 4N8CH 3RFRA 2EKJA 4KKAD 2IIJA 3B37A 3T9WA 2D7OA 3NFPA 3L4TA 3MRIA 3FXIC 4AEHH 4QXWA 5CINL 1I8MB 1PX3A 3UO1L 3LN4A 4AIZA 1DBMH 1X5FA 3CUPB 3BKJH 1IKFL 3MRRB 3VFNA 5IEKB 3QUXC 4HVBA 1CDCA 5G5DB 3S96A 25C8H 3V6OC 4U1KA 3DURA 4LBAA 1J5IA 3CFIC 5DJ8A 1MF2H 4G43B 4AX3A 2VZ1A 3AWFA 5GGTH 1TQUA 3FQUA 4JS7A 4AC4A 2AANA 4TNGA 3B2PA 2DMBA 5ENWB 1JAEA 5FUOL 1H0DA 1U41A 2DIBA 5IW1B 1FC1A 4MJHA 3RDJA 4AQAB 4LSIA 3QDME 1HL8A 4B96A 1WTLA 3PGDA 4W9ZA 3N55A 3LN9A 2WM0A 1VADA 1YEFH 1NTDA 2ARJQ 4UT9H 5DLLA 4PJIE 1XH1A 2WP3T 5FA3B 4TQ8A 1BIIB 2F19L 3LQAH 2DI7A 3V4PL 3IRZA 5B4MD 3SGKC 3FCTB 4YHLL 3I9PA 3S3SA 4HJEA 1OTSC 12E8H 2GQHA 4I89A 4BEIA 3PUCA 5IMMA 3QIUC 3UTTB 1KPVA 2DDQL 1IZNA 3IN0A 5C08A 4DK3A 1G90A 3V6FA 1DVUA 4J27A 5MEPB 4LP8A 1NLDH 2GITB 2G2NA 2BNQB 3IXTB 1NEZA 1RFDH 4YC2C 2NQ3A 1U30A 3RWHB 3NZ8B 3HS0C 3RWCA 5GXBB 4UQAA 4GKZA 4APQD 1JNNL 3FFOA 4OD3H 3GZQA 2CK2A 1BEXA 2I7OA 4GAYA 4NENB 3T0EB 2OSLB 1ZHWA 2EEBA 1HJBC 2XBDA 5EE2A 1RUQL 2ICEC 3MNVB 4JFPB 3ZDYB 5HDBF 3ZRCC 5KYWB 5GRZA 1MIML 2OJEB 1J5HA 5JDJA 1BWWA 5K33A 4LSUL 2FGZA 2VXSL 4J4PD 1GFPA 5DMKB 4WTWA 1HXKA 4HKJB 4ZAKA 1RIVH 3TEWA 5T3XL 1LP9B 4L0ZA 4YHLH 5DRZB 1RURL 1HU8A 2SEBA 4QR7A 5KSBB 3WHXB 2DQCH 1XF1A 3ZYIA 3BXNA 1V05A 4LLVB 4N8VB 3S0PA 3UBHA 4DPAX 4RX4A 3HUJF 3QYNA 3GSQA 3SE6A 2GJ6E 2BSRB 5DDHA 1BVLA 3RJQB 5HPOA 5DHDA 4C47A 3QZNA 4Z7AA 2VUOA 1WGOA 4WI4A 5E2WL 1F4AA 2NLJA 3IDMB 1AD9A 4HUXA 1I1FA 2DMCA 1IAKA 2DQEL 5DD0H 2V33A 4OAWA 4GO8A 3ARFB 1D2OA 5DCCA 4O49A 2J4UP 4KAQL 2BVQB 2W07B 4F15B 2EDBA 1IAII 1ZVSB 3S37X 3BFQG 5ITFA 4WSKA 1ZLUH 2J6EL 2WAHA 2YARA 3F64A 1QSEB 1JGLL 5DHXB 1CICB 1XGTA 2X4RB 3A4DA 4P5TD 4GRLB 4WLCA 4ZMZA 1AS7A 1LILA 5DURB 2QVMA 1VEPA 2XU9A 2HUEA 3KJ4C 1M1XA 1VFBA 3GMPB 5CJXC 3UO1H 3Q3GB 3ULUD 1CICD 2W1NA 1DBKL 3TEYA 2QPFA 3HMXH 5ESQA 3WEXB 4L4VB 3IETA 3GNMH 4Z0BH 3APFA 4LLMB 5AENA 1A14L 1U4EA 4FP8L 2QHRH 3FU8A 1AGBA 3MOAH 3ZXAC 4X6EB 2WXOA 3D3VE 3OBAA 1QFHA 4L0PB 4GP8B 1M4KA 4JZJC 3WFZA 2EDRA 4OIFA 5KBDA 1FBIH 3QJTB 4UQCA 3HR6A 4ZXBA 1YMHB 2O6EA 4ANWA 1WCBB 3OXRA 4RWYL 4E1TA 2YBRA 5D7SH 3V5KB 3R7QA 4YXHH 3EGXA 4KXDA 1JF5A 4G8GE 1F45A 3LKPB 3ARUA 3NCJL 4LCUA 3PJSB 4IRSC 5F7WC 4XHJC 3LQAC 4PWGA 1KGXA 3PWUA 3QAZC 3P9LA 1A6VL 2AZUA 1VADB 3K2UH 4YDIL 3BP6A 5GHWL 1ZLWK 3F58H 2A74C 2JB6A 3MRKA 5IWLA 1OK0A 3PU7A 3NJJA 4UT7H 2RJMA 1A9BB 3CZLA 2ERJB 4QRRA 3JWOL 4Z78A 4FNQA 3QPQC 4JRYE 3NCXA 4K71B 4AXWB 4XMVA 3V6OA 2A3TA 3FB7A 4OLYH 4F7TA 4E9TA 3KLHC 1BPLB 3B9KC 4A39A 1RZQA 1NLBH 2R9HC 4N2CA 4O4YH 1YQ2A 4AG4H 1MHPL 1DO5A 4QRRD 3ULUC 1RZKH 3FB8A 1A6WL 3SE4C 3T3ME 1JZEA 4MRBA 3LKSA 4RGNC 1F4YH 1T04A 4LKXB 5DRZA 1WLHA 1E9PA 1UUNA 3RL1A 4LZKA 2WWOA 3WENA 2Z4QB 4DKFL 4EZKA 1TEYA 3BRZA 4HPYH 1C5BH 4LLQB 4QIRA 5DMIH 2X5PA 3MFGB 3VXUB 5G4NA 4LCCA 2HN7B 2W8CA 4R7VA 5FUCE 4LIQH 4HIQA 4FG6D 5L2KE 4HLZG 1CD1B 2SODB 4O4UA 3CDGB 4KUZL 4GSUA 1WZ1H 4N8UA 3EYFA 4KY1H 2UUDK 5L4JA 2BOCB 2RMNA 3SSGA 1PCSA 1OCOB 5E6UB 3WIHA 2O5YL 4PGCB 4YR6B 4FQHB 2DQTL 3TBYB 2VQ4A 2HJFA 5A2KH 2P5WD 2VLRD 3KPOB 3D7PA 3FOMB 1MZYA 2DPKA 4IKIA 4FQQB 4P9HC 4Y5YC 3EO1A 1BQ5A 1MVUB 3WD5H 4UM9B 1BZ7A 4NKIL 5HJGA 2ZOKA 3HPJB 4KITB 4JFYB 5I1CL 3UTSB 1USQA 1T22B 1L7TH 1CDJA 4F2EA 2F53A 4WW2A 3UFIA 2QSVA 1JRHL 1WUZA 2CNYA 3GJFB 5D1QE 5IW1A 1J0IA 4MASA 4WV1B 5MEQA 3DIVA 5CJQL 4ZMAT 1KLFA 1M1SA 1UXMA 4OCSH 3TO4D 4C4KT 3QYCA 4J23A 1A9EB 2OTUB 3RIAK 4IBQA 3ULVL 1OXYA 2GJZA 4WJKB 3RRQA 3VD9A 3CLEL 2ZWNA 4YUEH 3NJNA 2WXFA 2C7UB 4Q6KA 3LD8C 2DWDB 2RACA 4F57H 3VFVB 3NFSH 4X7FC 3D4CA 2Y6TE 2CGRL 5GGVH 1QABA 2A7BA 3CFEA 2VW6A 4EBQL 2FL5B 2HXAA 3F01A 4HGMA 1EZVX 5AVYB 3TBWA 5FKAA 3TYGL 3AAEA 4EZJA 2APTA 2WB1A 4PJXA 4HUUB 1A02N 4R7NB 2YXWA 5GGQL 4MNQD 1DHKA 2YAEA 3K72A 2HKFL 2RH0A 2X4NB 3NCBB 4X9FA 3CFBA 4JFFD 4K8RL 3IDGA 1N59B 4XNYL 4IS6A 5TQ2H 5ALCH 2FJFA 3P4MA 4IGBC 1J86A 4WI9A 3LHAA 3SY7A 2WCSA 2X70B 1I7TA 5ID1A 5BO0D 4V2CB 4ZUSA 1EJOL 1U95A 4QJ5B 2EE6A 2FGWH 4ALAC 1MHEB 3WNNA 1PLBA 1B0WA 4I4WA 2BXYA 4M5ZH 4EOWL 4V1DA 1PKQE 1UGKA 2B2XH 2IG2L 3BFOA 4WWKC 1QJ9A 2DWSA 4AJ0A 4LDOB 1FVCB 4K3JH 3WUWA 3AY2A 3D39E 5JHLL 3I84A 5GHWH 1ZVHA 2BM3A 1JHLL 2CGYA 4JG5A 3O6FA 2ADGB 4PS4H 4PUBL 4UT7L 8PRNA 3Q9QA 4HETA 3PHAA 2CUHA 1PBYA 1XH3A 3ROLA 4PJ8A 5E4IA 3G04A 3RKDC 3O2WL 4PJ9C 2DTML 3QIBC 3RIFK 1MEXL 3QAQA 2AQQA 3G5VA 1IGYA 3O4LA 3J27A 3M8OH 3PFUA 3JV4B 5J1SC 4CVUA 1FNLA 1U0QA 1UVQB 2FO8A 3JWDL 2WO3B 2AXTO 1DQKA 1JFHA 3MROB 1TXKA 5EU4A 4TNEA 2GCYA 1U8PA 2BP0B 3O4OB 3SHSA 5J1AB 5AAWC 1DUYB 2BIHA 2VM9A 4NNYA 4JZOA 4P2RA 1FZKB 3OMAB 1M7UA 1MI5E 3RY4A 2VN7A 1ZIAA 1P7KB 2ENYA 3WKYA 4Q6IA 5B38A 1IVLA 4MB1A 1A6PA 3ETBF 4TTDD 5H37H 4LEEA 2YD0A 2V2XB 4IEFB 1R34A 4KY1L 3P3TA 3FSVA 3ZDZF 4LVNB 3KYOA 2CD0A 4AE0A 1TKWB 3PV6A 3JWDH 1FIGH 3D3VD 1HILA 4N2DA 5IFHH 3ARSA 3G6JB 2OMXA 4S1SH 3SKJH 2QV4A 3FFDB 2IAND 4PJFE 1E5AA 4GS7B 2X9WA 1AACA 3B3IA 5EA0L 2OSXA 2BVUA 3GLAA 5E2WH 3HEIB 1I75A 2OLDA 3PNWA 4ELKA 3CZKA 5KSUB 2VXVL 4JDEB 4ORGA 1P4LA 3OLDA 3FZUC 4NQUA 4PIRF 2GT9A 3WDHA 1T83A 2K3TA 1RI8A 2ZNXA 3WEAA 4B95C 3K72B 5I16B 1UKQA 4UUJA 2EIJB 6TAAA 4PJGB 4YJZL 3GGWA 2WLMA 3RDTA 1MRDL 2X1WL 3A6BL 3BZDA 4JJ5B 2R2CA 1U8OA 4R5VA 4NKDB 5FLUA 4XO9A 4GT0A 2IPKA 2B9BA 5FM5O 4WSJA 5F3BB 2P1YA 3MGOB 4RSVA 3BX7C 8CGTA 2XXMB 3R7RA 3MLPA 5K93A 4XVUD 1U8IB 2IAAC 3MV8A 3P0YL 4G9DA 1L9OA 3RX8A 3IRCA 4WRLA 1KLUA 3FU6A 3ZSTA 3F83A 3WEBA 1L0XA 1O6SB 3DGCR 4AM0B 3WJMB 4MX7A 4XN5A 1KENL 3SKMB 4HPOH 5EB9A 3CFUA 5IB5B 4ZW8A 2ZYHA 3GXMA 3TNMA 4DZBA 3B2UC 2K78A 4XNAA 1T5XA 1CFSA 2EADA 1GH7A 1YUHB 3F65A 4EQ3A 4NO2A 1GA2A 1PG7L 1RFDL 2QR0B 4N26A 3ZDZB 1T22A 5IJCC 3QSKB 4QNPF 4K73A 4ZPTB 1GGBL 4I3RL 4WJG3 4NQCE 3CIQA 3S48A 3L3GB 5EIIG 4ZPVA 4X0KB 4N3TA 1C9SA 4W6YB 2WVTA 2P52A 3SYBA 4UNTA 3X1EA 4H1LG 4P4KA 4G82A 4GXFA 5IFAL 4FCAA 5C70A 4IMLA 1XD0A 3HNTL 4JR9L 1X4YA 4JFWA 3RGVD 1KXTB 3FTGB 5CCKH 5GS2H 1TTCA 2JCCE 5C0BA 5C07B 3N0AA 5ABDE 2IAMD 2VAJA 1EHNA 2GJ6D 3GHEH 5JIHA 3IJEA 4I0PB 2EDNA 2JWYA 5ABZA 2RD0A 4ZUTA 4HKXB 4KGJA 3QR1A 3NJMA 3MJ9H 5CJOH 1RZGA 4JPVL 4BRVA 3ETTA 1H3VA 3TOPA 2YO3A 1EO5A 1ZEAH 2HA1A 2X2JA 5I17A 3WFHB 1QMUA 1MCLA 1IKOP 1QRNA 1FHNA 2CDGB 1ZV9A 3BH4A 3I6GA 1IKFH 3JVGC 5F7NC 5CZKA 4PBDA 4R2GB 2CDEB 3MNZA 1R17A 2WBJC 4UOZA 3SBWC 3MBWB 2VDMH 3MRPA 3R1GL 5DQ9A 4ACPA 2F1AA 2XETA 4HUMB 5BVPH 5IVXB 3V7AE 1PKQB 1VF5C 1U2HA 4LVEA 5GS0H 3VE2A 3LK2A 4HPYL 5IJBC 2VUYA 3FHEA 3WI5A 4WFEE 3L5WB 1G7QA 3O3EA 3QIWD 2OMFA 3F5WA 3O9WC 3U4EB 1B3IA 4G8GA 4DUVA 5DZOA 3LKPA 3QFJD 5GIRA 5D55A 4M48L 3K80A 4QDGA 1KPRA 2W60A 1QSED 3CBKB 4N2OA 4AFKA 3KDMA 2CPCA 3OWEA 5HDBB 4OZGE 4KMQA 4XAWH 3VG9B 1JPSH 3JSSA 4KHTH 3VXRD 1K8DB 3I3EA 1B0GA 2WQRA 4KK8D 2O6PA 3BUYA 2JJTA 4Y16D 2MQGA 1S7UB 2AW2A 3LH2H 4PREA 1GYVA 2A6KB 2J5WA 4PFEA 4A7SA 3HZMB 5I75B 2NUTB 2X41A 4B9PA 3ZE2E 4Z7OF 2AK1H 3MRQA 2EO1A 3D25B 3QIBD 4M6AA 3GMMB 1FA4A 1CB4A 1OOAA 5K9JL 1A3QA 4BCYA 2ZE0A 3FHAA 4WY7L 4GNKB 4QHMA 2IWGA 2O30A 1X9RA 5DL8A 1UKSA 2XG4B 4XAKE 4ZUUB 1J9CT 4OFVA 4MD4B 2XBZA 3BEVA 2FQDA 2E8ZA 5BZDA 3VD1A 2NNCA 1LDPL 3CX2A 4NO0B 4JFFA 4GSQA 3WNLA 2IDUA 4RDQF 2ICEB 3OXSB 4NCDA 2R59A 4PJ8C 3N44F 4HBQA 4LU5H 3BPOB 5EO1B 1ZT4A 1TJXA 5IVXF 5CEYA 1JZ6A 2FJUB 2IXQA 1OZUA 4AT6A 1WO2A 2ZYSA 1AO7D 1EVUA 2Q7NA 5FB8A 1NL0H 1UM6L 1MJ7L 4MMZC 4J3BA 3A22A 1GR7A 2NYKA 3O11B 4M8RA 1QBML 2EYRA 3DVGB 1G1OA 4KOCA 3QZBA 4GHBA 4K3JL 3DK2A 4FFZL 3QH3B 4KY2A 5D6CA 2Y2WA 5JQ6L 4M9PA 2D7PA 2E7MA 4NFBA 3EUUA 4Y0GA 2OMBA 3CHSA 1UADC 5A2IH 1RUKL 5CSZB 4N2IA 4AQ1C 4YGAB 5D1ZB 3PL6D 5TDOB 3MODL 4DIXA 3ZL4H 4Y4HD 4JM2B 2BP8B 1FL6A 1HKFA 4HKBB 1MN4A 2H1LM 1T2XA 4LU5L 4FT6A 1HXMA 1OCCB 2V17H 1EAJA 2XN0A 4IIQC 3U36B 4DQAA 2MEJB 2NNFA 1JPTL 3MNVA 3M8OL 1M7XA 3ZE1B 4AMWA 3PQUA 4WU5B 4H0IA 4G8EA 3CVDA 2ED7A 1NC2A 3GKWL 4CILA 2ZJSH 3VD3A 4PRAB 4JCMA 4K5MA 1ZWIA 2CDFB 5E2TH 1E4KC 5AKRA 4NZDA 3TCLB 3QO1A 4MBOA 4N85A 1FNFA 2G4EA 2KC0A 1EPFA 4HP5A 3HUJB 3SBQA 5HYJB 1YEDA 4PVMA 5ACMA 4E41B 4O02A 2B59A 2A9NL 4ZUWB 3BT2H 2MRYA 1KJ3L 2WJRA 4JCWA 5I6LA 4LK4A 5HHOE 1S7SB 3N50A 5F88B 2D3VA 1QLEB 4XOEA 5J12B 3P77B 4I3SH 1JSYA 3GKWH 2FK9A 1RIUL 2I27N 1I1YB 5C0AA 2DD8L 2M1KA 4ZTEA 5FPIA 5FKAB 1PZSA 4LASH 1YEEH 1AR1C 2BMKB 4ODUB 4YZWA 3D0VB 3ZY7A 4UYPA 5ISZD 3D87B 1F11A 4KK9C 5DJYA 5IBUG 4OZIB 1NBQA 1BBDL 1ZJAA 2IQ9H 2XI9A 4XZUA 1OY3B 3DGGB 1RUKH 3C6LA 2GUOB 3C2SA 4KZDL 2XV6B 3QB7C 5DJDB 5HYQB 2OA9A 1CT8B 1KCVL 4EI6A 2UVFA 3GMPA 5IM7B 4PWKA 2VZUA 4WI0A 5JIQA 4OZIA 4K71C 3JWNH 1BGXH 3QA3B 3HFMH 4QRPD 1B4LA 3AITA 3BKML 4H44C 3ZTEA 3LNEA 1TITA 1MCIA 4HCFA 1XXFC 3WMQA 4PJEF 4RGNB 3DSNB 2TSAA 2MCPL 3VI3E 1NGZB 5B3SB 3KYOB 5G2NA 4LPVA 5FA3A 4Z7VA 3QRBA 3QZPA 1WIPA 4RISL 2JQAA 1OM3L 5T33L 3ARBB 1XF4B 2OMZB 2NNAB 1BSIA 1RVFH 5I5MA 1MHPH 1N6UA 4LSQH 1AO7B 3L08A 3BEWA 3QUYC 3N43F 1M1XB 5GRJH 4JM2A 3GBMH 1FFPA 1J0KA 4NC1C 5CS7A 4G6JL 3BP7B 4KJPD 3VSUA 1CFVH 2MOVA 3VXME 3VSVA 3CVHH 3KZ8A 1RP8A 1JWMA 3ARFD 3O0RH 1KXHA 1QUPA 1UZ8A 5AVRB 1VA9A 3D0LA 3KHQA 5I1LB 3GHBH 4LPTA 3MV7E 3RBHA 3T0AA 1MPFA 2EEFA 3CHRA 3GTNA 4OZGB 5DJ8B 2J56A 3L4WA 1CO1A 3V0EA 3BUTA 1HS6A 3L2NA 3S5LA 3ZR6A 2O5NA 4O58L 1OF2A 1OPGL 3NABL 1KCWA 3J07A 2IDTA 2I25N 4ENEC 1UT1A 1C7SA 2WYHA 2Y2YA 5T1MB 4Z18A 2N0MA 7PAZA 3VD0A 1MLBA 2Z0BA 4Z3FA 3MRIB 2ZXQA 4ELDA 2LT9A 4FDWA 5EN3A 3WJJC 4WFED 1AS8A 3C6SA 3WJJA 3FC8A 4ONGL 1ZVNA 3GSNB 3HZVB 2WXLA 3E8VA 4OBRA 1GY1A 2D0HA 1EDQA 1Q0YH 3TN0C 4DJMA 4E2OA 3C5ZD 2VSDA 3ARZA 4JANB 4O02H 3BAKA 2O1AA 3MLUH 4JDVA 5FGBC 2WXRA 3U2IA 3EJPA 4U1LB 3QUXA 3CQFA 2YD7A 3VRJB 1HDMB 3KPMB 2HT4D 3Q9PA 4IHOA 4Y9GA 4EDXB 3UTTA 1CXFA 2PTVA 3OAZH 1X6NA 3L81A 3NIFB 3B9DA 1A6UL 3SO3C 1Q94B 1XT5A 2JV6A 4G6KH 3N43B 1R6VA 5F7LB 2P5WB 1JGIA 4TPRH 5DL7A 4FEIA 4LPWA 4DO6A 1LE5B 4GKZB 2JIXA 4JM2C 2Y1VA 1SJVA 1MREL 1S7SA 3K6NA 3B8SA 4ZFQA 5E8DL 1XQ4A 4UNUA 1TZOA 2VMCA 4HCRH 1K2DB 3LHPL 3A67L 3B7SA 2C1PA 4HWEL 2QKIB 1WITA 2H8PA 1XGUA 2ZCKH 5DMJB 2LAAA 4L8SA 4QMEA 4G9DB 1A2YB 5E8PA 5EN2B 3US9A 1G7PA 3DBXB 3LIZA 4BKLA 3TIDB 3PP3K 3SGDI 4XP5L 5BS0A 4FOZA 2AI0H 3CHOA 5CSBA 5AG9A 3HNVL 4B7LA 5KANG 4Z7UB 2QGCA 4JFHE 4HAGA 3LIUA 3WXWH 1UFUA 4G8EB 2OCFD 1JK9B 4TVPL 3L3DA 5EPMA 2DQGL 3RDTB 4RAVA 1TTBA 4GIOA 1HSBA 2VO5A 1FPTL 5IQMA 3U4AA 3FSWA 2V9QA 1SY6L 5F8RC 2DMKA 2OTWB 2YR3A 4JHUA 5TE7H 2CR3A 3PUUA 2M8XA 4WVRA 3KVDD 4JPIB 1WTGT 1V7MH 1ZTXE 3W39B 3EH4B 4PJ9B 5D71L 4GRMB 1YEDB 1NKRA 1RZGB 1HHJB 4OZGA 1SLVA 1WD8A 4ELME 2QGEA 2A9MH 2FX9L 2TSBA 2C3VA 4PGEA 4OQ1A 3MRGA 1L9SA 2DLGA 3I50H 1KYOJ 3OL2A 1RPKA 2LGNA 4G9FA 4X4MA 4ZDHB 4ZOEA 3VQMA 4BK5C 2TRHA 2FBJH 3TU6A 1DYZA 4FL4B 4B50A 5E1GA 2E9IA 5AVTB 1IJNA 2O5YH 3KL5A 3FUHA 4GG8A 4LQ1A 4OF0A 5IVZA 2F7QA 4LL9A 1DN2A 3AG2B 3LNGA 4NO5A 2HFEB 4BXSV 3O6FD 4Q74A 1CFVL 4L1SA 1U58B 2Z4QA 3D18A 1PDKA 3MRCB 4BZ1A 2OYMA 5KVFE 2NY0B 1OEZW 2XJKA 2V7HB 5EU3A 3BAEH 4XNKA 5KVDL 2CJ3A 1WFIA 1CYWA 1C5BL 1MHEA 2O4VA 3JV4A 1JTOA 4O9HL 5DT1H 2CIKA 1SXSA 3MV9A 4QHPA 3MRPB 2NY7H 4FQXC 4EUPG 4XCNA 1DN0A 2FSEB 4P8QA 1BXUA 1T20B 4XBPB 4G42A 4WFFE 3HAEA 3NSFA 4KMTL 1QO3A 2HLFD 4K8RH 4F58H 5A40E 2H6OA 3IF1A 5E99L 4DN3L 3BP6B 3KJ6L 4MD5A 2UXFA 3GSXB 1PZUB 4U4IA 3WFHA 2I5YH 5DWUH 5F44A 4Z77B 3AUVA 1JV5A 3LS4H 3NJKA 1NFAA 4P2RD 1KJMB 1EANA 5E4OA 5J8OA 2AABH 5BRZB 5CXPA 2BRRH 2HT3C 1FVEA 2CLZB 1NIFA 2YAQA 1PRNA 4B9YA 2CGRH 3FTWA 5GGVL 3MNZB 4EBQH 5GGRY 4WHDA 2WYZA 5DLML 4F1SA 2R1WA 2MCAA 3TASA 2PYEA 1SOQA 1G7PB 2W0PA 4PJIB 5BJTA 4MFHA 1NINA 2JK5B 3WHE0 2H32H 2IOIA 4MHHG 1S5HB 4YFDB 2J12B 4BZ2H 1OB1A 3MBXH 4H5SB 1F6FB 2HWZL 1A7QH 3HZMA 3LRHA 1EFXA 1WBXA 2XA3A 3P3UA 1SRDA 2B39A 1KELH 3FN9A 2G9HB 3QQ4A 5GTIO 3ZT7A 2LR4A 4AGNA 3Q6FA 1IZNB 3NMEA 3QJQB 2CBTA 3G6AA 1U2YA 2VT0A 1MEXH 1SEBB 4BZ1L 5EZJB 4QRTB 3C8HA 5AB1A 3VFNB 5BW7A 5ICZB 3GSNH 3OD3A 1I9JH 1KIRA 4Y4KD 3MLXH 1U3ZA 5DLMH 4DW2H 3GB7A 1SXBA 2EECA 5SV3A 1E3XA 1ED3A 1YEIL 4MAYA 5E51A 3EXLA 4LPYA 5F1KC 3QJFA 1IM9D 5BVJA 3BZ5A 1RY7B 2Y72A 3NRFA 3C2AH 4QOKE 5T1KA 5HGBA 1XR9B 3CDZA 4WK0B 3ZDYE 1MRCL 1T1XA 3I85A 3B3BA 5DZNA 5EEWA 1AXSB 2APSA 3PGDB 3MO1A 3B7YA 4ELKB 1L0PA 1TPXC 3ECWA 3FUIA 4CU7A 3JTYA 3MV8D 1XZWA 1LP9E 5LUMA 3A21A 3NZHH 1S7RB 3D2UA 5E1HB 3AT8A 5KSBA 2VDKL 1IBDA 4A6YL 4JVPA 3KM1A 5E8EA 5IVNA 4UI2A 3UZVB 4Y5VC 2LFGA 2DMHA 4L9LB 1JF1B 2AJUL 2R4OA 5D5MF 1QWNA 4U33A 4XMTA 2OMVA 3L3HB 3ZZ1A 4RAUB 3FOMA 5J13B 4I0PD 4JFOA 1L9TA 2XZCH 1C16A 4NO3A 3O0EA 2BO0A 1XCXA 4YE4L 4RLDA 4W68A 3TBBA 3VWJB 1Q9OA 2ARJB 3MJ7B 5E8PB 2AJVL 3FKUS 1IV8A 3WFDH 3S8WA 4YXKL 2WLZA 2OM5A 2WHVA 4I48B 4Q4IA 3SEPA 3X1FA 3QEQE 4P48A 5I8EA 2YD5A 4FOMA 3ZOAA 1E5CA 4RIRB 1KJ2B 4HLEA 6PAZA 3G5XA 5IROA 3CBRA 1NCIA 4LVOC 5C0BD 1JV2B 3N41B 1JNNH 5L4IA 5GS0D 4LMQI 1LK2B 3VXSE 5HYJA 3UEZA 2BWIA 3FQ2A 1G9EA 1KYAA 3GT6A 5C2BH 4G6AD 4Z3GA 5LXVA 4JKPL 4P5KA 2PPDA 5EEVA 3THML 2DLFH 1CFNB 3CMOL 3QCVL 4X99A 3REVA 1S7VA 3VG0H 1G9HA 2YD9A 1BHGA 1UD2A 1X5XA 4J3TA 4PHZA 4FGMA 5D1ZI 5SX5K 1MXGA 3U9UB 3R4RA 2VDKB 5A6MA 5I66A 3BKCH 3EYOB 2A5UA 3PS6A 4MD5B 2VE6B 1A4JB 5EU7C 3KM2A 1RJZB 2Q7YA 4UZUA 4X4YB 2X6VA 4U1NB 2VGLM 1HWWA 1Q90A 2IAMC 1NAKL 3LS4L 5DJYB 4IYKA 5EO9B 5B39A 5KSAA 1XIWC 2BIPA 3D39A 2PCYA 3BQUC 2EP6A 3CG8A 1IMHC 1JN6A 4PVBA 2RQEA 1DQIA 1Z0MA 1UG9A 2HG5B 2WCPA 2XUWA 3BWAB 4KAQH 7PRNA 1KXVA 3STBA 1LEKB 3GHEL 5IMLB 2RGSA 1LP9F 4XN8A 1AAJA 4Y2DA 5C1MB 3D18B 2Y1AA 5TGBA 1A8JH 4GUOA 1H3XA 4R90L 4GFTB 3QUMH 4X5WA 4LHUG 5DGQA 4PBVC 4AH2A 2FLMA 1OP5H 3FZUD 4JZOB 4F7PB 4RMRA 1AZBA 5I74C 5I76A 3GM0A 3QNFA 3C8KA 4O2CB 5J56B 1DN0B 4G59C 2WKGA 3VO0A 5CHNA 1TEFA 4FYTA 3L5WA 3E6FA 1TVHB 1A5FH 2WUCH 3FL7A 3JV6A 5EF0A 2X28A 1KB9J 5MI0C 4R84A 3VXUE 3KL0A 2A77H 3CH8A 1N0XH 1TKWA 4W9JC 1KIQA 1UWEL 1WBYA 2DYPB 2GIYA 3CDZB 4GSRA 4K7PH 4OJYA 3AA6A 1RK0B 5HSFA 4GKNA 2FTAA 1HYSD 2BSTB 5DA0B 1IGCH 2P3YA 1Z3RA 3N44B 4G7VL 4MNGB 4P46B 4Z9KB 5LGJB 1EMTL 2IH8A 1OW0C 4IRJB 1OW0A 3KWTA 1P53A 5B7FA 4HJIA 2E7DA 3LB6D 1FZKA 1NAMB 4UOW0 3GSUB 3V4VA 3P0YH 1OPGH 5FGBA 4ZMTA 5FO2A 5D2NC 4ONFL 3CV5A 2WLJA 1JTPA 1KJ3H 1JGUH 3UTSE 3EJQA 3PGUA 2L4OA 3I6LE 5F6IC 4BQCA 1PG7W 2ZUWA 2R0KH 3K0WA 4CU8A 1JHTA 1OTTD 3BQUA 3QH3A 2WD0A 1HI6A 4X9HA 2A9DA 3H3BC 4PB9L 4PR5B 5SWZD 2ZWLT 5TPWH 1TFPA 2Q6WA 1LK3H 4BUQA 3WUWG 1MAJA 4JFHD 2WNKA 3CVHL 1A8ZA 4B3VA 1D9KC 3RTQA 2X4UA 3N06B 1PW3A 3MMEA 4MXWH 3EAKA 3FQWB 3KXFD 1PFCA 1HTYA 3BZEB 4BH8A 3CLFL 2F2HA 1ZHYA 5DGRA 4NQDA 2LHAA 1BZ7B 2Z7UA 1CGXA 5GTHO 4PD4K 4K2UL 3AB0B 3FN3A 4OLZH 3V6BR 2VNCA 2JH2A 4QOKB 3BESR 4L37A 4ZFFA 1T2QH 2R29H 3OGOE 4P2QD 4A63A 5MHSD 4DHLA 4JJ5A 3BAXA 3MX0B 3P69A 1VZIA 1EO8H 1BFOA 4BWUA 4TPRL 5B66O 1NMAL 4LHUD 1RMFL 2ICWA 3EFFA 5D7LE 1DVSA 3VDCA 4OFDA 5I15L 2BHZA 2VISA 5FXCH 1K2DA 2LOEA 1DVFA 3UDWA 4OZHE 4UV4H 3LXBA 1AYRA 2BFGA 1XVSA 3DYMA 3G7TA 5LDUA 3CN2A 2J71A 1T3FB 3VWJC 2XXGA 1I7RA 4X7SH 3RWGA 2XXCB 3S9DB 1MCJA 4TQHA 4R9HA 5K9OB 2PF6A 4IMLB 4OCWH 3QWRA 4Z76B 2Z4TA 2EDEA 2R2EB 3MOQA 4I85A 3IXAB 2X38A 2PYED 2R0KL 3HOEA 2W60B 2VYRE 4OM0H 3UBFA 3UP6A 4CSZA 5BMFH 4QF1A 4RA0C 2PXYB 1F4WL 1RUQH 3NFNA 3O41B 3W0WB 3T0DA 1JXGA 1P2CB 4ES8A 4YHML 4OB5L 3QZOA 4OIBA 3IJHB 4P46D 5F97E 2WB7A 1S7TA 3ZDXB 2VZ3A 1MDTA 3OV6A 3VZTX 3RVTC 1GJIA 1TYJA 2Y0HA 1QHQA 4OCRL 4YO0A 2B59B 4WU7A 4JY4B 1AKJA 3L1OL 5HJBA 3BPCB 5HYIA 2NZIA 1TMQA 2ENPA 4PV9B 4LPXA 5I0DA 4NQCA 2R51A 3LKRB 1OF0A 1TQSA 4ODHL 2FZ3A 5D7IA 4M7KL 3HG1D 1D5ZB 4M1CC 5MP6H 3L9RB 5GS0C 4PWHA 3H53A 1J05B 1Z2KA 4RAVB 5EZPA 4WFFD 2W0LA 4NN7B 5FGRA 1CPUA 1ZT1B 4ZQKA 3KXFB 4DGWC 2OL3A 3QFGA 1IGIH 1K4CB 1BYOA 1SJEA 1D9KD 3JYBA 4J28A 5ALCL 5H4ZA 4OGYH 2AKRB 2IEPA 4GBXB 5TDNB 4AUUA 2IBZY 3MMEB 3AADB 4ZZFA 4JN1H 4EZMA 2Y07H 4AQEB 4PPTA 5FA4B 3D2UD 3F7KA 2KS0A 4WF7A 4JFEA 5IB4B 2ZICA 3ALWA 2R4RL 1YEGH 1TCMA 1NQBA 2BY1A 4OF3A 5JYMA 4QTIH 1J8HD 2YD8A 3P2TA 1YAZA 1AZRA 3HE6C 4XAKD 5CP7A 5AVZB 3AA1B 5F0LB 5E8NA 5ICYA 3WTXA 3TO4C 4PJ5B 1H3TA 1PYWB 2D7MA 4GG6E 5ADPL 2YAOA 3E1ZA 2EINB 5B22A 2UYLA 1O9VA 3TV8A 2IBGA 5EBGA 1T1ZA 2JKSA 4OF6A 3NN8B 1A7OL 1A1OA 1N26A 2YUVA 3QXTA 5HGHA 4GXVL 3ZTCC 1OSPL 4KZDH 2BZ7A 2DY2A 3FO9B 1KCRH 4XNQA 2R4SL 5EIIA 4JE4B 1NFDE 3VTMA 1EZUA 4AXWA 2C9SA 5DYOB 3EFDL 5IQLA 4N74A 4DQOL 5LGKA 5H94B 3ROOA 1M9WA 4HWUA 1MCRA 4Y9EA 1RCYA 4ODBD 1XGPB 3LQMA 4XNXH 4GQZA 4MDJA 3Q2VA 2XPYA 4P2RB 5TQ0L 3BT0A 4K3HA 5GGQH 4WGKA 1PY4A 1NC4D 1I8LC 3HUJA 3CN0A 4D0BA 4ODWA 2VDOL 3IVKA 3L3OA 4L8BA 2YHGA 1EGJH 2P5EB 3CDYA 2AJYH 2XQ0A 3F7YB 3L2MA 5LB1A 3KH4A 5IHLB 1NGQH 1R75A 4FXKA 4DGYL 2D31B 3AT9A 3R0NA 2X53A 5GRWA 4FRTA 4ZSOA 5JW3L 3UJTL 1MUJB 3QYMA 1Q94A 3ULUL 1DDHB 1ZS8B 2HTKD 2VQ1A 3PHOB 3FT0A 2B7DT 3MLXL 1VFAA 3QEUA 2GTZB 4FFVC 3SDYL 1GFNA 1RL1A 4L8DB 3PNWB 1D5IL 3OLGA 4NQCB 3UAQA 4Z76A 2DI9A 2YPVL 1G6RL 2I69A 1LL1A 2PP8A 2R0WH 4I9WE 1KJVB 1BLIA 5DF0A 3QUXD 1I3RA 5J6HB 4XVOA 4F7CB 1MFDL 4XBMA 3CZSA 3HRZC 1U92B 4AIEA 5TQ2L 1YMMD 4JFOB 5D6CB 4DPRA 4LE8A 3SKOB 4EUPB 2PWFA 3V0IA 1HIML 2VABB 2C8NA 4KXCA 4AUJA 2JCCB 2R83A 2L7JA 2XY1A 5C07E 1TJIL 2AK4A 1JI2A 3BJ91 4PJAF 3ZKNC 2D2CC 3T6VA 2QVKA 2ZCLL 4Z3HA 5LAXA 3WJLA 3GSVB 1GW6A 5IF0A 1DVFC 1K72A 3VFMA 4WAFA 4U1MA 2VZOA 4ABWA 4EIZC 4FQXD 2VDQL 1SYVA 4WWOA 3MUGB 4N2BA 3KLAB 4NC0B 1U8LA 2FJGB 4MX7B 3MCLL 2FRGP 5DVNA 4PJBE 5F1NB 2F53D 1UENA 3LRSA 3T0SA 2YZ1A 4WW1B 4YHIB 3S3CB 1IQWL 3V6ZA 3CVIL 4N1EA 4XPTH 4YPGA 1NCBL 3ILEA 4HUWA 3V52L 3BZ4B 3T2OA 1ACYH 1W6WA 4KNQA 1NIDA 4DKDC 5KVDH 4XN9A 2VKWA 3H9HA 5CZVL 2M06A 4X8CA 5E00A 3EYOA 3O3BB 5F6HI 4MJIB 2XKNA 3ZKQD 1A7NL 3W0WE 5H2BB 1EERB 4NKIH 3NYKA 5KS9A 2QTEA 3W2DL 4AQOA 1HT6A 4GRWB 5T1DH 1KB5L 3OSKA 1KGWA 1E2VA 3H54A 3FF7A 1VPOL 4UM9D 5E08H 3X1BA 4OGZA 5GGRA 4NN6C 3S34L 3DJRA 4I77H 2W5PA 3KH3A 2FAUA 3STZA 2A74A 2QPSA 4U05A 3KPSE 1SYSA 5E94A 2HT2C 2X4TB 4MNQA 2XRAL 3AREC 4G11A 4J3VA 2ZX7A 1N8ZB 4XP4H 1HWHB 3HC4H 2WZ0A 3GRBA 4U0QB 1U8NB 2JJVA 4N28A 3ZE2B 2YGNA 5F7EL 1BOGB 4M48H 3SDCB 2Z8WC 1SOSA 4NFCA 1Y7VA 5D7KD 2YEZB 2BIQA 5D71H 5LWYH 4P2QA 2XCMC 2PYEE 4R83A 2NXYC 4XX1G 3NPSC 1Z1WA 1N5AA 4CU6A 4XCFL 2J7LA 4XNMB 1CFNA 1B90A 3REVB 3J8F7 1WGVA 4L1DA 3F12B 4W1TA 3TWCL 1J1OH 5BVPL 3QRFM 3ZUNC 2A83A 5F96L 3TN0D 1AH1A 1H6UA 1F2XK 2VDML 4NEHB 2Y3AA 3QORC 1GFQA 2BWDA 2WNXA 5D8JH 3QHZL 1A22B 3IJYB 2C9XA 4MVBC 5HY9A 4Q0XH 1QQDA 2G60L 3ZT5A 4X7DC 2ZX6A 5FK9B 3BSZL 1EJOH 1QLFA 4QJ3B 3MBEC 3JWOC 1SJXA 2ZOWA 4YK4C 3AU1A 1J1PH 5EA0H 5GSRB 4F5CE 5BNXD 1SM3H 1K4DB 2MNUA 3CFDA 4KZCA 5CAYB 4P59L 4B6ZA 1RU9H 1ZE3C 4FZMA 2V4LA 2XNAB 5B4MC 2ICEA 3OXSA 3P11L 5I71C 2CCLA 1CLZL 4FLHA 3LZPA 4UOJA 2WANA 3EO1B 3KDPB 4P07A 3RP1A 1HHHA 2EDWA 3SCMB 1LXMA 5BUAA 1TIUA 2CO3A 5A2CA 2MWCA 2OULB 4NM4L 3DJTA 1FCGA 3S97C 2CO7A 2G60H 3NRQA 5E9AA 1HCYA 2PWEA 5E0FA 2GBAA 1ZLVH 4HXAH 4P2OA 5CWSA 3VWKA 4OJCA 1GVIA 1UATA 5KSVA 2G2RA 3AA0A 5DQJB 1J5CA 3ARDB 4J6RL 5CHNB 1F58L 2EDLA 2NY4C 3KNBA 1TQBC 1ANUA 4MQ7B 2XJLA 1SF3A 1S5LO 4LSUH 4AE1A 2HX8A 4H88L 4I3RH 7PCYA 4E9VA 4C57C 3IMWA 3D0AA 4N6RA 3THMH 3G08A 2N56A 3VXTA 5DI8B 2R7EA 3FYXA 1G7MB 5D7JA 3L3GA 2EDHA 3HUJE 1UM4L 3MV8B 3DGDA 4HIXL 3BRDA 3DTXA 2DWEB 1GJWA 1T83C 3GTVA 5C3LD 3F6LA 2PORA 2NSMA 3CVIH 3QJFB 2EDFA 1P0SE 4IBVA 4C83A 3DA4A 3C5XA 1LJMA 1QI4A 5HHOB 1KN4L 5IHZA 3AWEA 3PNRB 4MNHB 4AK1A 3CDFA 4R2GD 1RHFA 4BUGA 4JFZL 4XXWC 4X6FB 4JO1H 3GS0A 4JFQA 1JZDC 2NQCA 1UD8A 4GAYB 4NENA 4NKMA 3T0EC 1T3FA 1OCWH 4X4XB 3MR9B 5EG6C 3ZUCA 3CSYA 3X13B 4J5VA 3GJEB 3SY6A 4QPEA 5IB1A 1QOKA 1NGXB 1JZ3A 1P4LB 5E08L 5E9NA 3WIIL 5FYLL 4XVTH 3LKRA 3V6FB 5CEXB 3WU2O 1GS8A 2IAMB 3MKGA 4NKMB 1CBVL 3KBFA 5T3XH 3LQZA 4OZIE 3S3JA 3TA4D 3QDHA 4PJ9A 5DJXB 3T5WA 4A7UA 4Y9CA 4KPHL 4H8WL 5ANMA 1DVTA 1GPOL 1LE9A 1C08B 4RFEB 5HYJD 1WJ3A 3JBG7 2DD8H 2EH8H 3QPXH 5FM4A 4L37B 2ICWJ 4K9EH 2CQVA 2P46B 1JV5B 3QJRB 3IDIB 3IGFA 3RPKA 1UJ3C 4DP5X 1EQWA 1KT2B 3O2DL 4PRID 4TNWF 4F8TA 3MRJA 1EDYA 1FNGB 4ZUTB 3SY0A 3UPAA 1IC1A 2Y36H 2NYYD 2WLYA 3IM1A 3QJUB 2YIHA 3C5JB 5DJCA 4ATWA 4C00A 4GAGL 3POUA 4CC4A 2C3XA 4FE9A 3WIIH 5B8CB 3FU3A 3EG9A 5PAZA 5KBKA 2KHAA 4DGYH 3QWOA 1DBJH 4QNPE 3BEWB 4AZ8A 3X1NA 3ZE0F 2AEQL 3FDWA 1KC5H 4MJIE 3DA0A 3QI9D 5F72S 4H26B 3PIQA 2XTQA 3RB7A 3IB4A 3R0MA 3U46A 3KYAA 1U8LB 1WZKA 2F6AA 4IU3A 5DRXB 1ONQA 2Q86A 4RA3A 4L1BA 4LLYA 1B3JA 1I3GH 3IRPX 2QADD 2W95A 3OB0H 4JJOA 2FZ3B 4E9QA 5JXEC 2VDOB 2DLIA 4PGJA 4BQ9A 1AGEB 1XB6A 2R0WL 3OR7A 3C6LC 4RRPA 3SBPA 1H5BC 5CN2A 1WHPA 5FOJA 1F86A 4QRPB 1PSKL 2ZSWB 3HMXL 1TZ8A 3S36H 1G7IB 3NPSB 2AQRA 2V37A 3AGVA 3FT4B 4AMKL 1FFTB 4JN2A 5LHDA 3HFML 1SJHB 1VHPA 4Q6YA 3DJZA 3HAEH 4RGMB 2RAMA 3HZVA 1R3KB 4IRSB 2UZXA 5EBMA 2PYEB 4PJIA 3QORB 4DO5A 2J6EH 1GGCH 5BJTB 3MV9B 4A7TA 2YUWA 4JRYD 2G3XA 5JIPA 2H1PL 5KBMA 1GSKA 2H0PA 4LGPB 5I8OH 2A74B 1G43A 1URIA 2GI0A 4AM0Q 5BS0D 2COQA 3IPEA 1ESOA 1HYRC 5F70A 2BCMA 4YN3A 4OZIF 3AB0C 3GGWB 4RDBA 1GC1H 3MUHL 2K4TA 1ILUA 4MA8L 4GG6A 2IGLA 3DX6A 4N8VG 4JPWL 4XNDA 1J9QA 4JAMB 1CLCA 1IKNA 4Y4FA 3WS3B 4HEMA 5GISH 4C54A 3SE4A 3SZDA 1A6WH 3RKPA 1EZVY 3U0PB 3C60C 3O8XD 4QTFA 4QXGL 2XQYG 4N24A 4GXUN 1C1EL 1BZ9B 4JPKL 2CUMA 1FO0A 4QYAA 1NIAA 1RIUH 2JKTM 3JTTB 3QT2A 2X12A 3HI6L 1ZPLA 4CVZA 2UVEA 1MRFL 1N12A 3ARBD 3A24A 4FFTA 3DETD 4WDIA 2GFBB 1R5VB 4XXCC 1GGCL 1MM4A 4PRDB 3KG5A 2XMXA 1DEDA 4M02A 1PLCA 3VXPB 3U2SA 3AXLA 5E9DA 2NY4B 4TLUA 4ETQB 1U6AH 2BDNL 2VXSH 2NPLX 3FQTA 3O9WD 5AAMA 3EJCA 1K8IA 3D12B 1E9OB 1XTLA 2F1EA 2Q1EA 2N59A 3P4LA 4KUCF 3UAAA 5HYSB 1WP6A 4CMMB 4LDEB 3RWEB 1HNFA 3QISA 4LPCA 4FESA 2A2QT 1I85A 3QI9B 5HGGS 3V4UH 3WFBL 5ANME 4ENED 4IIZA 4XO8A 5KYYA 3EJYD 4FNSA 1HSBB 5DEFA 1S9VB 5CGYD 4PR5A 1NC4B 2F15A 3SKOA 4EUPA 3UXFA 3O2DA 4NDMB 5C9JA 2VC2B 4U6HA 3T65A 3MACH 2ITEA 2J8UE 2R23B 3WD5L 4BFFA 3WDJA 2DQUH 2ODJA 3MV8E 1AG0A 5EN2A 4B0MB 1U6AL 2BDNH 1BD2A 4QGYA 4AV0A 3GJFH 2WQAA 2EE9A 4F7MA 2Y23A 1ZHBA 3JVGA 4IJTA 1U3HB 2F19H 3HW9A 1ZA3B 1DJYA 2CRYA 2DZEA 5BZWA 4PJDF 1AD0A 1L4IA 2VRKA 4WIQA 4MMYA 1CIDA 2OL3H 2I5YL 5CP3A 3LD8B 1MWAH 3UIYA 3MRHB 2HSIA 4KNSA 1ZDSA 3PP4L 4HUXB 3BUPA 1JF1A 2PPEA 2ZCKL 5E8OB 4L48A 1URZA 5E2UH 2GHZA 5JA8B 5TE6H 4E41D 3P02A 1M7DA 3EDJA 3ZO9A 1KBGH 3HMWH 2CJUH 3ULVF 4PRBA 2QLVB 2EUZA 2APFA 2NY7L 5EORH 2C4FU 5HJ3B 5EU4B 1QSFD 2F9BT 4OLEA 5JW4Q 3UX9B 2IMMA 2J8UA 2OI9B 3O3AB 3WN5A 1QR1B 3OHMB 3O45A 4GBXD 3QWRD 3Q8AA 4RLCA 4N2MA 4JO5A 3O3DB 5CKAA 4EXKA 3V4PA 3CFKA 1NANI 4CMHB 2BSDA 1EFXD 4HD5A 5DUBB 1VACB 3CVCA 4KTYA 4WCYH 5ADOH 2E7BA 3D2TA 5E56A 3G04B 5E6YA 4FFYH 2NRDA 3F12A 4AEEA 3AAEB 1BXAA 3QEGH 3OPZH 5DK2B 3V55A 3ZIYA 4P2AA 1KULA 2Y5TA 3K7UA 3C09C 3KPLB 5K1NA 4POZC 3C6EA 4DW2L 2ETWA 2OL3B 1HCZA 4HBCH 5CD3A 4MDIB 1BVZA 1A6VH 1WAPA 4CVZB 4WI8A 5EV7A 1ZLDA 2UWEE 2XTSA 3MRBB 2X40A 4F2FA 1PQZA 1WC7B 4U1JB 3OHXC 4U0RC 5HI5D 3A0HO 3DX1A 1MNNA 4WW1A 1NWOA 4YHIA 2V2WB 4UB0H 5I66B 3ZKXC 4A2DA 1OP4A 3DRTB 3FU5A 4JUTA 1D6EA 3EH1A 6CGTA 2FSEA 4XE0A 5CUSL 3UACA 1ZTXH 5E6IC 4HUVA 5SX5H 5AUMB 43CAA 2FBRA 2CIIA 2XE2A 1ZE3H 1H6FA 4ZOBA 1P4IH 3SDXE 2X4QA 3PG2A 1UWGH 3KDMB 1T1ZB 3ARRA 3PV6B 1K4CA 3GQFA 4PCYA 2XC8A 5DO2D 1JWSB 2ILLA 3U9PL 1S3KL 4ISVA 1TLMA 4KQ4H 4NO0A 1NSNL 4BA0A 2NY6D 4P3CL 5ESQB 1M2VB 4ZO8A 3WEXA 3M1BB 3PL6C 3E38A 3MFFA 3PWLA 4MQSB 1HE7A 3GB7B 4UDTB 5A43C 1CDUA 4UTBA 1PD1A 2BRQA 2Y36L 4HGWA 3VFUB 5F9WB 3PJLA 1CBJA 3ZW3A 1IE5A 3ATBA 5DO8A 1D5BA 4G7QB 4X6BB 4OQTL 4S0SD 3MNWB 1KENH 3DUUA 2BOBA 4CN1A 2J3SA 3N1FC 2EDOA 2G3MA 3ILPA 2DQHH 1EO8L 1S7WB 3HS8A 2ROXA 3DUSA 3UG5A 4NRZA 1CG9B 4E5XA 1QG3A 2W9LA 3OJDB 3Q8FA 4XI5D 3F8UB 2AXWA 4AI7A 5IFHL 1GIGH 1NUNB 3VFPA 1N70A 1NC4A 5FO9A 4KO6A 2DAVA 2E0PA 4GUPA 2A6IB 3OAUL 5AD0A 1JNJA 1HZLA 2XX1A 3KLKA 4E9YA 2QEJA 1X5HA 1Q1JL 4E42A 1CGVA 1J0JA 2VITB 5HHOD 2AAVA 3OR6A 4OSUL 3RBGA 3W3BA 2CR6A 5F96H 2UZXB 5C0EA 1MG3C 5ABAA 5IR1B 2Z8RA 2CJTA 3QDMB 1AOZA 2LFUA 3IT8D 1UEMA 4OGXH 5LCVL 4F93B 2DB8A 1EEUA 1GGIH 4JEGB 5B39G 5I2IB 2WWMD 4OD3L 3QJZA 3BGMA 2Z1KA 2WBJD 3FB6B 3GLEA 1GAFL 2YPLA 3INOA 4UQ3B 5I0VA 3FTVA 3SKJL 2FECL 3QEQB 4UTBL 4G5ZL 1JZ7A 2PUQT 1CDHA 2OYKA 3FSAA 1DJHA 4U1HB 2K7PA 1BM3L 3EO0B 4XODA 1JHKH 4GW5B 5I5JA 1ZLSH 3UTTE 1KLGA 1WFMA 4HWZB 1BQKA 4BD4A 4FNLH 1NC2B 3TNMB 3NUKA 4FC3E 4MB4A 4EVNB 2HTLD 3P30L 3QIWC 2FDBP 2WINB 3HZKB 4YL4A 3UERA 1B4TA 2VC2H 5CIPH 4HA1A 1NDGA 1IUZA 1OAKH 2AQSA 4M5ZL 3WNPA 3ZN6A 1ZT7B 2E4TA 5IESL 4UWQB 3HR5A 4M5YL 3OAUH 3LRKA 5LLIC 2AJUH 1MFEH 3RLSA 4NNXA 1YNTF 3N40F 3OVUB 3RVXD 3TURA 5EZOL 1JPGA 4H20L 2BNUA 2QZ5A 1OSZB 2GK0A 4QY8B 3KS0H 3TYFB 4D0CA 2VOTA 4Y19D 2OBGA 3MCYA 5E5MB 3R4DA 4XPAL 3DURB 2DWEA 1SHMA 1W6LA 3C08H 4Y4FD 1BEYL 4FQJH 1LMIA 4G8IA 5IP4A 1HESA 3T8XA 5GRYA 3DMMC 2WLKA 4I0PC 1CLOL 2G0LA 4OJFH 4ZX5A 5EC2A 3V0DA 5HGHB 3IU4L 5TJWK 1QFWM 3MV7A 2AS5M 3ESVF 1X4XA 4LGSB 4ZMXA 3QHFH 3C9NB 1XCQB 4UM9A 3UP1A 4YLQT 4PRPE 3GSOA 4R4NC 2VRQA 1W72L 4NBXB 3KBPA 2GG1A 3ZL1A 1RZ7H 3GPEA 1OP3H 1DBML 3VD2A 4P49A 1OSYA 1WDAA 4BFBD 3ETBJ 1NGXA 1E27A 4PUXA 3DV6B 4HS6A 1N19A 3U30C 5FFOA 1HYSC 4G8FB 1CUOA 2VDLB 1CXEA 1VGEL 2UZPA 4FQLL 4MAZA 4X4ZA 4Z7VE 4NZ8A 4M8VA 3KYNB 3QRAA 4XH2B 3VE0A 5HHQB 2H6UA 3OR6B 1QI3A 3KPPA 1LO3H 1QNIA 4WEBL 2MHAB 5CMAB 4ETYA 2XKUA 2OW6A 4OLUL 5LN4A 1QSEE 1G0YR 2RIKA 4KI5F 1MJJB 2P5ED 5K1VA 2DQIL 5TGBB 1PZ2A 1PZ3A 3U0TA 4MZIA 5DR5H 2RFXA 3QCUL 2JTDA 4XMXA 2HZHA 2J2ZA 3DO4A 1IM9B 4X8GA 4XXDA 3WL9A 5I28A 1AGDB 1UYWL 1SHSA 3JV6B 5IB3A 5HY9B 3JWNE 4NKOB 3MOBH 2ZAIA 3F00A 3T4AA 1OB0A 1KDJA 3PABA 4PUBH 4CKVX 3H4FA 15C8L 3D3VB 3EBAA 3OMZA 5I18H 3UTZA 4D3CL 4PJHF 1YQVH 3QARA 5JPNC 3FT4A 2Q9OA 1FFRA 1NGPH 3FBQA 4YDKH 4JAMA 2VDOH 3E3QC 2JI1A 4KRAA 3V0VA 3L17A 4PW3A 1A3RL 5DJAA 4YSEA 4WO4B 4KJYB 3ZE0E 2PRNA 5CZXD 4GMSL 1T0NB 1CFBA 3PXLA 3X14A 1KXQE 4OCXL 2IH3B 1REIA 2G9KA 5DO2C 1U8OB 2PPAA 3CZNA 4NNYB 4JRYB 3VCLB 2FX7H 2M26A 2O5XH 1UT9A 4AV4A 1QSVA 2R23A 5ID0A 1I7UA 1N5YH 4O3YA 1CGWA 3DOHA 4I1NB 3T3MB 1MPAL 5C0GA 4PGZA 4FFYL 3ARPA 4O2EA 3S3PA 6FABL 3U4BL 2JKNA 4I88A 2V6HA 4J3OC 5D7LA 4BINA 3GHPA 3AY4C 3NSJA 1HH9A 2H9GA 3ASNB 2DEXX 1E4HA 3DV4A 5IV2B 2ZP8A 5E99H 4DN3H 1DJWA 4Q2ZA 2VN4A 1MWAB 3GIVB 4A1RA 1GL4B 4AGOA 3TBSA 1GZPA 4TF4A 4MXQD 5IFJB 1DFXA 3EOBA 5L2KB 5FUCC 5EEXA 3GUTA 3VWKD 2NY0D 4ETQA 1VCAA 4C8XA 1HKLL 2LU5A 3D9AH 3QRGH 1UJ3B 4LOUD 5H37G 2XT1B 1JRHH 3GMNB 3EGSB 1T21B 2WBWB 5FHBL 3WFBH 4E0RB 1NCCH 2W94A 3TFKC 2Q10A 1JCKA 1NCJA 1ZANH 2HB0A 5I18L 1OALA 2N2LA 4HC1H 4M29A 3BRYA 1P7QA 3QDAA 4KNTA 4S1QH 4IJ3C 5CEXA 3TLRA 2Y22A 1XCQA 3FFDA 4E42B 4UTAA 4C4BA 3JZ7A 4YVUA 3E2HB 4OUUB 4QXVA 5DZVA 3ESOA 3WN5C 2XOTA 4M4RA 2CA3A 2IWFA 3SPVB 5DD5L 5LVEA 5IBTH 4UTAL 1TEGA 4G80B 2W80C 3MYJA 2WBKA 3CN4A 1LTXA 3BS0A 1M6OB 1G0XA 2XG5A 5I82A 4NOFA 4J7RA 2GI7A 1OP9A 3VXOB 4BFKA 1TSHA 5CD3B 2P8PA 2VXQA 1QJ8A 1I9RH 1OAJA 4KVCL 1U3HA 4N9OB 3RWEA 2HT4C 3P73B