5T5OA

Lectin from bauhinia forficata in complex with tn-peptide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
229
structure length
229
Chain Sequence
SELSFNYPNFQSVEDITFQGGASPRNETLQLTPTDSNGIPIRQRAGHAVYSQPFQLRDTSFYTTFTFVIRTTSNSPADGFAIFIAPPDFPVKRYGGYLGLFEPNTATNTSANKVVAVEFDTWVNTEWKEPRYRHIGIDVNSIVSVRVTRWQDKDVFSRSIATAHVGYDGISKILTAFVTYPDGGNYVLSHVVDLAEIFPGDVRIGFSGATGQYETQYIHSWSFSSTSTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title Structural analysis and unique molecular recognition properties of a Bauhinia forficata lectin that inhibits cancer cell growth.
pubmed doi rcsb
source organism Bauhinia forficata
molecule tags Sugar binding protein
total genus 53
structure length 229
sequence length 229
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2016-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5t5oA00
5CB7A 3SISA 1X50A 2GMEA 1IS5A 1UMZA 4LBQB 3POSA 1LHWA 2CNAA 5DZGA 1V6LA 4C1XA 1CVNA 3MW4A 1SFYA 2R0FA 1LEMA 4Y26A 3AP7A 3PVEA 5GZCA 2WT1A 2NP0A 1IS6A 4H55A 4R9BA 5DZFA 1GKBA 1G9AA 4KBBA 1CR7A 1VLNA 2A6XA 4BLJA 1V6MA 3AXEA 1HQLA 3M3CA 2AYHA 1LHNA 4Y1YA 2DVFA 4YFWA 1N3OA 3N7KA 3PMEA 3OYWB 3B69A 3A0KA 3KM5A 1QMJA 4YW2A 3O12A 3DUIA 3POWA 4Y1UA 1N47A 2DUOA 2PHXA 3H0OA 1JYIA 1C1LA 1LGNA 1W6MA 1N1YA 3VV1A 2DVBA 3ZXJA 2UURA 4LBMA 1MACA 3GALA 4TZDA 4XTMA 3OGGA 1WBLA 1BZWA 5GZGA 4DRRA 1DBNA 1KJLA 3HMYA 2EAKA 3BIWE 1OKQA 4DRVA 3AJZA 4YLZA 2D6LX 1WLCA 2W08A 3PVNA 4GWMA 1QGLA 4P9XA 2ZGQA 2WKKA 3O0WA 2ZACA 4YZ1A 1QNYA 5HCAA 3ZYPA 4GXLA 3W58A 2P3KA 4Y22A 1MS1A 5LK5A 2D6MA 3B9CA 5JOWA 5GLWA 3ZXFA 4WVVA 2UWAA 4NOTA 4LBKA 2ZGTA 3GNEA 1VALA 1SCRA 1MS5A 1WBFA 5GZFA 2I2SA 5EYYA 4ASMB 1W0OA 2VH9A 1Y7BA 4U2AA 1G9CA 3N36A 1GZWA 2OUJA 3APBA 4AVSA 1DQ4A 4XILA 4AWDA 4L8QA 2EIGA 1DQ1A 3LCPA 2VW0A 2DUPA 4Y20A 1S0BA 4DPNA 2ENRA 1GZ9A 2AGSA 2EALA 3AYCA 3PVOA 4D69A 4K1YA 2A3XA 4ATEA 2WSUA 4XMAA 5F5QA 3IPVA 3T1MA 3WVJA 3A4UA 1MVQA 4Q8KA 4U36A 1GBGA 2GNMA 4FOQA 2A6YA 5T5PA 4YFZA 2R49A 2GNDA 4BMEA 5GLUA 1GLHA 4JRAA 4Q1RA 1V6KA 2SBAA 1ONAA 3W59A 2YMZA 4Q8LA 2DUQA 4UW6A 2CTVA 2XG3A 1JYCA 1KQRA 4YW1A 3ZXLA 1S0IA 2ZHNA 1AX0A 2ZBJA 5GALA 2EXHA 1SCSA 4PBPA 1LEDA 4YM1A 2XB6C 3WDXA 1ULCA 2ZHLA 3ZPYA 5KXDA 2ZGRA 5DG1A 3RS6A 2PELA 2ZZJA 1S0CA 5T5JA 3M3EA 5EWSA 3SH3A 1PZ9A 2W52A 4C1WA 3AJYA 1SACA 2NYYA 2VXRA 3WDYA 4FOVA 3WUCA 1N1VA 3Q9OA 4M3CA 1DGLA 4XOGA 5SV8A 2E7QA 2DYCA 1WLDA 3NV3A 3UL2A 3ZXEA 2A3WA 2NN8A 2WT2A 4R9DA 1PZ8A 4YW3A 5KXBA 1YO8A 1LESA 2AUYA 2UWBA 3AZXA 3ATGA 4R9CA 3WHUA 4I30A 1S0FA 1J1TA 2YZ4A 3UK9A 1JW6A 3USUA 1SBDA 1Q8SA 1SBFA 3NV1A 4YM0A 1LULA 4XE9A 1BKZA 1MZ5A 2YY1A 4GKYA 5F9TA 3M3QA 2OW4A 3RSJA 4AGRA 1W0PA 4BMBA 4YZ3A 3VUOA 4JCKA 4FPHA 4PF5A 1CPNA 4IQPA 2JD4A 2A71A 3VKFC 3ZSKA 3MW2A 4UW5A 1FYUA 2WT0A 2VW2A 3WG4A 5HCBA 3OY8A 1B09A 2DVAA 1MZ6A 1U0AA 3AZZA 4FPGA 4YW4A 4BQ1A 1V6JA 1QU0A 1G7YA 3HN1A 3IPVB 2ZGOA 2D43A 4ISQA 1WD4A 1HDKA 1LCLA 1H9WA 5JDBA 1JUIA 1UPSA 4XTPA 4XHXA 3WCSA 3AP9A 3N7LA 4FPKA 1LOCA 1QDOA 4WZFA 3AFKA 3KQRA 4K20A 2AH2A 1BXHA 1SLLA 3FUQA 2D44A 2G4IA 1MS8A 1W6NA 2A75A 4UW4A 3SNMA 5T5OA 2D6KA 2GN3A 1S0EA 1DFQA 4ATFA 3LSEA 1KRIA 1WUVA 2GN7A 1QOSA 5DUWA 3VKNA 3NV4A 1C57A 1W6QA 4FP3A 5GLTA 2JE7A 3V65A 3ZSMA 1F31A 4P9YA 1ZA4A 2D3RA 5DG2A 4RL7A 1GSLA 4GALA 4XBLA 1YRZA 4ISRA 3WG1A 1KDKA 4XJAA 3ASIA 3WUDA 1DQ2A 3RQ0A 2RHPA 3HR9A 4BM8A 1A78A 1HLCA 3AYAA 5EYXA 2ARBA 4ITCA 1F9KA 2D3PA 2GMPA 1FAYA 3AYEA 4XIOA 5GZEA 3TB0A 1O4YA 1A8DA 3WOGA 2E6VA 1XQNA 2GNTA 3FBYA 1NLSA 5EXOA 2WQZC 1ZM1A 2ZKNA 2V73A 1AXKA 1CONA 2AREA 2DVGA 5GJ6A 2JKBA 5JOZA 2Z42A 4BLIA 1WW6A 1ULGA 2ZGMA 3MPPG 5CBLA 4FPEA 3AX4A 5H9QA 4LBQD 1S0DA 4XMIA 1GZCA 1LU1A 3AXDA 4XBQA 4XIKA 3V0BB 2CL2A 1AF9A 1CJPA 3IKWA 3IM0A 4Q27A 5DUUA 2D6NA 2ZGSA 5H9PA 5T5LA 2DURA 1YI7A 3AZVA 1QNWA 2PHWA 3N3HA 4AYUA 4PCRA 2YV8A 2ZABA 2TEPA 5E8AA 1QOOA 4AVTA 3D4KA 3OY8B 3SITA 5IK8A 1LTEA 5IT6A 3FLTA 1QKQA 1AZDA 2CY6A 4CTEA 5IK5A 1C4RA 2P2KA 1MS3A 3JU9A 3O0VA 1LGBA 1RIRA 2A70A 1S0JA 1EPWA 5E88A 1CN1A 1YYNA 3RRDA 1G9BA 1OQ1A 2D3SA 3A0NA 5H9RA 3FLPA 1V00A 2NMNA 3V0AA 5H9SA 2JECA 1WW4A 3ZVXA 4Q2FA 4Y24A 1AX1A 4FPOB 3WNXA 5IK7A 3WLUA 3D5OA 1I1EA 4JC1A 4F83A 2CYFA 3ILNA 4XDQA 4WV8A 5FRAA 1W6MB 2SLIA 4Y1VA 4YM3A 1GYKA 1GNZA 1N1TA 2ERFA 5FREA 3UJQA 2P34A 1UN1A 3OBRA 3ILFA 4LBOA 5AVAA 4Z8BA 3TAYA 1MVEA 1ENQA 1N1SA 1MS9A 2E51A 2ZGLA 4FPYA 4YGCA 1YIFA 2EXJA 2GDFA 1LODA 3AZWA 2JJ6A 4FQ4A 5GLZA 1GANA 1S0GA 1JXNA 1LU2A 2PHTA 3AZYA 3VKLA 4AGVA 4DQAA 4GWNA 2EXKA 1FV3A 4YG0A 4GKXA 2VY0A 4YZ2A 1CPMA 4YG3A 3OYWA 2R0HA 4Y22B 2WNEA 5IK4A 3BTAA 1FATA 2JE9A 1HQWA 4Y1ZA 4P9WA 5DUVA 3IMNA 3WV6A 1CQ9A 4P14A 5T52A 3LSDA 2DVDA 2CWMA 1IKPA 2EF6A 4FPCA 1YXWA 1SLBA 1HKDA 2A6WA 1DZQA 1GZWB 3M2MA 4CZSA 4LBLA 1FNZA 5DUXA 1DLLA 1Z78A 4Y20B 2ZGPA 3M1HA 3ZSLA 3JUUA 3BODA 3ENRA 5DXDA 5JVVA 3WCRA 1N3PA 2E7TA 1H30A 2DWRA 5CAZA 5JOXA 1CESA 1LOFA 1DYKA 1URXA 3M3OA 1V6IA 3N7MA 1KITA 1Q8QA 1JBCA 5T55A 1AX2A 4PBOA 4OZXA 3ZSJA 4Q26A 2DV9A 2DU0A 4R9AA 2C9AA 3O0XA 1LOGA 2ZA9A 2V5YA 1WCSA 4SLIA 1FX5A 2LTNA 1VAMA 4ZXKA 1F5FA 1IS3A 2ZGNA 1UL9A 3ZYRA 1LOEA 5IUQA 4M3CE 1AVBA 1MS0A 1UAIA 1VIWB 3T2TA 3B00A 2NM1A 1BQPA 1LOFC 3T1LA 4YZ5A 4BPZA 2JDZA 4MYEA 4XJ8A 4XZPA 1IKQA 1RITA 2A3YA 4K1ZA 4XJ9A 1H9PA 4FPLA 3AYDA 3R05A 4TYSA 4RA0A 2UU8A 3ZXKA 2D7FA 1AJKA 5CA6A 2NMOA 3V64A 1Q56A 1S1AA 1G8WA 2GALA 2FMDA 2GNBA 4M3CB 1N3QA 1W6PA 5CNAA 2PHRA 1QF3A 1Q8PA 2ZMNA 3ILRA 1UKGA 3WDVA 4ZKTB 1WW7A 3L2YA 3SH5A 1G9FA 3PJQA 2GMMA 5KXEA 2R16A 4FQZA 5KXCA 2W39A 1LHUA 3B01A 2ES3A 3WHTA 1DHKB 2DTWA 3FLRA 1IS4A 2ZHKA 1APNA 3U4XA 2ZMLA 3AP4A 2PHUA 1IOAA 3D6EA 4XJZA 3USUB 1Q8VA 1D2SA 4YGEA 5GM0A 3NV2A 1ENSA 3BOPA 1VAVA 1WW5A 1WD3A 2ZMKA 3R4UA 1JN2P 2KM2A 1PZ7A 1G9DA 1LGCA 1UX6A 1SLIA 1UZZA 1ENRA 3SH4A 3OBTA 4WVWA 5BYNA 1Z0HA 2UWCA 1DQ0A 2W68A 4FP2A 4YGBA 2ZGUA 1LOBA 3INAA 5HCFA 4XJWA 1LOAA 1OFSA 1LECA 2AENA 4LBNA 5JLVA 1DYPA 1QDCA 4GA9A 1BJQA 4HANA 1W6OA 3I8TA 5T50A 2CWSA 2E53A 2LALA 2ZHMA 3WDUA 2VUAA 4DFSA 2B7YA 1W6NB 1ULEA 5JOYA 4FPJA 5GLVA 1BYHA 1LJ7A 4YZ4A 2OVUA 2D6PA 1ULDA 2YXSA 1LHOA 4YG6A 1C1FA 4K21A 3WG2A 2OUHA 4Q1PA 3OJBA 5L73A 1I3HA 4FPFA 4YGDA 4YM2A 1W6QB 5DZEA 1QOTA 3POYA 3OPZA 4XXPA 1R1ZA 1GV9A 3AP5A 3FUOA 1KDMA 4LBQA 2HYKA 4CRQA 3MEPA 4PQ9A 1RINA 3N7JA 1D0HA 1GNHA 2WSVA 3QLQA 2ARXA 3I4IA 4FOWA 4W65A 2D6OX 3O5SA 1AXYA 2YROA 1W6PB 2DU1A 1LENA 3DGTA 1V6OA 5JMCA 2AR6A 4XXAA 5GZDA 1A3KA 1KJRA 3RMXA 2P3JA 5T54A 1FNYA 4YW5A 4UW3A 1O4ZA 1AJOA 2ZAAA 3IN9A 1G86A 1GICA 2VU9A 3C2UA 2VW1A 3SLIA 2C5DA 4AVVA 2WLQA 3N35A 2PHFA 1SLTA 4NO4A 3CNAA 2DTYA 4XYXA 1LHVA 4BOWA 4FOYA 1CIWA 1ULFA 2BQPA 1FV2A 3AP6A 2A5ZA 4XBNA 3RMYA 4M00A 3NWKA 3WDWA 2H0BA 1DIWA 1JHNA 3UJOA 4M01A 1SBEA 1V6NA 2P3IA 3WG3A 2A6VA 2EXIA 3R4SA 5E89A 2FHRA 1W6OB 2A6ZA 1Q8OA 1WLWA 1JOJA 4XHBA 3WZ1A 2Q5TA 2A7AA 1SLAA 3RG0A 3VKMA 4DS0A 1NXD1 3B3QE 3WDTA 4AGGA 4LBJA 1SLCA 3FFZA 4Y1XA 3V0AB 2P37A 2WJSA 4HL0A 3AK0A 1DQ6A 3QCWA 4FVVA 4M3CF 1UZYA 3V0BA 1TEIA 3VKOA 1MS4A 3MW3A 2NZ9A 2ZGKA 2R1BA 4XJUA 1MR5A 1AXZA 1DQ5A 2R1DA
chains in the Genus database with same CATH superfamily
3IDCB 1X50A 1IS5A 1UMZA 4NIAA 1VR3A 1AR71 1HRV3 1UNBA 4PJYA 3NRUA 1V6LA 4C1XA 2Y0OA 1O59A 3MW4A 3JXSA 1IPKA 2B9UA 2R0FA 2Y6LA 4CDUA 4C90A 3E5QA 4JDMA 3VD4A 1HV1A 5DAPA 1HB3A 2EVXA 1IS6A 4B29A 4R9BA 3SHRA 1Y9QA 2XHKA 5DZFA 1GKBA 3VZMA 5KC5A 5K0UA 4QX2A 4KBBA 2RM22 1V6MA 3AXEA 4JGYB 1HQLA 1LHNA 1WCUA 2Y6JA 1RUG2 1N3OA 2KXLA 1BEV3 3OYWB 3B69A 3V56A 2LM3A 3EO6A 4Z92B 4LA3A 3MF9A 2YC2A 5F2WA 3H0OA 5FPXA 1LGNA 1W6MA 3VV1A 5T3NA 2RDRA 1QIQA 1WA4A 3TWIA 3JD71 4LBMA 3N9LA 4TZDA 4XTMA 1OOPA 3PUHA 2I07B 1K5MA 4QKDA 4UBHA 1ZA7A 5BV6A 1OKQA 4GJZA 4DRVA 5LZ6A 1NLQA 3TYJA 5FK7A 1YNAA 3AKQA 1JZ3A 2W08A 3PVNA 4HPKA 4Q4X3 4LT5A 2ZGQA 3AMMA 2WKKA 3MF6A 4GIQA 4QT6A 3ZKUA 1CAVA 1F4AA 3KWVA 4OQ9A 2XJVA 1EYBA 5JMOA 2P3KA 1MS1A 5C3RA 1LRHA 3B9CA 3OGJA 1BBT1 1ZZ6A 4LHSA 3K51A 4RYDA 2UWAA 2HWD2 4JDOA 5GLWA 1XU1A 4JGZA 3VBFB 5CADA 1MEC2 1VALA 3WQBA 1SCRA 1RUJ2 2WAAA 5GZFA 5FWEA 4CEWC 1NQDA 4ASMB 3OTFA 1MQTA 2VH9A 1Y7BA 3H3UA 3I7DA 5EQUA 4BQXA 1PK6C 1VRH2 1GZWA 2OUJA 2ZX0A 3GZAA 3JBG3 2EIGA 3AMPA 4K9SA 3MV01 5AC92 3B02A 3ACHA 2KA3A 4GB31 2FZ2A 3ZLIA 5JXJA 2AGSA 2XL9A 2JG8A 4NWWA 4IE5A 3WNLA 3KCXA 4AI1A 1XB9A 2WSUA 3FHIB 4XMAA 1QQP2 4Q8KA 4FOQA 2A6YA 3ZSEA 1FPN2 3CJIA 3OGRA 3FE5A 3UGFA 3TN93 4JRAA 4JHZA 2X29A 2YBPA 1ZZBA 4QHBA 3BALA 2QNKA 1ONAA 2CAUA 2YMZA 4Q8LA 3NAPC 5BNNA 4WM8C 2XONA 3WP4A 5C9AC 1JYTA 4PBPA 1BVP1 1LEDA 5FY8A 1H1MA 1EUTA 2P1BA 2JG9A 2O0OA 4Q4W1 2R043 3LOBA 5FYYA 4EZ4A 5LRRA 3RJRA 1SDDB 1S0CA 3IT8A 2HWE1 3CU7A 2BFUL 3K4ZA 1PZ9A 2E26A 1OLRA 4C1WA 1GR3A 2NYYA 3HWJA 3WDYA 4FOVA 3WP6A 1RVF1 1RL3A 2ZCWA 1OA4A 3Q9OA 5FK8A 3H1YA 4CCJA 3VZKA 2VVEA 3ZXEA 2A3WA 5KHGA 1PZ8A 1R083 1RUD1 2Q1ZB 2XBO3 5CFCB 1YO8A 4YVSC 4LORA 5J37A 3ATGA 4N43C 4LA2A 3NSTA 3I97A 4R9CA 4S2FA 4CCCA 5FUPA 2YZ4A 2RR11 4KG8A 3LQCA 4RHV1 1SBDA 2JXAA 4W4ZA 1GNYA 4FT8A 4GKYA 2OW4A 2PLV2 2YBKA 5FZ1A 1UOFA 5FZ9A 1W0PA 3KSCA 4P9JA 2VZUA 1QJX1 1W99A 1JS9A 4AQ6A 5FR3A 1NA1A 4WM7A 2VOKA 4L11A 1X8MA 3N9MA 2QQKA 3MW2A 4RQPB 1PIV2 1OD3A 1FYUA 3WG4A 3MHZA 5HCBA 1STMA 4S2GA 1K5JA 3CJXA 5FO7B 3VBUC 1YUDA 1VMJA 1HDKA 1H9WA 1HN1A 3WCSA 4XHXA 2J42A 3WW3A 3HQRA 1LOCA 2JB4A 2VNGA 1S4CA 3UT0A 3AFKA 1OKOA 2D44A 2RMU3 4QM9A 1H2KA 4UW4A 1ASJ3 3SNMA 2IXJA 4IEWA 3WP3A 4NUBA 2Q1MA 4ATFA 2HWC1 1K12A 4BA6A 3VD3A 1PGL2 2WFPA 4QGLA 1A8MA 4CCNA 5A70A 5DUWA 3KV5A 4RFRB 3NV4A 5CISA 1W8WA 5GLTA 3V65A 4CP9B 1NUKA 2VMCA 4I09A 2X09A 1ZA4A 3WF2A 4CEYC 1GSLA 4GALA 1TME1 5K0UC 3H7YA 1SHWB 4ISRA 1HXS2 1VBA1 2R071 2JDNA 2WIIB 1PO23 3HR9A 1UU6A 1A78A 2WNUC 3VB9A 3BVCA 2VG9A 3AYEA 2GMPA 1FAYA 3P5BA 4YYOA 2KD7A 2QFEA 1O4YA 2IVJA 1CZTA 1AYN3 2AZ5A 1HRI2 5FP8A 1XQNA 2XLAA 1NLSA 3GDBA 5EXOA 5HPOA 1CONA 1W03A 2AREA 2DVGA 3IIAA 5GJ6A 3H8XA 3KV9A 1PO11 2CDPA 4ET7A 1OI6A 1LB2A 1NOVA 1WW6A 2LUWA 2XVLA 5HXMA 3MPPG 2G19A 4FPEA 2RS52 3MIFA 1RHI3 4Q4V2 4GMP0 4XBQA 3ZFFC 2CL2A 4AEDB 1CJPA 2D6NA 2ZGSA 5T5LA 2DURA 3JQXA 3N3HA 1QNWA 4XFCA 5FY4A 3VDDA 2HWF1 2VXJA 4PCRA 1NY72 1C3HA 2TEPA 1QOOA 2Y8KA 3PHMA 5E8AA 4AVTA 2TNFA 4UWDA 4NR1A 4E27A 4FSJA 1OVSA 1QKQA 1AZDA 4CXYA 3JU9A 4AAPA 1EAH1 3CIHA 1LGBA 4JGZC 3SXWA 4AR2A 1RIRA 2FCVA 3LDKA 4AG4A 5FMDA 5JOWA 2LS6A 4LJHA 1KS4A 3W21A 3ZXFA 2D3SA 1XNTA 2CGOA 1V00A 1H2MA 2JICA 5ACA3 1WW4A 2Y26A 2BW8A 1X8EA 1H0BA 4Q2FA 1W8OA 4YRDA 4C8DA 4Z2AA 2J1TA 2X5IB 2R32A 3WLUA 2CV6A 2Q30A 1I1EA 1YCIA 2XXZA 5IWFA 3PDQA 3C7EA 1Y9MA 3HNMA 3ILNA 2E7AA 2W9XA 4QKFA 4WV8A 5FZKA 4CDQC 1ACCA 1CAUB 5FZ4A 2VZ3A 1HIXA 4ZZ8A 4MLOA 2EAAA 2P34A 5BNQA 1WKYA 1TQ5A 4LK7A 4X6QB 2WO1A 3LA3A 1BK0A 2MEV2 5HV4A 2XPJA 4NMIA 4JVAA 4ZU5A 3D0JA 2JEMA 3HVDA 3U78A 4CCKA 1MS9A 2E51A 3WINE 3MPBA 1W8HA 5DDJ3 4CEWB 2GDFA 3IZOA 2JJ6A 4JGYA 2HH9A 2XJTA 5FPBA 1B35C 1PMJX 3VKLA 1S0GA 2PHTA 2VGDA 1UOJA 3IAQA 1UMIA 3TNPB 1X82A 2WQ8A 1OT5A 3AC0A 5FYUA 4Q29A 1RMU3 3OYWA 2WLPA 4ZZ5A 1EPZA 1GWLA 2VBPA 2WNEA 3ABZA 3EXUA 3PLQA 1OFNA 4IXLA 5IK4A 3BTAA 1FATA 3E5UA 3GBFA 3AFGA 4CDXC 3EBRA 5DAQA 3I2DA 4OHZA 1EY2A 1YFYA 2Y60A 3GXUA 3LSDA 3T0BA 2CWMA 1C8M3 1IKPA 2FDHA 4W6XA 1RUF2 4PQQA 2XJQA 2ZPXA 1ODNA 3M2MA 1L3JA 5FZGA 3FBMA 4PLNA 3LKJA 1FNZA 4E4SA 3AB0A 2V4VA 4CDWC 1RUE1 4Y20B 3ZSLA 3M1HA 3ENRA 4N53B 5FKCA 2FDKA 1HV0A 1PVXA 2WFF2 2BOJA 2PAEA 5A3TA 2RG4A 3P1IA 5APAA 2PXJA 3N7MA 1KITA 3ZSJA 2VZOA 5LB6A 1AX2A 5T55A 5LW9A 5IVEA 4AHYA 1AR61 2C9AA 3VBFA 3ME2A 1NXMA 2ZKLA 2VMIA 1RXFA 4SLIA 4ZXKA 2VCAA 1IS3A 5KC6A 4JKKA 4IESA 5JSPA 5DAXA 1VAKA 1UL9A 5EZWA 2VD7A 1MS0A 4LHNA 3ZDSA 3T1LA 4E8CA 1QY4A 2JDZA 4XJ8A 5FZBA 2C6SA 1MZEA 4FPLA 4LKFA 3R05A 4N43B 3ZXGA 4RA0A 4XFHA 2RM21 1X36A 2BNOA 1CZVA 2A1XA 4GMP3 1WGPA 2GNBA 2GALA 1RUG1 2W2IA 3RNSA 5CNAA 1MPXA 1XSRA 1Q8PA 4HKLA 2ZMNA 2XLGA 1UY1A 3L2YA 4LKDA 1G9FA 4BU2A 2X8KA 4XQDA 3BIEA 4ZPIA 4QXKA 4XFAA 2NPIA 3KHBA 5BXXA 1QXPA 3VBUB 4EQVA 3USUB 1OF4A 1D2SA 1XE7A 4XDOA 3NV2A 3BOPA 1VAVA 5CKMA 1PMHX 4LNVA 4RGKA 2QQJA 1G9DA 1QJEA 1R1A2 1SLIA 1UZZA 1Z0HA 4EYUA 1UD1A 1DQ0A 2WC2A 2W68A 3ELNA 4YNIA 4FP2A 3J8F3 2VVDA 4NHXA 1C5HA 1LOBA 3OF1A 3IWZA 5FXWA 3LDRA 1YLLA 1LECA 2B46X 4QPWA 1DYPA 1QDCA 2QUOA 3D3AA 4HANA 4DXRA 4Y5Z0 4FTBA 5CFCA 1MEC1 3ZYFA 4AFBA 4LUMA 1Y4WA 3LIGA 3GZUC 4CEYB 4CPBD 4RSUA 1RUJ1 2VUAA 4DFSA 2Q4SA 3ZX7A 5J7MA 5JOYA 4FPJA 4BQYA 3LA2A 4A2UA 1VRH1 2OVUA 3HEIA 2D6PA 5I91A 1WMXA 3K75B 1S2EA 2WNUB 4MX3A 1XNCA 1I3HA 5CG8A 1V0AA 3DPRC 4YM2A 5L7OC 1W6QB 4Q4Y2 5DZEA 4ZS3A 1IG0A 4XXPA 3OPZA 2WNVB 1R1ZA 2VOWA 4CU6A 5A3LA 3GJBA 1QQP1 4NAMA 4XURA 3AP5A 3FUOA 1KDMA 1CD3G 1LNSA 1D7PM 3MEPA 4V2VA 2VCCA 2Q8OA 4ZS2A 1XNAA 2WSVA 3QLQA 5ISLA 2ARXA 2YC4A 2JIGA 3I4IA 2D6OX 4FFHA 4W65A 3GZEA 3HN3A 1W6PB 4LO7A 1LENA 5A3OA 5B4NA 1AR83 3KQ4B 3IBMA 3ZFFB 3JB4C 5C6CA 1OSGA 3VDBA 4IEUA 4JX0A 2ZZQA 3FJSA 3RMXA 3NL1A 2MNGA 3LEKA 4B3NA 1FNYA 1C28A 4YW5A 4CPBA 1O4ZA 3H1WA 2ZAAA 1E5HA 2VU9A 4MOAA 1DF0A 3GF6A 3IAPA 4LR4A 3ZFGC 4QU1A 3TBDA 2W1UA 1O5LA 1OQEA 3N35A 5LCWL 1AYM3 2PHFA 4QQOA 4CP9A 1AL23 3KVBA 4P5HA 4NO4A 5JPNB 2HWB2 3OOXA 4NIDA 3LPFA 2YU2A 5C3OA 3K48A 1FV2A 4BJ0A 3AL5A 3AP6A 3VD9A 2UY8A 4XBNA 3VDAA 4BB3A 3WDWA 5EJZB 1GWMA 1SBEA 1OVPA 4W6WA 4A7KA 3AVRA 3UGGA 5A33B 4AFMA 2A6VA 4QX7A 5CFDB 4QHOA 1Q8OA 1WLWA 2P3YA 3LF7A 4CDQB 5G05L 3VBHC 1CWPA 2Q5TA 3BTYA 4IV1C 2D97A 1FMD3 2JIJA 1YQ6A 2PLV1 4QWNA 5LBCA 2UYAA 3WDTA 2VUCA 4Y1XA 5F6KA 3V0AB 1K45A 4W6YA 4LKEA 2XWJB 4NPRA 4X6RB 1PIV1 1TEIA 2GC3A 2ID4A 3BGAA 3VKOA 2K0GA 1VBE2 1MR5A 1AXZA 4DIQA 1B35B 2VMHA 3KGLA 3TEYA 1JYNA 1W04A 4RR3B 1UU4A 1LHWA 1NYWA 4A44A 4OUEA 1CVNA 1UZ0A 1SFYA 1LEMA 3HD8B 4Y26A 5E16A 1DGRA 3UV9A 4BQ2A 4XF1A 2X53S 3O1TA 5A7QA 4H55A 4MGZE 4CU9A 2E32A 4D7TA 4HBNA 3O1PA 4PI2A 2A6XA 1AR73 4BLJA 1PGL1 2PYTA 3VL8A 4I2OA 2DF7A 4MO3M 4XF4A 4Y1YA 2DVFA 2OKXA 3PUSA 4XW3A 3VZNA 3S7IA 3POWA 4LLOA 1N47A 2DUOA 2IVIB 2PHXA 5IATA 1TMF2 1JYIA 1HXS1 1XYOA 4AI9A 3ZXJA 1FXZA 4JTOA 5FQ0B 4UF0B 2BERA 2Q0AA 2FZ1A 5FZ3A 3ETQA 2BJSA 4MZUA 2Z2SB 4AFCA 1WBLA 4HG6B 4TN7A 3K46A 4DZGA 3JB8A 5K9YA 2XUMA 2FDIA 4NPLA 3BU0A 2CU5A 3WY6A 1UY3A 2W87A 3JD73 4L9BA 4CEWA 3MIEA 3MIBA 2RS33 2P5BA 3WNNA 3O0WA 1PK6A 2ZACA 2J1UA 1QNYA 2D5HA 4FTEA 2BV4A 3PUIA 5D1IA 4GXLA 3W58A 3VHNA 2RS51 4GWIA 2D6MA 4Q4V1 2OQ7A 1I5PA 3IDBB 4N8MA 3SKJE 4XUOA 1CAXB 2HEVF 3U1XA 5FMBA 2B42B 3ACLA 1NY71 5JR2A 2YDEA 4COVA 5EYYA 2PFWA 2Y6FA 4N9IA 2VBDA 5FMCA 4FFIA 1BBT3 3DYMA 1UMHA 1DQ4A 4OULA 4OLLA 2YU1A 1U5IA 3LEIA 4WM8A 3K2OA 3I54A 4Y20A 4JHTA 4DPNA 5A3PA 2BRTA 2G1MA 5C9AA 2CHHA 3AYCA 4AK3A 2E63A 4YW6A 2A3XA 3B93A 1Q43A 2J7MA 1WCDJ 4ARYA 1FOD3 1DLCA 1GBGA 1OHFA 4YFZA 2GNDA 1YJLA 2HLEA 5GLUA 1RC6A 4GB33 4JKLA 4NHLA 2DUQA 2G9FA 4MV2A 4RQPC 1JYCA 1POV1 3SC7X 5B2GB 3S0MA 1AX0A 3NJZA 4QHZA 2DFBA 1HB2A 2EIEA 2JKXA 1XRUA 3WDXA 3ZPYA 5KXDA 2ZGRA 4QM8A 5IFTA 1QJU2 4AVBA 4MGTA 5DG1A 2ZZJA 1W9WA 3EYPA 4YVSA 4FO9A 2JWPA 3M3EA 3PU8A 4N43A 4C0HA 5LEKA 3WQ0A 1ULPA 3SH3A 2XKOA 1X7NA 4QD2A 1M4WA 2OYZA 4XUPA 3WF3A 1A34A 2VXRA 2Y6GA 3J9SA 4QX1A 1V9U2 2GC2A 5SV8A 2ET1A 1ND3C 2AEYA 1J58A 2BVVA 3OGSA 1RUH3 3UL2A 2HWE3 4L97A 3DPRB 3E6BA 4IE0A 5L7OB 3MLJA 3BCWA 5LA9A 3LB9A 2Q8EA 5C8CC 2JDKA 3RZZA 2AUYA 2VM9A 1BCXA 4P08A 1HX6A 4Y4YA 1QXJA 4YZ5A 1J1TA 4DO0A 3VBUA 4RS5C 1RUF1 3USUA 1Q8SA 2VZPA 3NV1A 3CLPA 5IVBA 1BKZA 1MZ5A 1RUD3 2YY1A 4XAAA 3ROUA 3M3QA 3CEWA 2FBEA 4JCKA 1ZBE2 5C33A 2VZTA 2WFF1 4PF5A 1CPNA 1KEXA 2RR13 3NO8A 2VOVA 4N7UA 5M0TA 1DG6A 4UW5A 5BNPC 2WN2A 3MIGA 4QB1A 1J1LA 1TVGA 5DMYA 3BPZA 4BQ1A 4EROA 4XF9A 1XU2A 3IPVB 1J59A 3ZFGB 2ZGOA 1QJX3 2QQVA 1UYXA 4XEZA 1JUIA 1ASJ2 4G9SB 2CDOA 1QDOA 4CEYA 3L9JT 2Z69A 3KQRA 3GCXA 4K20A 2AH2A 2W94A 3MO4A 4H7LA 4WZFA 3B9IA 3QOPA 1MS8A 5A7SA 4AEDC 2A75A 5ANQA 5FP3A 2WNOA 3VBOC 3ZKYA 4A41A 5LRSA 5DAVA 3C7GA 1DFQA 1WCKA 3VD7A 5C3PA 4HXCA 2WNUA 5A7NA 1E57A 3F2ZA 1QOSA 3NQHA 2ZOEB 4CCLA 1C57A 1W6QA 4FP3A 3GBGA 1D4M2 4UFJA 4V1PA 1GOHA 4META 4P9YA 1DCSA 3VBHB 5DG2A 2HWC3 4AVCA 3AVSA 1F5JA 2VNVA 2VCBA 3CO2A 1VJ2A 1VPHA 2WZR2 4IV1B 4OMCA 4AFAA 3W5MA 1KDKA 2I74A 3A22A 3QACA 4IUGA 4XJAA 1PGW2 2RHPA 4BM8A 3I3MA 1ZRFA 2X5IC 4ITCA 4PI0A 2FMYA 5GZEA 5FYTA 2JENA 3TB0A 3VN4A 3ZFFA 3Q8CA 1J3QA 4EN7B 1F4HA 3PL0A 3WOGA 5F3EA 3I3DA 3OUIA 4BQ5A 3ZYIB 1YHFA 4DINB 2RDQA 2WQZC 3OBAA 3MFCA 4HKOA 1PVC2 2V73A 1AXKA 4MHUA 1OPOA 3LFIA 2XUEA 3WXPA 4BLIA 2QJVA 1R1A1 2W46A 2YHJA 3WW1A 2O8OA 5CBLA 4CUCA 3JCIA 2XMLA 5H9QA 5D2AA 2GC0A 5FZDA 3CF6E 3IKWA 5H9PA 3T2QA 5IVFA 2EIBA 3FFQA 4XUQA 5DUUA 3VKMA 5FV3A 1YI7A 1PO13 4HT1T 2YV8A 2ZABA 4N90A 3RI9A 1U5ZA 1YQ8A 3OY8B 5FLHA 5C5TA 4XQWA 5FY5A 3FLTA 3T3YA 1O3RA 5A33A 5LBEA 2CY6A 4ZY9A 1MS3A 5KHHA 1UY2A 4IE6A 4CDQA 3T0DA 1CN1A 4A7YA 2P4EA 1YYNA 2QE3A 3RRDA 1ZBA3 1X9PA 5F1RA 5H9RA 2YFUA 5ABJC 1QEXA 3FLPA 5J09A 2VMFA 4FXGB 5H9SA 1NT0A 3V0AA 3MI8A 3OUHA 3ZVXA 1OA2A 1EAH3 1GOFA 1GWKA 3E5XA 4Q4Y1 4Y24A 4FPOB 3WNXA 4HVRA 4N53C 2ZTNA 4I0AA 2WRAA 2XJPA 1B35A 5FRAA 3RYPA 4JV4A 4Y1VA 5JUVA 5FYBA 4YM3A 3CZJA 4RR3A 3O1UA 2ERFA 4LBOA 1UN1A 4UFKA 5TSWA 3RJ2X 2K46A 3LZZA 2Q8CA 4QKNA 4NPMA 3H50A 4I01A 5DDJ2 4CDXA 3RGBA 5I0SA 4E2QA 5EJ3A 3MYXA 3HT1A 3RZHA 2WYFA 5FPVA 3T30A 2ZGLA 3NJXA 4FPYA 5FYIA 5LASA 4EV0A 4I3GA 5FFOC 4IV3C 3I2HA 1LODA 3NW4A 5FBJA 4FQ4A 3P3PA 4ASLA 1JXNA 1LU2A 4AGVA 2RJLA 2QVSB 4YG0A 4YZ2A 4YG3A 3DCQA 4Y22B 5FPZA 4CDWA 1NCQB 4NRMA 5JPMB 1S2KA 4UAPA 2HWB1 4Y1ZA 3HQUA 3WV6A 1ZX5A 1CQ9A 4R4XA 5FQ0A 2WS92 1OA3A 2Y34A 3OD0A 2DVDA 3PVBB 1ND2C 4JAAA 3SMHA 2EF6A 2JE8A 3MGUA 1PHMA 4D6SA 3TEWA 4Y5TA 2HEYF 4GH4B 1RUI2 1H8TB 1LR5A 1SLBA 5FZ6A 3HPNA 1RUC2 1ZVFA 3DXTA 1KFUL 3O1VA 3Q8EA 3NNFA 4B4RA 2XVGA 4NHKA 1Z78A 2R30A 1UYYA 3F95A 5DXDA 3RVHA 5JVVA 3WCRA 1H30A 3FX3A 2DWRA 5CAZA 4DXSA 5CIRA 4UOJA 1CESA 3M3OA 1SMVA 1FT9A 4M0HA 4MGQA 4NHYA 3EHKA 1JBCA 2VMDA 1HJFA 4OZXA 2VJXA 5CKNA 1RUE3 3DYPA 4R9AA 5A6XA 4QGMA 4RFT0 1O91A 2XH6A 2R6QA 1QJY3 1CAXA 4FFGA 2MHFA 3CMGA 4LULA 1LOGA 4V2WA 1VBE1 2V5YA 1WCSA 2VECA 4NROA 5F37A 1VAMA 2ZEXA 3LEMA 1F5FA 1W9YA 4GULA 4ZU7A 3DL3A 2BPA2 1H8VA 1ND3B 2QQLA 4Y5SA 1REDA 4AQTA 4M3CE 1AVBA 1AR63 1UAIA 3B00A 1VBB2 1BQPA 1LOFC 5JXGA 1EUUA 2RJKA 3BTXA 4FAHA 1IKQA 2A3YA 4IERA 4K1ZA 2AACA 4LLFA 4K8FA 5A6ZA 1H9PA 4BZ4A 5C8CB 2QZ3A 1CZSA 5IW0A 3ZYBA 5F2SA 3I49A 1GQPA 2F4PA 2D7FA 3AKRA 4IGOA 5C4WC 4RS5B 4DY5A 5CA6A 4SBVA 1ZZ9A 1JZ4A 1E5RA 1ZYBA 2WYSA 4HN1A 4M3CB 2FMDA 1SG3A 3VHOA 2XWBB 3WF4A 5IVJA 4OZOA 3WNOA 3GCWA 3WDVA 1TMF1 3PJQA 4EN9B 2WNVC 3WHTA 2ORXA 5BNPB 3I3EA 4WBBA 1DHKB 1IGOA 3B5LB 5F6LB 1RUG3 1YQ5A 2ZHKA 3IMMA 1O6UA 3AP4A 2VR4A 4LPLA 1JYXA 3K3OA 3OPWA 4D0QA 4CCMA 1TZOA 2ETEA 1Z7S3 2Y0IA 3OPTA 3OBZA 4FAGA 3R4UA 4CP1A 3U10A 5CG9A 1PZ7A 3ZN5A 1ENRA 5F39A 3BUCA 4WVWA 3UYJA 3VBOB 5CVRA 1QHDA 3RZKA 4YGBA 1F2NA 4QPIB 5HCFA 3INAA 3H1MA 2DDUA 3EJKA 4XDPA 4D7SA 3DPRA 3BYWA 3M7AA 5L7OA 2VZRA 1YC61 1DU3D 5IFPA 2CWSA 2ZHMA 3POEA 1LKNA 4UFMA 4AF9A 1W6NB 4QAWA 4YWAA 1REEA 3WF1A 4RGAA 1BYHA 1LJ7A 3QD6A 5HI0A 4P9GA 2YXSA 1LHOA 4YG6A 1NCRC 1MEC3 1W9TA 1JUHA 2ZEZA 3OJBA 2EICA 3KD4A 4W50A 5LWBA 4HLTA 4YGDA 4PT6A 4XF3A 5CFDC 2WO3A 1QOTA 3POYA 4PIZA 3TEXA 4E4DX 3MV11 2HYKA 1TNFA 4HVQA 1SPPB 4YVWC 3VHPA 3ZFGA 3N7JA 5D8AB 1D0HA 4FOWA 5FMOS 3R6SA 3O5SA 1M06G 3BTZA 3BOWA 5JMCA 4LIVA 1QQP3 1BLZA 1JMUB 2W92A 3DECA 2WABA 2VNRA 3HNBM 1VMFA 3RZJA 1WA6X 4NRPA 4TWTA 5G04L 1A3KA 4XQ4A 4B8EA 2WR9A 3J7HA 4WVZA 4PIYA 3TOJA 3SCHA 3OCPA 4Y4RA 5T54A 4H2AA 4RR3C 3A23A 4Q0UA 1QJU1 1AJOA 4UW3A 1PM4A 3IN9A 2PQQA 4BCUA 5IJRA 1OMIA 1ST8A 5IHRA 3SLIA 5LATA 4AQSA 4DEQA 2D40A 5HBAA 4HKWA 2WLQA 1U5YA 5J96B 1E5IA 2FCTA 4QXCA 4LHLA 3DYOA 1RB8G 3VBHA 2DCKA 4QX8A 3VZJA 4B7EA 4IV1A 2Z4FA 1V9U1 2DTYA 3L2HA 4X8NA 4BIOA 4MG2A 5ABJB 4BOWA 3RWKX 3CQOA 1CIWA 1ULFA 4UFHA 3LAGA 2FCUA 1XPWA 4XETA 3PIJA 3RMYA 2TUNA 5FYVA 1DIWA 5FPUA 4A6SA 1K42A 3PUAA 4CXXA 3ZPOA 1GZTA 2EA7A 3R4SA 4J25A 2FHRA 1W6OB 4KMQA 2A6ZA 1JZ2A 3J7LA 1J3PA 2VOTA 2K9ZA 1VBD3 4QU2A 2A7AA 1SLAA 3H8UA 1IPSA 4KGQA 3RG0A 1ENXA 4DS0A 3I3QA 1YFWA 3B3QE 2RDSA 3FFZA 2J1RA 1ZBE1 2QKDA 3ZO0B 3HBKA 4HL0A 4KWKA 4OI1A 3H3LA 3AK0A 1DQ6A 2W3JA 4FVVA 4MVTA 4M3CF 3KV6A 1W8UA 4JKMA 4OUMA 5FCCA 3NKGA 2GSYA 1MS4A 4IV3B 4XJUA 2ZGKA 4LHKA 4HN0A 4G3YC 2GMEA 4LBQB 1AR92 4AEMA 1ASJ1 3POSA 5FY9A 4P9IA 4LMFA 2C24A 3G7DA 1PIV3 1OH4A 4K40A 1BHGA 5KBFA 3D8CA 1ZZ7A 2IFWA 1O3QA 1RUNA 3AP7A 1NQJA 2BZDA 2XJRA 2WT1A 3U4SA 2NP0A 4QDQA 1NZCA 3ZXAC 2JD9A 3OUJA 4OHVA 1PNFA 5J3UA 1G9AA 1ND2B 1COV3 1CR7A 4CU7A 3RYRA 4AHZA 1UX7A 3M3CA 2AYHA 1XE0A 3CKHA 2ZX1A 3KT1A 2YUEA 4TSVA 1D4M1 1UXZA 4YFWA 1YQCA 1EP0A 3N7KA 4ONUA 3A0KA 1RTVA 2FQPA 1QMJA 3O12A 1W05A 4KBZA 4AW7A 3ZN6B 3KVAA 3J26N 3PJYA 4Y1UA 3GHNA 2VMEA 2WZR1 4CXWA 4Z82A 1N1YA 5FJHA 3UKVA 4CA9A 4QPGC 3AMNA 1PGW1 4MGIE 4OHYA 5F32A 4OI0A 4JTNA 1QJZA 3GALA 4CCEA 2P6HA 5FZ7A 3OGGA 2VE1A 2YC0A 1KS5A 4BXSV 4QQPA 4COYA 3OB8A 5I8SA 1J3RA 5FKBA 4DRRA 1DBNA 1KJLA 1UOGA 2EAKA 2PMWB 3HMYA 3BIWE 2RS32 3LE0A 3EB7A 3Q8FA 4I0BA 1W90A 2ZS6B 1DDLA 4YLZA 4AI8A 2D6LX 2ZJCA 4NIGA 1C5IA 1H6XA 1PVC1 4KWJA 2BBVA 3N9NA 1QGLA 4NVPA 3KZ4C 4XABA 1E5SA 3GHMA 2Q8DA 3T2PA 2HWD1 4Q5OA 4HSLA 3NNLA 4Y22A 2O14A 4COZA 5L9BA 1NCQA 5LEJA 4FCAA 5LK7B 5C4WB 1MS5A 2H6BA 4L92A 1WBFA 3VBSC 3BU7A 4DOUA 2I2SA 5CEHA 4A45A 1QH6A 1W0OA 3POIA 1VBC3 2UY9A 5AC91 4Q4V3 4U2AA 2Q1FA 3N36A 4AWDA 2Y6KA 4XILA 4UYBA 3LCPA 4D3WA 1KFXL 2VW0A 3WW2A 2DUPA 4RQPA 4WZCA 3T4VA 1FOD2 1UF2C 2VZSA 4HK9A 4EN6B 3S7EA 2ENRA 1GZ9A 2EALA 4D69A 3PVOA 4LO4B 4K1YA 4BIFA 1FPN1 2VZ1A 1MVQA 4U36A 4QB6A 5T5PA 5FYSA 4K3UA 4BMEA 4KU7A 1GP5A 2XVKA 4DXZA 4CCDA 4Q1RA 3W20A 1V6KA 2X05A 4KQ7A 1UU5A 1XXNA 5JXIA 1W39A 2J1VA 4AHWA 1MZFA 2VCMA 4UW6A 5F3GA 3OD4A 2XG3A 4IE4A 3QBQA 4ZONA 4YW1A 1G6NA 3ZXLA 1S0IA 3N9QA 2EXHA 1GOGA 1ND3A 1U12A 4YM1A 2WWUA 2XB6C 1UPIA 2W0XA 3S5AA 1X33A 5DDJ1 1EV13 2RS12 5C8CA 1GQGA 2R063 5T5JA 1POV3 2YFZA 4BE3A 4P00B 4A7ZA 1K5MB 4B7KA 4GJYA 1O3TA 2W52A 1W2OA 3AJYA 1SACA 4AE2A 4RS5A 2I45A 2IUWA 1RUH2 1IG3A 4UFLA 1UZVA 2DFCA 1N1VA 4M3CA 1L7QA 1NCRB 4XOGA 2E7QA 2DYCA 4Q0QA 4KGGA 5JXHA 1WLDA 3IDAA 4MXWB 4OQ8A 2NN8A 5LY1A 1YFXA 3C7FA 4BWOA 5FY1A 4OI4A 4UXAA 2OZJA 3J7MA 5BNPA 3U07A 4DY3A 3OG2A 2WS91 3THPA 3WHUA 1D0GA 4I30A 3WT3A 4XFBA 3LA7A 3UK9A 2Y64A 4XACA 4YVWB 5F3IA 1RUI1 1SBFA 4YM0A 1LULA 4XE9A 4MH0E 1RUC1 2D98A 4EWAA 1MQTB 2YPJA 3ZIWA 4LKSA 4JQTA 2JDYA 3WQ7A 1UY4A 1T6BX 4IGQA 4BMBA 4AEDA 3ZYJB 4Q0SA 5JSOA 1OF3A 2HYXA 3VBOA 1HRV2 2A71A 2JD4A 1RUF3 1K3IA 1Q5OA 3Q8AA 1DZTA 5FUIA 2GP3A 2ZX4A 3AMHA 4N9HA 4XF0A 2DVAA 1R093 1U0AA 2JG8B 2V09A 2VZQA 4PLOA 1W9FA 4YW4A 4IGPA 1V6JA 2VVFA 4NIHA 3ACGA 1WD4A 2OX0A 1LCLA 4A6OA 5JDBA 4XTPA 1H1AA 2WFF3 2OA2A 3AP9A 3CJIB 3I59B 4FPKA 4MADA 2LROA 4EWEA 2C1FA 4JDNA 5L19A 1SLLA 4BQWA 5I0UA 2G4IA 3KCCA 1W6NA 1WCQA 4XUTA 5T5OA 1BEV2 5BNNB 2GN3A 1S0EA 4QB2A 1VBB1 3LSEA 2ET7A 1KRIA 1WUVA 4H14A 5FYHA 2GN7A 4CP2A 2X5IA 4O9EA 5FZHA 3ZFEC 2JG9B 4GMP1 3VKNA 2BBAA 4P5YA 2VTXA 3HOBA 1UO9A 4AVAA 4CCOA 3ZSMA 1F31A 3B94A 2D3RA 1W9SA 2OIIA 4RL7A 1CAUA 3QH6A 4EJRA 4DUWA 1H2NA 3WNPA 1YRZA 4BXFA 5LA0A 2BEOA 2BWAA 3ASIA 4D6QA 1DQ2A 3RQ0A 1S2BA 1HLCA 3AYAA 4Q4X2 1HRI1 5EYXA 2ARBA 4LOSA 4XFGA 5FZOB 1F9KA 2D3PA 3MDPA 2JDMA 2D5FA 3WNKA 4QMAA 4F8AA 5I8YA 3J7NA 4ZHNA 4I0WB 4Q0PA 3TNQA 2GNTA 2WINB 3OEAA 4HVOA 2Z5WA 2OXBA 3HBZA 5BPXA 1YJKA 1XE8A 1ODMA 4TLFA 4I02A 4HSJA 4OYUA 5JOZA 5JZGC 4AOCA 2Z42A 1A6CA 1TNRA 2VPVA 2ZGMA 4GAZA 5A32B 5C3QA 1ZREA 4FI9A 3AX4A 4ORFA 1PO12 4LBQD 1SZBA 2WN3A 1LU1A 1ZRIA 3AXDA 3JBG2 4XZUG 5C70A 3E1F1 5FO9B 5K8SA 1JZ7A 4Q27A 5ABJA 5DAWA 1Y9GA 3AZVA 2J1SA 3U14A 3H8OA 1R1A3 1W2TA 3SITA 5EIYB 1IHMA 5IK8A 1LTEA 3IB3A 5LY2A 4B4QA 3PURA 1NCQC 1D2QA 2J1EA 4CTEA 1ZBA2 2P2KA 4N53A 1GFF2 5KHJA 5E6HA 4EN0A 4LEJA 1S0JA 3TN92 5F7UA 3FZ3A 4HK8A 2VQ0A 4QPGB 1G9BA 1OQ1A 4QX0A 3A0NA 2OT7A 4IE7A 4MGKE 5F5AA 1XSQA 3LIHA 2NMNA 5D21A 4GH4C 1OUXA 1CIYA 4OMDA 1H8TC 4EZHA 3A7QA 2K2SA 1NE6A 3GJAA 3P6BA 4AL9A 1PGSA 5IK7A 2XJUA 2YPDA 5AFBA 2EIDA 3UGHA 1PX3A 2R042 4IV3A 4XCBA 2HBUA 1JYWA 4D6RA 1RYYA 2SLIA 3ACFA 2MEV1 2VAUA 4YW7A 1OD5A 2WBKA 1GNZA 1N1TA 2DCYA 5FREA 3UJQA 5AVAA 3WQ1A 4BK5A 3M4FA 2IXIA 4HMZA 4Z8BA 2XR4A 1SFPA 3PNAA 5A3UA 1CGPA 1N1SA 2DBNA 5HV0A 3SCGA 1WMEA 4HETA 3VBSB 4YGCA 1AUYA 1YIFA 2ARAA 2EXJA 1ND2A 1R082 1W8NA 2KR2A 2XBO2 4Q4W3 4XC9A 5IVVA 1I9RA 5GLZA 3D0SA 4MGYE 1SEFA 4E2GA 1GANA 4DQAA 3U37A 4GWNA 2EXKA 2ZXQA 1FV3A 1CPMA 1NAEA 2RV9A 4PDWC 3S6PA 1CJDA 2XHNA 3ZN4A 2VQTA 3O1SA 2PAKA 1RVF3 1SDWA 3ZN6A 4AHXA 1GU3A 2JE9A 1HQWA 2B8MA 1F8VA 4FTSA 4KU8A 4KL1A 1O8SA 4P14A 3U0ZA 1WMDA 5T52A 2XL7A 4FPCA 3VDDB 2C9KA 4K8RB 4E9KA 4XPVA 2A6WA 4CZSA 1PX4A 1DZQA 1VRBA 2PHLA 3SKVA 2HWB3 4DEVA 5FOBB 4LBLA 4QGNA 3R4DB 4KWUA 1WZXA 4RHV3 5DUXA 3SEPA 5K7PA 3N4MA 2ZEYA 1J83A 3TEZA 1XNDA 3JUUA 5DPNA 4AEKA 4MUVA 3I2IA 3NJVA 1REFA 5JOXA 2VQAA 1LOFA 1URXA 2RMU2 1Y43B 1QJY2 4J6GA 2W47A 4LK6A 4PBOA 3AKTA 2B9VA 1O7FA 2IFRA 4Q26A 4BYYA 2DV9A 2DU0A 3AMQA 3VLBB 3O0XA 3S57A 1XOYA 5C4WA 1ZRRA 4AI2A 3KV4A 5FZ8A 3DKQA 3C7OA 1FX5A 1YQ2A 2LTNA 4DMIA 4Z1VA 3HAGA 4QPIC 1AR91 3ZYRA 1LOEA 2JDAA 5IUQA 3T2TA 2NM1A 2P17A 4BPZA 1BVVA 1UZWA 2BWCA 2Y33A 1RITA 4LIUA 4MYEA 2WNVA 1VBE3 4XJ9A 3VBRB 4UT5A 1OLQA 5CFDA 4KNCA 2BTVC 4WVMB 5FZMA 4IEOA 1WLTA 1GQHA 5FXVA 1PO22 3NNGA 4JRLA 2QDNA 5J36A 3ZR5A 5FXZA 2DCTA 2RJ2A 2NMOA 4CU8A 3URFA 1POQA 3AL6A 1AYN2 2XKPA 3T4HB 1N3QA 1W6PA 4MGSA 3FL7A 1YI9A 2PHRA 4IEPA 1JZ6A 2F4LA 5A80A 3SEEA 4J1WA 2PAMA 4ZKTB 5FO8B 1WW7A 1TME3 3SH5A 2LW8A 4CUBA 2GMMA 3ECQA 2J22A 1VBA3 4KH9A 2W39A 4QX3A 4R8HA 2R073 5KXCA 2DTWA 3FLRA 1QH7A 1Z7S2 3ZDVA 4E4HA 1IS4A 2ZMLA 2YBSA 2B5HA 3CL1A 4LO8A 1IOAA 2VUDA 3D6EA 4PLMA 4XJZA 5CYYA 1RHI2 5D8AC 2QQUA 5A7WB 2WA4A 5GM0A 2JDPA 4UFIA 1ENSA 1TMF3 2RS31 5JIAA 1WW5A 1WD3A 2AEZA 3HT2A 4NHMA 5BY5A 2KM2A 3KF5A 1LGCA 2VOXA 1UX6A 3OBTA 5BYNA 2UWCA 4NN0A 4UBGA 3NNMA 1W8TA 4CP0A 3LWCA 5FDBA 1I5ZA 2WL1A 2ZGUA 1O3SA 1NCRA 1IQAA 1OFSA 2VNOA 4LBNA 4MXWA 3ZFEB 1BJQA 2BP6A 2XOMA 4IDZA 4LE3A 3AM2A 1KGYA 2E33A 4J1XA 5IAVA 5T50A 2E53A 3WDUA 1O8PA 2HWF3 5ACA2 4S2DA 3RYKA 3VDCA 5EV7A 2ADDA 5IYYA 4FFFA 2IXCA 4YVWA 5GLVA 4IEYA 2BGPA 3ZMOA 4CSWA 3EQEA 5ERLA 3WG2A 4K21A 1RXGA 5LBBA 3M8LA 5I0RA 4YSFA 5JCTA 5L73A 1FOD1 5EJ1B 4FPFA 3RDIA 4KI5M 3PTRB 5HXVA 3KT4A 2D93A 1Y3TA 5CKQA 1VMHA 1JI6A 2B39A 2H6CA 2XGXA 1RINA 4PQ9A 1H1IA 2GZWA 1IQDC 5JZGB 1GNHA 5KHKA 3I59A 5FYZA 4UI9L 2VUJA 3X29B 2DU1A 3ZMNA 3ST7A 4XCAA 4INDA 3WR0A 4BH9A 5FZLA 5EP9A 3CHXA 4QXHA 4XXAA 5GZDA 2QQNA 1RMU2 2BFUS 1JTZX 2DBIA 2WWJA 2JB8A 4O61A 2P3JA 5FPAA 4LE4A 4URAA 3POGA 2QCSB 1PMIA 2IXHA 2RS11 1G86A 3C2UA 3FHQA 2VW1A 2C5DA 2RE9A 2WUHA 1UIKA 4C0BA 3ZYGA 1C8M2 3S5QA 1SLTA 2W95A 1RUH1 3MFAA 4UF0A 5EHDA 4E4ZA 2IZWA 4Z2WA 1QJU3 4L99A 4QX5A 3AKPA 1LHVA 1V70A 3I2JA 4FOYA 1UY0A 4RN5A 1DP0A 3FN9A 2BQPA 5A3NA 2IXKA 3NWKA 1JHNA 5DN2A 2BNNA 5FZOA 2P3IA 5FIXA 3N9PA 3WG3A 1VBD2 1JZ5A 1V9U3 5E89A 2E31A 1KXGA 1JOJA 3LFMA 1H4GA 1JYVA 4IEVA 3WZ1A 4CVUA 5KR7A 1CAWB 2WA3A 3DKWA 3T0AA 5J48A 4F3JA 1NXD1 4R52A 4AGGA 3WX5A 1SLCA 1T6GC 2P37A 2Z79A 3RZLA 5A32A 2IWGB 3JQWA 5F8PA 1W0NA 4EE2A 5HCHA 3LD8A 5AFEA 1HRV1 1OLME 4IEXA 2FDGA 4OHXA 1UZYA 3H3ZA 4H7MA 4GWJA 4DUVA 3W9AA 2NZ9A 2R1BA 5ANNA 3HQXA 1DQ5A 2R1DA 4RD7A 1XJAA 5CB7A 3SISA 1H6YA 1ZBE3 5B4XA 1HB4A 2WDBA 1HW5A 2CNAA 4PDWB 5FZEA 2B45X 5DZGA 3TRSB 1RGSA 5BNOC 4M4RA 5A1AA 1COV2 3WEZA 3PVEA 5GZCA 1BEV1 3E6DA 1OUSA 4ARXA 4QPGA 5EPAA 2WQ4A 4NE9A 1NE4A 3UKTA 1VLNA 2IXLA 2V5DA 1W8ZA 5FWJA 3HJRA 2RM23 3HNYM 3PMEA 4CUAA 3KM5A 1UYPA 3OGVA 4YW2A 2X10A 3DUIA 4CDUC 1C1LA 2TBVA 1OH3A 2W91A 3NKTA 1W8FA 4AZZA 1HQNA 2DVBA 2OPKA 5FZFA 2GH8A 3I2GA 2UURA 4IW3A 1MACA 1Q3EA 1D4M3 4Q4X1 1TE1B 4A3XA 5FZ0A 2ZAHA 3J8F2 1BZWA 4HONA 3WF0A 2QQMA 3QH7A 4AEJA 4AQ2A 1GUIA 5GZGA 2WZR3 2NLRA 1W28A 4B4PA 2XDVA 3AJZA 2FDFA 3VBSA 3MIDA 1WLCA 4D7YA 2W1SA 3RFRA 4GWMA 3POFA 4P9XA 1PNGA 3H7JA 3PU3A 4EWDA 1DGWA 2FDJA 4YZ1A 5L9VA 3VHRA 5HCAA 1OQDA 3ZYPA 1H4HA 3PMSA 1RJ8A 5K4LA 5LK5A 3K3NA 3C7HA 1OOPC 1UWWA 3DEMA 1ZZCA 2QBXA 5I8TA 4WVVA 3JBG1 1PVC3 4NOTA 1K5MC 4LBKA 2ZGTA 4Y33A 3GNEA 1UXXX 4LO5B 4ZXEA 1VBC2 4AI0A 1PM7A 3E6CC 5FP4A 4DB5A 5IVYA 4OHWA 2HWD3 2YGMA 3SQOA 5C8WA 2WZ8A 3ZR6A 5BUVA 3GM8A 3PUQA 4W8JA 5FY7A 1G9CA 1RUJ3 3APBA 4AVSA 1ZBA1 1RUOA 4L8QA 1WWYA 1DQ1A 5FZAA 2WO7A 3TN91 1S0BA 5LBFA 1OPMA 1VRH3 2QQIA 1CX4A 4ATEA 1CX1A 3GZTB 5F5QA 5AC93 3IPVA 5A3MA 3WP5A 3T1MA 3WVJA 3A4UA 1XBFA 5FYCA 1AR82 4AI3A 2GNMA 2R49A 3AKSA 1MQTC 4IETA 1GLHA 3K4AA 2SBAA 3W59A 3RZMA 2R041 1SFNA 1FPN3 5J1XA 2CTVA 3DXUA 1KQRA 3O1RA 3I2KA 2ZHNA 1O4TA 5I0DA 2ZBJA 5GALA 1EV12 1SCSA 2JG8C 3W5NA 1AYM2 5FMOL 2R062 4R4ZA 1AL22 1ULCA 2ZHLA 4N7IA 4QDSA 5DABA 1BK1A 3VBRA 3CJIC 3RS6A 2PELA 1DZRA 2F17A 5EWSA 4WVMA 1NKGA 1OBNA 2XBO1 1R081 4A3ZA 3BKZA 2Y38A 3NJYA 3ZM8A 3ZOIA 5BNNC 5SV5A 1GP6A 2CAVA 2YB7A 3UETA 3WUCA 3ORJA 3Q8BA 4GD4A 1DGLA 4DNYA 2G9ZA 4FBFA 1QWRA 3NV3A 1XC6A 1PK6B 2JG9C 2WT2A 3BPSA 4R9DA 1XNBA 4YW3A 3U75A 1F35A 1FMD2 5JIUA 5KXBA 2RVAA 1LESA 2GU9A 2UWBA 3AZXA 4BK4A 2OZ6A 4P02B 1S0FA 3NVCA 3B7MA 5A7WA 1JW6A 5I93A 1POV0 3VZOA 3UNPA 1W3VA 5F9TA 3RSJA 4C91A 3T08A 1ZRDA 1L7LA 4EN8B 4AGRA 4YZ3A 2WS93 3VUOA 2OS2A 4DXTA 1R092 2BYVE 4FPHA 4KG0A 3NAPB 3ZSKA 2ADEA 2PLV3 4IQPA 3VKFC 4WM8B 4F7ZA 2DCJA 3KB5A 5JAXA 1RUI3 4BHPA 5C9AB 2WT0A 2VW2A 3O14A 2RMU1 2LRPA 1RUC3 1B09A 1QJY1 1MZ6A 2BOIA 3AZZA 3K77A 3KCYA 3OY8A 4FPGA 5AVPA 4D94A 5A6YA 3POJA 3HN1A 1QU0A 1G7YA 1UW8A 3ZFEA 5C7GA 1DYOA 2D43A 4ISQA 1BMV2 1HN0A 4O65A 4MXVA 1UPSA 4ZU4A 2VL4A 3N7LA 1AR72 2W1WA 4D8MA 2BDRA 1BXHA 3FUQA 5JI7A 3VD5A 2JDHA 4NJ4A 1NA1C 4ES9A 4WM7C 4PF1A 5A7PA 2D6KA 2VBBA 3DN7A 3THTA 3CBNA 1OURA 4RGGA 3MIHA 1UOBA 4YPJA 4OVEA 3E97A 5JSRA 3D82A 1UQXA 3FMGA 2ORZA 3NNJA 3BB6A 1PO21 1RJ7A 4MHRA 3ZIXA 2JE7A 4MSVA 4YVSB 4HZFA 5DQ0A 2V72A 3VGIA 1VBB3 1T2XA 3POBA 4XBLA 5L36A 3KLSA 1AYN1 4LXLA 3WG1A 2CGNA 5JZGA 3WUDA 2V4AA 3JD72 4M0NA 4ASKA 3BI3A 4P9LA 3ZYHA 1HXS3 4COWA 4XIOA 1AL0G 1GMMA 3MLLA 2N7GA 1Z7S1 2J1AA 3MICA 1A8DA 2PN5A 2E6VA 3WW4A 3JZVA 3FBYA 1SQ4A 1RHI1 2XQRA 1ZM1A 1HJGA 2ZKNA 4M4PA 4QQLA 1ALYA 1NG0A 2YYOA 1HRI3 1JU3A 3MBWA 2YG0A 3ZXDA 2JKBA 1ZZ8A 2ILMA 3RI8A 1JU4A 2VTXJ 1ULGA 3RWNA 5BNOB 3IDEA 2C4XA 2GC1A 3H9AA 1JHJA 1VB4A 3S30A 3T09A 4XMIA 1S0DA 1BBT2 1GZCA 4XIKA 3V0BB 4E8DA 1AF9A 2QQPA 3IM0A 4AYUA 3U11A 3SCFA 1IPJA 2PHWA 2RS53 4GH4A 1H8TA 4BQ4A 1HB1A 5F5CA 3D4KA 3PIGA 2HKXA 4AFDA 3DV8A 3NMBA 2BU9A 2BUKA 4I3PA 1W2AX 4PIXA 5IT6A 2QQOA 5ACA1 2O8QA 5IK5A 1C4RA 1FI2A 2XJSA 3O0VA 3P3NA 5JR7B 4CDUB 1LAJA 2A70A 1EPWA 2UYBA 5E88A 4GB32 1YWKA 1CAWA 4LQRA 2HEWF 2OQ6A 4OCTA 3RZGA 2MPFA 5K0UB 1NZIA 2PTMA 1OC1A 4OUSA 3O1MA 3VDDC 4CE8A 2JECA 4XUNA 4AXOA 3O7OA 4O9GA 1AX1A 1XYPA 2QTWB 5LA1A 4TTGA 1R64A 3D5OA 2QZ2A 2WAOA 3A21A 4JC1A 4F83A 2CYFA 4XDQA 2HJIA 1YIPA 3FC0A 1W6MB 4GZ9A 4IEZA 4NRQA 5KHIA 1GYKA 5FPLA 3OBRA 4PDWA 3ILFA 5A3WA 3GBWA 1OOPB 1W06A 1OLMA 3TAYA 4Q4W2 4QDRA 1MVEA 1ENQA 3ES1A 4QQ2A 1RMU1 3H42B 2DCZA 2MEV3 2HWE2 2WZEA 3M70A 4IL7A 2WWSA 4Y3OA 3MUZ1 3AZWA 4HPKB 5FOJB 2VQUA 3UESA 4L2NA 4PHZA 4BISA 1J84A 1CAVB 3AZYA 1RVF2 2VMGA 4XFIA 5FLJA 4K6BA 4GKXA 2VY0A 1C8M1 5IAXA 3VBRC 1UCXA 4DUXA 2PA7A 2R0HA 2CGPA 3C8XA 4A4AA 2Y6HA 3BN6A 3T2OA 1RUD2 4JGZB 4P9WA 5DUVA 3IMNA 2HBTA 3CDZB 3K4DA 1VE0A 2GH2A 1AHSA 1H2LA 3GGLA 1UKRA 3KMHA 1TG7A 4JGYC 1YXWA 2RR12 5FBZA 4RHV2 3LGRA 1GP4A 3CZUA 1HKDA 1VBD1 1GZWB 3MUY1 1KD7A 2OPWA 4COUA 2BNMA 5FAXA 1DLLA 2ZGPA 1F15A 1QJX2 2QDRA 4OI2A 4QPIA 3BODA 4H3WA 4CUGA 5FJKA 1N3PA 2E7TA 3VL9A 5C71A 3FHAA 3LOIA 5CZKA 3VZLA 4JQRA 5F3CA 4YARA 1DYKA 4A42A 3MZHA 1V6IA 1ULOA 1Q8QA 1W2UA 4Q0VA 4ES8A 4LO6B 1WMFA 3KF3A 1QXRA 3KS7A 4L0PA 2F6BA 2ZA9A 4HFSA 3THDA 5A1FA 2W1QA 3USSA 2ZX2A 4O7XA 2ZGNA 5A6QA 3LDBA 1VIWB 1JH5A 4QKBA 1C8NA 1U5XA 1VB2A 5FP7A 5L9RA 2HWC2 5FTTC 3ON7A 4XZPA 1COV1 1DGWX 5FUNA 3KT7A 5F5IA 2W5FA 2B4KA 2CSGA 3AYDA 4TYSA 2UU8A 3VBFC 1AR93 3ZXKA 4CDXB 3WD5A 1AJKA 2BVBA 1SPPA 3LEGA 5D8AA 1QJFA 5IVCA 3V64A 1Q56A 1S1AA 1G8WA 1TME2 4XVHA 1VBA2 1QF3A 2R072 4BQ3A 1NLRA 2PQSA 4OFGA 3ILRA 2PHDA 1UKGA 5FZIA 2G9GA 5KXEA 2QQWA 2R16A 2A73B 3GYDA 4FQZA 4CDWB 2JX9A 1LHUA 3B01A 2ES3A 2ARCA 2O1QA 3J4UH 5A7OA 5JWPA 1APNA 3U4XA 1VP6A 2VO5A 2PHUA 2L9LA 3UKNA 1Q8VA 3J8F1 1X9TA 2ZEWA 4YGEA 5FXXA 3I2FA 4LITA 1XYNA 3I3BA 2ZMKA 4LTAA 1JN2P 3SH4A 1NA1B 4WM7B 3FWEA 1YFUA 2RDNA 4QPYA 4TLGA 1NX9A 4QXBA 4FXKB 4TXWA 2FD8A 4XJWA 1LOAA 4QQHA 3DF0A 2HWF2 2AENA 1JOPA 5JLVA 3R0RA 4GA9A 2H0VA 5KWRA 3MLKA 1W6OA 3I8TA 1VBC1 3M3IA 2LALA 1XNKA 1ZNPA 4JZRA 1JZ8A 5FLIA 2B7YA 1EAH2 1YEWA 2JDUA 1UYZA 1ULEA 3ES4A 3N9OA 2YGLA 4GQ7A 3THCA 2VULA 2GAUA 3C3VA 4YZ4A 1ULDA 1C1FA 2VC9A 2OUHA 4Q1PA 2P6CA 3OSDA 1L7RA 3KHCA 5LA2A 5J98B 3NAPA 1DGRN 5GKAC 2WZPP 4K7JA 5CFCC 4B1MA 4AAXA 1GV9A 1AR81 4LUKA 4LBQA 5I0TA 4CRQA 1JOBA 4Q4Y3 2BGOA 3O1OA 4LOTA 5FYMA 2GP5A 4Z07A 1O5UA 1AXYA 1JODA 2YROA 3DGTA 1V6OA 2AR6A 3KGZA 1US2A 1EV11 2BGCA 1AYM1 2R061 1KJRA 1AL21 3LPGA 5JI9A 3IIIA 2WO2A 4URTA 5C5UA 1GICA 5FY0A 5FP9A 3RPQA 2ATFA 3OEBA 2R7EB 1UIJA 2ZX3A 5CU1A 4AVVA 4IEQA 3WNMA 1W2NA 4CYDA 2IC1A 2E9QA 3EMRA 4KWLA 2XQXA 3ALQA 3I2OA 2NQYA 3CNAA 4XYXA 2RS13 2VZVA 2XLFA 4G4FA 5EFUA 2A5ZA 2C26A 4M00A 1ZRCA 1FMD1 2H0BA 5FZCA 4XFFA 3UJOA 3ITQA 1V6NA 3HIFA 4M01A 5C3SA 2EXIA 1OXCA 1US3A 1P8JA 1S55A 1D4VB 4XHBA 1I6XA 4B1LA 4NAOA 1RUE2 4NWVA 4E2SA 3PTYA 4X8PA 4BDVB 5E1RA 4LBJA 1W3XA 5A1LA 5BNOA 2WJSA 1R091 4XAEA 3QCWA 3ETPA 3G6JB 4S2HA 1AR62 3ACIA 3V0BA 4NIIA 3WSOA 1IZ3A 2C0ZA 3MW3A 2AC1A 4HOOA 2VTFA 3H8RA 1BMV1
chains in the Genus database with same CATH topology
3IDCB 1X50A 1IS5A 1UMZA 1VR3A 1AR71 1HRV3 4PJYA 1V6LA 4C1XA 2Y0OA 3MW4A 1IPKA 2B9UA 2R0FA 4CDUA 4C90A 3E5QA 4JDMA 1HV1A 2EVXA 1IS6A 4B29A 4R9BA 3SHRA 1Y9QA 2XHKA 5DZFA 1GKBA 3VZMA 5KC5A 5K0UA 4KBBA 2RM22 1V6MA 3AXEA 4JGYB 1HQLA 1LHNA 1RUG2 1N3OA 2KXLA 1BEV3 3OYWB 3B69A 3V56A 2LM3A 3EO6A 4Z92B 4LA3A 3MF9A 3H0OA 5FPXA 1LGNA 1W6MA 3VV1A 5T3NA 1WA4A 3TWIA 3JD71 4LBMA 4TZDA 4XTMA 1OOPA 2I07B 1K5MA 4UBHA 5BV6A 1OKQA 4DRVA 3TYJA 1YNAA 3AKQA 2W08A 3PVNA 4HPKA 4Q4X3 4LT5A 2ZGQA 3AMMA 2WKKA 3MF6A 4GIQA 4QT6A 1CAVA 2XJVA 1EYBA 2P3KA 1MS1A 1LRHA 3B9CA 3OGJA 1BBT1 1ZZ6A 5GLWA 3K51A 3ZXFA 2UWAA 2HWD2 4JDOA 3VBFB 1XU1A 4JGZA 5CADA 1MEC2 1VALA 1SCRA 1RUJ2 5GZFA 4CEWC 1NQDA 4ASMB 3OTFA 1MQTA 2VH9A 1Y7BA 3H3UA 3I7DA 1PK6C 1VRH2 1GZWA 2OUJA 2ZX0A 3GZAA 3JBG3 2EIGA 3AMPA 4K9SA 5AC92 3B02A 2KA3A 4GB31 2FZ2A 2AGSA 2XL9A 2JG8A 4NWWA 3KCXA 4AI1A 2WSUA 3FHIB 4XMAA 1QQP2 4Q8KA 4FOQA 2A6YA 3ZSEA 1FPN2 3CJIA 3FE5A 3TN93 4JRAA 2X29A 1ZZBA 4QHBA 3BALA 2QNKA 1ONAA 2CAUA 2YMZA 4Q8LA 3NAPC 5BNNA 4WM8C 5C9AC 3WP4A 4PBPA 1BVP1 1LEDA 1H1MA 2JG9A 2O0OA 4Q4W1 2R043 3LOBA 5LRRA 3RJRA 1S0CA 3IT8A 2HWE1 3CU7A 2BFUL 1PZ9A 1OLRA 4C1WA 1GR3A 2NYYA 3HWJA 3WDYA 4FOVA 3WP6A 1RVF1 1RL3A 2ZCWA 1OA4A 3Q9OA 3H1YA 3VZKA 2VVEA 3ZXEA 2A3WA 5KHGA 1PZ8A 1R083 1RUD1 2Q1ZB 2XBO3 5CFCB 1YO8A 4YVSC 5J37A 3ATGA 4N43C 4LA2A 3NSTA 4R9CA 4S2FA 2YZ4A 2RR11 4KG8A 4RHV1 1SBDA 2JXAA 4FT8A 4GKYA 2OW4A 2PLV2 1W0PA 3KSCA 4P9JA 4AQ6A 1QJX1 1NA1A 4WM7A 2VOKA 4L11A 1X8MA 3MW2A 4RQPB 1PIV2 1FYUA 3WG4A 5HCBA 4S2GA 3CJXA 5FO7B 3VBUC 1YUDA 1HDKA 1H9WA 3WCSA 4XHXA 3WW3A 1LOCA 2VNGA 3AFKA 2D44A 2RMU3 4QM9A 1H2KA 4UW4A 1ASJ3 3SNMA 2IXJA 4IEWA 3WP3A 2Q1MA 4ATFA 2HWC1 4BA6A 1PGL2 2WFPA 4QGLA 1A8MA 5DUWA 3NV4A 5GLTA 3V65A 4I09A 4CEYC 1ZA4A 1GSLA 4GALA 1TME1 5K0UC 3H7YA 4ISRA 1HXS2 1VBA1 2R071 2WIIB 1PO23 3HR9A 1UU6A 1A78A 2WNUC 2VG9A 3AYEA 2GMPA 1FAYA 4YYOA 2QFEA 1O4YA 1AYN3 2AZ5A 1HRI2 1XQNA 2XLAA 1NLSA 5EXOA 1CONA 2AREA 2DVGA 3IIAA 5GJ6A 1LB2A 1PO11 1OI6A 1NOVA 1WW6A 2LUWA 2XVLA 3MPPG 4FPEA 2RS52 3MIFA 1RHI3 4Q4V2 4GMP0 4XBQA 3ZFFC 2CL2A 4AEDB 1CJPA 2D6NA 2ZGSA 5T5LA 2DURA 3JQXA 3N3HA 1QNWA 4XFCA 3VDDA 2HWF1 4PCRA 1NY72 1C3HA 2TEPA 1QOOA 3PHMA 5E8AA 4AVTA 2TNFA 4NR1A 4E27A 4FSJA 1QKQA 1AZDA 3JU9A 1EAH1 4JGZC 1LGBA 3SXWA 1RIRA 4AG4A 5JOWA 1KS4A 2D3SA 2CGOA 1V00A 1H2MA 2JICA 5ACA3 1WW4A 2Y26A 2BW8A 1X8EA 1H0BA 4Q2FA 4YRDA 2X5IB 2R32A 3WLUA 2CV6A 2Q30A 1I1EA 1YCIA 3ILNA 4WV8A 2E7AA 4CDQC 1CAUB 1HIXA 4MLOA 2EAAA 2P34A 5BNQA 1TQ5A 4X6QB 3LA3A 2XPJA 2MEV2 4JVAA 4ZU5A 3D0JA 2JEMA 1MS9A 2E51A 3WINE 3MPBA 5DDJ3 4CEWB 2GDFA 2JJ6A 4JGYA 2XJTA 1B35C 3VKLA 1S0GA 2PHTA 2VGDA 3TNPB 1X82A 4Q29A 1RMU3 3OYWA 2WLPA 1EPZA 3EXUA 2WNEA 3PLQA 5IK4A 4IXLA 1OFNA 3BTAA 1FATA 3E5UA 3GBFA 3AFGA 4CDXC 3EBRA 3I2DA 4OHZA 1EY2A 1YFYA 3LSDA 2CWMA 1C8M3 1IKPA 4W6XA 1RUF2 2XJQA 2ZPXA 3M2MA 1L3JA 3FBMA 4PLNA 3LKJA 1FNZA 4E4SA 3AB0A 4CDWC 1RUE1 4Y20B 3ZSLA 3M1HA 3ENRA 4N53B 1HV0A 1PVXA 2WFF2 2PAEA 3N7MA 1KITA 3ZSJA 5T55A 1AX2A 4AHYA 1AR61 2C9AA 3VBFA 3ME2A 1NXMA 2ZKLA 2VMIA 4SLIA 4ZXKA 1IS3A 5KC6A 4IESA 5JSPA 1VAKA 1UL9A 5EZWA 1MS0A 4LHNA 3ZDSA 3T1LA 1QY4A 2JDZA 4XJ8A 1MZEA 4FPLA 3R05A 4N43B 3ZXGA 4RA0A 4XFHA 2RM21 1X36A 2BNOA 4GMP3 1WGPA 2GNBA 2GALA 1RUG1 3RNSA 5CNAA 1Q8PA 4HKLA 2ZMNA 2XLGA 3L2YA 1G9FA 2X8KA 4XQDA 4QXKA 4XFAA 2NPIA 5BXXA 1QXPA 3VBUB 3USUB 1D2SA 1XE7A 3NV2A 3BOPA 1VAVA 4LNVA 1G9DA 1R1A2 1SLIA 1UZZA 1Z0HA 1UD1A 1DQ0A 2WC2A 2W68A 3ELNA 4YNIA 4FP2A 3J8F3 2VVDA 1C5HA 1LOBA 3OF1A 3IWZA 1YLLA 1LECA 2B46X 1DYPA 1QDCA 2QUOA 4HANA 4FTBA 4Y5Z0 5CFCA 1MEC1 4AFBA 4LUMA 3GZUC 4CEYB 4RSUA 1RUJ1 2VUAA 4DFSA 2Q4SA 3ZX7A 5J7MA 5JOYA 4FPJA 3LA2A 4A2UA 1VRH1 2OVUA 5I91A 2D6PA 2WNUB 4MX3A 1XNCA 1I3HA 5CG8A 3DPRC 4YM2A 5L7OC 1W6QB 4Q4Y2 5DZEA 5A3LA 4XXPA 3OPZA 2WNVB 1R1ZA 2VOWA 1QQP1 3AP5A 3FUOA 1KDMA 1CD3G 3MEPA 2Q8OA 2WSVA 3QLQA 2ARXA 3I4IA 4W65A 2D6OX 1W6PB 4LO7A 1LENA 1AR83 3IBMA 3ZFFB 3JB4C 5C6CA 1OSGA 4IEUA 2ZZQA 3FJSA 3RMXA 3NL1A 2MNGA 4B3NA 1FNYA 1C28A 4YW5A 1O4ZA 3H1WA 2ZAAA 2VU9A 1DF0A 3GF6A 4LR4A 3ZFGC 3TBDA 1O5LA 1OQEA 3N35A 1AYM3 2PHFA 4QQOA 1AL23 4P5HA 4NO4A 5JPNB 2HWB2 3K48A 1FV2A 3AP6A 2UY8A 4XBNA 3WDWA 4W6WA 1SBEA 4A7KA 5A33B 4AFMA 2A6VA 5CFDB 1Q8OA 1WLWA 4CDQB 3VBHC 2Q5TA 4IV1C 2D97A 1FMD3 2PLV1 2UYAA 3WDTA 4Y1XA 5F6KA 3V0AB 4W6YA 2XWJB 4NPRA 4X6RB 1PIV1 1TEIA 2GC3A 3VKOA 2K0GA 1VBE2 1MR5A 1AXZA 1B35B 2VMHA 3KGLA 4RR3B 1UU4A 1LHWA 1NYWA 1CVNA 1SFYA 1LEMA 3HD8B 4Y26A 5E16A 1DGRA 3UV9A 4XF1A 2X53S 4H55A 4MGZE 4D7TA 4HBNA 2A6XA 1AR73 4BLJA 1PGL1 2PYTA 3VL8A 4I2OA 2DF7A 4XF4A 4Y1YA 2DVFA 4XW3A 3VZNA 3S7IA 3POWA 4LLOA 1N47A 2DUOA 2PHXA 1JYIA 1TMF2 1HXS1 1XYOA 3ZXJA 1FXZA 4JTOA 5FQ0B 2Q0AA 2FZ1A 3ETQA 4MZUA 2Z2SB 4AFCA 1WBLA 4DZGA 3JB8A 5K9YA 2XUMA 3WY6A 4L9BA 3JD73 4CEWA 3MIEA 3MIBA 2RS33 3O0WA 1PK6A 2ZACA 4FTEA 1QNYA 2D5HA 5D1IA 4GXLA 3W58A 3VHNA 2RS51 2D6MA 4Q4V1 3IDBB 1CAXB 2HEVF 2B42B 3ACLA 1NY71 2YDEA 4COVA 5EYYA 2PFWA 4N9IA 1BBT3 1DQ4A 4OULA 4OLLA 1U5IA 4WM8A 3I54A 4Y20A 4DPNA 5C9AA 3AYCA 4AK3A 2E63A 2A3XA 3B93A 1Q43A 1WCDJ 1FOD3 1GBGA 1OHFA 4YFZA 2GNDA 1YJLA 5GLUA 1RC6A 4GB33 4NHLA 2DUQA 2G9FA 4MV2A 4RQPC 1JYCA 1POV1 5B2GB 3S0MA 1AX0A 3NJZA 2DFBA 1XRUA 3WDXA 3ZPYA 5KXDA 2ZGRA 4QM8A 1QJU2 4AVBA 5DG1A 2ZZJA 4YVSA 4FO9A 3M3EA 4N43A 4C0HA 5LEKA 3WQ0A 3SH3A 2XKOA 1X7NA 4QD2A 1M4WA 2OYZA 2VXRA 3J9SA 1V9U2 2GC2A 5SV8A 2ET1A 1ND3C 1J58A 2BVVA 1RUH3 3UL2A 2HWE3 4L97A 3DPRB 3E6BA 5L7OB 3MLJA 3BCWA 5C8CC 3LB9A 3RZZA 2AUYA 1BCXA 1HX6A 4Y4YA 1QXJA 1J1TA 3VBUA 4RS5C 1RUF1 3USUA 1Q8SA 3NV1A 3CLPA 1BKZA 1MZ5A 1RUD3 2YY1A 3ROUA 3M3QA 3CEWA 2FBEA 4JCKA 1ZBE2 5C33A 2WFF1 4PF5A 1CPNA 2RR13 3NO8A 2VOVA 4N7UA 1DG6A 4UW5A 5BNPC 3MIGA 1J1LA 3BPZA 4BQ1A 4EROA 4XF9A 1XU2A 3IPVB 1J59A 3ZFGB 2ZGOA 1QJX3 4XEZA 1JUIA 1ASJ2 4G9SB 1QDOA 4CEYA 3L9JT 2Z69A 3KQRA 4WZFA 4K20A 2AH2A 4H7LA 3B9IA 3QOPA 1MS8A 4AEDC 2A75A 3VBOC 5LRSA 1DFQA 1WCKA 2WNUA 1E57A 1QOSA 2ZOEB 1C57A 1W6QA 4FP3A 3GBGA 1D4M2 4V1PA 4META 4P9YA 3VBHB 5DG2A 2HWC3 4AVCA 1F5JA 3CO2A 4IV1B 4AFAA 1VJ2A 2WZR2 1KDKA 2I74A 3QACA 4XJAA 1PGW2 2RHPA 4BM8A 1ZRFA 2X5IC 4ITCA 2FMYA 5GZEA 2JENA 3TB0A 3VN4A 3ZFFA 4EN7B 1J3QA 3WOGA 3ZYIB 1YHFA 4DINB 2WQZC 4HKOA 3MFCA 1PVC2 2V73A 1AXKA 1OPOA 3WXPA 4BLIA 2QJVA 1R1A1 2YHJA 3WW1A 2O8OA 5CBLA 3JCIA 5H9QA 2GC0A 3CF6E 3IKWA 5H9PA 5DUUA 3FFQA 3VKMA 1YI7A 1PO13 4HT1T 2YV8A 2ZABA 4N90A 3RI9A 1U5ZA 3OY8B 5FLHA 4XQWA 3FLTA 1O3RA 5A33A 2CY6A 1MS3A 5KHHA 4CDQA 1CN1A 4A7YA 1YYNA 2QE3A 3RRDA 1ZBA3 5F1RA 5H9RA 5ABJC 3FLPA 5J09A 4FXGB 5H9SA 3V0AA 3MI8A 3ZVXA 1OA2A 1EAH3 4Q4Y1 3E5XA 4Y24A 4FPOB 3WNXA 4HVRA 4N53C 2ZTNA 4I0AA 2XJPA 1B35A 5FRAA 3RYPA 4JV4A 4Y1VA 4YM3A 4RR3A 2ERFA 4LBOA 1UN1A 5TSWA 3RJ2X 3LZZA 3H50A 4I01A 5DDJ2 4CDXA 5I0SA 4E2QA 5EJ3A 3MYXA 3HT1A 2ZGLA 4FPYA 4EV0A 4I3GA 5FFOC 4IV3C 1LODA 3NW4A 4FQ4A 3P3PA 4ASLA 1JXNA 1LU2A 4AGVA 2RJLA 2QVSB 4YG0A 4YZ2A 4YG3A 4Y22B 5FPZA 4CDWA 1NCQB 5JPMB 1S2KA 4Y1ZA 2HWB1 3WV6A 1ZX5A 1CQ9A 4R4XA 5FQ0A 2WS92 1OA3A 3OD0A 2DVDA 3PVBB 1ND2C 4JAAA 3SMHA 2EF6A 3MGUA 1PHMA 2HEYF 4GH4B 1RUI2 1H8TB 1LR5A 1SLBA 1RUC2 1ZVFA 1KFUL 4B4RA 2XVGA 4NHKA 1Z78A 2R30A 5DXDA 5JVVA 3WCRA 1H30A 3FX3A 2DWRA 5CAZA 5CIRA 1CESA 3M3OA 1SMVA 1FT9A 4M0HA 3EHKA 1JBCA 4OZXA 1RUE3 4R9AA 4QGMA 4RFT0 1O91A 2XH6A 2R6QA 1QJY3 1CAXA 2MHFA 4LULA 1LOGA 1VBE1 2V5YA 1WCSA 2VECA 1VAMA 1F5FA 4GULA 4ZU7A 3DL3A 2BPA2 1H8VA 1ND3B 1REDA 4AQTA 4M3CE 1AVBA 1AR63 1UAIA 3B00A 1VBB2 1BQPA 1LOFC 2RJKA 4FAHA 1IKQA 2A3YA 4IERA 4K1ZA 4LLFA 5C8CB 4K8FA 1H9PA 4BZ4A 2QZ3A 2F4PA 2D7FA 3AKRA 5C4WC 4RS5B 4DY5A 5CA6A 4SBVA 1ZZ9A 1ZYBA 4HN1A 4M3CB 2FMDA 3VHOA 2XWBB 3WDVA 1TMF1 3PJQA 4EN9B 2WNVC 3WHTA 5BNPB 4WBBA 1DHKB 1IGOA 3B5LB 5F6LB