5T6DA

2.10 a resolution structure of norovirus 3cl protease in complex with the dipeptidyl inhibitor 7l (hexagonal form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
174
Chain Sequence
HHHAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based exploration and exploitation of the S4 subsite of norovirus 3CL protease in the design of potent and permeable inhibitors.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Protease/protease inhibitor
molecule keywords Genome polyprotein
total genus 40
structure length 174
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t6dA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t6dA01
2WPKS 5FBEA 3SHAH 3OYPA 3KN2A 3ZVBA 1XVOA 1P04A 2VVCA 4B1TA 1CA0B 1FAXA 1VR1H 3GY6A 1DLEA 3Q3XA 3UWJH 1O2PA 2AH4X 2P3UB 1TX7A 2V6NA 1DT2A 4ZHMU 2ANYA 4FUFA 1JIMA 1FLEE 1QA0A 1Z1JA 1HAXB 1CE5A 1ZMLA 1GL0E 3RC5A 4ABEA 1QQUA 1P2IA 3SGBE 4Y7BA 4B75A 4GSOA 1NZQH 4YOIA 3DHKH 1ANDA 2FX4A 4JYUH 2ZECA 1LPKB 3DUXH 4WXIA 1Y3VA 5GXPA 4JZIA 4LXBH 3PTBA 4HI3A 1W7GH 4BAKB 1FDPA 1C5UA 1HYLA 1SPJA 3A85A 4I8LA 2A4RA 2YNAA 3OTJE 4BTIB 2ZFPH 3M37A 1SQTA 4DURA 2GCHG 2P16A 1B0FA 1C2JA 2PTCE 1UK2A 4ISLA 3HKIB 2A5AA 3UOPA 1S81A 1UVSH 2A5KA 1VCQA 1QHRB 1K28D 4XFQA 1D3QB 2ZFQH 5CMXH 1PQ5A 5K7RA 1JMOH 1TNKA 1OWJA 1TMUH 4X1RU 3SQHE 1LHEH 1C5XB 3UREA 1V2MT 4UEHH 3KQDA 2GV6A 1FN8A 1SB1H 1Z1IA 2Z6BD 3UNSA 2TPIZ 3RXKA 3P17H 2ANWA 4ABFA 2W3IA 1TNLA 1CBWC 3SJOA 4BAMB 3RXPA 1Z8RA 1HJ8A 5EQRA 1OYTH 4R8TB 2C8ZB 4SGBE 1O3PB 3GY4A 5F8ZA 3MO6A 3EA8A 3BTFE 1QL8A 4MDSA 5HYOA 4GVUA 5B6OA 3QX5H 4B71A 3MU5A 5AFZH 4UD9H 1GBEA 1HAHH 1W0ZU 3M36A 1BCUH 3A7ZA 1GJ9B 2UWOA 1AVXA 3CS7A 1S0RA 2FXRA 1QTFA 1XXFA 1TRMA 2R3UA 3HATH 1ELCA 4FXGH 3DFLA 2XBVA 3PWBA 3KCGH 1HJAB 1RIWC 4H4FA 2C4FH 3RM2H 1EOJA 3K9XB 4FVBA 1QBOA 3VXEH 1YYY1 4FUGA 1F5LA 2BD2A 1MKWH 3SV6A 3SZNA 5C1XA 4M7GA 2D1JA 3M7QA 1AFQB 1LO6A 2VB0A 3TH3H 1EOLA 1NFUA 1V2NT 1H9LB 2UUFB 4GHQA 1GBIA 1VGCB 1YP9A 5GWZA 2OC1A 4K1TA 3A81A 1TOMH 3E0NB 3ZVAA 1BRCE 3I29A 3IITA 1AN1E 3P92A 1QBVH 1GVLA 3E16B 1ELVA 2OCVB 1GHXH 2OTVA 2FX6A 1GJDB 1C4Y2 3STIA 1ZTLA 3HKJB 4GCHG 4SGAE 4BAOB 1C2DA 5E8EH 3JZ1B 1NRPH 4X8TH 4TPIZ 3QTOH 4AG1A 1EPTC 2RG3A 3M3SA 4X2XA 3C1KA 3SO3A 1DUAA 1GBCA 2EEKA 1PJPA 4IBLH 1Y59T 2AYWA 1GHZA 1C2GA 4OS2A 3V12A 1W14U 1NU7B 3S0NA 2GCTC 2FOFA 1SGCA 1AE5A 1BJVA 2CF8H 1TWXB 3SUEA 3U1IB 4NSVA 1GBJA 2D2DA 4UFDH 1YPMH 3GY7A 1BMMH 2FI5E 2A45B 3BTME 3LKWA 4AGJA 3LT3A 4ZHAA 4D8NA 2FI3E 1C5WB 2SGQE 1LPGB 2Z9JA 3DD2H 3SUFA 1HDTH 1A5IA 3STJA 2ZU3A 4KGAA 2J34A 1CGIE 2G81E 3BEUA 2OD3B 4U01A 1T8NA 4DIHH 5HM2A 2JH0D 4AGKA 2ZFFH 4NIXA 3B23B 1E36B 1GL1A 4Q7XA 3L6PA 1PPBH 2A2XH 2OP9A 1W11U 4AFUA 1K1NA 2F3CE 3RU4D 3RXFA 3AAVA 2R0LA 4Y71A 5A8XA 3GOVB 5AFYH 4DCDA 1SGEE 5TJXA 3EE0B 1KLJH 1XKBC 3PYHA 3RXRA 2M5TA 3RLYH 1PQ7A 3MNXA 1SLVB 2CV3A 2TGAA 2ZZUH 3IG6B 3S9BA 3TGJE 9LPRA 3UNRA 3SW2B 3OU0A 1SGFG 4JK5A 3ZZ6A 1CO7E 4MNWA 3ATKA 3RXGA 4CRAA 2A4GA 1VGCC 3O8CA 1O31A 1TPSA 1TX8A 4BTUB 3IWMA 2EI8A 1SFQB 3PROA 1AFEH 4K8BA 4NFEA 5T6DA 1RIWB 2XNIA 3RXVA 2WV4A 1MH0A 3U8OH 1ZHPA 1A46H 2KAIB 4A1VA 3RLWH 2R2WU 4XE4A 4X8SH 3BIUH 5EW1H 1TB6H 1TQ7B 2ANMH 4Y0ZE 3SQEE 8GCHF 2ODPA 1SR5C 1QRXA 4ABGA 1FPCH 1OKXA 1GHWH 1EZXC 4XBCA 2P3TB 3TIUA 1A5GH 1DY8A 2WV5A 2W5EA 5EXMA 2OQ5A 1LKAA 2A7JA 1QB1A 1HGTH 1FY8E 1O2UA 1N1LA 2FYQA 2ANKH 2Y7ZA 3VB3A 1GI7B 1EP6A 2A5IA 5DK1A 1CU1A 4NIWA 1GCTC 1ZHMA 2BY9X 5E0HA 1ELGA 1DWCH 4Y0YE 1YPJH 3B8JA 4ISHH 5DP8A 4OS7A 2AMQA 1YCPK 1G9IE 3TH2H 3ZZ3A 1TGCA 3RXLA 4GUXA 1ZGVA 1GBFA 1LVMA 1C4V2 1BRBE 3QTVH 1SC8U 4AX9H 1GHBG 5ESBA 1BRUP 3E3TA 1CHOF 3AW0A 1BA8B 3NK8A 4CH8B 1O2IA 1AKSB 2AEIH 1ABJH 1N8OC 3LPRA 1QURH 1W0YH 3DFJA 1BTWA 4YLUA 5F8XA 1TPAE 2PFEA 4WWYA 2VINA 3TK6A 3UPEA 3W95A 1EPTA 2WUBA 1MD7A 3BTWE 3MH5A 3SU6A 1AB9C 4F4OC 2RA0A 1WYKA 2STBE 4DG4A 2SNWA 3ATIA 3UY9A 5FPTA 5T6GA 1A7SA 2AIQA 2AGIX 2PKSC 2PKAA 1QJ7B 1TBQH 4JK6A 3NUMA 3PMAB 1RTLA 3MHWU 2GD4B 3LGIA 1GDQA 2I6QA 3MOCA 3ENSB 3ZZAA 5AVDA 2AGEX 1TE0A 4CBOA 1TRYA 2B8OH 3Q77A 3LJOA 5DP3A 1EJNA 4ZKSU 3GYMA 1O38A 4AFQA 2WPMS 1FMGA 1SHYA 5A0AE 4IGDA 3S7HB 3FANA 1GJCB 4IW4E 1C5PA 1EPTB 5DKMA 5A0BA 2VVVA 3LJJA 2H9EH 2BQWB 1DUEA 3KQCA 2F9PA 5C5OA 3A7VA 2BVRH 1A2CH 3RU4T 2HPQH 2FOEA 2Y81A 4WXVA 3RXHA 1KXBA 3L33A 3BN9A 4H6TA 5EG4A 3I77A 3TGIE 5FPYA 1QY6A 2BDGA 1ZRBA 1LHFH 2P59A 2D26C 3OY5U 3MNCA 1AY6H 1GJ6A 3SJ9A 2LPRA 1TIOA 4BXWA 1ZMJA 3DT0H 4UE7H 4K2YA 5CHAC 1UVUH 1GHAF 2CJIA 3MTYA 3T29A 2ZU1A 3M5NA 2ULLA 3O8DA 2BD8A 4OS6A 3N7OA 2RCEA 4ZH8A 1GBTA 3T25A 1S6HA 1QBNA 5C5NA 3TNTA 3TITA 4JYVH 1O2TA 1EZUC 3O8BA 1H9HE 5DP7A 3RMNH 1ANEA 2IOTA 1GBKA 1QCPA 3FFGA 1J8AA 2HPPH 5J4SA 1SGIB 5JBTA 1BMAA 1MKXK 2XWAA 2FEQH 4CR9A 4WVPE 3QLPH 3ZVFA 1SGFA 2AIPA 2J92A 1IQKA 4IN1A 2JETB 1BMLA 2GV7A 4LOYH 1ZGIA 2J95A 1OWHA 2Z9KA 1AMHA 1P9UA 4OS4A 1Y5BT 1Y3XA 1HAOH 1TONA 4I8KA 2ZU5A 1FIWA 1LHGH 4YOJA 5JBAS 2GCTB 1ZMNA 2ZHQH 3A8CA 3BTDE 1DXWA 1P09A 1ZPCA 2FZZA 1O2HA 3O8RA 2HNTE 1XUFA 3UUZA 4O03A 2AS9A 4ZKNU 4IS5A 1JBUH 1YCPM 2CMYA 1WQVH 1DICA 3TJNA 5C20A 5LPFA 2ZP0H 2BMGB 2F9UA 5HXFA 3G01A 1SFIA 1AE8H 4WMFA 5A09A 2HWLB 1OOKB 4ZROA 2NU3E 4DW2U 1GMDF 1TX6A 3FZZA 1DWDH 3PM3A 1AQ7A 3MH4A 1NM6A 4KTSA 3EQ0H 2G00A 3D23A 2IN2A 3GY8A 4ZXXH 1O30A 1TAWA 4WJG2 1QL9A 3TK5A 1Z8JB 3ZZDA 1SG8B 1GVZA 1ZJDA 1LKBA 2Z3EA 1C2EA 1UO6A 1Y8TA 4ABJA 3SV9A 3P8FA 5TCCA 3GISB 3VEQB 1QQ4A 2ZTYA 1AUTC 3SU3A 1OPHB 2PGQB 4LZ4B 2ILNA 2OINA 1G32B 2XCNA 4D76A 6ESTA 4NIVA 1NY22 4BTTB 2V35A 5E2OA 1YC0A 2P8OC 1BHXB 1ZYOA 3NWUA 2B5TB 4HGCA 1AUJA 1SGYE 4U2WA 1W7XH 2QF0A 1INCA 2UWLA 3RDZA 1XUJA 2BD3A 1LVOA 3VB5A 3GY3A 4X1QU 1LDTT 3GCTF 1GCDA 2UUKB 3FP6E 1TLDA 1MTNC 3ZVDA 1L1NA 1MKWK 4AB9A 2J38A 2ASUB 2IPHA 1K1PA 2XBXA 2ZFTA 2ZU4A 3R0FA 1W10U 1K1IA 1FJSA 1N6XA 2SGFE 2W3KA 3SJIA 3LIWA 3UFAA 1LQEA 1AWHB 2VWOA 2ZO3H 1HAYB 1BITA 1RS0A 1XUKA 3VPKA 4UFFH 3A8DA 4DY7B 2BTCE 1S84A 3SU0A 1ZTJA 4CREA 3KL6A 5L2YH 1MTWA 2XC0A 4E06H 2D8WA 3H7TA 5EODA 4BAQB 2WYJA 1N8OB 1YM0A 4YESB 1RGQA 4RSPA 2C90B 1NT1A 1FI8A 2P3FH 4YZUA 5EQSA 3E6PH 1KXCA 3ELAH 3LDXH 1LHCH 2PSXA 1YBWA 2HOBA 3A7XA 4IN2A 3A89A 3F9HA 1TGBA 5E0JA 4CBNA 4NG9H 3SNCA 2A2QH 1HJ9A 3B9FH 3MO3A 1T31A 5AHGH 3U8RH 1ZOMA 1AZ8A 4BAHB 2W7UA 1L1GA 4IMZA 3VB4A 2H6MA 2ZPRA 2GCHF 3E1XB 4FUHA 6GCHG 1EB1H 3RXOA 3P8GA 2ZGJA 3ZYDA 4ISNA 1U6QA 1W13U 1O3BA 4OS5A 4X6MA 2VU8E 1DITH 1NO9H 3KQEA 3VGCB 7GCHG 1F2SE 1O37A 1TA6A 3RUOA 4Q80A 4FVDA 1C2FA 3SGAE 1P0SH 3Q3YA 3BTEE 4I8GA 3PTNA 5GCHG 2TIOA 4CRBA 1T7CA 2Y80A 1ARCA 2WPJS 3FP8E 3ZV9A 1TPPA 1DOJA 1HNEE 2STAE 5I46H 3QZRA 3A80A 1YLCA 3URDA 3M35A 1BBRE 1J9CH 3PLPA 3QGNB 1GMCF 1P06A 1C5TA 2Z94A 4TY6A 4X2WA 3MYWA 4I8JA 3A8BA 5AF9H 4ZHLU 2VH6A 1HPGA 3LU9B 4MPVA 2VWLA 3T27A 1THSH 3V7TA 3K65B 3SOSA 2IJOB 2FS9A 5FX5A 5GCHF 4E7RG 1NU9A 5EOKA 1ARBA 1C5ZB 1KTTB 2EA3A 1SGDE 2Y5HA 2VGCC 1AB9B 2FIRH 3TJUA 1KIGH 1OX1A 2BLOA 2ALPA 5EQQA 2ZHFH 2JH6D 2FOMB 4JZDH 3U69H 2DE8A 4DOQA 3UR9A 1GWAA 4KP0A 3TLOA 1TBZH 1XUIA 2NU1E 2QYIA 2QIQA 1GJBB 1FY4A 4AZ2B 4WF8A 2ZPQA 1GI5A 4ZKOU 1W12U 1RD3B 4X1PU 1HAPH 3M7TA 5A2MH 1K21H 2ZQ1A 1PPEE 1KXEA 5EPNA 4Y8ZA 2SGDE 1MTVA 2OBOA 2ZDLA 4B2AA 1P05A 4A1TA 1OS8A 3K6YA 4LZ1H 3NZIA 1SOTA 2FDAA 3LGVA 1ID5H 3RXMA 4A5TS 5GJ4B 1C5MD 2J4IA 2CXVA 2C93B 4GHTA 3TGKE 3U9AH 1HAZB 3T28A 1A4WH 3KEEA 1C1SA 2Q6DA 1FAKH 4ZAEA 1LTOA 1T32A 2FO9A 4Y6DA 1D6RA 1T8OA 3F68H 1MBMA 1KYNA 1CGJE 3SGQE 3P95A 3NKKA 2SGAA 4MPXA 5FCRA 1MZDA 1XX9A 4Q2KA 1TALA 4X8UH 1L2EA 1ELAA 1O2YA 1VITH 2BD9A 2TGDA 1KXDA 1F0UA 1FY5A 3BSQA 4YT6H 4K5ZA 2ZQ2A 2FOCA 3ZZBA 3UOUA 4JMYA 3NXPA 3M3TA 4VGCC 1A3EH 1BQYA 4GPGA 3UNQA 2C8WB 1TPOA 1ELFA 3RU4E 2QXIA 2BYAX 2BDIA 1P3CA 2G4TA 5E2PA 1ORFA 4YOGA 2F9BH 4A6LA 2HNTC 1GI3A 2XCFA 3AAUA 4B74A 1QJ6B 1NRQH 2QXGA 3GCTG 2VVUA 1LCYA 1NRRH 2BDCA 5ABWA 3TH4H 3GY5A 1O2RA 1MUEB 2H5DA 1ESBA 1H4WA 1RTFB 5DG6A 5F03A 2A4OA 4O3TA 1Y3YA 2FM2A 1P2KA 3SNDA 3ZZCA 4ISIH 1LMWB 1IHSH 3A7YA 1HLTH 4MTBA 1BIOA 2QA9E 2BXTH 1DSTA 1BDAA 2P95A 3C27B 1PQ8A 4NWKA 1OWIA 2GZ7A 4INLA 5CE1A 2OQUA 2V3OH 3MU1A 2O8TA 4BOHA 1TOCB 3OX7U 4E05H 2UWPA 4FUDA 2ESTE 1A0LA 1QJ1B 2GVFA 1UCYE 1HAVA 3ATLA 1PPHE 2ZKSA 5DP4A 3A87A 1ANCA 1TNHA 3V0XA 1G36A 2VNTA 2Y5GA 3LH3A 3VGCC 3PO1C 3SU4A 1YCPH 1IQGA 2FESH 1TQ0B 4INHA 5HM9A 8GCHG 1DE7H 1WSSH 1HUTH 1EXFA 1W3CA 2HRVA 3KQBA 1BOQA 1UMAH 1THRH 2PKAB 1F0SA 3MFJA 2BLWA 3Q3KA 1G3BA 3BIVH 4Y8YA 3GDSA 2ZEBA 2NWNA 1E34B 1M9UA 5C1UA 1UK3A 1WUNH 2OC0A 1UTNA 1DANH 2GDDA 2BVSH 1CA8B 1O5FH 3QGJA 1K1JA 1NS3A 2Z3DA 1P03A 4BANB 1GDUA 1QB6A 1O3CA 1P02A 4X1NU 5FHTA 2H1UA 3ATWA 4MPUA 2ZGXH 1GI9B 2RA3A 1GG6C 1YPEH 1OP8A 2ZCKP 4NCYA 1NPMA 1V2JT 1FQ3A 2ZDKA 2J94A 4ISOA 1C1VH 1P12E 1PPGE 5LGOA 1V2PT 1BMNH 1L4DA 6LPRA 2A0QB 1HAVB 1MQ5A 1SI5H 4UONA 3W94A 2FOGA 3UR6A 2ZFRH 1GHVH 1EJAA 2GGVB 1KSNA 3SU1A 2SGPE 1O3IA 1YGCH 5GDSH 1MTUA 4I32A 1GBBA 1QB9A 3SU5A 2HVXA 1O2GH 1GCTB 4XDEA 3SU2A 3RXSA 3RP2A 1TNJA 1RXPA 1ZPZA 4FUEA 3URCA 2Z3CA 2GZ8A 1C5LH 1NESE 8LPRA 1O3KA 1A3BH 1EP5A 1IQMA 1O2OA 4I33A 4PROA 1C1QA 3BG4B 1UVTH 4AFZA 2WPIS 2V3HH 1UTOA 1HFDA 1SGQE 4U30A 5C1YA 3BG8A 4HTCH 6CHAB 1Q31A 2Y82A 1C5QA 4X6PA 1GBHA 2Z9LA 1BTUA 2NU0E 3CENA 1O2JA 3LGYA 5C67A 4CRGA 2BXUH 1EQ9A 1VZQH 5H4IB 4AYYB 4I8HA 3S7KB 1F0RA 4WMDA 1FNIA 1E38B 2C8XB 1QRWA 2F9OA 3GY2A 3ZV8A 1ZJKA 3SNAA 4B2CA 4GLYA 2BDHA 4TYDA 3U98H 1E37B 1O5CB 3ZVGA 2ZDMA 3UQOA 3BTKE 1L0ZA 4DVAU 1S0QA 2CGAA 1CT4E 2ZGBH 2ALVA 1C2KA 1SGTA 1CBWB 2W26A 1O3HA 1RRKA 1TYNA 1HIAA 3ZZ5A 1F0TA 1O0DH 2PUXB 2BY8X 4MNVA 2QCYA 3D49H 3ZVEA 4FU7A 1KDQB 3D65E 3ITIA 1O5AB 1A1RA 5JB9S 3KGPA 1C1UH 2ZPSA 4Q7ZA 2VWNA 1GMDG 2ZIQH 1ELDE 1TBRH 1GI8B 1IAUA 1BUIA 3P8NA 1O32A 3D62A 1UHBB 4D7GA 1Z8GA 1SMFE 4YO9A 2BD5A 2WYGA 2ZU2A 4X1SU 5T3HA 4KELA 2GT8A 2V0BA 1PYTC 1JWTA 2Y5FA 1O2WA 2BX4A 3ESTA 1O2VA 5PTPA 3A83A 1AWFH 4AB8A 2R9PA 4AOQA 3RMOH 4HZHA 3DA9B 1SGPE 3PWCA 5F6MA 4DGJA 1YPLH 3MI4A 2FP7B 1HAGE 3ODFA 5BRRE 2PLXA 2BX3A 2PWXA 1DVAH 5CHAB 1O3FA 1UJ1A 1H9IE 2QC2A 1IQHA 5FX6A 2GX4A 5L2ZH 4QT8C 1O35A 1OP0A 2FOHA 4AG2A 2OXSA 1C5OH 1QNJA 1Q2WA 2H9HA 4RKOB 2PV9B 1OWKA 1P2OA 2DE9A 1K2I1 2G52A 2TBSA 6CHAC 1XUHA 1GI2A 3SORA 1O3MA 1FY3A 5EGMA 3RMMH 1O2XA 1C1PA 1C2IA 4A7IB 1BT7A 3QWCH 1UTKA 3PLKA 1DLKB 4X6OA 1VJ9U 1ZSJA 1V2TT 3M7UA 4XSKU 1RTKA 4CH2B 1AIXH 1SGRE 1Q3XA 1ZR0A 1C5VA 1JRSA 2GT7A 1WTGH 1J17T 3TJVA 2G5VA 7ESTE 1EZQA 4Y79A 1Y5UT 1GI6A 1G3DA 4H42U 3PMHB 1C5SA 4Y11E 3R3GB 4CRCA 1V2OT 4THNH 3UWIA 1C5YB 1BZXE 2CHAC 2XWBI 1E35B 1CHOG 2BDYA 5DP9A 1P01A 1GG6B 1D3TB 2ODQA 1AVGH 1V2QT 2ZNKH 1WTHD 1MBQA 3GICB 1QIXB 1VITF 2KAIA 1AI8H 3RC6A 5HMAA 2EI6A 2WINI 1MZAA 2ZTZA 1NFXA 1WOFA 2JETC 1D6WA 4ASHA 1SLXB 2R2MB 3SNEA 4JZEH 2VIDA 1ELTA 1S5SA 1K1LA 3BV9B 1QRZA 2P8OB 1P10A 2BB4A 4MNXA 1HRTH 1P3EA 2BY5X 3NCLA 4MNYA 4OGXA 5LH8A 1EJMA 1SQAA 1ABIH 4K1SA 4Z6AH 1DS2E 3KIDU 3ZZ7A 5FPSA 3CS0A 3ZVCA 2HGTH 1PQAA 4TWYA 1ZSKA 2JH5D 4ABAA 1GBDA 1WQSA 4XBDA 4TY7A 1PPCE 1EAIA 3EAJA 1EX3A 4KTCA 2QY0B 1ZSLA 2I6SA 1YF4A 3RXJA 4RKJB 3HGPA 3SUGA 2ZG0H 3AW1A 1GVKB 2DUCA 1XMNB 1AU8A 4AFSA 3MU4A 4ESTE 4Y7AA 1BTXA 3BTHE 1F5KU 1O34A 1KLIH 4DT7B 2QV1A 2VH0A 1DWEH 1A5HA 1DFPA 1Z71A 5DJ7A 3LGUA 1SVPA 2QGRA 1NROH 4AYVB 4NWLA 1T4VH 2GKVE 5BPEA 5HGGA 2QAAA 3MU0A 2QN5T 2PW8H 1AO5A 1DX5M 3LC3A 3K2UA 4ABIA 1BB0B 1QFKH 1QL7A 4K1EA 4U32A 1EZSC 5E0GA 4NFFA 2Y7XA 3A82A 2VJ1A 1OWDA 1NC6A 1F92A 2J2UA 1FN6A 3EGKH 4B2BA 3CP7A 2Q6GA 1NRNH 1C2HA 1ELBA 3EA7A 1O2MA 1H8IH 4B76A 5C3NA 1O3OA 2ZA5A 1D4PB 1Z6EA 1ZLRA 1G37A 1WAYB 2WPLS 2A31A 1LVYA 1FONA 2AFQB 2SNVA 2XTTB 1EKBB 2VIWA 3RXUA 3SV2H 2VIOA 1F5RA 1AFQC 2EI7A 2FOBA 3ATMA 2QF3A 2OBQA 4A1XA 3RXDA 2GMTC 2ZDNA 2VIVA 3BEFB 1NTPA 1DM4B 1Z8IB 2XRCA 3BEIB 2HALA 1OSSA 2A1DB 1DWBH 1UVPA 1YPKH 3NPSA 1D3PB 2C3SA 1HJAC 1GJAB 1OWEA 1HIAB 2BY6X 1CSOE 2ZHEH 3QDZB 1WBGB 4Q7YA 1JRTA 1P2QA 5EW2H 2ZWLH 1HXFH 4NA7A 2O8MA 5EXLA 1IQJA 1FPHH 1P2NA 3RXTA 4K8YA 3A86A 3TNSA 4ZUHA 2PR3A 7GCHF 1DSUA 1Z7KA 4Y10E 3SHCH 2ZI2H 2BDAA 2R3YA 2Z9IA 3QUMP 1MKXH 2GZ9A 2VGCB 4Y76A 1WCZA 5J4QA 1GGDC 3S9AA 1PYTD 4MG3A 5FBIA 2A7HA 1SGNE 2JKHA 1BTHH 2H9TH 4AORA 1UHBA 2F91A 4Z0KA 1SL3A 4X2YA 1O3NA 1WV7H 2FTLE 3LC5A 1GHBF 1SLUB 5DP5A 5DO4H 1ZRKA 1GJ5H 4H6SB 1HBTH 1G2MA 1K1OA 1O33A 5DP6A 1K1MA 1PFXC 2FMJA 1OXGA 2G51A 2VWMA 1GMCG 3M5MA 3PLBA 3RM0H 5F8TA 3RXEA 1NFWA 3MNSA 2TGTA 1GI4A 4INKA 4NZLA 3TVJB 4XOJA 5L6NH 4D7FA 2CHAB 1EATA 1G3EA 4J2YB 4D9QA 4TWWA 3H5CB 1S83A 4NZQA 1X7AC 3HK6B 2XBYA 2VIPA 1PPZA 4CRFA 3QK1A 1MCVA 1B0EA 3PO1B 5K0HA 2B9LA 3BG4C 2FLBH 1GI0A 2BZ6H 1TA2A 1FV9A 1IQNA 3KNXA 1T8LA 3A7WA 3SV7A 1UTLM 4YM9A 1P9SA 4YTAA 2F83A 1XKAC 1UTPA 1S82A 3A84A 1BBRK 1O2LA 3Q00A 1HB0B 2AGGX 3M5LA 1SSXA 2NU4E 4X8VH 1SOZA 1IQIA 1W2KH 2CN0H 1S85A 3ZZ4A 1JOUB 1O3JA 1TMBH 3S9CA 1LQDB 1C1MA 3V13A 1O3DA 1C1OA 1XM1A 1UTQA 2ZCLP 3LGTA 1IQEA 2J9NA 1L4ZA 5FXLA 4WH6A 1AGJA 4VGCB 3E8LA 2BLQA 2FS8A 3FZDA 1GJ7B 3FVFB 4O3UA 5ETXA 1E0FD 1ESAA 2UUJB 1O3GA 4UDWH 3T2NA 1VJAU 2GTBA 3PV4A 1HV7A 1O2NA 4UFGH 2PTNA 1XVMA 7LPRA 2HNTF 1RFNA 4I7YH 4CRDA 1V2VT 2F9VA 3QN7A 1MCTA 4R0IA 1B7XB 3E90B 3EA9A 4FUIA 1GGDB 4F49A 5EXNA 1BBRH 2XC5A 3MNBA 4ABHA 1QR3E 1ANBA 3GCNA 5GPIB 1G3CA 4WMEA 1D9IA 1JXPA 5LPEA 4CR5A 8ESTE 3VXFH 1O5GH 1AKSA 3EYDA 1V2UT 4K69A 1BJUA 2BOHB 4IC6A 4J1YA 4ABDA 4HFPB 3ZYEA 1AVWA 3VB7A 4JCNA 4WY3A 4GCHF 1OP2A 2F9NA 1FIZA 1K9OE 1J16A 3H7OA 2BY7X 4FU8A 1TGNA 1Z6JH 3ZZ9A 4AN7A 4I31A 2FTMA 3RXAA 3E0PB 3LGWA 1L1JA 2BZAA 2ZGHA 1GHYH 1T4UH 3PMBB 2FODA 4ZMAH 1ZHRA 5FCKA 1YKTA 1GBLA 3RXQA 4FUCA 4RN6A 3MO9A 2PSYA 3UIRA 3MH7A 9ESTA 1EUFA 1EAXA 2AERH 3UQVA 1BHXF 5JDUB 1V2ST 1THPB 2ZHWH 3TJOA 1SBWA 1ETRH 3P70B 1P2MA 3OSYA 1IOEA 1KDQA 1BTPA 1CGHA 2H2ZA 1O3EA 2SFAA 1W8BH 3U1JB 1YPGH 2A32A 1HAIH 1O2KA 3SI4H 1V3XA 1A0HB 2XBWA 2ZDAH 3A8AA 3M5OA 4D9RA 1TRNA 5EU8A 1FZZA 1ESTA 4B73A 1C1NA 1MAXA 1EAUA 1ZPBA 3MWIU 3K6ZA 5ESTE 1CA0C 1BTYA 1CT0E 2FLRH 1YPHC 5GIBA 5T6FA 5JYIA 3HGNA 3RXCA 2BQ7B 5EPYA 2PHBA 3RMLH 3P6ZB 3LOXA 4LK4A 4YLQH 3LONA 1RJXB 1KTSB 4ZKRU 1A61H 3PB1E 4Y8XA 3F1SB 1NRSH 2TGPZ 4NSYA 2G5NA 2SGEE 3BTGE 5A0CA 1GJ8B 3MH6A 5JBCS 1NFYA 2OC8A 2OC7A 2FWWA 1ZZZA 4JYTA 3SN8A 4TPYA 2VIQA 1CQQA 2NU2E 4WH8A 1VCWA 1BRAA 2ZC9H 3MU8A 1CHGA 3SV8A 1Y5AT 2PKSB 2ZDVH 1LVBA 2ZF0H 1C9PA 4MVNA 1H8DH 1A0JA 2PUQH 1LHDH 4X6NA 2G8TA 1J15A 1FY1A 2A4QA 3KF2A 2G4UA 3HPTB 2FI4E 4E7NA 3A7TA 5DPAA 1EASA 1MD8A 1P11E 1PPFE 4UFEH 5LPRA 3GYLB 4NGAH 1C5RA 2LNCA 1MTSA 3A88A 1VCPA 3F6UH 1GBAA 1VITG 1YLDA 1CVWH 3GCHC 5I25A 2OLGA 1GJ4H 5TCAA 2WPHS 1G30B 1TGTA 1MQ6A 1O5DH 8KME2 1V6DA 2BHGA 5JBBS 4MLFB 4OS1A 1GDNA 1XXDA 1UCYK 3F9EA 1Y3WA 5IDKA 5C2ZA 4FUBA 1TFXA 1XUGA 1P8VC 1YPHE 3F9FA 3SBKA 2ZHDA 1NN6A 2UUYA 4ZXYH 1C1WH 2OUAA 2B0FA 1C1TA 2H5CA 1H1BA 1SQOA 4XBBA 1MU6B 2G55A 2RDLA 1TNGA 1UTJA 4GAWA 1O5EH 4CHAB 2GDEH 2Z7FE 4K60A 2PGBB 3SUDA 2GMTB 5A8ZA 4K3JA 2HLCA 3BTTE 1QA7A 4O9VA 2CF9H 1C4U2 3SI3H 3Q76A 3TU7H 4X2VA 3FP7E 4JZFH 5DGJA 3GCOA 2BVXH 1MU8B 3F9GA 2XW9A 1ZTKA 1UTMA 1HXEH 3V3MA 2BDBA 3E91A 1O36A 4BXSA 1ETTH 1V2WT 4OGYA 2FOAA 1KXFA 1N6YA 7KMEH 1K22H 3P8OA 1KXAA 1DY9A 3RC4A 1UCYH 1CT2E 3GDVA 4A92A 1ETSH 3T62A 1TNIA 2BQ6B 4BNRA 1JIRA 3UTUH 4NA9H 1AZZA 1O2SA 1DDJA 1OYQA 2BD4A 3SNBA 1DXPA 3VFEA 4JZ1A 1HCGA 1O2ZA 1F7ZA 1V2KT 1FXYA 4IMQA 2W7SA 1O3AA 4NA8A 1SLWB 5JB8S 3S69A 2BD7A 3TPIZ 4MPWA 1EB2A 2O8WA 2GP9B 3RXIA 1C2LA 3ODDA 3BF6H 2K1QA 2Z9GA 3L3TA 1O3LA 3FAOA 3I78A 3SJ8A 1C5NH 4FUJA 1B5GH 3BTQE 2Q6FA 2A7CA 5G4BA 2AMPA 1IQLA 2FYRA 3RXBA 1D3DB 1ELEE 1IQFA 1T8MA 2O8UA 1C1RA 3OY6U 2BLVA 2ZGCA 2P94A 2YOLA 4YT7H 3GCHB 1C2MA 2C8YB 5FAHA 2FPZA 2XXLA 1BTZA 2AMDA 4FU9A 1V2LT 2QXJA 3HK3B 3QO6A 4X0WU 3AASA 2ZFSA 1GHAG 3QZQA 1AD8H 1P2JA 1AHTH 1EAWA 1UK4A 1G2LA 2R0KA 2EC9H 1GMHG 3TK9A 3PMJA 3T26A 2ZTXA 1UVOA 1MAYA 1O5BB 2Y6TA 3MMGA 2BOKA 3KHVA 1DPOA 4KTUA 3ZZ8A 1MTNB 1KLTA 4CHAC 3GDUA 1KY9A 3VB6A 3M3VA 3T5FH 4DIIH 5L30H 1TGSZ 2XC4A 1O39A 2YNBA 4O97A 4ABBA 3JZ2B 2ZCHP 2THFB 2TRMA 1V2RT 3AVZA 2P93A 2B7DH 1GPZA 1Y3UA 1TMTH 1MMJN 1O2QA 1C9TA 2Q1JA 1FUJA 1GI1A 1GMHF 3EDXB 1IHTH 1ACBE 5IYTA 1TABE 3SJKA 2WUCA 1P57B 2O9QA 4DJZB 2BM2A 5SGAE 2QXHA 1J14A 4MQAA 3M61U 3WY8A 1LPZB 4IC5A 1GBMA 1QGFA 2ODYB 1S6FA 5JPMH 3U8TH 4KKDA 5A8YA 6GCHF 2XYAA 1WU1A 4NIYA 3LH1A 1SHHB 2O8LA
chains in the Genus database with same CATH superfamily
2WPKS 5FBEA 3SHAH 3OYPA 3KN2A 3ZVBA 1XVOA 1P04A 2VVCA 4B1TA 1CA0B 1FAXA 1VR1H 2YMSD 1DLEA 3GY6A 3Q3XA 3UWJH 1O2PA 2AH4X 2P3UB 1TX7A 2V6NA 1DT2A 4ZHMU 5EJLA 2ANYA 4FUFA 1JIMA 1FLEE 1QA0A 1Z1JA 1HAXB 1CE5A 1ZMLA 1GL0E 3RC5A 4ABEA 3F2FA 1QQUA 1P2IA 1E79D 3SGBE 4Y7BA 4B75A 4GSOA 1NZQH 4YOIA 3DHKH 1ANDA 2FX4A 4JYUH 2ZECA 1LPKB 3DUXH 4WXIA 1Y3VA 5GXPA 4JZIA 4LXBH 3PTBA 4HI3A 1W7GH 4BAKB 1FDPA 1C5UA 1HYLA 1SPJA 3A85A 4I8LA 3DCLA 2A4RA 2YNAA 3OTJE 4BTIB 2ZFPH 3M37A 3UB0A 1SQTA 4DURA 2GCHG 2P16A 1B0FA 1C2JA 2PTCE 1UK2A 4ISLA 3HKIB 2A5AA 3UOPA 1S81A 1UVSH 2A5KA 1VCQA 1QHRB 1K28D 4XFQA 1D3QB 2ZFQH 5CMXH 1PQ5A 5K7RA 1JMOH 1TNKA 1OWJA 1TMUH 4X1RU 3SQHE 1LHEH 1C5XB 3N7EA 3UREA 1V2MT 4UEHH 3KQDA 2GV6A 1FN8A 1SB1H 1Z1IA 2Z6BD 3UNSA 2TPIZ 3RXKA 3P17H 2ANWA 3WW7A 4ABFA 2W3IA 1TNLA 1CBWC 3SJOA 4BAMB 3KYGA 3RXPA 1Z8RA 1HJ8A 5EQRA 1OYTH 4R8TB 2C8ZB 4SGBE 1O3PB 3GY4A 5F8ZA 3MO6A 3EA8A 3BTFE 1QL8A 2KZ4A 4MDSA 5HYOA 4GVUA 5B6OA 3QX5H 4B71A 3MU5A 5AFZH 2JIZD 1GBEA 1HAHH 1W0ZU 3M36A 1BCUH 4UD9H 3A7ZA 1GJ9B 2UWOA 1AVXA 3CS7A 1S0RA 2FXRA 1QTFA 1XXFA 1TRMA 2R3UA 3HATH 1ELCA 4FXGH 3DFLA 2XBVA 3PWBA 3KCGH 1HJAB 1RIWC 4H4FA 2C4FH 3RM2H 1EOJA 3K9XB 4FVBA 1QBOA 3VXEH 1YYY1 2J5UA 4FUGA 1F5LA 2BD2A 1MKWH 3SV6A 3SZNA 5C1XA 4M7GA 2D1JA 2VBCA 3M7QA 1AFQB 1LO6A 2VB0A 3TH3H 1EOLA 1NFUA 1V2NT 1H9LB 2UUFB 4GHQA 3PV5A 1GBIA 1VGCB 1YP9A 5GWZA 2OC1A 4K1TA 3A81A 2KX4A 1TOMH 3E0NB 3ZVAA 1BRCE 3I29A 3IITA 1AN1E 3P92A 1QBVH 1GVLA 3E16B 1ELVA 2OCVB 1GHXH 1S6LA 3PV2A 2OTVA 2FX6A 1GJDB 1C4Y2 3STIA 1ZTLA 3HKJB 4GCHG 4SGAE 4BAOB 1C2DA 5E8EH 3JZ1B 1NRPH 4X8TH 4TPIZ 3QTOH 4AG1A 2JDID 4ACBA 1EPTC 2RG3A 3M3SA 4X2XA 3C1KA 1SKYE 3SO3A 1DUAA 1GBCA 2EEKA 1PJPA 4IBLH 1Y59T 3WWFA 2AYWA 1GHZA 1C2GA 4OS2A 3V12A 1W14U 1NU7B 3S0NA 2GCTC 2FOFA 1SGCA 1AE5A 1BJVA 2CF8H 1TWXB 3SUEA 3U1IB 4NSVA 4B6EA 1GBJA 2D2DA 4UFDH 1YPMH 3GY7A 1BMMH 2FI5E 2A45B 3BTME 3LKWA 4AGJA 3LT3A 4ZHAA 4D8NA 2FI3E 1C5WB 2SGQE 1LPGB 2Z9JA 3DD2H 3SUFA 1HDTH 1A5IA 3STJA 2ZU3A 4KGAA 2J34A 1CGIE 2G81E 3BEUA 2OD3B 4U01A 1T8NA 4DIHH 5HM2A 2JH0D 4AGKA 2ZFFH 4NIXA 3B23B 1E36B 3KYFA 1GL1A 4Q7XA 3L6PA 1PPBH 2A2XH 2OP9A 1W11U 4AFUA 1K1NA 2F3CE 3RU4D 3RXFA 3AAVA 2RDEA 2R0LA 4Y71A 4ZCNA 5A8XA 3GOVB 5AFYH 4DCDA 1SGEE 5TJXA 3EE0B 2EY4C 1KLJH 1XKBC 3PYHA 3RXRA 2M5TA 3RLYH 1PQ7A 3MNXA 1SLVB 2CV3A 2TGAA 2ZZUH 3IG6B 3S9BA 3TGJE 9LPRA 3UNRA 3SW2B 3OU0A 1SGFG 4JK5A 3ZZ6A 1CO7E 4MNWA 3ATKA 3RXGA 4CRAA 2A4GA 1VGCC 3O8CA 1O31A 2CK3D 1TPSA 1TX8A 4BTUB 3IWMA 2EI8A 1SFQB 3PROA 3AK5A 1AFEH 4K8BA 4NFEA 5T6DA 1RIWB 2XNIA 3RXVA 2WV4A 1MH0A 3U8OH 1ZHPA 1A46H 2KAIB 4A1VA 3RLWH 2R2WU 4XE4A 4X8SH 3BIUH 5EW1H 2K0QA 1TB6H 1TQ7B 2ANMH 4Y0ZE 3SQEE 8GCHF 2ODPA 1SR5C 1QRXA 4ABGA 1FPCH 1OKXA 1GHWH 2V7QD 1EZXC 1VKYA 4XBCA 2P3TB 3TIUA 1A5GH 1DY8A 2WV5A 2W5EA 5EXMA 2OQ5A 1LKAA 2A7JA 1QB1A 1HGTH 1FY8E 1O2UA 1N1LA 2FYQA 2ANKH 2Y7ZA 3VB3A 1GI7B 1EP6A 2A5IA 5DK1A 1CU1A 4NIWA 1GCTC 1ZHMA 2BY9X 5E0HA 1ELGA 1DWCH 5C17A 4Y0YE 1YPJH 3B8JA 4ISHH 5DP8A 4OS7A 2AMQA 1YCPK 1G9IE 3TH2H 3ZZ3A 1TGCA 3RXLA 4GUXA 1ZGVA 1GBFA 1LVMA 1C4V2 1BRBE 3QTVH 3WWBA 1SC8U 4AX9H 1GHBG 5ESBA 1BRUP 3E3TA 1CHOF 3AW0A 1BA8B 3NK8A 4CH8B 1O2IA 1AKSB 2AEIH 1ABJH 4XRNA 1N8OC 3LPRA 1QURH 1W0YH 3DFJA 1BTWA 4YLUA 5F8XA 1TPAE 2PFEA 4WWYA 2VINA 3TK6A 3UPEA 3W95A 1EPTA 2WUBA 1MD7A 3BTWE 3MH5A 3SU6A 1AB9C 4F4OC 2RA0A 1WYKA 2STBE 3OAAD 4DG4A 2SNWA 3ATIA 3UY9A 5FPTA 5T6GA 1A7SA 2AIQA 2AGIX 2PKSC 2PKAA 1QJ7B 1TBQH 4JK6A 3NUMA 3PMAB 1RTLA 3MHWU 2GD4B 3LGIA 1GDQA 2I6QA 3MOCA 3NRLA 3ENSB 3ZZAA 5AVDA 2AGEX 1TE0A 2M2AA 4CBOA 1TRYA 2B8OH 3Q77A 3LJOA 5DP3A 1EJNA 2YMSB 3GYMA 1O38A 4ZKSU 4AFQA 2WPMS 1FMGA 1SHYA 5A0AE 4IGDA 2W6JD 3S7HB 3FANA 1GJCB 4IW4E 1C5PA 1EPTB 5DKMA 5A0BA 2VVVA 3LJJA 2H9EH 2BQWB 4Q4LA 1DUEA 3KQCA 2F9PA 5C5OA 3A7VA 2BVRH 1A2CH 4P00A 3RU4T 2HPQH 2FOEA 2QF5A 2Y81A 4WXVA 3RXHA 1KXBA 3L33A 3BN9A 4H6TA 5EG4A 3I77A 3TGIE 5FPYA 1QY6A 2J97A 2BDGA 1ZRBA 1LHFH 2P59A 2D26C 3OY5U 3MNCA 1AY6H 1GJ6A 3SJ9A 2LPRA 1TIOA 4BXWA 1ZMJA 3DT0H 4UE7H 4K2YA 5CHAC 1UVUH 1GHAF 2CJIA 3MTYA 3T29A 2ZU1A 3SZEA 3M5NA 2ULLA 3O8DA 2BD8A 5DN6D 4OS6A 3N7OA 2RCEA 4ZH8A 1GBTA 3T25A 1S6HA 1QBNA 5C5NA 3TNTA 3TITA 4JYVH 1O2TA 1EZUC 3O8BA 1H9HE 5DP7A 4FETA 3RMNH 1ANEA 2IOTA 1GBKA 1QCPA 3FFGA 1WXRA 1J8AA 4F48B 2HPPH 5J4SA 1SGIB 5JBTA 1BMAA 1MKXK 2XWAA 2FEQH 4CR9A 4WVPE 3QLPH 3ZVFA 1SGFA 2AIPA 2J92A 1IQKA 4IN1A 2JETB 1BMLA 2GV7A 4LOYH 1ZGIA 2J95A 1OWHA 2Z9KA 1AMHA 1P9UA 4OS4A 1Y5BT 1Y3XA 1HAOH 1TONA 5KEDA 4I8KA 2ZU5A 1FIWA 1LHGH 4YOJA 5JBAS 2GCTB 1ZMNA 3FO8D 2ZHQH 3A8CA 3BTDE 1DXWA 1P09A 1ZPCA 2FZZA 1O2HA 3O8RA 1W0JD 2HNTE 1XUFA 3UUZA 4O03A 2AS9A 4ZKNU 4IS5A 1JBUH 4RT1A 1YCPM 2CMYA 3F0PA 1WQVH 1DICA 3TJNA 5C20A 5LPFA 2ZP0H 2BMGB 2F9UA 5HXFA 3G01A 2KCYA 1SFIA 1AE8H 4WMFA 5A09A 2HWLB 1OOKB 4ZROA 2NU3E 4DW2U 1GMDF 1TX6A 3FZZA 2WV9A 1DWDH 3PM3A 1AQ7A 3MH4A 1NM6A 4KTSA 3EQ0H 2G00A 3D23A 2IN2A 2L6OA 3GY8A 4ZXXH 1O30A 1TAWA 4WJG2 1QL9A 3TK5A 1Z8JB 3ZZDA 1SG8B 1GVZA 1ZJDA 1LKBA 2Z3EA 1C2EA 1UO6A 1Y8TA 4ABJA 3SV9A 3P8FA 5TCCA 3GISB 3FN8A 3VEQB 1QQ4A 2ZTYA 1AUTC 3SU3A 1OPHB 2PGQB 4LZ4B 2ILNA 2OINA 1G32B 2XCNA 4D76A 6ESTA 4NIVA 1NY22 4BTTB 2V35A 5E2OA 1YC0A 2P8OC 1BHXB 1ZYOA 3NWUA 2B5TB 4HGCA 1AUJA 1SGYE 4U2WA 1W7XH 2QF0A 1INCA 2UWLA 3RDZA 1XUJA 2BD3A 1LVOA 3VB5A 3GY3A 4X1QU 1LDTT 3GCTF 1GCDA 2UUKB 3FP6E 1TLDA 1MTNC 3ZVDA 1L1NA 1MKWK 4AB9A 2J38A 2ASUB 2IPHA 1K1PA 2XBXA 2L74A 2HLDD 2ZFTA 1W10U 1K1IA 2ZU4A 3R0FA 1FJSA 1N6XA 2SGFE 2W3KA 3SJIA 3LIWA 3UFAA 1LQEA 1AWHB 2VWOA 2ZO3H 1HAYB 1BITA 1RS0A 1XUKA 3VPKA 4UFFH 3A8DA 4DY7B 2BTCE 1S84A 3SU0A 1ZTJA 2QF4A 4CREA 3KL6A 5L2YH 1MTWA 4OM9A 4ASUD 2XC0A 4E06H 2D8WA 2KR7A 3H7TA 5EODA 4BAQB 2WYJA 1N8OB 1YM0A 4YESB 1RGQA 3F2GA 4RSPA 2C90B 1NT1A 1FI8A 2P3FH 4YZUA 5EQSA 3E6PH 1KXCA 3ELAH 3LDXH 1LHCH 2PSXA 1YBWA 2HOBA 3A7XA 3OTPA 4IN2A 3A89A 3F9HA 1TGBA 5E0JA 4CBNA 4NG9H 3F3BA 3SNCA 2A2QH 1HJ9A 3B9FH 3MO3A 1T31A 5AHGH 3U8RH 1ZOMA 1AZ8A 4BAHB 2W7UA 1L1GA 4IMZA 3VB4A 2H6MA 2ZPRA 2GCHF 3E1XB 4FUHA 6GCHG 5IK2D 1EB1H 3RXOA 3P8GA 2ZGJA 3ZYDA 4ISNA 1U6QA 1W13U 1O3BA 4OS5A 4X6MA 2VU8E 1DITH 1NO9H 3KQEA 3VGCB 7GCHG 1F2SE 1O37A 1TA6A 3RUOA 4Q80A 4FVDA 1C2FA 3SGAE 1P0SH 3Q3YA 3BTEE 4I8GA 3PTNA 5GCHG 2TIOA 4CRBA 1T7CA 2IPQX 2Y80A 1ARCA 2WPJS 3FP8E 3ZV9A 1TPPA 1DOJA 1HNEE 2STAE 2XOKD 5I46H 3QZRA 3A80A 1YLCA 3URDA 3M35A 1BBRE 1J9CH 3PLPA 3QGNB 2F4LA 1GMCF 1YLNA 1P06A 1C5TA 2Z94A 1QZ8A 4TY6A 4X2WA 3MYWA 4I8JA 3A8BA 5AF9H 4ZHLU 2VH6A 1HPGA 3LU9B 4MPVA 2VWLA 3T27A 1THSH 3V7TA 1WDIA 3K65B 3SOSA 2IJOB 2FS9A 5FX5A 5GCHF 4E7RG 3GS9A 1NU9A 5EOKA 1ARBA 1C5ZB 1KTTB 2EA3A 1SGDE 2Y5HA 2VGCC 1AB9B 2FIRH 3TJUA 1KIGH 1OX1A 4B6FA 2BLOA 3H09A 2ALPA 5EQQA 2ZHFH 2JH6D 2FOMB 4JZDH 3U69H 2DE8A 4DOQA 3UR9A 1GWAA 4KP0A 3TLOA 2KCOA 2RFKC 1TBZH 1XUIA 2NU1E 2QYIA 2QIQA 1GJBB 1FY4A 5CHBA 4AZ2B 4WF8A 2ZPQA 3FOAA 1GI5A 4ZKOU 1W12U 1RD3B 4X1PU 4XD7D 1HAPH 3M7TA 5A2MH 1K21H 2ZQ1A 1H8HD 1PPEE 3CNRA 1KXEA 5EPNA 4Y8ZA 2SGDE 1MTVA 2OBOA 2ZDLA 4B2AA 1P05A 4A1TA 1OS8A 3K6YA 4LZ1H 3NZIA 1SOTA 2FDAA 3LGVA 1ID5H 3RXMA 4A5TS 5GJ4B 4HG6A 1C5MD 2J4IA 2CXVA 2C93B 4GHTA 3TGKE 3U9AH 1HAZB 2QE7D 3T28A 1A4WH 3KEEA 1C1SA 5KECA 2Q6DA 1FAKH 4ZAEA 1LTOA 1T32A 2FO9A 4Y6DA 1D6RA 1T8OA 3F68H 1MBMA 1KYNA 2KCAA 1CGJE 3SGQE 3P95A 3NKKA 2SGAA 4MPXA 5FCRA 1MZDA 1XX9A 4Q2KA 1TALA 4X8UH 1L2EA 1ELAA 1O2YA 1VITH 2BD9A 2TGDA 1KXDA 1F0UA 1FY5A 3BSQA 4YT6H 3W1EA 4TSFD 4K5ZA 2ZQ2A 2FOCA 3ZZBA 3UOUA 4JMYA 3NXPA 3M3TA 4VGCC 4AC9A 1A3EH 1BQYA 4GPGA 3UNQA 2C8WB 1TPOA 1ELFA 3RU4E 2QXIA 2BYAX 2BDIA 1P3CA 2G4TA 5E2PA 1ORFA 4YOGA 2F9BH 4A6LA 2HNTC 1GI3A 2XCFA 3AAUA 4B74A 1QJ6B 1NRQH 2QXGA 3GCTG 2VVUA 1LCYA 1NRRH 2BDCA 5ABWA 3TH4H 3GY5A 1O2RA 1MUEB 2H5DA 1ESBA 1H4WA 1RTFB 5DG6A 5F03A 2A4OA 4O3TA 1Y3YA 2FM2A 1P2KA 3SNDA 3ZZCA 4ISIH 1LMWB 1IHSH 3A7YA 1HLTH 4MTBA 1BIOA 3MQKC 2QA9E 2BXTH 1DSTA 1BDAA 2P95A 3C27B 1PQ8A 4NWKA 1OWIA 2GZ7A 4INLA 5CE1A 2OQUA 2V3OH 3MU1A 2O8TA 4BOHA 1TOCB 3OX7U 4E05H 2UWPA 4FUDA 2ESTE 2JJ2D 1A0LA 1QJ1B 2GVFA 1UCYE 1HAVA 3ATLA 1PPHE 2ZKSA 5DP4A 3A87A 1ANCA 1TNHA 5C0TA 3V0XA 1G36A 2VNTA 2Y5GA 3LH3A 3VGCC 3PO1C 3SU4A 1YCPH 1IQGA 2FESH 1TQ0B 4INHA 5HM9A 3OEHD 8GCHG 1DE7H 1WSSH 1HUTH 1EXFA 1W3CA 2HRVA 3KQBA 1BOQA 1UMAH 1THRH 2PKAB 2YMSC 1F0SA 3MFJA 2BLWA 3F0OA 3Q3KA 1G3BA 3BIVH 4Y8YA 3GDSA 2ZEBA 2NWNA 1E34B 1M9UA 3F2HA 5C1UA 1UK3A 1WUNH 2OC0A 1UTNA 1DANH 2GDDA 2BVSH 1CA8B 1O5FH 3QGJA 1K1JA 1NS3A 2Z3DA 1P03A 4BANB 1GDUA 1QB6A 1O3CA 1P02A 4X1NU 5FHTA 2H1UA 3ATWA 3N7DA 4MPUA 2ZGXH 1GI9B 2LELA 2RA3A 1GG6C 1YPEH 1OP8A 2ZCKP 4NCYA 1NPMA 5HIZA 1V2JT 1FQ3A 2ZDKA 2J94A 4ISOA 1C1VH 1P12E 1PPGE 5LGOA 5EJZA 1V2PT 1BMNH 1L4DA 6LPRA 2A0QB 1HAVB 1MQ5A 1SI5H 4UONA 3W94A 2FOGA 3UR6A 2ZFRH 1GHVH 1EJAA 2GGVB 1KSNA 3SU1A 2SGPE 1O3IA 1YGCH 5GDSH 1MTUA 4I32A 1GBBA 1QB9A 3SU5A 2HVXA 1O2GH 1GCTB 2KM0A 4XDEA 3SU2A 3RXSA 3RP2A 1TNJA 1RXPA 1ZPZA 4FUEA 3URCA 2Z3CA 2GZ8A 1C5LH 1NESE 1YWUA 8LPRA 1O3KA 1A3BH 1EP5A 1IQMA 1O2OA 4I33A 2XNDD 4PROA 1C1QA 3BG4B 1UVTH 4AFZA 2WPIS 4I86A 2V3HH 1UTOA 3EE7A 1HFDA 1SGQE 4U30A 5C1YA 3BG8A 4HTCH 6CHAB 1Q31A 2Y82A 1C5QA 4X6PA 2V3MA 1GBHA 2Z9LA 1BTUA 2NU0E 2IJD1 3CENA 1O2JA 3LGYA 5C67A 4CRGA 2BXUH 1EQ9A 1VZQH 5H4IB 4AYYB 4I8HA 3S7KB 1F0RA 4WMDA 1FNIA 1E38B 2C8XB 1QRWA 3FKSD 2F9OA 3GY2A 3ZV8A 1ZJKA 3SNAA 4B2CA 3PRDA 4GLYA 2BDHA 4TYDA 3U98H 1E37B 1O5CB 3ZVGA 2ZDMA 3UQOA 3BTKE 1L0ZA 5DSFA 4DVAU 2J98B 1S0QA 2CGAA 1CT4E 2ZGBH 2ALVA 1C2KA 1SGTA 1CBWB 2W26A 1O3HA 1RRKA 3UAIC 1TYNA 1HIAA 3ZZ5A 1F0TA 1O0DH 2PUXB 2BY8X 4MNVA 2QCYA 3D49H 3ZVEA 4FU7A 1KDQB 3D65E 3ITIA 2GJGA 1O5AB 1A1RA 5JB9S 3KGPA 1C1UH 2ZPSA 4Q7ZA 2VWNA 1GMDG 2ZIQH 1ELDE 1TBRH 1GI8B 1IAUA 1BUIA 2JJ1D 3P8NA 1O32A 3D62A 1UHBB 4D7GA 1Z8GA 1SMFE 4YO9A 2BD5A 2WYGA 2ZU2A 4X1SU 5T3HA 4KELA 2GT8A 2V0BA 1PYTC 1JWTA 2Y5FA 1O2WA 2BX4A 3ESTA 1O2VA 5PTPA 2WPDD 3A83A 1AWFH 4AB8A 2R9PA 4AOQA 3RMOH 4HZHA 3DA9B 1SGPE 3PWCA 5F6MA 4DGJA 1YPLH 3MI4A 2FP7B 1HAGE 3ODFA 5BRRE 2PLXA 2BX3A 2PWXA 1DVAH 5CHAB 1O3FA 1UJ1A 1H9IE 2QC2A 1IQHA 5FX6A 2GX4A 5L2ZH 4QT8C 3SYJA 1O35A 3DSGA 1OP0A 2FOHA 4AG2A 2OXSA 1C5OH 1QNJA 1Q2WA 2H9HA 2OK5A 4RKOB 2PV9B 1OWKA 1P2OA 2DE9A 1K2I1 2G52A 2TBSA 6CHAC 1XUHA 1GI2A 3SORA 1O3MA 1FY3A 5EGMA 3RMMH 1O2XA 1C1PA 1C2IA 4A7IB 1BT7A 3QWCH 1UTKA 2AHME 3PLKA 1DLKB 4X6OA 1VJ9U 1ZSJA 1V2TT 3M7UA 4XSKU 1RTKA 4CH2B 1AIXH 1SGRE 1Q3XA 1ZR0A 1C5VA 1JRSA 2GT7A 1WTGH 1J17T 3TJVA 2G5VA 7ESTE 1EZQA 4Y79A 1Y5UT 1GI6A 1G3DA 4H42U 3PMHB 1C5SA 4Y11E 3R3GB 4CRCA 1V2OT 4THNH 3UWIA 1C5YB 1BZXE 2CHAC 1E35B 1CHOG 2BDYA 2XWBI 5DP9A 1P01A 1GG6B 1D3TB 2ODQA 1AVGH 1V2QT 2ZNKH 1WTHD 1MBQA 3GICB 1QIXB 1VITF 1COWD 2KAIA 1AI8H 3RC6A 5HMAA 2EI6A 2WINI 1MZAA 2ZTZA 1NFXA 1WOFA 2JETC 1D6WA 4ASHA 1SLXB 2R2MB 3SNEA 4JZEH 2VIDA 1ELTA 1S5SA 1K1LA 3BV9B 1QRZA 2P8OB 1P10A 2BB4A 4MNXA 1HRTH 1P3EA 2BY5X 3NCLA 4MNYA 4OGXA 5LH8A 1EJMA 1SQAA 1ABIH 4K1SA 4Z6AH 1DS2E 3KIDU 3ZZ7A 5FPSA 3CS0A 3ZVCA 2HGTH 1PQAA 4TWYA 1ZSKA 2JH5D 4ABAA 1GBDA 1WQSA 4XBDA 4TY7A 1PPCE 1EAIA 3EAJA 1EX3A 4KTCA 2QY0B 1ZSLA 2I6SA 1YF4A 3RXJA 4RKJB 3HGPA 3SUGA 5FL7D 3DSOA 2ZG0H 3AW1A 1GVKB 2DUCA 1XMNB 1AU8A 4AFSA 3MU4A 4ESTE 4Y7AA 1BTXA 3BTHE 5F53A 1F5KU 4RI0A 1O34A 1KLIH 4DT7B 5EIYA 1W0KD 2QV1A 2VH0A 1DWEH 1A5HA 1DFPA 1Z71A 5DJ7A 3LGUA 1SVPA 2QGRA 1NROH 4AYVB 4NWLA 1T4VH 2GKVE 5BPEA 5HGGA 2QAAA 3MU0A 2QN5T 2PW8H 1AO5A 1DX5M 3LC3A 3K2UA 4ABIA 1BB0B 1QFKH 5T1VA 1QL7A 4K1EA 4U32A 1EZSC 1UW7A 5E0GA 4NFFA 2Y7XA 3A82A 2VJ1A 1OWDA 1NC6A 1F92A 5CDFE 2J2UA 1FN6A 3EGKH 4B2BA 3CP7A 2Q6GA 1NRNH 1C2HA 1ELBA 3EA7A 4Z1MD 5C0UA 1O2MA 1H8IH 4B76A 5C3NA 1YY3A 1O3OA 2ZA5A 1D4PB 1Z6EA 1ZLRA 1G37A 1WAYB 2WPLS 2A31A 1LVYA 1FONA 2AFQB 2SNVA 2XTTB 1EFRD 1EKBB 2VIWA 3RXUA 3SV2H 2VIOA 1F5RA 1AFQC 2EI7A 2FOBA 3ATMA 2QF3A 2OBQA 5C94A 4A1XA 3RXDA 2GMTC 2ZDNA 2VIVA 3BEFB 1NTPA 1DM4B 1Z8IB 2XRCA 3BEIB 2HALA 1OSSA 2A1DB 1DWBH 1UVPA 1YPKH 3NPSA 1D3PB 2C3SA 1HJAC 1GJAB 1OWEA 1HIAB 2BY6X 1CSOE 2ZHEH 3QDZB 1WBGB 4Q7YA 1JRTA 1P2QA 5EW2H 2ZWLH 1HXFH 4NA7A 2O8MA 5EXLA 1IQJA 1FPHH 1P2NA 3RXTA 4K8YA 3A86A 3TNSA 4ZUHA 1BMFD 2PR3A 7GCHF 1DSUA 1Z7KA 4Y10E 3SHCH 2ZI2H 2BDAA 2R3YA 2Z9IA 3QUMP 1MKXH 1E1QD 2GZ9A 2VGCB 4Y76A 1WCZA 5J4QA 1GGDC 3S9AA 1PYTD 4MG3A 5FBIA 2A7HA 1SGNE 2JKHA 1BTHH 2H9TH 4Q63A 4AORA 1UHBA 2F91A 4RT0A 4Z0KA 1SL3A 2KFWA 4X2YA 1O3NA 1OHHD 1WV7H 2FTLE 3LC5A 1GHBF 1SLUB 5DP5A 5DO4H 1ZRKA 1GJ5H 4H6SB 1HBTH 1G2MA 1K1OA 1O33A 5DP6A 1K1MA 1PFXC 2FMJA 1OXGA 2G51A 2VWMA 1GMCG 3M5MA 3PLBA 5GNDA 3RM0H 5F8TA 3RXEA 1NFWA 3MNSA 2TGTA 1GI4A 4INKA 4NZLA 3TVJB 4XOJA 5L6NH 4D7FA 2CHAB 1EATA 4TT3D 1G3EA 4J2YB 4D9QA 4TWWA 3H5CB 1S83A 4NZQA 1X7AC 3HK6B 2XBYA 2VIPA 1PPZA 4CRFA 3QK1A 1MCVA 1B0EA 3PO1B 5K0HA 2B9LA 3BG4C 2FLBH 1GI0A 2BZ6H 1TA2A 1FV9A 4P02A 4FOUC 1IQNA 3KNXA 1T8LA 3A7WA 3SV7A 1UTLM 4YM9A 1P9SA 1K0HA 4YTAA 2F83A 1XKAC 1UTPA 1S82A 3A84A 1BBRK 1O2LA 3Q00A 1HB0B 2AGGX 3M5LA 1SSXA 2NU4E 4X8VH 1SOZA 1IQIA 1W2KH 2CN0H 1S85A 3ZZ4A 1JOUB 1O3JA 1TMBH 3S9CA 1LQDB 1C1MA 3V13A 1O3DA 1C1OA 1XM1A 1UTQA 2ZCLP 3LGTA 1IQEA 2J9NA 1L4ZA 5FXLA 4F55A 4WH6A 1AGJA 4VGCB 3E8LA 2BLQA 2FS8A 3FZDA 1GJ7B 3FVFB 4O3UA 5ETXA 1E0FD 1ESAA 2UUJB 1O3GA 4UDWH 3T2NA 1VJAU 2GTBA 3PV4A 1HV7A 1O2NA 4UFGH 2PTNA 1NBME 1XVMA 7LPRA 5HIYA 3OFND 2HNTF 1RFNA 4I7YH 4CRDA 1V2VT 2F9VA 3QN7A 2WHXA 1MCTA 4R0IA 1B7XB 3E90B 3EA9A 4FUIA 1GGDB 4F49A 5EXNA 1BBRH 2XC5A 3MNBA 3N99A 4ABHA 1QR3E 1ANBA 3GCNA 5GPIB 1G3CA 4WMEA 1D9IA 1JXPA 5LPEA 4CR5A 8ESTE 3VXFH 1O5GH 1AKSA 3EYDA 1V2UT 1KMHB 4K69A 1BJUA 2BOHB 4IC6A 4J1YA 5KGOA 4HFPB 4ABDA 3ZYEA 1AVWA 3VB7A 4JCNA 3DSPA 4WY3A 4GCHF 1OP2A 2F9NA 1FIZA 1K9OE 1J16A 2KCPA 3H7OA 2BY7X 4FU8A 1TGNA 1Z6JH 3ZZ9A 4AN7A 4I31A 2FTMA 3RXAA 3E0PB 3LGWA 1L1JA 2BZAA 2ZGHA 1GHYH 1T4UH 2PP6A 3PMBB 2FODA 4ZMAH 1ZHRA 5FCKA 1YKTA 1GBLA 3RXQA 4FUCA 4RN6A 3MO9A 2PSYA 3UIRA 3MH7A 9ESTA 1EUFA 1EAXA 2AERH 3UQVA 1BHXF 5JDUB 1V2ST 1THPB 2WZQA 2ZHWH 3TJOA 1SBWA 1ETRH 4ACAA 3P70B 1P2MA 3OSYA 1IOEA 1KDQA 1BTPA 1CGHA 2H2ZA 1O3EA 2SFAA 1W8BH 3U1JB 2HVYB 1YPGH 2A32A 1HAIH 1O2KA 3SI4H 1V3XA 1A0HB 2XBWA 2ZDAH 3A8AA 3M5OA 4D9RA 1TRNA 5EU8A 2J98A 1FZZA 1ESTA 4B73A 1C1NA 1MAXA 1EAUA 1ZPBA 3MWIU 3K6ZA 5ESTE 1CA0C 1BTYA 1CT0E 2FLRH 1YPHC 5GIBA 5T6FA 5JYIA 3HGNA 3RXCA 2BQ7B 5EPYA 2PHBA 3RMLH 3P6ZB 3LOXA 4LK4A 4YLQH 3LONA 1RJXB 1KTSB 4DT4A 4ZKRU 1A61H 3PB1E 4Y8XA 3F1SB 1NRSH 2TGPZ 4M9FA 4NSYA 2G5NA 2LP6A 2SGEE 3BTGE 5A0CA 1GJ8B 3MH6A 5JBCS 1NFYA 2OC8A 2OC7A 2FWWA 1ZZZA 4JYTA 3SN8A 4TPYA 2VIQA 1CQQA 2NU2E 4WH8A 1VCWA 1BRAA 2ZC9H 5HKKD 3MU8A 5B6LA 1CHGA 2EQNA 3SV8A 1Y5AT 2PKSB 2ZDVH 1LVBA 2ZF0H 1C9PA 4MVNA 1H8DH 1A0JA 2PUQH 1LHDH 4X6NA 2G8TA 1J15A 1FY1A 2A4QA 3KF2A 2G4UA 3HPTB 2FI4E 4E7NA 3A7TA 5DPAA 1EASA 1MD8A 1P11E 1PPFE 4UFEH 5LPRA 3GYLB 4NGAH 1C5RA 4YXWD 1NBMD 2LNCA 1MTSA 3A88A 1VCPA 3F6UH 1GBAA 1VITG 1YLDA 1CVWH 3GCHC 5I25A 2OLGA 1GJ4H 5TCAA 1MABB 2F43B 2WPHS 1G30B 1TGTA 1MQ6A 1O5DH 8KME2 1V6DA 2BHGA 5JBBS 4MLFB 4OS1A 1GDNA 1XXDA 1UCYK 3F9EA 1Y3WA 5IDKA 5C2ZA 4FUBA 1TFXA 1XUGA 1P8VC 1YPHE 3F9FA 3KQ5A 3SBKA 2ZHDA 1NN6A 2UUYA 4ZXYH 1C1WH 2OUAA 2B0FA 1C1TA 2H5CA 1H1BA 1SQOA 4XBBA 1MU6B 2G55A 2RDLA 1TNGA 1UTJA 4GAWA 1O5EH 4CHAB 2GDEH 2Z7FE 4K60A 2PGBB 3SUDA 2GMTB 5A8ZA 4K3JA 2HLCA 3ZIAD 1FX0B 3BTTE 1QA7A 4O9VA 2CF9H 1C4U2 3SI3H 3Q76A 3TU7H 4X2VA 1SQRA 3FP7E 4JZFH 5DGJA 3GCOA 2BVXH 1MU8B 3F9GA 3VG8A 2XW9A 1ZTKA 1UTMA 1HXEH 3V3MA 2BDBA 3E91A 1O36A 4BXSA 1ETTH 2WSSD 1V2WT 2K8IA 3U28C 4OGYA 2FOAA 1KXFA 1N6YA 7KMEH 1K22H 3P8OA 1KXAA 1DY9A 3RC4A 1UCYH 1CT2E 3GDVA 4A92A 1ETSH 3T62A 1TNIA 2BQ6B 3OEED 4BNRA 1JIRA 3UTUH 4NA9H 1AZZA 1O2SA 2W6ID 1DDJA 1OYQA 2BD4A 3SNBA 1DXPA 3VFEA 4JZ1A 1HCGA 1O2ZA 1F7ZA 1V2KT 1FXYA 4IMQA 2W7SA 1O3AA 4NA8A 1SLWB 5JB8S 3S69A 2BD7A 3TPIZ 4MPWA 1EB2A 2O8WA 2GP9B 3RXIA 1C2LA 3ODDA 3BF6H 2K1QA 2Z9GA 3L3TA 1O3LA 3FAOA 3I78A 3SJ8A 1C5NH 4FUJA 1B5GH 3BTQE 2Q6FA 2A7CA 5G4BA 2AMPA 1IQLA 2FYRA 3RXBA 1D3DB 1ELEE 1IQFA 1T8MA 2O8UA 1C1RA 3OY6U 2BLVA 2ZGCA 2P94A 2YOLA 4YT7H 3GCHB 1C2MA 2C8YB 5FAHA 2FPZA 2XXLA 1BTZA 1H8ED 2AMDA 4FU9A 1V2LT 2QXJA 3HK3B 3QO6A 4X0WU 3AASA 2ZFSA 3OE7D 1GHAG 3QZQA 1AD8H 1P2JA 1AHTH 1EAWA 1UK4A 1G2LA 2R0KA 2EC9H 1GMHG 3TK9A 3PMJA 3T26A 2ZTXA 1UVOA 1MAYA 1O5BB 2Y6TA 3MMGA 2BOKA 3KHVA 1DPOA 4KTUA 3ZZ8A 1MTNB 1KLTA 4CHAC 3GDUA 1KY9A 3VB6A 3M3VA 3T5FH 4DIIH 5L30H 1TGSZ 2XC4A 1O39A 2YNBA 4O97A 4ABBA 3JZ2B 3PRBA 2ZCHP 2THFB 2TRMA 1V2RT 3AVZA 2P93A 2B7DH 1GPZA 1Y3UA 1TMTH 1MMJN 5EJ1A 1O2QA 1C9TA 2Q1JA 1FUJA 1GI1A 1GMHF 3EDXB 1IHTH 1ACBE 1E1RD 5IYTA 1TABE 3SJKA 2WUCA 1P57B 2O9QA 4DJZB 2BM2A 5SGAE 2QXHA 1J14A 4MQAA 3M61U 3WY8A 1LPZB 4IC5A 1GBMA 1QGFA 2ODYB 1S6FA 5JPMH 3U8TH 4KKDA 5A8YA 6GCHF 2XYAA 1WU1A 4NIYA 3LH1A 1SHHB 2O8LA
chains in the Genus database with same CATH topology
2WPKS 5FBEA 3SHAH 3OYPA 3KN2A 3ZVBA 1XVOA 1P04A 2VVCA 4B1TA 1CA0B 1FAXA 1VR1H 3GY6A 1DLEA 3Q3XA 3UWJH 1O2PA 2AH4X 2P3UB 1TX7A 2V6NA 1DT2A 4ZHMU 2ANYA 4FUFA 1JIMA 1FLEE 1QA0A 1Z1JA 1HAXB 1CE5A 1ZMLA 1GL0E 3RC5A 4ABEA 1QQUA 1P2IA 3SGBE 4Y7BA 4B75A 4GSOA 1NZQH 4YOIA 3DHKH 1ANDA 2FX4A 4JYUH 2ZECA 1LPKB 3DUXH 4WXIA 1Y3VA 5GXPA 4JZIA 4LXBH 3PTBA 4HI3A 1W7GH 4BAKB 1FDPA 1C5UA 1HYLA 1SPJA 3A85A 4I8LA 2A4RA 2YNAA 3OTJE 4BTIB 2ZFPH 3M37A 1SQTA 4DURA 2GCHG 2P16A 1B0FA 1C2JA 2PTCE 1UK2A 4ISLA 3HKIB 2A5AA 3UOPA 1S81A 1UVSH 2A5KA 1VCQA 1QHRB 1K28D 4XFQA 1D3QB 2ZFQH 5CMXH 1PQ5A 5K7RA 1JMOH 1TNKA 1OWJA 1TMUH 4X1RU 3SQHE 1LHEH 1C5XB 3UREA 1V2MT 4UEHH 3KQDA 2GV6A 1FN8A 1SB1H 1Z1IA 2Z6BD 3UNSA 2TPIZ 3RXKA 3P17H 2ANWA 4ABFA 2W3IA 1TNLA 1CBWC 3SJOA 4BAMB 3RXPA 1Z8RA 1HJ8A 5EQRA 1OYTH 4R8TB 2C8ZB 4SGBE 1O3PB 3GY4A 5F8ZA 3MO6A 3EA8A 3BTFE 1QL8A 4MDSA 5HYOA 4GVUA 5B6OA 3QX5H 4B71A 3MU5A 5AFZH 4UD9H 1GBEA 1HAHH 1W0ZU 3M36A 1BCUH 3A7ZA 1GJ9B 2UWOA 1AVXA 3CS7A 1S0RA 2FXRA 1QTFA 1XXFA 1TRMA 2R3UA 3HATH 1ELCA 4FXGH 3DFLA 2XBVA 3PWBA 3KCGH 1HJAB 1RIWC 4H4FA 2C4FH 3RM2H 1EOJA 3K9XB 4FVBA 1QBOA 3VXEH 1YYY1 4FUGA 1F5LA 2BD2A 1MKWH 3SV6A 3SZNA 5C1XA 4M7GA 2D1JA 3M7QA 1AFQB 1LO6A 2VB0A 3TH3H 1EOLA 1NFUA 1V2NT 1H9LB 2UUFB 4GHQA 1GBIA 1VGCB 1YP9A 5GWZA 2OC1A 4K1TA 3A81A 1TOMH 3E0NB 3ZVAA 1BRCE 3I29A 3IITA 1AN1E 3P92A 1QBVH 1GVLA 3E16B 1ELVA 2OCVB 1GHXH 2OTVA 2FX6A 1GJDB 1C4Y2 3STIA 1ZTLA 3HKJB 4GCHG 4SGAE 4BAOB 1C2DA 5E8EH 3JZ1B 1NRPH 4X8TH 4TPIZ 3QTOH 4AG1A 1EPTC 2RG3A 3M3SA 4X2XA 3C1KA 3SO3A 1DUAA 1GBCA 2EEKA 1PJPA 4IBLH 1Y59T 2AYWA 1GHZA 1C2GA 4OS2A 3V12A 1W14U 1NU7B 3S0NA 2GCTC 2FOFA 1SGCA 1AE5A 1BJVA 2CF8H 1TWXB 3SUEA 3U1IB 4NSVA 1GBJA 2D2DA 4UFDH 1YPMH 3GY7A 1BMMH 2FI5E 2A45B 3BTME 3LKWA 4AGJA 3LT3A 4ZHAA 4D8NA 2FI3E 1C5WB 2SGQE 1LPGB 2Z9JA 3DD2H 3SUFA 1HDTH 1A5IA 3STJA 2ZU3A 4KGAA 2J34A 1CGIE 2G81E 3BEUA 2OD3B 4U01A 1T8NA 4DIHH 5HM2A 2JH0D 4AGKA 2ZFFH 4NIXA 3B23B 1E36B 1GL1A 4Q7XA 3L6PA 1PPBH 2A2XH 2OP9A 1W11U 4AFUA 1K1NA 2F3CE 3RU4D 3RXFA 3AAVA 2R0LA 4Y71A 5A8XA 3GOVB 5AFYH 4DCDA 1SGEE 5TJXA 3EE0B 1KLJH 1XKBC 3PYHA 3RXRA 2M5TA 3RLYH 1PQ7A 3MNXA 1SLVB 2CV3A 2TGAA 2ZZUH 3IG6B 3S9BA 3TGJE 9LPRA 3UNRA 3SW2B 3OU0A 1SGFG 4JK5A 3ZZ6A 1CO7E 4MNWA 3ATKA 3RXGA 4CRAA 2A4GA 1VGCC 3O8CA 1O31A 1TPSA 1TX8A 4BTUB 3IWMA 2EI8A 1SFQB 3PROA 1AFEH 4K8BA 4NFEA 5T6DA 1RIWB 2XNIA 3RXVA 2WV4A 1MH0A 3U8OH 1ZHPA 1A46H 2KAIB 4A1VA 3RLWH 2R2WU 4XE4A 4X8SH 3BIUH 5EW1H 1TB6H 1TQ7B 2ANMH 4Y0ZE 3SQEE 8GCHF 2ODPA 1SR5C 1QRXA 4ABGA 1FPCH 1OKXA 1GHWH 1EZXC 4XBCA 2P3TB 3TIUA 1A5GH 1DY8A 2WV5A 2W5EA 5EXMA 2OQ5A 1LKAA 2A7JA 1QB1A 1HGTH 1FY8E 1O2UA 1N1LA 2FYQA 2ANKH 2Y7ZA 3VB3A 1GI7B 1EP6A 2A5IA 5DK1A 1CU1A 4NIWA 1GCTC 1ZHMA 2BY9X 5E0HA 1ELGA 1DWCH 4Y0YE 1YPJH 3B8JA 4ISHH 5DP8A 4OS7A 2AMQA 1YCPK 1G9IE 3TH2H 3ZZ3A 1TGCA 3RXLA 4GUXA 1ZGVA 1GBFA 1LVMA 1C4V2 1BRBE 3QTVH 1SC8U 4AX9H 1GHBG 5ESBA 1BRUP 3E3TA 1CHOF 3AW0A 1BA8B 3NK8A 4CH8B 1O2IA 1AKSB 2AEIH 1ABJH 1N8OC 3LPRA 1QURH 1W0YH 3DFJA 1BTWA 4YLUA 5F8XA 1TPAE 2PFEA 4WWYA 2VINA 3TK6A 3UPEA 3W95A 1EPTA 2WUBA 1MD7A 3BTWE 3MH5A 3SU6A 1AB9C 4F4OC 2RA0A 1WYKA 2STBE 4DG4A 2SNWA 3ATIA 3UY9A 5FPTA 5T6GA 1A7SA 2AIQA 2AGIX 2PKSC 2PKAA 1QJ7B 1TBQH 4JK6A 3NUMA 3PMAB 1RTLA 3MHWU 2GD4B 3LGIA 1GDQA 2I6QA 3MOCA 3ENSB 3ZZAA 5AVDA 2AGEX 1TE0A 4CBOA 1TRYA 2B8OH 3Q77A 3LJOA 5DP3A 1EJNA 4ZKSU 3GYMA 1O38A 4AFQA 2WPMS 1FMGA 1SHYA 5A0AE 4IGDA 3S7HB 3FANA 1GJCB 4IW4E 1C5PA 1EPTB 5DKMA 5A0BA 2VVVA 3LJJA 2H9EH 2BQWB 1DUEA 3KQCA 2F9PA 5C5OA 3A7VA 2BVRH 1A2CH 3RU4T 2HPQH 2FOEA 2Y81A 4WXVA 3RXHA 1KXBA 3L33A 3BN9A 4H6TA 5EG4A 3I77A 3TGIE 5FPYA 1QY6A 2BDGA 1ZRBA 1LHFH 2P59A 2D26C 3OY5U 3MNCA 1AY6H 1GJ6A 3SJ9A 2LPRA 1TIOA 4BXWA 1ZMJA 3DT0H 4UE7H 4K2YA 5CHAC 1UVUH 1GHAF 2CJIA 3MTYA 3T29A 2ZU1A 3M5NA 2ULLA 3O8DA 2BD8A 4OS6A 3N7OA 2RCEA 4ZH8A 1GBTA 3T25A 1S6HA 1QBNA 5C5NA 3TNTA 3TITA 4JYVH 1O2TA 1EZUC 3O8BA 1H9HE 5DP7A 3RMNH 1ANEA 2IOTA 1GBKA 1QCPA 3FFGA 1J8AA 2HPPH 5J4SA 1SGIB 5JBTA 1BMAA 1MKXK 2XWAA 2FEQH 4CR9A 4WVPE 3QLPH 3ZVFA 1SGFA 2AIPA 2J92A 1IQKA 4IN1A 2JETB 1BMLA 2GV7A 4LOYH 1ZGIA 2J95A 1OWHA 2Z9KA 1AMHA 1P9UA 4OS4A 1Y5BT 1Y3XA 1HAOH 1TONA 4I8KA 2ZU5A 1FIWA 1LHGH 4YOJA 5JBAS 2GCTB 1ZMNA 2ZHQH 3A8CA 3BTDE 1DXWA 1P09A 1ZPCA 2FZZA 1O2HA 3O8RA 2HNTE 1XUFA 3UUZA 4O03A 2AS9A 4ZKNU 4IS5A 1JBUH 1YCPM 2CMYA 1WQVH 1DICA 3TJNA 5C20A 5LPFA 2ZP0H 2BMGB 2F9UA 5HXFA 3G01A 1SFIA 1AE8H 4WMFA 5A09A 2HWLB 1OOKB 4ZROA 2NU3E 4DW2U 1GMDF 1TX6A 3FZZA 1DWDH 3PM3A 1AQ7A 3MH4A 1NM6A 4KTSA 3EQ0H 2G00A 3D23A 2IN2A 3GY8A 4ZXXH 1O30A 1TAWA 4WJG2 1QL9A 3TK5A 1Z8JB 3ZZDA 1SG8B 1GVZA 1ZJDA 1LKBA 2Z3EA 1C2EA 1UO6A 1Y8TA 4ABJA 3SV9A 3P8FA 5TCCA 3GISB 3VEQB 1QQ4A 2ZTYA 1AUTC 3SU3A 1OPHB 2PGQB 4LZ4B 2ILNA 2OINA 1G32B 2XCNA 4D76A 6ESTA 4NIVA 1NY22 4BTTB 2V35A 5E2OA 1YC0A 2P8OC 1BHXB 1ZYOA 3NWUA 2B5TB 4HGCA 1AUJA 1SGYE 4U2WA 1W7XH 2QF0A 1INCA 2UWLA 3RDZA 1XUJA 2BD3A 1LVOA 3VB5A 3GY3A 4X1QU 1LDTT 3GCTF 1GCDA 2UUKB 3FP6E 1TLDA 1MTNC 3ZVDA 1L1NA 1MKWK 4AB9A 2J38A 2ASUB 2IPHA 1K1PA 2XBXA 2ZFTA 2ZU4A 3R0FA 1W10U 1K1IA 1FJSA 1N6XA 2SGFE 2W3KA 3SJIA 3LIWA 3UFAA 1LQEA 1AWHB 2VWOA 2ZO3H 1HAYB 1BITA 1RS0A 1XUKA 3VPKA 4UFFH 3A8DA 4DY7B 2BTCE 1S84A 3SU0A 1ZTJA 4CREA 3KL6A 5L2YH 1MTWA 2XC0A 4E06H 2D8WA 3H7TA 5EODA 4BAQB 2WYJA 1N8OB 1YM0A 4YESB 1RGQA 4RSPA 2C90B 1NT1A 1FI8A 2P3FH 4YZUA 5EQSA 3E6PH 1KXCA 3ELAH 3LDXH 1LHCH 2PSXA 1YBWA 2HOBA 3A7XA 4IN2A 3A89A 3F9HA 1TGBA 5E0JA 4CBNA 4NG9H 3SNCA 2A2QH 1HJ9A 3B9FH 3MO3A 1T31A 5AHGH 3U8RH 1ZOMA 1AZ8A 4BAHB 2W7UA 1L1GA 4IMZA 3VB4A 2H6MA 2ZPRA 2GCHF 3E1XB 4FUHA 6GCHG 1EB1H 3RXOA 3P8GA 2ZGJA 3ZYDA 4ISNA 1U6QA 1W13U 1O3BA 4OS5A 4X6MA 2VU8E 1DITH 1NO9H 3KQEA 3VGCB 7GCHG 1F2SE 1O37A 1TA6A 3RUOA 4Q80A 4FVDA 1C2FA 3SGAE 1P0SH 3Q3YA 3BTEE 4I8GA 3PTNA 5GCHG 2TIOA 4CRBA 1T7CA 2Y80A 1ARCA 2WPJS 3FP8E 3ZV9A 1TPPA 1DOJA 1HNEE 2STAE 5I46H 3QZRA 3A80A 1YLCA 3URDA 3M35A 1BBRE 1J9CH 3PLPA 3QGNB 1GMCF 1P06A 1C5TA 2Z94A 4TY6A 4X2WA 3MYWA 4I8JA 3A8BA 5AF9H 4ZHLU 2VH6A 1HPGA 3LU9B 4MPVA 2VWLA 3T27A 1THSH 3V7TA 3K65B 3SOSA 2IJOB 2FS9A 5FX5A 5GCHF 4E7RG 1NU9A 5EOKA 1ARBA 1C5ZB 1KTTB 2EA3A 1SGDE 2Y5HA 2VGCC 1AB9B 2FIRH 3TJUA 1KIGH 1OX1A 2BLOA 2ALPA 5EQQA 2ZHFH 2JH6D 2FOMB 4JZDH 3U69H 2DE8A 4DOQA 3UR9A 1GWAA 4KP0A 3TLOA 1TBZH 1XUIA 2NU1E 2QYIA 2QIQA 1GJBB 1FY4A 4AZ2B 4WF8A 2ZPQA 1GI5A 4ZKOU 1W12U 1RD3B 4X1PU 1HAPH 3M7TA 5A2MH 1K21H 2ZQ1A 1PPEE 1KXEA 5EPNA 4Y8ZA 2SGDE 1MTVA 2OBOA 2ZDLA 4B2AA 1P05A 4A1TA 1OS8A 3K6YA 4LZ1H 3NZIA 1SOTA 2FDAA 3LGVA 1ID5H 3RXMA 4A5TS 5GJ4B 1C5MD 2J4IA 2CXVA 2C93B 4GHTA 3TGKE 3U9AH 1HAZB 3T28A 1A4WH 3KEEA 1C1SA 2Q6DA 1FAKH 4ZAEA 1LTOA 1T32A 2FO9A 4Y6DA 1D6RA 1T8OA 3F68H 1MBMA 1KYNA 1CGJE 3SGQE 3P95A 3NKKA 2SGAA 4MPXA 5FCRA 1MZDA 1XX9A 4Q2KA 1TALA 4X8UH 1L2EA 1ELAA 1O2YA 1VITH 2BD9A 2TGDA 1KXDA 1F0UA 1FY5A 3BSQA 4YT6H 4K5ZA 2ZQ2A 2FOCA 3ZZBA 3UOUA 4JMYA 3NXPA 3M3TA 4VGCC 1A3EH 1BQYA 4GPGA 3UNQA 2C8WB 1TPOA 1ELFA 3RU4E 2QXIA 2BYAX 2BDIA 1P3CA 2G4TA 5E2PA 1ORFA 4YOGA 2F9BH 4A6LA 2HNTC 1GI3A 2XCFA 3AAUA 4B74A 1QJ6B 1NRQH 2QXGA 3GCTG 2VVUA 1LCYA 1NRRH 2BDCA 5ABWA 3TH4H 3GY5A 1O2RA 1MUEB 2H5DA 1ESBA 1H4WA 1RTFB 5DG6A 5F03A 2A4OA 4O3TA 1Y3YA 2FM2A 1P2KA 3SNDA 3ZZCA 4ISIH 1LMWB 1IHSH 3A7YA 1HLTH 4MTBA 1BIOA 2QA9E 2BXTH 1DSTA 1BDAA 2P95A 3C27B 1PQ8A 4NWKA 1OWIA 2GZ7A 4INLA 5CE1A 2OQUA 2V3OH 3MU1A 2O8TA 4BOHA 1TOCB 3OX7U 4E05H 2UWPA 4FUDA 2ESTE 1A0LA 1QJ1B 2GVFA 1UCYE 1HAVA 3ATLA 1PPHE 2ZKSA 5DP4A 3A87A 1ANCA 1TNHA 3V0XA 1G36A 2VNTA 2Y5GA 3LH3A 3VGCC 3PO1C 3SU4A 1YCPH 1IQGA 2FESH 1TQ0B 4INHA 5HM9A 8GCHG 1DE7H 1WSSH 1HUTH 1EXFA 1W3CA 2HRVA 3KQBA 1BOQA 1UMAH 1THRH 2PKAB 1F0SA 3MFJA 2BLWA 3Q3KA 1G3BA 3BIVH 4Y8YA 3GDSA 2ZEBA 2NWNA 1E34B 1M9UA 5C1UA 1UK3A 1WUNH 2OC0A 1UTNA 1DANH 2GDDA 2BVSH 1CA8B 1O5FH 3QGJA 1K1JA 1NS3A 2Z3DA 1P03A 4BANB 1GDUA 1QB6A 1O3CA 1P02A 4X1NU 5FHTA 2H1UA 3ATWA 4MPUA 2ZGXH 1GI9B 2RA3A 1GG6C 1YPEH 1OP8A