5T5FL

Neisseria meningitidis factor h binding protein in complex with monoclonal antibody jar5
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
DIVMTQAAPSVPVTPGESVSISCRSSKSLLHSNGNTYLFWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTSFTLRISRVEAEDVGVYYCMQHLEYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neisseria meningitidis factor H-binding protein bound to monoclonal antibody JAR5: implications for antibody synergy.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
molecule keywords Factor H binding protein variant B24
total genus 48
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2016-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t5fL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t5fL01
2WBJC 2W0PA 3PF2A 1J1OH 1V3JA 4MDJA 1TJHL 2J8HA 1BGXL 1MJ8L 1EA9C 4P49A 4XBEH 3HRZB 5HYJB 4QOKD 5C86A 3TT1H 5C2BL 1H15B 1OM3H 4PRNB 1A14L 2Q8BL 5J06A 4AEIL 1KTKE 2V2WA 1S78D 3MLSH 3CVHA 4JQVA 3WIFA 5TPWH 2DWDA 3TVMA 4HIXH 1RK1A 4DUWA 1J05A 4K8RC 3U4EB 4LF3A 3MBXH 4MD0B 1YNTA 5H2BB 2X7LB 3QEUB 2AJUH 1J1XL 4H0HB 3WBDA 3TESA 4HX1A 5GGSB 1A1MB 3MNZB 5I2IB 4J1UB 3VG9C 5DJZA 4ZAKB 3QEQD 1JF1B 2FD6L 1FZKB 3X17A 5GS2D 2YD6A 5GISH 2WBJD 5C08B 4M48H 4JFQB 5FYJH 2NW3A 4TVPL 4PJ5A 3S5LA 1JGLH 1R5IA 4LLDB 2FLBT 4GAJH 2HFEA 3D18B 4FFYH 4JM2D 1UYWH 2BY2A 3PJSA 2CQVA 1W72L 3ZDXE 2X89A 3W5NA 2E27L 1H8NA 1CLYL 3HZKB 1XGTA 3ESUF 3IFOB 4UT9H 1OP3K 5F7LB 4X6FB 4POUB 2WUBL 4UTAL 4HFUL 4OGXH 4KTDL 2JCCE 4G7YH 1UFUA 1YEGL 3I85A 3T1FA 3WFZA 2R29H 4TSAH 1DVFC 4PJEB 5ID1A 1Y0LA 1FYTD 3QIUA 1BWMA 2WP3T 2VXUL 3SY0B 4FFWD 2AS5M 4LLUA 4AT6A 1HNFA 3JTSA 2X4TB 4D94A 3MRIB 3WXVL 4PB9L 4E42B 1GPOH 2FO1A 1ADQH 1X9QA 4Y7MA 3SGDH 5MP6L 3BDYH 5I1KL 2F19L 4Z7WE 3I6KB 3T3MF 3BWAB 3WN5C 1QKZL 1MCFA 4DGYL 2DQFB 3LQZA 1HHKA 4KV5F 1QACA 4I0PC 4IOSD 1F2QA 2FX7L 1QPPA 3E6FB 2AKRB 3NBNA 1AXTH 5F89A 4Z7WF 2CRYA 4LBEA 2XPGB 4RWYL 1S7RB 2DYPB 1CGSL 2GSGA 3JVGC 4GRWF 3SDAB 5T33L 4GKOA 1KEGL 1BD2E 5E2TH 1A6AA 2FHBA 3TJHC 3K81A 5CEZE 1A6VH 5FO7A 1EUUA 1Z9MA 4NJAL 4P59L 3P4NB 1AGCB 3EHBD 4YDLC 1MCOL 3EDJA 4PJBF 1KB5A 4A2MA 2VDQL 3O45A 3T04D 3UTOA 2OTPA 4ODTL 2RGSA 2VN4A 4UIKL 1PZ5B 3ZTJH 5ALCL 4XP6L 5C71A 5JOFB 3GMMB 2P5ED 4XHJC 4Q9RL 1WISA 5KSAB 5DJAB 1T21A 3AU1B 5DR5L 2F54B 1EFXD 1G7IB 1A6ZB 2Z31B 5CD5D 1E4WH 1GVIA 2ICCA 2V9RA 3MV7E 4U6VH 3R8QA 3TVMB 4ZAKA 1MJ7H 4G9FA 5HGHB 4NZUL 4TVPH 5HI3D 4NP4H 3PABA 3CDFA 5C8JB 5IQ9B 2XKUA 4ZOBA 3EJJX 1KLUA 2ZCHH 1RHFA 1H15A 1V3MA 2BJML 1MHHA 3RGVA 4U6TA 2HKHH 3SKMB 4E41B 3I3EA 4AEHH 5INDA 1Y18A 3MJ6A 2P46B 2R1WB 2EXWD 1RJZB 3FO1B 2ZKHH 3QNZA 3NCJH 4NRYB 5DFVC 1KIQB 2D7TH 4FZEL 4PLJC 4XC1H 5E24E 2E7LA 1B2WL 4OCWL 3MA7A 3EOYG 3IXAB 3FO0L 3QUML 4HWBH 4OCLC 4OLEA 3HZVB 4F3FA 1AO7B 2X4QA 1J0YA 1T20A 1DE4A 4Q9BA 3I50L 3KG5A 5BO1L 2J4WL 3REVA 1QFHA 4X4YB 2FJHA 1SJHB 5E5MB 4S10A 3PDGA 1FVCA 4RMUA 3UTQB 2J8UA 4TNVK 4XPBL 1V7ML 5IB3B 5IW1A 4P9HC 1I9RH 2XACC 2C3VB 1EIBA 2VKXA 1A7QH 3MROA 3TBYB 4NDMA 4HUXA 1SM3L 1YN6A 4D9LL 4OD1H 1BFVH 3BMWA 2UZYB 3HC3L 2CLVB 1T0NA 3BUTA 3CMOH 3FFCA 4XVJH 1JZ3A 2EEBA 3QUZB 1I9IH 4G43A 4X6BA 2GCYB 2ZNXA 1Q9WA 1FAIH 1R3KB 1MFBH 2D4DA 4JFEB 1I1RA 1KPRB 1SM3H 4PJ8B 2BHUA 2EDBA 1BBJB 2IPKB 2A6DB 4HFWA 4GAGH 3FZUD 3FQNB 4XCCH 3RA7L 2YUVA 4R7DB 5FHAH 2NX5A 2Q8BH 2JJVA 1JF6A 2EE9A 4G7VH 1W72B 2VDLH 5JDJA 3GO1L 1FZJA 3QDGA 3TNNB 2NTFA 3T0EC 3OMZA 3QQNA 5ALBH 5KBNC 4Z76B 1YYMH 5C0FA 1OOAA 4NKDB 3WFBL 2H2PD 1C7TA 4DKEH 3IDXL 5FDWA 1I7TB 4MJ6A 1WWBX 4Q74A 4HJGB 2FD6H 4AENB 5T3XE 1NFDE 1S7UA 5IFAL 1A4KB 5FA3A 5EORH 3G08B 2H26A 4G3YH 2JKXA 4XCEB 4X5WB 3G6DH 3DTXB 4FFVD 4OJFH 3NCJL 5EU4A 1E28A 2QSTA 3SOBH 2VDOL 2BSSA 3FFCD 3EFFB 4PTTA 5LQBH 5EOCJ 4WUKH 4YAQA 3ZYJA 5TGBB 5A2IH 5I1LB 5CILL 1S9YB 1TQCC 1NUGA 3QCVL 4G42A 3MREA 4YZFE 1RZFH 4YBQC 1KCRL 2OR8A 1NC2B 1KG0A 1DQQA 5EC2A 3FQXB 5BQ7B 4OT1H 2Y06L 3GSNH 3HC4L 3NFNB 3VD7A 4F58H 3UTPE 5C0EA 1LMKA 4MQSB 1A9EB 3P3YA 1FVDA 4K8RD 2G5RA 4P5TC 2E7LC 2PCPB 3FZUC 1G7LB 5CEXB 1IAMA 1NCDH 3VFPB 3LKRA 4OLXL 4UNUA 4Z78B 4FFWC 2JIXB 2YEZB 1DQLL 4JVUA 3SKMA 3NZHH 3SQBA 1P84J 3THMH 4QRRA 3VW3L 5F1KC 2CDFA 2NZIA 1UZ8A 1JNLL 4LPWA 3KYOA 1B6DA 1A6WH 2W9DH 1AO7E 2Y6SC 3RWJB 4NGHL 3QDMA 2ZOLB 4NNYB 3INUL 4LSTL 3VFMA 2ID5A 1G6RH 1OLLA 1BQSA 1A1NA 3EOBB 5EC1B 1ZVYA 1RIHH 1BFOA 3MV11 3X3FH 5FYLD 1BOGA 2VE6B 5C6TH 3ILQD 2HG5A 4ZFGL 1U8KB 4N8CH 1BVKA 5E00A 5BOPA 3CFDA 5GS3A 2MKWA 3WFCH 3BRGC 4JHAL 3C08H 1QBLL 3MBEB 1FV1B 2O93L 4X0KB 3QSKB 4GBXD 3OKEA 2HJKB 4XNQA 4NUGH 4QTIH 4GW5A 4X6CB 2FH6A 3UJJH 4HPOL 4R6UA 2VDKH 2QR0A 1E27B 3AXLA 3MBXL 2AJSL 3IKKA 1X4ZA 2CKBL 3QUXD 2F54D 1DCLA 4PRHD 1QBLH 1CLCA 4CN1A 1A3QA 4N8VB 3IDIB 3DMMA 4OZGA 4O9HL 5J9PA 2PR4L 4PP1D 1OF2B 2IADA 2R9HC 1VGKB 4NFBA 4M8QA 4GH7B 4JO3H 4Y19B 2AEIT 3ZT7A 1UB5B 2LVCA 3GGWB 1I85C 1KT2A 5DHVB 4LSTH 3UAJD 3QJHB 1MFBL 1WITA 4Z7UE 5DYOA 3OL2A 1F00I 4BSWA 4NNPH 3LY6A 4UBDC 1S5HA 3CUPB 3V7AG 1FL5A 1YNKL 4DGIL 2E27H 5K9OA 4HFWB 5JZ7D 1SBSH 1I3GH 1QOKA 4MA3A 2F53B 1WCBB 3S5LG 4WEBH 5HGBB 4LBEB 4NM4L 3L5XH 5DT1L 3QUXB 4HXBL 1FCGA 3STBA 1L0XA 2Y36H 2EIZB 2XWJA 1HQRA 4GKZA 1PZUB 2XKNA 4HKJB 2OP4L 2YRLA 4XAKE 4DW2L 2OCFD 1H5BB 3LRGA 3DSFL 5J13B 3SHSA 1I3GL 1I7TA 4MJ6B 3LKNB 1AR2A 2VIRB 5CCKL 1QBAA 2ITDA 3BZEA 5D72L 3MNWA 3VGFA 2YSSB 4WWKC 1UB6A 4KRPD 3PHOA 5D70H 1P7HL 2YD1A 3PWUA 3PQYA 4UV4H 1YZZA 3GMRB 1W72A 5GGVL 1K3IA 5DJ2B 1IEAB 1JTTA 1SMAA 5I1GH 3WIIL 5MEOB 1KCSH 3QEQE 1EHNA 3QPXL 2VLKD 4N0YL 5F1NA 2Y25A 5HGAB 3HN3A 5GRXG 3RKPA 1AR1D 3QIWD 5HJ3A 2GJZA 3CX5J 4PLKC 2HLFC 2Z31C 2KL6A 4ELKB 1ACZA 3OJVC 2M2DA 4Y4KD 3DRQB 5F1OB 3PWJB 3QDAA 1M71A 4MXWH 3RZCD 3PABB 5C8JA 4WUUB 5ESVB 4MMXC 3ECBB 4I5BA 4GSDL 4OGZA 3ZDXF 3ZKQD 5K33A 3IVKB 4MD5A 4P23A 4Z7UF 4YHKL 5C2UB 1UKSA 1QSFD 3LVEA 3NZHL 4HULB 4NM8L 3B5GA 3SCMB 4LLAA 4WFEE 4MAYD 5BOZG 5JXAH 4JGMA 1FAKT 4TTDD 1QSFE 2NYYD 1F4XH 2VDQH 4PREA 5CP3H 1IRAY 4X6CE 1P2CB 4CMHB 2XIDA 1N5YL 1J9CT 3R06A 4OV5B 2Z8VC 4NZTL 4QO1A 3GJFH 3BVNA 5E2JA 2OL3L 1O0VA 3FHQA 3LOWA 1IAII 1PG7H 3QUZA 1BHGA 4LU5L 4MNQE 4HT1H 5E56A 3JV4B 1OPGH 2YD2A 1OARH 4I4WA 4RGOH 4CVXB 3GMPA 4PRHE 3R1GH 3VMNA 1IAKA 3O6LL 5FUCE 3HG1A 1FHGA 1KPUA 4HWNA 4LLYA 2HVJA 4ODSL 4K3EL 4MHHI 4F8TA 4JQIH 3HMWL 4WV1A 4Z7OE 4YDKH 4WO4A 5GRZA 3RWHB 2GFBA 1N59B 1YEGH 4U6HB 3TGXA 3ZKSD 1N26A 5TDPA 1BLNB 1BOYA 2DI9A 2NY0D 3KPOB 4G43B 4G6AC 4FHBD 3IT8D 3JZ7A 3LKOA 1DLFL 1FNEA 5EOQH 5IB5A 3SDXE 5DO2D 1VFUA 3TT3L 2N56A 4WY7L 4ZUSA 5C7XH 3KPSD 4Q7DA 1IGCH 1WFNA 2VLJA 4H0IA 2EYTA 2X1WL 4FP8H 4DKFH 5TDOB 3WIHA 1I7RA 3OZ9H 2OR7A 3VWJD 4WHTA 5D7LA 5A16A 1KFAL 1WICA 3K8LA 1F90L 1J5OH 1RJLA 2WWKT 5DMIH 3GI9L 4WY7H 5C7XL 4JZJC 3RY6A 4QT5A 1X5JA 5I73C 2WANA 2JTDA 2HT4D 4M6ML 3V5DB 1NLBL 4PJ9A 3S3SA 4F7MB 4EI6A 1IL1B 1JGDB 3P40A 4NWTL 4H1LG 1JWMB 2IAMB 2I9LB 5I1GL 4ZTPL 3WEXA 1T89A 4H20L 1G7QA 3QDMB 3T1WA 3DUUA 2FSEA 4KQ4L 4OZHF 4YUEH 1P4BH 2Z8SA 4QRRE 4LVHC 3X3GH 4ORGB 2NY7H 2FHFA 1MCOH 2IQAB 3HUJE 2JIXA 2X4PA 4KKLC 2ICEB 3RWFA 1WZ1H 1IGYB 5KVDL 1J05B 3JUYA 1S78C 4TTDC 5TE4L 2DMCA 4H0GA 1BPVA 3BUYA 1CBVL 3WDJA 1PLGL 5IVZA 3CH1B 1FJ1A 4LSDA 4GXUN 3GJEB 4EZMA 1LWRA 3RWGA 3U4EA 4JO4L 1XF2B 1YEDA 4WFED 1RUQH 1CWVA 4OUUB 5I66B 1KN4L 1C16B 4ERSH 4M6MH 2EC9T 2B4CC 5T1DL 2BY1A 5FO9B 1ULVA 4YK4C 4DVRH 5KG9B 3STLA 3X12A 2FHCA 4CUCA 1KF9B 5ELIA 3JWDC 3K74B 4BQ8A 2IBGA 2HFFA 5FV2A 3VFTB 1RU9H 3VXUE 5EPMB 5D1QA 1VESA 3TH2T 5JO5A 3KPLA 1DQDL 1KXVC 4OF5A 4PRHB 5IVXA 4XMPL 3SGDI 4XC1L 1I1AB 3F12B 4Y16B 3QPQD 4N8PA 5C08E 3HG1D 1FNSH 3DHMA 4JN1H 2KKQA 2APXA 3MRQB 4LARH 1CD1B 5D8JH 3GMQA 3U1SL 2DN7A 4EEEA 1CLZL 3QUKA 3MJ9H 3V7AE 4OZ4A 4IJ3C 1SEBA 4MJ5A 5DJCA 4P2RE 3KJ6H 1EEQA 2D7OA 1PG7L 1B3JA 5T3ZD 3RWDB 3QAZC 1E0OB 1U36A 5DRXA 3RVXD 5A2JH 5HYSA 3MZTA 4MA7H 1PVHA 5F7NC 4IRJD 3ARDC 2HFTA 1IQDB 2HVJB 2P42B 4I77H 2HMID 3MCLL 4M4PA 3BWUC 2X41A 1QTYT 3PGDB 4GRLA 2X9YA 5D6DC 4NZJA 4TULH 3GMNB 4DVBA 1HXYA 1XFPA 4YXHL 4ZPTB 2OMNA 4NQEE 5C07E 4JDZB 3S3JA 3RP1A 5AZEL 1YMME 1FBIL 2MNUA 3CCHA 5EDXA 5EBWB 5TDPB 3BD3A 2A73A 3MRBB 1J8HB 4L4TB 5AYUL 3DI3B 2A9NH 1T5WA 1IT9H 1T5XA 2ORBL 3AM8C 1KTDA 1H5BA 4KROD 3VRJB 2CR3A 3N85H 1YDPB 3V6ZA 3OKKA 3CLEH 3U46B 3RDTC 4MS8D 2UWEF 2CLZA 4F7PA 4PRBB 5FYKD 3RY4A 4LHQB 2VLKA 4MXVF 5EU3A 2VQ1B 3LEYH 4OCXL 2JK5A 4NO0D 5BZWA 5DD1L 1NBYA 3S98A 2FIKB 2OTUB 4Z7VE 4MD5B 2IANB 5GGRB 3V4UL 3FONA 5EZLB 4P23D 2IBZX 4X9FA 2DKMA 4QOKA 3PP3H 1CICC 3VD3A 3ULSB 4YHML 5JQ6L 5MENB 4OUUA 5I66A 2LV4A 5I8EB 1DL7H 5GJSH 5LCVH 1RV6X 3KYKH 2JB5L 3O81A 1F02I 5MP6H 3RVVD 1JYVA 3TN0C 5DQJB 5JXED 4TUOB 4PBXA 4K71B 1FO0A 1HWHB 5I1EH 4BFIA 5D2LE 4PG9B 2EDTA 3R1GL 3LKQB 3BPCA 3EJZD 3GJEA 2W9EH 5AG9A 4DGIH 3GFUA 2YPLE 3EYOA 3M17A 5I16A 3SE9L 2EKJA 4F7MA 1DQJA 1U91B 3CVHL 1HNGA 1QSEE 3HRZA 4NM4H 5DT1H 3DX8A 1GC1L 1KB5H 4EI5C 3SDCB 1CG9B 3MGAA 5DUBA 5IEHB 5D7IE 5DZLA 1A6TA 4P23B 2FDBP 3ESVF 4N1CA 3C5JB 1AY1H 2EH7L 2UYLA 2V2WB 3DURB 4DUXA 3F58H 4C4KT 1I1YA 1KIRA 3TCXA 1AGBB 2CK0L 3RTQA 4KVNL 4PGJA 4BH8B 5D6CB 5MHSE 1OSZA 3OGCB 3QQ3A 5LCVL 3R8BB 4HCRL 4KPHH 2HT2D 5EZIL 1U8LA 1D7FA 5HVGB 5IMKB 5LVEA 2H1PH 3I84A 3S36H 4U1SB 4NKIH 3F8UB 4NUJA 4G6JH 1EX0A 3D39E 1J8HA 4L4TA 2JCCF 3GK8H 3TWCL 3S96B 4R4FH 3F7QA 4UDTA 3MNVA 4GRLC 3KPRA 3MLWL 1PAMA 5DJCB 3MRCB 4I0PA 2X1XR 5KTEL 1OGAA 3LEXA 3TZVB 4JPVH 4P46D 3O9WA 5C0AD 2PETA 2O61A 1EVTC 4HWUA 2A6IA 4HWBA 1HHGB 2Y9RT 5EIIA 5ICZA 1DTUA 1GC1C 1E4XL 2Y72A 3N85L 3NCMA 5EPMA 2IPTL 4WENB 3VXMB 1MELA 2DTML 1U8IB 4KZDL 3MXVH 4NQDB 2BZDA 1HIML 4PBWD 3B83A 3K8KA 1IZJA 1T7XA 4PJ5E 3GBNH 2M8XA 4TULL 3NCEB 3W9DB 3IXTA 4R4BA 3RWEA 4KUZL 2H32H 2WSKA 5IFHL 3QEHA 1JZ4A 1MRDH 1HZHH 1NFDF 5FKPA 4QYOB 3GHBL 4NO5A 3MXVL 3QXDA 4U1LA 1OWRM 3ILPB 3KXFE 4G6JL 4FXKA 4NKDA 3LQAH 5ESQB 4XI5C 4ZUUA 3PIQA 1FNGB 5FOBB 3CPLB 1DVFB 1J18A 4P3WA 3QDMD 2OR9L 4D0DB 3P9WB 5J4MA 2YR3A 1BMGA 2VZ1A 4JGUA 4M6NL 4KMQA 5ENWA 4OF6A 3QDME 5C9KA 3QWQB 4KJYB 1UZ6F 3MOAH 5HGGS 5F6HJ 3AUVA 4ZOEA 1J11A 1NCBH 1RUPL 5IVOA 1FNHA 1H8SA 3PWPA 2JB6A 4OZHE 4OKDA 4OLVH 4PJXA 3QRGL 43CAB 5AZ2L 3U6RB 3B9KD 5DJ8A 3EO0B 1IC1A 4JJHA 1SHMA 3HRPA 4PLKD 5EA0H 2CIIB 3CSBA 1G0DA 2NPLX 5IESH 4Z0BL 3ZHDA 4UQ3A 2HH0L 2G75B 3QHTC 3C09B 4P2QD 1XGPA 4X6DA 2A9ML 4L4VE 3QJFA 2HKFL 2J6EA 2NY5H 4HUKB 4DZBB 4LSVH 3VRLF 3P9MA 5JMOC 4KK5C 5HYEA 4F9PC 1FRGH 1K2DB 3D5OF 4YXKL 2UWEA 4OAWB 4P3CH 1CD9B 4GRWH 4Z95H 5HDBE 5FHAL 3DVGB 1PGRB 2A0LC 4WJ5B 3EO1A 3BO8B 1GGIH 4LSPL 1ZS8B 3O3EB 4DGVH 1A1OA 5E8DL 3NTCH 2GKIA 3NGBC 4JPWH 5L2KE 5FO8B 2W9DL 3BN9C 3ALXA 1JNNH 1L4IA 4WWKB 1QBML 3MZGB 1R5VA 4FG6D 4IS6B 5H94B 3PG2A 5FECA 4NKMA 4EI5A 4JPIA 1RIVL 1ROWA 1FGNL 4OZIE 4LP5A 1GZQA 1C5BL 1MSPA 3CSYB 3IXTB 3LPFA 3C2AL 5EZIH 3OJDA 1G7PA 3VXUD 3H2WA 4MX7A 3SCMD 4QYOA 2V2XA 1B4JL 1JJUA 5CSZA 4X98A 3C5ZD 4WHDA 3O4LE 1C12A 5JQ6H 1S9WA 2W59A 2CLVA 1C5DB 1MIMH 3QO1B 4OD1L 5IP4A 3D39D 1RZFL 2RFXB 5F7EL 1NAKL 4OCNC 4MNGE 2C1OA 3X11B 1WT5A 1Q94B 4MS8C 4WTZG 3SDYL 4EUPH 5J9PB 5CJBA 4EN3D 2B5IC 4KTEH 4FTVE 2ZUWA 43C9B 3AREB 1FP5A 1A4KA 1T4KA 3N0PB 4NQTA 3IJHB 1QO3B 2P49B 4HWEL 1FPTL 1OGTB 4RIRA 2GCYA 3NIFF 5B22A 3H3PL 1UEMA 4WW2C 3VE0B 1DLFH 2GJ6E 2AABH 4XHJD 4Y4HC 5KVEH 1EBAA 2UY6A 4KAQH 1P4LA 4KZEH 1BX2B 3EJYC 2FH8A 1ZT7B 4LEXH 1NCAL 2XWTB 4XP6H 1NL0H 3V6OC 2XN9A 1NFDA 1Q9WB 4M1CD 5EUOF 4TRPH 3X3FL 2EIDA 1X44A 2WMPA 4KTYA 4DCQA 2R23A 1NAML 4K9EL 4WFGE 3TEUA 5D6DA 3HR6A 5D4QA 3BIKA 2ZUUA 3KXFD 3VFPA 5KAQF 1DBJH 4YHPA 1V3KA 2R56L 4DW2H 4OGAC 3RFZC 2Z4QB 5TJWK 1IVLA 1QA9A 4W6WB 3ZKXB 1OAKH 4QRRB 4WFFD 1Z9SA 3PWUB 2B1AL 3C6LC 3UZQA 4HWZA 4D9RE 2GJZB 1U8HA 1BM3H 3ARFC 1RZJC 3MXWL 3SDCA 3MV8A 3MLUH 2I5YL 2A77L 3LS5L 1A7RL 5F7FA 1MY7A 3PWPE 4YEFA 3MV7A 1JF1A 2SEBB 4XNZB 1G7JB 1I1AD 2GTZA 2ARJB 2GJJA 2ESVA 4M7KH 1H3GA 5DJ2A 4W68A 1VENA 3FJTA 1CL7L 1WTLA 4NP4L 3VFVA 4Y2DB 1D5ZA 5DC0A 3MRRB 3WIFB 3BZFA 1JI2A 3QNXA 1M7DA 5CSZB 1F2XK 3D3VB 4LCCA 5B3JE 5D96B 4ZUVB 1CXHA 1JHTA 1XR8A 4NKOB 1WJ3A 3IDJA 4WW1A 1R3JA 1LDSA 1I7UA 4GG6B 2F5BL 2XNAB 4PY7B 1SY6H 3LN9A 3JV6B 5ITFA 1EXUB 3RWCB 1HE7A 3LEXB 3TZVA 2NW3B 4NCC1 3MLZH 1R5VB 5FKAA 3STZB 3MJ7B 4NHUB 2C3GA 5KVFL 1Z9LA 2F53D 4IHOA 4YFDB 1WT5C 1V7NH 4L8SA 1YEFH 3HCVA 5EZJA 3O2VH 3U9PL 3M8OH 5EIIB 1RUMH 3L3GA 2ICWB 5BZDA 4XXCA 1N5YH 2XXCB 4U31A 2YPKA 1AHWA 3H7BB 4XPBH 4YO0B 3VU2A 2CUHA 4PRDA 4OZIA 1YUHA 4RAUA 2FR4A 1A0QL 4XBGA 5JPNB 4XPFL 2AK1L 5GRWA 5E2UH 3T2PA 3WHXB 2IQ9L 1ZWIA 1AH1A 1GOGA 4Y2OA 3FQTA 3QG7L 2RIKA 4C83B 1TNMA 1JGVH 5D5MB 3GI8H 4NPYB 3EYVA 2VYRE 3BISA 5KVEL 2BSRB 3O6ML 3NZ8A 3VFNB 3IJSB 5GIRA 3TBWA 2FJFA 3HE6C 3IDYC 4LSRH 4Y8AA 2YK1L 1A3LH 1UKTA 5HHOA 5SX5K 4QHNA 1VFOA 1MCPL 4ZFFA 4XNQB 1AKJB 1D5MA 5F9JB 4JFFD 5L8LB 1LGVA 2BRRL 2W0LA 4TUJA 5HDOA 2R0LL 4XNUH 2P8MA 3KYMB 1A7PL 1OD7A 1YJDH 2YD3A 1T1XA 2HKHL 3GBLA 4HIIB 4MLSA 5DUML 1TTGA 1CFBA 3VFRB 5I74C 5BRZE 1WWCA 3SPVA 4I3GA 4X4XA 1AIFB 3EYFB 1M6OA 3QDJE 4V1DE 1YEFL 3QUMA 1BD2A 3B9KC 3PDOB 3IAPA 2DQJH 1MAML 1DSFL 1XCTA 5I18L 4I18B 4EQ3A 1FNGA 1QRND 4PJXF 4P4KA 5ISZB 2B4CH 2FJGB 4OD2B 2Z8RA 4NKQB 4MJIB 1FLTX 4QEGA 5EO0B 5F3BB 1LK3L 3QNXB 4WUUD 2I5YH 3MLUL 4JN1L 1F42A 3VRIA 1W8OA 2Y5EA 3VGEA 2QQLH 1NGWA 4TYUA 2AQ2A 4MJID 3RGVC 1CL7I 1KBGL 3UZEA 2QQKH 4NFCA 1KB5B 4M93B 5L6YL 3EJZC 1CL7H 5C08A 2GY7B 3SBWC 5DA0B 5B38G 4K7FA 5SX4H 1RJLB 2NY7L 2WLYA 1JZ6A 4CN4A 2VZSA 3KPQA 1Q0XH 1G9ML 3D3VE 5JIHA 2UZIL 5I1EL 1CICB 1BEYL 1RK1B 4PJ8D 2W65A 3AAZA 2CSPA 3IDGB 3GNMH 3P4NA 1PJ9A 4O4YH 4GG6E 1JFQH 1H9VA 3A6BL 4P5MA 4R8WH 3NOIA 3TO4C 1MCBA 3QEGL 4Q6IA 3O6FD 3C6LB 5E6IB 4LLUB 3CJJA 3EYQD 5T1KA 1JHLL 3FT4A 4JFQA 5C6WH 4YDIL 1JN6B 3EHBC 5JOFA 3QUYB 3IRPX 1WWWX 1HYRC 1ZWIB 4KROB 2R2EA 5I75B 1T2XA 3TM6A 4PJAF 2AXGB 1U8MB 5EOTA 3KWWA 1UCTA 4K7PH 4WV1B 1FVEA 1PQZA 3PWNB 4OBSA 3RPIB 1IC7L 2FZ3B 4YDLB 5EB9A 3CLFL 4HCRA 5E70A 5IGXH 5DK0B 2XPGA 2E6QA 2HYMA 1VPOH 2V5MA 4PRDB 4RFEB 1ZLUK 3WUZA 4OZIB 5IJVB 2BC4A 3C08L 2BNRE 2DM2A 4G9FE 2PTUA 2D31A 2Q3AA 3LHPH 2R4RH 1P6AB 1VSCA 2CRZA 3OX8B 4PGDA 4HZAA 1MIEH 3GI8L 3KPLB 4LHUG 1KJ2H 4PRHA 5I1IL 4ZDHA 2OBGA 1YUHB 1MCSA 4RAUB 2FR4B 1Z6JT 4JFEA 4UILL 5D70L 1NBVH 2NY2B 4QHLB 2ZUQB 5HHVL 4PJEA 1F5WA 4YC2B 1I3VA 1UWGL 3KPPB 4MHHG 1FH5L 3INUH 3R4DA 4S0TD 4AT6B 3QUKB 3HNSL 5I2IA 3GRWA 5FYKL 3WYRA 4HS8L 4KDTC 3VFTA 1J0JA 5FDYA 4PV9B 1WZ1L 1DUYB 1JTOA 4A2LA 1FO0H 5IHUH 1JPFA 3HG1B 5C0GB 3DGCR 4HIHA 5E03A 5FGCB 1T7ZA 1YPZE 5C0CE 2XZCH 4L8CB 1I1AC 4URTB 1RQ5A 4JM2F 3QWRD 2IPUG 4Z6AT 4W6XB 2HFEB 3D18A 3WKMH 3H0TB 4X9IA 1Q72H 4ZSOE 2VXSL 5DK3A 2BFVH 3A67H 3NABL 4QRPB 3NPSB 3F5WB 5L88L 2P43B 1MCWM 4LDOB 4YJZL 3BJLA 3EYFA 4FOMA 1F8TH 1INQA 3FO9A 3MSPA 5BW7C 2X4PB 2HTLD 4LPCA 1LEGA 1X5AA 4FFYL 3ETBF 2EDQA 2NY6D 5I1CL 5E99L 4BQ6A 2ZUVA 3ROLA 1NEZA 2FRGP 3GMOB 3FRUB 3MLPA 4P2QE 1CZ8H 3SOBL 4I18A 5DEFA 1F58L 5HHOB 1L9MA 1HN1A 2OI9B 4LKCB 2CKNA 4JDTH 5IQ9A 4Y89A 4MAUH 2R0ZH 4Y16D 3EO9L 3DUUB 3VI4E 1QUNA 1G9NC 4BSVB 1GZPA 3B9KA 2VC2H 1FPTH 3IDXH 4KHTH 5L8KB 4HIIA 4DTGH 4NQVA 1G0XA 1KCSL 1JPSH 2YXMA 4S0SD 3HNTL 4M7JH 4YBLB 2CGRL 3ISWA 1NQBA 2HJLA 2HVKB 4J3TA 2CLZB 5I30L 4YEEA 2EZ0D 2BY0A 3DARA 3RWJA 5KSAD 4WTXA 5CKGA 2P7TB 1U8OA 2IMNA 2ICEA 3RWFB 4KRMB 4Q9QH 4LCYA 2BC4B 2YRPA 5IESL 5IJKA 2NY5C 1HOCA 4YHPB 1QFWI 1R0AH 4J4PD 2COQA 2BVQB 2CD0A 1U8NB 4E41E 5EUOE 1U93B 4IHOB 4LCIL 4PJDF 3WXWL 3UJIH 5JIPA 2CUIA 2YPLB 5C09E 4LHUD 3WNMA 3MOBH 4LHUA 3NIGF 1OTUC 4X80L 1AHWB 3H7BA 1FL3B 2XZQL 1SBSL 2XQBL 5GGVY 3BRFA 4MDIB 4JANA 1GGIL 3LD8C 2ADJB 2OQJB 3EFDL 1ZVSA 2JCCA 3ARDA 4DEPB 1BQUA 1DQDH 5ISZD 3QUYD 3I2CL 1KB9J 3D1MC 1MREL 2DQDL 4JR9L 5DURB 3MODH 2JF1A 2C4FT 5CLWA 3ZE2F 4C55A 5EZOL 1OF2A 1Y6NR 5A3ID 1C16A 3SE9H 1CDGA 3MRQA 4Y4HA 3DTXA 1TPXB 2PYEB 1R3JB 2LU7A 4J3VA 2LABA 4EBQH 1RIHL 2JJTA 4HIJB 5CJXA 3I9GL 4N0UB 1T83C 2FJGA 5ILTH 5FK9A 5AEAA 2A6IB 4H5SA 5CMAB 1OP9A 4G9DB 3U7YL 5IBLD 5L7XL 2XTJD 2G2RB 3DXAB 3N1PC 5DI8B 5HDLA 2UVEA 1XR9B 4ZG1A 1Q72L 2ADGA 1IEHA 1G7HA 4L3CA 1OGAB 4GUPA 2KZ1B 2VISB 1AD9A 3ARED 3QUMB 3AMKA 3MV01 2XTJE 5DQDH 4OF7A 1KULA 1B6UA 3AMLA 1KLGB 3DJ9A 4GW5B 2DQCL 3LKSA 4JRXA 1FO0L 5IHUL 4U7KA 2DDQL 1NGPH 5CJ8A 4NO2A 1U92A 5JTWA 3LPGA 3FTGA 5F44A 1ED3A 2YUWA 4OCYH 4MAYB 4KKLD 1KEMH 4FQ1H 3U0TB 2OYPA 2VB5A 4U6XA 1JZ7A 1B9ZA 4JO1H 1BVKB 4X6DF 1OAZH 4HBQA 2HVKA 4OQTH 4HMCA 2XZAL 3QUYC 5FCSH 2HRLA 4I3RH 4PJ7F 3VFNA 1CT8B 3D0LA 5C0JB 4MZ2A 5C08D 3MROB 3TBYA 1KBGH 2OX5A 3HHRB 2ZCKH 3A0OA 4IRSB 3CVIL 5MEOA 4P46A 4DEPC 5DEGA 1FFOB 3WMSA 3QFJE 1I75A 1BFOB 1T6VN 3IU4L 3V6BR 2MCPH 1HHJA 4ZAKC 1HHIB 5D1ZC 3GIZL 2EH8H 4P2OA 1NSNL 3W0WE 3QHZH 3QXVA 1I9RL 2B4CL 4KMTL 4LF3B 3RX8A 2EIBA 1M7IA 2C1PB 3UPRA 3IAGC 4UTBL 2JB5H 2R1YB 3MUJA 1ITCA 5DMGD 4KI1A 5D2NE 5EULV 1YECL 4JZJA 5HYJD 3BPOC 4XZUB 4PJDA 1AC6A 4R97C 5C0EB 3DROB 4X6DE 4KKAC 4E5XB 2DDQH 5IQ7H 5HGAA 5ACZB 2LAGB 4MYWB 3ZTJG 3WIHH 3KR3L 2MJWA 5DRNA 1QYGL 1ZVHA 4CBPA 5B21A 4LCWA 2NCMA 3B2VH 1KG0B 3KHOA 1DJSA 5HSFA 3LMJL 3MRLB 3B9AA 3E2HC 2OMBA 4M8QB 1NFIB 3DGGA 4XVTH 1T1WA 5IEKB 2A6KA 4WU7B 4X9HA 4F7TA 1UH3A 3QUXC 2VQUA 3OKMB 1HKLH 2EDDA 1QRNA 2DRUA 5EFIA 4HLZH 1VADA 1A1OB 4BSWB 1GL4B 1CGWA 4MCZA 4QRRD 2NY4D 3NFPA 4YDJA 3QQ9C 5GGQH 3T0VA 2NZ9C 1RFDH 3IFPA 5DDHA 3ARBB 4K3GA 2BVOA 4XAWL 5TDNB 2PTTA 2X4SB 3S9DB 5KN5A 1QFPA 1HINH 1MPAL 2BDNL 2C5DC 2YKLH 4B50A 1N2RA 4KQ3H 3QB7C 4FQLL 1F4WL 3ZKMC 3O9WB 4WNQB 4J3OC 4D9QE 4M1DL 1DL7L 1BOGB 2VE6A 3Q5OA 3AXLB 1U58A 2R4RL 2ICES 4JRWA 1CZ8L 3DVGA 2GIYA 4GXUM 3TBSB 4NO0A 5J6HB 4TVPD 1IBGL 4X0KA 1VGKA 2WQRA 2OL3A 1AI1H 3MRGB 3V4PH 3OB0H 4R0LC 3SE4A 1MCNA 3OXSB 4PJIB 4HT1L 1CDHA 4HGWB 3TT3H 4M3JA 2DLTA 2E6JA 5DLML 4H26A 5EOCH 1C7SA 1CS6A 2ZJSL 3ZZ1A 3PNWB 5IQ7L 2DLGA 3Q6GH 4MNQA 4YFEA 3IDYB 3VXRB 4Z7VB 2FECL 3JTSB 4LLWA 4HC1A 1MWAA 5JW5A 1TZGL 2D3VA 1QO3A 5DMIL 1J5OL 3BGAA 4NO2B 2OZ4L 1XAUA 1NUNB 1ZT7A 3JUZA 3RU8H 5C0IA 4BSVA 2ENYA 3LEYL 3CAFA 3U0TA 3W2DL 4NSKB 4UTBH 1UM4L 3BPLC 1QR1A 5CP7B 4G6ML 3QQ4B 3T09A 4YX2H 4GUPB 4P9ML 3RL1A 1DVFA 4XX1G 4KKBC 2DTSA 5F9OL 1JGEB 1OAXH 2EE3A 4TOYH 4D3CH 4FXKB 4RIRB 3ZSTA 1Q9KA 2AJZA 4PR5A 1I8IA 4QGTA 4KK6C 3O2DL 4NZRL 3RVUD 2R56H 1ZOXA 3TO4A 4CVUA 4NCC2 2NYYC 3UZVB 2Y1VA 4PPTA 1ZHNA 2MTPA 3O45B 4ETYA 2Q7YB 3VJ6B 3BGFC 1IKFL 3MLSL 2I9TB 5LXGL 4JO3L 4EDWH 1RZGA 1MHEB 4YBQD 1ZMYA 4N0FB 4MA7L 1QSZA 3PP3K 4P57A 3UROR 1T1YB 2DI7A 5J0BA 3UTZB 3BKJH 1VEMA 3S35L 2EDHA 3V4UH 1YNTB 4Z7VF 1S7SA 2VZ3A 2MPAL 4O02H 3CSYA 4ZYKA 4Y4KB 4M93C 4S1DD 3V4PL 4M62H 3OKMA 2VXUH 1NANH 1TJIL 1CIDA 4XPGH 2G60H 1IEBA 4PY8I 5A1AA 1ND0B 1WWAX 2IFGA 4HXBH 4JLRA 1GYAA 5FM8A 1RVFH 3PWLA 4MJ5B 5EORL 3ARFB 3HB3D 4OAWA 3GKZA 4ZUTA 1BQHA 2IAND 2PUQT 3V4VL 3QULA 4X6FA 1BIIA 5J13C 3GSOA 5HYSB 2BCKB 1I1AA 4TQEL 5F7YC 4F2MA 4MNQB 5LGKA 3RDTA 3GJFB 4OM0H 4L8DA 3MA9H 3BO8A 4K94L 4FQHB 4R7DA 4UDUB 4PLNC 4PB0H 1UACL 5HYSG 2PR4H 4GXVL 3BQUA 3MCG1 5C9JB 5IB3A 4JHZA 3RZCB 5DVNA 2J88L 4CU7A 3FB6A 4CN6A 3UDWC 1R3LA 1BFSA 2DMBA 1LO2L 3OV6A 2Y6SD 4PJ5B 3QXTA 3S37H 3S5LB 1GH7A 4PY7A 4E42A 2OZ4A 3PV6A 2IAMC 4XAKD 4X4ME 2ZPKL 3V52L 1A7NH 3C5ZA 3IFLL 4HLZG 1P7QB 4JKPL 5AD0B 3GMPB 1KC5L 3LRHA 4A6YL 1Y0LB 3QIUB 4HAGA 4NOFA 4POYA 4HWEH 3D69A 4OIAA 2F8XC 1D5XA 1KIPA 3ZHKA 1ORQB 4NQEB 3UJTL 2DBLL 2IH3B 3MC0A 2QQNH 1AGDA 5A43C 1BBDH 1JVKA 1X5YA 3DSNA 3HZKA 5HYQB 1P6FA 1G7MA 5HI3C 4FP8L 1HH6A 1UXSB 1V5JA 2R39A 3HZMB 5T3ZL 3OQ3B 2C26A 4KRPB 4F37K 3QDJA 3HB3C 3B2UD 4JRYB 4V1DA 5I8KH 3IU4H 4U1HA 4JZOB 3J8F7 3DXAA 3G5YB 3I75A 4N1EA 2Z31A 4OJFL 2I07B 2WINA 4QXWA 5B38B 2NLJA 3BDXA 3PGFH 3T65B 3VXQB 1F13A 1TETH 4RISH 2APTA 4J3SA 3O41B 5FDWB 1NGWB 1G7QB 1V8HA 4I3RL 3D3VD 3WEXB 4DN4L 3Q5YA 3WD5L 1QA9B 1P5VA 1MFCH 4EXPX 1TZHA 3ARQA 3TPKA 5JW3L 4PJXE 4RNRA 2E3VA 3SE8L 3OPZH 5JW4R 4U1NA 5DJAA 1T21B 2IQAA 2ZUQC 5HHPA 3HI5H 1F45A 4L4VB 3LEVH 4OQ1A 2B2XL 3E8UL 2V17L 4RRPA 3BSZH 3WSQH 4ZPVB 1N5AB 5EUKA 4ETQB 3WFEL 3ZE2E 1MH5A 1D9KA 5F7WC 1U8PB 1ETZA 1F4YH 2AP2A 3GEWB 1AQDB 4JJ5B 4JDZA 4WO4D 4XVTL 2X89D 4P48A 5IG7B 1KJVB 4RX4D 4QTIL 1HCFX 1I9JL 3AU1A 3VWJB 3VDCA 1A6AB 4WTZA 1I1YB 4F2MB 2NY0C 3P9LB 5CGYD 2DLIA 3GSXB 4P5MB 1NGXA 3U83A 3G6AA 4CADB 5EUOB 4LCUA 4PJCA 5D6CA 5DK2A 3FOMA 3DOSA 2J3SA 5GS0L 1IE5A 1F4XL 5EO9B 2GT9A 3S96A 4Z7NE 3ULVE 3STZA 1T0NB 3IU3A 3C6SA 2XA8L 5EOTB 2YA2A 3CXDH 3QPQC 3SGKA 3RQ3A 3TCLB 1LO3H 4YO0A 4MXQD 4R3SA 1I3UA 2F8VA 2C3VA 4BH8A 3FOLA 2BVPA 2AXGA 1KJ3L 6FABH 3KAAA 3SY0A 1CG9A 2EIEA 1T1YA 4NC1E 5DJYA 2BSED 2ADIA 1P69B 2V7NA 2H6PA 1BVZA 3VFSB 2BOCA 5FKAB 5T1KB 3V9FA 3MQIA 3D6GA 3MLRH 3BWAA 3C5SA 4L8BB 3ARGA 35C8H 4XCYA 2N1KA 2VUOA 1JPGA 1UXWA 1YEDB 1X5LA 3BX7C 1UCBH 1RUKL 4Y5VB 1I4FB 5FYJE 25C8L 3MGTA 4KTEL 1XGYL 1GGCL 4NZDA 4JZNB 2W0FB 3KJ4B 4NO5B 5TQ0H 5L0QB 1AKJA 1D5MB 1WCQA 5F9JA 4IRJB 3QI9C 4TSCL 1KJ2A 4O4YL 3B9VA 1Z3GL 1KC5H 3HLAB 4L1DA 1S9XA 4H26B 1AQKH 3VRJA 3SPVB 2DL9A 1TVBB 3ULUC 1CLOH 4DWHA 3VXPB 5IFJB 4IIQC 2PKDA 4X5WA 3WKNA 1WEJL 1D6VL 4P4KB 4MVBC 4UNTA 3MLTA 4MD4B 5EO1A 5AWNL 3VD9A 1C08A 2OTUA 4G7VL 4HV8B 4RGNC 5DJ8B 3OTTA 1J12A 2AQ3A 4KHXL 1JZ5A 3QBTB 1FFQA 1RZ7L 1BAFH 1KCLA 1ZA3A 3GRWL 1TDQA 2FYYA 5DD5H 3LQMA 5HPMA 2ZUTA 3IF1B 1ACYL 3ZDZF 1E6JH 3UJJL 4BQCA 4M9PA 3JTTB 3LH2L 1TZIA 5TH2B 1JMXA 1FVDB 4ELMB 1HH6B 2E7BA 3OPZL 4P2QB 4WI2A 4XCFL 4XPHH 4O2CB 1MRFH 4ZYKB 2GI7A 4NT6A 4PB9H 4L4VA 1SJEB 3P9LA 4U4BA 5CAYB 2ICWJ 3BKYH 1S7XB 2BFVL 5CIPA 1Q0XL 2DBJA 4L9LC 4APQB 12E8L 2FZ3A 2ZCLL 2ILLA 3X13B 4IDJH 4TSBH 3O11B 5IHZA 1FBIH 2GY5A 1CICA 2X9XA 5IEHA 5DUBB 3DVNA 4YFLI 2AJXH 3VI4F 5DGRA 4P3CL 1OAUL 4DUVA 5F96H 1EHLH 5JW4M 2CXGA 4WU5B 4LPUA 5C09D 4RFEA 1JMZA 4PRPB 4FN0A 2C4XA 2Y5TB 3C2SA 2NY5L 2GK0A 3GSWB 2EXWC 1CFTA 4M7LH 2AK4B 2AJVH 2CDGB 4Y19A 1JNLH 1F3JB 4Y2DD 4U6HA 4PTUB 2JJSA 1G1YA 3LSOA 2ZUYA 2QR0B 2IJ0C 3AY4C 4UV7H 1U2CA 3B6SA 2JELH 2HWZH 1N6QH 4LVEA 4FQQB 3U9PH 3ARBD 3QH3B 1GIGH 5DWUL 5FV1L 4K94C 1NMCC 3WUWA 1MF2L 4OLVL 2ADIB 2V7NB 3PHQA 1K8DB 3X14A 3PL6A 2EC9U 5JXEA 5FUOL 4F80A 4LIQE 1CU4H 4M43L 4HIHB 5D1XD 2V2TB 1YMMA 1RU9L 3ZDYF 3GHEH 3OKEB 3QPXH 4EUPB 1J0KA 2F5AH 4BZ1H 3CXHJ 2VKWA 2OK0L 3HA0A 1IJ9A 5LBSL 1UWXH 3MV9E 5IB1A 1J8KA 2B2XH 2Y4SA 4R7NA 4JG0L 4NC1C 3HMXH 5CZXD 3O6MH 3ARFD 4P2RB 2LU3A 3K1KC 3EO0A 4NQED 1FQ9C 4UUJA 3T3PE 4PJ7B 1RVFL 3E1F1 3LB6C 3RVTD 1ES0A 1N7MH 1A7BA 2XQYG 3W9EA 5H35B 5KANI 4ERSL 3UTTD 3C9NA 1AGDB 5D1XC 3UX9B 3IDNA 5DMYA 1HQRB 2HTKC 1IEAA 1QFWL 1XIWC 3DNKA 5CJOH 4D0CA 4HPYL 1CT8A 1FIGH 2Y36L 4K3HA 1MLCB 1N0XH 4OCRL 4YHOH 2E8ZA 3FB5A 1T22A 3ARGC 2LAAA 3QWRA 4JCMA 4PJ8C 5T3ZH 2ITDB 3BZEB 1FL5B 2BHYA 3DXAD 2WIMA 4WI3A 5C07D 2D0FA 1T04B 3SJVE 1T4KB 4S1QL 1JZ2A 4ELME 5AZEH 3K8MA 4FTVA 4X7SH 4Z5RA 3JV5A 4NQSA 3BPNB 3FQRB 2P8PB 3EDFA 1LK3H 5JA9A 2GT9B 3MRHA 5E1HB 4Y5XB 4K55A 4K7PY 2PCPA 2E8YA 3IFLH 3EKCA 1RURH 5D93C 1X6NA 3B3IA 3TA3B 5CBEA 5EN2A 2P24A 1YY8A 4JFZL 4AG4L 3HTLX 4YZFF 3LQAC 4FG6C 3CVHH 4L8SC 2NXYC 3DV4A 3G9AB 2AVGA 2BVYA 2F58L 4QF1B 2JIXD 3BOVA 5FYKH 4LHUB 1IKFH 1U3HB 2CIKA 2VXQH 4G6KL 1HIMH 1ZT4B 4JO2L 1IAIL 2EDKA 2FEEL 4R97B 3DRTB 5FGBC 4XTRC 2NY3C 3ULVL 4KU1A 4WDIB 3DROA 1LEKB 5B8CC 3CFDB 4U2YA 3OZ9L 3CVIH 1E4KA 3N9GH 1OQXA 2WLZA 3T2OA 1IGTA 4HQQL 1P2CA 1UQSB 4NO3B 5GGSY 5T1LD 4GO6B 4HAFA 1NC4B 1S7QA 5L6YH 2A6JB 1ZGLM 4OM1H 2GK0B 5EOQL 3SGJA 3L9RB 2G60L 5KN5B 4NFDA 4NKMB 5DHYB 1NFIA 3DGGB 43CAA 1Z0NA 3DLQR 5DDHB 3ES6B 4PV8B 1NCWH 2QKIA 3NCYP 4N8VA 4G80B 35C8L 3BHBB 4MVBD 2ZKHL 4N1HB 1OAQL 1FYTE 5E2VH 4UQ3B 5DMKB 2C7UA 1XCQA 3KPSA 4Y1AB 1KTLA 5DZOA 5H2BA 5HHNA 3TIDB 1MY5A 2VLLB 4ZAKD 4X7TA 3IVKA 5IVXB 2H2SC 3FB5B 1T1WB 5CEYA 1OT2A 1INDL 4NZTH 1B0GA 4CNIB 4PJBA 4CVWA 1R3IH 4GMTL 3VXRD 1KELH 4PJ9B 3QCUH 1MFDL 4WNQA 1ZHLB 3KLAB 4ZUWB 4FTVB 4MAYA 4AEFA 3D0LB 1WC7B 2CR6A 1IGCL 3L3HA 5FEBA 2H41A 3EOAB 4JFED 5C0BE 5I76A 3VA6A 3HE7D 3IB4A 1TVHA 4ALAL 1MWAH 2B7DT 1G9NL 1XF1A 3L1OL 3SKOB 3BZ4B 4GAFB 2NNAB 2EYRA 3BW9B 2P5WE 3QFDB 4ZUSB 1QD0A 3QIUC 4JDTL 43C9A 3QEQA 3ULVH 4CJ0A 1D9KC 4OQTL 4LNRA 5M7QA 4H5SB 4P2OB 1NLDH 4Z18A 1G7IA 1T6WA 4ZMAT 2QL1A 1T1ZB 1PKQA 4L3CB 2CIKB 2GYSA 3WJJC 1DUZA 4JFYA 2W9LA 1CFQB 4WDIA 5FYJD 3TWCH 5ACZA 3NA4A 2VDRL 4Z9KB 1OY3B 4BA8A 4BQ9A 2WK2A 1T04A 2DM4A 5GGVH 5EN2B 2R69L 4E5XA 5KSUA 1IC5H 5J6GA 1F4WH 2FEEI 4NO3A 3ZKND 3DV4B 2A6KB 3JVGA 3ABZA 1BVLA 4R26H 1RMFL 4DFIA 3ZTNH 1KB9K 2YS4A 4NZRH 4FQQA 4XBPA 1CF8H 3SDAD 4KRLB 3NFPB 4PJ5D 1D5BA 1HSBB 1MHEA 1SYVA 2AI0H 3T8XA 1IBGH 1T0PB 1AR1C 3QIWC 4G6FD 3GSWA 1WFTA 4X8JA 2XI9A 3ZO0A 1A22B 5E6ID 2R2HB 8CGTA 2AJYH 2DD8L 2F54E 2ERJB 3IGAA 5CUSL 3ZL4H 5CJ5A 3RZWA 3WO4B 5IM7B 4PJHA 1BBDL 4QHMB 2MHAA 4GS7C 4H1LH 4NDMB 2CRIA 2EDLA 4PG2A 4X4MA 5IBLC 3U0PA 3F12A 1IAOA 2YWZA 1CBVH 5BXFB 5FF6B 4X80H 3RGHA 1FYTB 4AIZB 4FQXA 1A4JA 5JHLL 4RAVB 5HYIA 2H2SD 4G6AD 5GGTA 4LL9A 4POZC 3SGEH 3AGVA 2UYLB 1CE1H 3DURA 2X05A 2VLRD 2FJHB 3BAEH 3X13A 4I2XE 3BGFB 1PY9A 1SEBB 4XP9H 3C9NB 2O5XH 2DS4A 4WW2A 1K4DB 5L7XH 1AO7A 2X4QB 3MUY1 4AM0B 2MQ0A 3FQXA 3TYGH 4CW1B 3C5JA 2FGZA 4G9FB 5HGHA 1TCRA 3RVWD 4IOIB 4NWUL 4NNYA 5DRWB 1MLBB 3DXAE 3RWGB 4AEIH 5ADPL 3TIDA 4NQCA 1WF5A 4ZFGH 4KMTH 5GGTH 4IM8A 4JM2B 3C87A 4OCXH 5C0RL 5DMKA 1IGFH 2UY7A 4F7PB 1Y18B 5AYQA 3REVB 5LQBL 4ZNEE 1FH5H 4LSSH 3B8SA 1M05B 4KTDH 5FB8A 1PEZA 4UV4L 4M7KL 3H9SE 3T0WA 1J8HE 4L4TE 5C0BD 1BEYH 3FHAA 3LSOB 5E9DE 1DZBA 3J7HA 2P5WB 1QFWM 5AYUH 2J5LC 1G6RB 4MCYB 2YBRA 4GKSB 1ERNA 1F6AA 3OKDA 3GM0A 5CINH 3DYPA 4PRBA 4GMSL 4L5FH 4NQDA 3MREB 1VACA 3GIZH 1I8KB 4J3XA 5DMJB 3W9DA 1GIGL 5DWUH 4FXLA 4AL8H 1PYWB 3FB7B 3RWDA 5GGRA 1ZE3C 3HUJF 4D8PB 1T03H 3U46A 3T4YA 4M5YL 5T5NF 2H26B 3BT2L 5D2NB 5ISZE 5K59E 2DIAA 2G9HA 5GJTL 3EYSH 4UQ2B 2F9BT 1QG3A 4KKNA 4PJGF 1CXIA 4AL8L 4BK5A 4FFZH 1BZ7A 3OG4B 1QQDA 1N4XH 4ZPTA 4GKNB 2EYSA 2ZSWA 3VGDA 4HIEB 3L3OB 1KN2L 3F5WA 1ZT4A 3GBMH 3GKWH 2VLKE 5F88B 5HYJA 3SKUD 3FQWA 5KSBA 3CFCL 2DQGL 4JB9L 3S37X 1IGJB 3K2MC 3QUYA 2DJUA 5SWQA 3VWKA 1CQKA 4KJPD 4Y0GA 3ARDD 3L3JB 1ETZB 4ZDHB 1IQWH 3WS3B 1ZA6A 4HFUH 4OGXL 1IMHC 4CADA 4ISVB 4ONFL 1HQ4B 2A9NL 1FVEB 1PQZB 5HHXL 4Z77B 5KOMC 3EYQC 4LSSL 3UCRA 4LVOC 1PDKA 4GS7B 3LKPA 2R2HA 2BRQA 2IBZY 3EYOB 3M17B 5I16B 2BCKA 2DJ4A 1JN6A 1MI5D 3PL6C 4EQ2A 5IW6B 1A6TB 1AQKL 1H0DB 3H9HB 2AV1A 1U8MA 2AJYL 5C09B 3JWDL 3PV7A 5IMKA 3DWTA 4PRPD 4BSJA 3LS4H 2R4SH 4ZPVA 1N3NA 2HT2C 4L3EB 4HCRH 1RIVH 4Q9QL 1J88A 1V7NL 5I1CH 3E8UH 1WZLA 1MHCA 2VNCA 5DK0A 4BH7A 4L3AA 2YHGA 4GRLD 5D2LF 4KUCD 1DANT 3ZKXC 5DR5H 2P48B 1LEGB 1GZPB 3B9KB 5J8OA 2R2CA 3B5TA 1X3DA 4DN4H 1FV1A 4R4BB 3RWEB 3SKJL 3SE3C 1NCWL 3KPQB 4KY1L 3EJYD 3OKLA 4PD4J 3VXNA 1ITBB 1BQLL 5FB8B 4XWOD 3PE9A 3IDMB 3DRQA 4KGLA 4PJIE 1FZKA 2CGRH 4PJGA 2P5WA 5K93A 4IMLB 4AZ8A 4XC3L 3RUGE 5IBTL 5C0RH 3ZYOA 5ICZB 3WV0A 2HKFH 4U1GB 1QBBA 3IETB 4HKZB 3BRDA 5I1JH 1OAYH 2V5RA 2WWMC 4FQHA 2BRRH 1LE9B 1HYSC 5IB2B 2D7TL 4FZEH 4AIOA 4JE4B 2LQRA 3UBXA 1YPZB 5C0CB 4CAGA 3DIFB 4OCMC 3NIDE 4XCNA 3V0WH 2VZUA 1T66C 1XF4B 3ZE1F 1J1XH 3LMJH 3GSVA 4QRPE 1N59A 5CD3B 1SYVB 5HYQA 2YA0A 5I1HH 2R2BB 3BIBX 4J8RB 4JFDD 3FN3A 1F8TL 3PGCA 1DBAH 2BNQA 4PRIE 1RUAH 1P4LB 5F21B 5IGXL 2IH1B 3ZT5A 5HVFB 1RZ8A 5K9QI 1P7QA 3L3IB 1BF8A 3ORJA 4MA3B 3HPJB 4HH9A 3NCBB 4U1MA 2R4SL 2PYFB 3CFBB 1U6AH 1UM5H 4ODXA 4EOWL 1J0IA 3MRMA 3O41A 1NGQL 5E4EB 2DQEL 4RFNB 3VXSE 2JELL 5FF6A 4QKXB 4UILH 5D2NA 2OSLB 2I07A 4HKJA 4LMQI 2K9UA 4JFHE 5C0AA 4YGVB 3DX8B 1QR4A 3UXFA 3VMPA 4YGAB 4WUKL 5AAMA 1NCCH 3QG7H 5I8OH 5GS1B 4HIEA 1KJVA 3RDTD 3TA3D 2CO6B 4UIKH 1U8OB 2P7TA 3HNVL 3OHXA 3BPOB 2B8OT 3LD8B 1TNNA 5TE6L 5KSBE 4PJAA 4TNWK 3SEPA 3R06B 3BP7A 3GSNL 3HC4H 4LLDA 2P8LB 4S1DC 4WJ5A 1N5AA 5IBTH 5IG7A 1QFOA 3VXTB 3GUTA 3RUGF 1NAMB 4HKXA 1HILA 2CRMA 4LPXA 4Z7QF 3F7PC 3QCTL 1YY9D 2V7HB 1KENL 2GW5A 3KNBB 3OB8A 5FXCH 5D1ZD 5TE6H 5GGSA 4WWKA 3P30H 2ZSWB 5EUKB 5D7IB 4U49A 2ARJA 4FMKA 5J1AA 1TQCB 4MZ3A 1KPVB 4MA8L 3RVXC 3L7FB 5DGQA 4LEXL 4XI5D 5JOPE 1PLGH 1MI5A 3ECBA 4I5BB 1HEZA 3BH9B 3E6HA 1R5IB 1VEPA 1VADB 3EO1B 2YUZA 1CXKA 1M7DB 4LLQB 2Q76A 1TQBB 5GGUB 4MAYC 3WN5B 4Y5VA 4ZTOL 4G9FD 1U0QA 3UTPD 2YC1A 4F8QA 3DHJA 5I19H 4DVRL 3MRLA 4NQCD 4U0RB 5T1KD 4QXGL 4XPFH 4DZ8B 5IMMA 5DD1H 3W82A 3K80A 5D9SB 4RA3A 2X4NA 2PYEE 4X7EC 4YBHA 2HAZA 4UIMB 3I6LE 5IVXE 4E0RB 3RI5F 3D2UB 3QI9B 3QNYA 1ZLWK 5IVZB 4JM2A 4ZXBA 4RAVA 2J8OA 2A77H 3LS5H 4N0UE 3VG0L 3FFDA 1CXLA 5ALCH 1ZANH 2APFA 2FWOB 3RNQB 1P9MC 3KYAA 3FO2B 4NRYA 4I0CC 1P1ZB 1GCFA 3I6GA 3L7EA 1B4JH 1IFHH 3OBAA 3REWB 2JJUA 4KGJA 4OGAD 1YY9C 1RD6A 1KLGA 3B2VL 1UZ6E 4XRCB 4IOFC 4TSCH 1XIWB 3BP4A 5HTSA 5FHBL 4D0DA 2Y7QB 1J8HD 4L4TD 2IF7A 3FB8A 3C60B 1NFDB 4XGZA 4HWZB 1IAIM 4OM0L 5HGDB 1UWXK 1LNUB 5HHOD 1HQ4A 1FN4A 1R3HB 1OP5K 4BQBA 4J23A 3RIAK 4GG6F 2WNGA 2J8UF 1KPUB 5HPOA 4HK0A 5ERWB 1FZOB 1ORSB 2VDML 3E0GA 1QVOB 2WBWB 4JFPB 2BMKA 4WO4B 2WUBH 4UTAH 4X5XA 5FYLL 2PW1B 4D8PA 3MJ9L 3UYRL 3I3BA 2ZSVB 2D7MA 2AJVL 2IANE 3VFVB 3FTGB 3MYZA 5GZOD 3V95A 3QFJB 2HRPH 4QCIB 1AFVH 2XWTA 2V7HA 5TQ2L 2MCPL 1YQVL 4M5ZH 5BRZA 3G6DL 3IFPB 4KK8D 3GIVA 2DLFH 2DQUL 5J11C 4O2FB 5ADOL 4ONFH 2AEQL 4BJLA 2BNUB 4WFHE 4D0BB 1GGBL 5L9DL 3WDHA 1U8HB 2E9IA 4OKVA 2EO1A 1RPQA 2P5EE 5J3HC 1EZVX 3MRJB 1G6VK 2Q8AL 4EN3C 5F93C 5E99H 4WI6A 4M48L 5GS0C 4QHKI 1EFXB 2FL5A 1BP3B 1B4RA 5LBSH 1T2QH 1EUTA 5DRNB 2R1YA 4K23H 5I75C 3LZFH 4POZD 4OI8A 4KROC 5F1IB 4H1LB 1QEWB 1F3DJ 4WHYH 4IMKA 4J1UA 3MRMB 2DIBA 1SYSB 5KSVB 2FSEB 3OJMB 4P46B 2J2ZA 4P4RA 4ZO9A 3O4LA 3FT3B 4K3DH 2RQ8A 3MLXL 1LP9B 3QCTH 3FRPA 3FFDB 4S1SL 1URLA 2HG5B 2WBJA 2WUCL 2XFXB 5DS8A 5IF0A 2XZAH 1DDHB 5CP7A 3DO3A 4HK3J 1CGVA 5FYKU 4YFLF 5ID0B 2E6PA 1RURL 4L9LA 3VXRA 3NPSC 2Q3ZA 1RK0A 1NCBL 1RUPH 4XVSH 3CDGB 3SDAC 3OB0K 1F3RB 4UUJB 3TO2A 5EU5B 5I9QB 5C0IB 3CFIC 1GGYA 2EDNA 1EAPB 1WIOA 1DANU 2PNDA 2AAVA 4LRIC 2YPKB 3B6SB 3GSNB 3D85D 4JY4B 1LE9A 3LN4B 3O3AA 3KPRE 4PJ7A 3BP6A 2CJUL 4X7TB 4KY1H 1RI8A 3HZYB 3EFDH 2AV7A 1YEHH 4DZ8A 1EO8L 3NCCB 3W9EB 1UQSA 1TIUA 2C7UB 4B41A 5IEKA 3ULUL 1RZKL 3FB6B 1UJ3A 3SDCD 3CZFA 3KLAA 1GGCH 3LRSB 5IBUB 5E5UB 4NN5C 5IK3A 2R1XB 4OFKA 1FL6B 4IIQB 4R96B 5KW9H 5BRZB 3UPCA 4JFEE 5DJXA 3ULSA 1B0GB 2DLEA 1KPRA 1IEBB 1NCDL 1RULH 4HJGA 5GS2H 3PHQB 3X14B 5B4MD 2WIIB 5J1TC 4YDIH 3CDCA 3G04A 1ZV5A 3BH8A 4NRZA 4OKVB 4C56E 1XCQB 3KPSB 3U7WL 4DVBB 3V0WL 1UENA 5GGRY 3TNNA 2HA1A 1AGFA 2VLMD 2ED7A 3WLBA 4JM2C 4MA1C 3OGOE 4ODTH 3VXMA 1MFAL 4DK3A 4OZIF 5BCAA 1ZLVK 4ONHB 3OKKB 1N64L 5INCB 5C3LD 4AENA 4I8DA 4GAJL 3KNBA 4YHZL 1FVCB 2X1QA 2WZPD 1UT9A 3KVQA 5JNYB 4U1GC 4Z7WA 4I3SH 5A3IC 3HAEA 1G9EA 3HFML 1FG2B 1CCZA 1HKFA 1YPZF 2G5BA 2QQKL 5DA4A 3I50H 5BO1H 2YPLD 1CDBA 1OVZA 2J1KA 5DD3L 1NBVL 1FFNA 2R0KL 5HDBF 3RVWC 1MCEA 4XNMB 1SY6A 1A21A 3P4OA 3MRRA 5IHLB 4ALAH 1OP5H 1AGBA 3RTQB 3RL2A 3RL1B 1RZ8B 2I9TA 4O5LL 1VPOL 3EOTH 1UZ8B 1WGOA 1FNAA 2IALA 3VFMB 5A2KH 5EO9A 4GT7A 4NQSB 5DFVD 7FABH 2IG2H 2D9QB 4LLVB 1MJUL 5F9WC 4Q6IB 5DD6A 3K2UL 3VD5A 4RSVA 4PGCA 3HI1B 3UTTA 2NY4B 2XRAH 4PG9A 4ZNEA 2J7LA 4CGTA 2FWOA 1U8JA 3QO0B 4YHIA 4Z78A 1IM3B 4NBYB 3WE6A 2Z93B 3KYOB 3EIFA 1DQQB 3VW3H 2CDFB 4I18C 8FABB 5D8JL 2APVA 5JMRA 3F62A 4RGNE 3TN0A 1DEEA 3MACL 2ZCKL 2R2EB 1R5WA 2A74B 4Z95L 2FL5B 3MRDA 3LKQA 3LN5B 1EEYA 4L3ED 5C0DA 4YDVA 3KLHD 5D7LD 4JHBA 3RNQA 4OT1L 4G42B 1NAMA 3V6FB 1F58H 2CPCA 4DGVL 2NW2B 3SDDB 1DQJB 1R24B 1KJ3H 3ULUE 5F9AC 1CIUA 5FA3B 1NC2A 1H3UA 4UT6L 5BVJA 2W92A 5DO2C 5ESAA 4JKWA 5D9SA 5IKCA 4PV9A 1T3FA 5GHWH 4JM4H 4WRLA 4NWUH 3HNTH 1ED3B 5MEQB 1OTSD 2Z35B 1R3IL 1X5GA 4GMTH 4NQCE 5DHYA 15C8L 1VCAA 4B53A 2CJUH 4JZOA 4ZOCA 1CFVL 3D0VA 1PX4A 3V52H 4ZSOB 1BBJA 1F3DH 1QYGH 5GRUH 5ERWA 2YUXA 4WHTB 1G7HB 2EEDA 3MLYH 2EDFA 4ZS7L 2NX5B 3SDXA 5DSCB 3BDYL 5I1KH 5AUMA 5LJYH 2H6PB 2DYPD 2WW8A 4AMKL 2NY2D 2JJSC 4HMEA 4XP5H 4CW1A 3O9WC 3AS0A 2FATH 3Q48A 3JV0A 4PP2A 3RPKA 4XGZB 4FZ8H 5CINL 4IJ3B 1U8IA 2E7CA 4PBVC 5FHBH 4HJ0D 4JRYE 3PUCA 2XA8H 4OV6F 3GIVB 2DQIH 4PS4L 4H20H 4RZCB 4AYFA 3FFCE 2OJZH 5JIIA 2BVTA 3WFDL 1XGPB 2GFBB 3BKMH 1TZIB 3L3DB 5AWNH 4LKCA 2RBLA 1MIEL 2EH8L 3CXHK 4TOYL 1LDPH 1A6UH 4K2UH 4Q2ZB 1FFNB 3ULVC 1OGAD 2QQLL 3BEVB 3FRUA 5T3XD 2Q6WB 2YN5A 4TUKH 2QSCL 2NY6C 4XXDA 4JQVC 2RCSL 3VXSB 3MOBL 5CIPB 5CSGA 4YHNA 3T0ED 4FFVC 4RMRA 2E7HA 5FM4A 4D9RD 3G5VA 1TXKA 1NGXB 1NCNA 4KFZC 3HE7C 5J7CC 5MEND 3WUWG 3VXQA 1MH5B 1CTNA 1INEH 1HOCB 1RUML 1A9EA 1AGFB 2OTWB 3UTSB 5KOVC 5KTEH 2AI0L 4M7ZB 3TNMA 3NGBB 1A7PH 3TH4T 2X7LA 3UJTH 3VH8G 4OLXH 4Y2DA 4PGBB 5MERA 4GLRH 2HN7A 5F97E 4PJEF 3K46A 1TMCB 4XPGL 1RY7B 3P0YL 4RGNB 3F6IA 1WFUA 2NLJB 1IM9D 4M7LT 1WQVT 1UM6L 1S7VB 4LSRL 3DI2B 3PP4H 3G5ZB 2D4FA 1LP9E 1HH9A 5DQ9B 1UWEH 1B0RA 1WAAE 4HDIB 4LRNH 3LN5A 4PRPE 1U95A 4IRSC 1EXUA 2XQYK 1Z2KA 3NVQA 3RHWK 1DEEB 4JRXD 5IFHH 4P5TA 1M05A 5DUMH 1SJVA 3KS0J 3D48R 3BP6B 1NANI 1NH6A 4OLYL 2AK4A 5DJZB 4YQXH 2H3NB 2EXYC 3CDYA 3BXNA 1M71B 3GMRA 1T80A 3MRFB 2J4WH 4KHTL 3QEUA 2VL5B 4NQCB 4WW2B 4HG4K 3V5KA 1TJIH 4MWFA 1KYOJ 5LAXB 4L4VD 1JYNA 5C0DB 1E4XH 5AG8A 4UZGA 3JSSA 3MGOA 4Y88A 3TCLA 1S9XB 4PJBE 4L8CA 3ARGB 1G9NH 1AD9B 1KB5L 3O3BB 1C1EH 1H0DA 2ARJQ 2C3HA 3ILQC 2EYTB 5K9JH 3WNKA 5CMAA 5C70A 2Z92A 1HXYB 1HHKB 4ODSH 4YE4L 1OD9A 5A16B 1CK0H 4LQFH 4U0RC 2DWEB 3DUSB 1FFPA 1QFUH 1S9VA 3V0VA 5DSCA 3SDXB 4XMKH 5CD5C 4RQQA 4UQ2A 1MJ7L 5I17A 1TENA 4GBXA 4O58L 1S3KL 4X99A 3PHSA 5D7IF 1NPUA 3Q6FB 3DX7A 4LRIA 3BMVA 4C83A 1KENH 5I8CA 2E9JA 1UGNA 4QRPD 3U9UA 3L3DA 3T3ME 4LFHG 4OTXH 5FCUL 3ZKMD 5KJRL 4E41D 5C92A 4GKNA 2EDRA 3CLEL 1WIUA 3U30B 5SX4I 5CKAA 1A6PA 3TVMD 4PLJD 5E94B 1J87A 4OI9A 4WGVB 1GAFH 4CVXA 5D7SH 3L3KA 3OKDB 2AW2A 3T4YB 2FX9H 2V9TA 5HHMB 3VWJC 5HHVH 2VERN 1IARB 4OF3A 1A3RL 1P4IL 3EBAA 4K2UL 3MBED 1MHPL 3L1OH 1EEZA 1OLZA 1CN4A 2WQ8A 1KLFA 1G7JA 1T7VA 5IROA 2HTKD 2FBJL 2R9HD 4Y16A 4Q9RH 3NAAH 3TN0D 3K4DA 2UUDH 2H3NA 1ZHNB 2F58H 2CK2A 3QT2A 3IDGA 4EUPA 4WU7A 1C8PA 4K7PX 4LCIH 3WXWH 3VFOB 1PZ5A 5DFWH 1FSKC 4HUUB 4MNHB 4APQC 2H32A 5JORB 1BZ9A 1JRHH 3O6KH 1V3LA 4HPYH 1CK0L 4LQFL 3WUWB 5CEZH 3TBVB 5GQBA 3D3VA 4LCCB 5EO0A 3WHXA 2Z93A 3FN9A 5D1QD 1QZ1A 2AV1B 5DJ6A 5EIQA 4BKLB 5I1HL 4OSUH 3V4VH 4S1QH 4ISVA 2CKBB 1MCCA 1MNUL 4XPAL 2ICWA 1Q9OA 4LFHD 4LLVA 5C0ND 2Z91A 2ZJSH 3O6FB 5GRJH 3H9HA 4NNXB 4XP1H 2X4NB 3QDGD 4WO4C 5DD5L 2IQ9H 2W07A 4ORGA 1NEUA 1U6AL 1UM5L 3PNWA 5J12C 3MJ7A 2FECI 5ADPH 1IC7H 4Y1AE 3AM8A 5HDQH 1S7QB 3CX5K 2X70B 4FQXC 4NRXB 2RCSH 1MCPH 2XWBA 4HD9A 1MCIA 4QLRA 3LV3B 3HMXA 2AGJH 3QXWA 4PP2B 1ZXQA 2BNRD 5AAWA 4XVJL 2QKIB 32C2A 3CH8A 1EJOL 3NAAL 3U7AA 2I60H 3VGAC 3WFEH 1NC4A 2ZZUT 3RVUC 3ZHLA 4ODWB 2PO6A 3GSQA 4LSVL 2GUOA 4XXCC 3DIFA 5JUEH 4U1NB 4ACPA 4XNYH 2Z35A 5HBBA 3JWOH 4OZFG 4OM1L 3M45A 2VR4A 3CXDL 3ARUA 4XP1L 1FGVH 1NLDL 1VHPA 3FFCB 4G6MH 4Z76A 5GS1A 2GITB 1S8DB 2QSVA 5CEZD 1A2YA 1KEGH 3OR6B 1AJ7H 1Q9KB 4KQ3L 2CUMA 3PQYE 3WFDH 3UAJC 3A6CL 3VXOA 4CJ1A 1YJDC 2XQBH 1HH9B 1JGEA 3MXWH 5DQ9A 3CZJA 3H9SD 3QDJB 4V1DB 5E2WL 3V79C 5C0BA 2Q20A 1J10A 3V2AR 5HI5C 2VXVL 1LDPL 2I25N 1OB1A 3BP4B 4XMLL 5E8NB 1KN2H 4ZQKB 2A9MH 4LSUL 2BP3A 3TO4B 4PGBA 1Z9OA 1LO5A 3QZWA 2I26N 3QXAA 2DKSA 1LEIA 2B20A 2K7QA 1OQOA 5CZVH 3UTZA 5TFSL 4LKXB 1EGJA 5D2LB 2YOCA 3UTSE 1FLRL 3FAXA 4LPYA 4A6YA 4CMMB 2P5EA 3LKRB 4LAJH 3UPAA 1AHWC 3O4OB 5ECJE 3ET9F 3OAUL 5EWIH 2Q7YA 3VJ6A 4AIZA 1DN0A 2AGJL 4MQXC 1J0HA 1JPSL 1U8NA 3N1MC 4WCYL 1YYLL 1ZHLA 3QEQB 4M6OL 4L3EE 1IGML 4JN2A 1MRCH 2YD5A 4UDUA 2NY6B 3S7GA 4IOFD 1CFNA 1JK8B 3C8HA 3HR5A 5I1AA 4HKBA 4NNPL 2YC1B 2QV2A 4X6CA 4M7LL 4DN3H 3RX5A 3CIQA 4DKEL 3LS4L 4OF0A 1G6RL 5CBAB 3NFNA 2Q76B 3PV6B 2KQMA 4JFFA 1NEZG 3BZDA 1KTRL 1BQHB 5L9DH 1MI5B 4QRSB 4PRAB 4NOBA 3C6SB 3QUMH 3BHBA 1ADQA 4UOW0 4ODUB 3U79A 2W91A 4AH2B 5J56B 5GISL 4WWID 4D2NA 4Y4FA 5HD8C 2DKUA 3L9RA 3LH2H 1ZEAL 1JV5A 1BQLH 1E4KC 1MCWW 3FCTB 1BIIB 4XBPB 4Y4KA 2OK0H 3C2AH 5D1XA 5IWLC 2JCCB 3ARDB 1W0YT 1WV7T 1MRFL 5E94A 5L0QC 2BOBA 3QEHB 2G2RA 2DMKA 5TQ0L 5J6GB 1CDIA 2M26A 5F70A 1A14H 4R90L 5HGDA 5BS0D 2HJKA 1NGZB 5EIVA 4K9EC 1RUAL 5IVNA 1FDLH 1JE6A 2F53A 2GUOB 3NH7H 5K9KA 3ULUH 5B39G 2ZSVA 4M7JL 4ZUUB 1FL6A 4R96A 3L5JA 4HSQA 1R6VA 1JUFA 4Z7QE 4NQDE 3LZFL 5HHPB 1CLOL 1IM9A 3N1GC 4QRTA 2EDOA 1UJ3B 1JL8A 4KC3B 1LO5B 2P4AB 2ZPKH 3FN0L 5DHVA 5LWYL 4NRZB 1Q0YH 3H3PH 3WL9A 2BMKB 3RBSA 4WEBL 4U0QB 3IJYB 3GSRB 1T1ZA 3CGTA 3JXAA 4PJXB 1YEJH 5I0DA 2BX5A 1K6QL 3JWOL 3QFJD 4N8CL 3P4MB 5D7JB 1CFQA 2GSIB 3Q3GA 3QIBD 3MA9L 1QVOA 1X5HA 1MFAH 3CZFB 4YC2C 1L6XA 1DBML 1HWGB 5I17B 5DHVH 1S8DA 5L8JB 2MOVA 3F65A 3KLHC 5TFSH 1PSKL 2CLRB 2VDRH 3L5IA 3MV7D 5DEFB 3P73B 4LNRB 1K5NB 1VFBB 5I19L 5MHSD 1TTUA 1M7IB 2C1PA 3UPRB 5IJKC 1NBQA 1N6UA 4BKLA 1FC2D 5ANMB 3KYKL 1IC5L 1NEZB 5B8CA 5JDSA 1YEKL 3QXDB 4U1LB 4FQJL 5LXGH 3LHPL 1CE6B 3HC3H 4O58H 2QADD 1CR9H 3WIIH 3NH7L 4CMHC 4IRSA 5DTFA 4YIQB 2W1NA 2A0LD 4DQOH 4CU6A 4QRSA 1U2HA 2AXFA 4ORZC 3TPUB 3L95B 1RZKH 1NGYA 1S5IL 1XH3A 2IC2A 2Z9TA 1QEWA 2ED8A 3MFFA 4LVHB 2NY3D 4DZBA 5DJ6B 5ILTL 3OKYA 4HS3B 1NDGB 1MWAL 4WWKD 4G8GE 4XT1C 1WSST 5I8KL 5KSAC 1Q9OB 4OIBA 5E7BA 2IG2L 4FNLL 2WWMD 4KMLB 1KCVL 4MLIA 4HS6A 4TNWF 3QIWB 2XFXA 5DS8B 3K3QA 1CDUA 2FIRT 3PIQB 4ZQKA 4HC1L 3EZJB 1VFMA 5FK9B 4MSWA 1U42A 5JXAL 1Q1JH 1RK0B 2H9GB 5F6IC 2EXYD 3Q1SH 2FCBA 1VKXA 5EU6B 4M5YH 1SMOA 3FN0H 5FKPB 3MCLH 3SGEI 1BREA 2VWEE 3BIAX 1A1MA 4ZO7A 3VGGA 4N5EC 1BVLB 4HUUA 2BJMH 3ARYA 2BVPB 1WFOA 2HT4C 5EG6C 1E27A 3U30C 1WTGT 4HUMB 1F3JA 5DRWA 4X7DC 1P7KB 2UUDK 5BVPL 1XIWD 1ZHKA 1SQ2N 1JRHI 1N2RB 1CU4L 1E6OH 4JFDE 3G9VA 3VXUB 3G5XB 3WHE0 2FNBA 2F54A 1JGUL 3V0AC 4MX7B 1A5FL 2FO4B 1I4FA 3MUHL 3RUGA 4AH2A 5DZNA 4Y19E 4PGEA 5DQDL 4Z77A 3WFHB 2CKBH 1JPGB 1JPTH 1UXWB 4KJQC 1U41A 1IGIL 4JKPH 2XV6B 4P99A 4U6YB 4MDIA 3QWOA 1Y6MR 2X4RA 3VWKB 4AIXA 2DF3A 5SWQB 3RZCC 3V5HA 4DGYH 4QNPE 1NBZB 3VH8A 4XWGL 4OZGF 4U1KB 4YXHH 3ROOA 1G7PB 4WIQA 2IH1A 1A7QL 3MRPA 3N9GL 1LE5B 3W11D 3HPJA 4DKFL 3VXRE 4CL7A 5H35A 2ITCB 2QHLA 5T3ZE 1DQML 4HUNB 1XF5B 3GJFK 5IWLA 5DEGB 5AZ2H 5E0QA 2X2YA 2X1OA 2O5XL 4QTHA 2AEPL 4F57L 1HKLL 5F7KC 4KVNH 1P9MA 1I7RB 4IBLT 2ZWLT 4D0CB 1LD9A 1QQDB 1XGRB 4K3JL 2X44D 4OGYH 4PJCE 1XF4A 5TQ2H 4P2QA 4EOWH 3MLTB 4MD4A 5EO1B 4IRJA 4R4ND 4WHCA 1EDQA 1V05A 4MQ7A 4PG2C 1HHIA 3OKOA 1ZAGA 1GHFH 3JTTA 3KPNA 3LB6D 1FFOA 2VMFA 1G6RA 4NHUA 1OTTD 4HKZA 3IETA 1BGXH 4TQEH 1TVBA 4YLQT 2H9GA 5D7JD 2R29L 1BAFL 3GRWH 2QHRH 4K3JH 2G75A 3OXRB 3VXNB 5MEPA 4PTUA 4PB0L 3QXUA 4ZUVA 5T5FH 1AGCA 4H8WL 2VWEC 3IAQA 3QA3A 3SO5A 4W4OC 2NTFB 5ISZA 2HMIC 3BP7B 1IM3A 1AFVL 1A3LL 2QSQA 3NCYS 1MFNA 3GMMA 1EGJL 1G0YR 3MRDB 1RFDL 5C2BH 3TNMB 3OKLB 2AEPH 4N0CC 4EDXB 3DMMC 4LVNB 1JRHL 4N90D 1KCVH 3TN0B 3KLSA 4OIIH 1EJ6A 4HDIA 5DLMH 4HH8A 1RJYB 3BKJL 4YNYB 3VFSA 2IAMD 1E28B 1KACB 1RHHB 3HE6D 1S7VA 1WZKA 3U36B 1W2KT 2YD7A 2ZNWA 4PRPA 1S7XA 3U82B 4LIQH 4K7PL 5IW6A 3GSOB 1PW3A 5C0AB 3QDHA 4PGCB 1CFTB 1JPTL 1RZKC 4QHLA 3MRPB 4RMTA 4I0KA 2NZ9D 5DRXB 1CGTA 4XCFH 4LDLB 4M43H 1BJ1J 3UTQA 4G7YL 5EZJB 4DOHE 1FYHB 2HFGH 1AGEB 3TLRA 4ZFFB 1MHPH 5SWSB 3TBTA 3KPOA 3LAFA 1E6OL 3AS1A 5KG9A 2OL3B 4AG4H 2DQTL 3LKPB 3O3BA 2HWZL 4JQIL 3VG0H 5BW7A 3S97C 4H8WC 1NUDA 2V5SA 3KPMB 1S9VB 3V0VB 2IFFH 4NBXB 4PGEB 3CU7A 3BPLB 5I1JL 3KPSE 4RA0C 1ND0A 5F96L 2BSRA 3QHFH 5D5MA 4NYLA 3UBXB 5IUSA 1NKRA 3ALWA 4MXWL 4Q2ZA 3PWPD 3ELAT 3MO1B 4OZGE 5HI4C 4HUXB 4OIIL 2FX7H 1UG9A 2VDPL 4FQXD 1CTOA 4XBGB 3HMXL 3SJVB 1YEEL 5TE7L 4KKAD 4ZSOA 4Q9CA 3S88H 3S4SA 1NKOA 4Y5YB 5F7DA 1FZMA 1DEDA 3M1BB 5CWSA 5JHDD 4PRIB 1I7ZA 3GMOA 1F4AA 4JO2H 3AS2A 4U1JB 4UOJA 2BVUA 1A6ZA 3IJYA 1KEML 4FQ1L 3SO3C 5B3JF 4XMPH 2EE6A 3ZE0E 5D7LE 4UOW1 5E6IC 3BPCB 5BJTB 4M61B 1QRNE 4JQXC 3OG6B 4KKCD 1E6JL 1XGRA 5CD3A 2V9QA 4M1CC 3P2TA 4QRTB 4MJIA 1EK3A 2ATKA 4RZCA 3T4AB 1T0MB 5E00B 4J3WA 1D3CA 3AFLA 2FGWL 4B7LA 1I8IB 2X9WA 1YPZA 2H2PC 5C0CA 4YDKL 3MPCA 1HXMB 5CS7A 3DETD 3FONB 5EZLA 2SEBA 1C1EL 5DTFB 3QUZD 3L5HA 4HBCH 1JYWA 1U3HC 1C5CH 2LTQB 2VDPH 5IMLB 4K71C 4OD2A 3SDYH 1DDHA 5I1DA 3QA3B 1GGUA 5D72H 4ONOA 4H88L 4M6AA 3V6OA 2NXYB 3G5YA 1X5ZA 2YEZA 3K2UH 2DM7A 4LGSB 5FFLA 1BECA 1GC1H 1N0XL 2VDLL 3CFCH 4JB9H 4MJ2A 4PGZA 3IJSA 5I6XB 4S2SB 3S34H 1SJXA 5D1ZB 1S7TB 4N68A 2FBOJ 1FORH 3P9MB 1MCRA 2O5YL 1IC4L 3BQUB 2VABB 4XP4H 1AO7D 2FATL 4YBLC 3QRFM 1MRCL 3S6CA 3WO4C 1DBAL 2WWKO 5C0AE 3TH3T 5JPMB 5F7EH 4QHMA 4Y5XC 4JLRB 2P8MB 5FGSA 2V5YA 3N06B 3C09C 2P45B 2C4FU 2XY2A 3BPNC 3KS0H 1GSMA 5MI0B 3BT2H 4KJQD 1QBMH 3RPIA 1NCUA 4AK1A 4PJHE 1NGQH 4NUGL 5ICXA 4ZD3L 5CCKH 3QDGE 2BNUA 5FYJL 1M4KA 3H7LA 3NACL 2NR6C 1L7TH 3VGAB 4JY5H 1FE8L 4PV8A 3GBML 2X4RB 1B88A 3FQUB 4RGOL 3EDKA 3VFUA 4JPIB 4XMLH 4XP5L 4LMQE 3WJLC 4OBRA 5EZOH 3MNWB 5EUOA 3EDEA 3GM8A 1IILE 3IDIA 4OZGB 3WFHA 2EZ0C 4YHYC 4YPGA 2FBJH 3TZVD 2DWEA 5GIRB 5KS9A 4LASL 1IKNC 5GZOC 2W60B 4WUUA 5ESVA 4F33A 2ICWI 4UINH 2OJEB 3V7MA 5SWZA 4ODWA 1KT2B 4GKZB 4JDVA 1Q1JL 1BLNA 1OAZL 2VDNL 1X5IA 3ARWA 4PJIF 1QLFB 4Y4FD 1AXSA 5CJQL 4QCIA 5I15H 2Y7QA 4M03A 4X7CC 5ALBL 1WC7A 4JREB 4I13B 1U9KA 4YHKH 4CDGC 1YA5A 3R0MA 1UM4H 4KDVA 1S9KC 4PREB 1FZOA 1ORSA 3QQ9D 2EC8A 3D69B 1Q9LA 4Y16C 4MQTB 4JZNA 2NNAA 5IR1A 1LHZA 2YBRB 4GKSA 1MCJA 1UXSA 5FIEA 5L88H 1NJ9A 3TA3A 1MVUB 4EIGB 2QADC 5ETUA 3BE1L 3C60A 3FB8B 3MACH 3L6FB 5INCA 5M94B 2NY0B 1TVDA 4OFYA 2ZG1A 3DMMB 1I85A 4LVNC 5AD0A 2VSCA 3HZYA 2GJ6A 5CFHA 3SDDD 3VCLA 3H0TA 1WBYA 2AJ3B 4X6DB 1D5XB 1QLEH 1SVCP 5ACMA 3DV6A 5FUZH 3H9YA