5T6DA

2.10 a resolution structure of norovirus 3cl protease in complex with the dipeptidyl inhibitor 7l (hexagonal form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
174
Chain Sequence
HHHAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based exploration and exploitation of the S4 subsite of norovirus 3CL protease in the design of potent and permeable inhibitors.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Protease/protease inhibitor
molecule keywords Genome polyprotein
total genus 40
structure length 174
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t6dA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t6dA01
5DJ7A 1ABJH 4YOJA 2VVVA 1DSUA 1HAVB 2Z3CA 4K69A 4ABIA 4K2YA 5A0BA 1G2MA 3ZVBA 4BAHB 3LH3A 4BTTB 5L30H 1W7GH 3M61U 1DUEA 1PQAA 2ZDNA 2Z9IA 5I25A 1KLIH 1RTLA 3VXFH 1Q2WA 3GDSA 5EG4A 1GJ9B 1A0HB 4JK6A 4JZ1A 3HGPA 1KXDA 1LVMA 5E2PA 1YYY1 1INCA 3SNAA 2ZHQH 1K2I1 1DITH 3PM3A 2QXJA 3QO6A 1A5HA 5DP9A 1DICA 2ODQA 1O2LA 4MVNA 1ZHPA 4GAWA 3U9AH 1PPGE 4CRGA 1BB0B 1GJAB 3BSQA 5E2OA 2ZGBH 1PFXC 4UFDH 1GBDA 1SGQE 2JETB 2GX4A 5EGMA 4I33A 5F03A 1ELBA 1Z8GA 1BTWA 4LK4A 2ZZUH 3GY7A 2B7DH 3D23A 3RU4T 4CRDA 2QXIA 1P9SA 2TPIZ 4E05H 5E8EH 4B2AA 1TAWA 1ID5H 2H5CA 1KXEA 3EA9A 1BBRK 2FTLE 1G2LA 1ZPBA 1DFPA 1QA7A 1QL9A 2QV1A 2K1QA 3URDA 3RXCA 1Y5BT 5FPYA 1ANEA 4I8LA 1C1MA 4VGCB 1DT2A 1DXPA 2H1UA 2R3UA 2O8TA 3TVJB 2J4IA 1BJVA 4ABBA 1O3FA 2ZPSA 3MU0A 1F5LA 1KXFA 3LJOA 3QTVH 3QX5H 9ESTA 4E7RG 1RIWB 1O2TA 3RC4A 1P3EA 1GWAA 4MNVA 1GHVH 4TWWA 4MTBA 1L2EA 2IPHA 2HNTC 1C2MA 2Y82A 4NZQA 1UTNA 4NG9H 1W3CA 4X1QU 4CH2B 3OX7U 3RXAA 1P03A 1TGCA 2VWLA 4HGCA 2GMTB 1SB1H 4R0IA 3VEQB 2Z9LA 2FODA 1MAXA 2EEKA 1HAVA 2CV3A 1BRAA 1CGIE 3FP6E 1LHEH 2FX4A 1O34A 2AGGX 2SGQE 1K1MA 3PWBA 2OC0A 3DFJA 5HYOA 4NGAH 1FJSA 1O5DH 2VGCB 1ZTLA 2PUXB 3TNSA 2FM2A 1FI8A 3O8DA 1BRUP 2BXTH 1OX1A 1JRSA 2ILNA 1FY4A 4NWLA 1G9IE 2ZFTA 4B2BA 2YNBA 4DG4A 1F5KU 1SGRE 3W94A 1B7XB 1SQAA 2GT8A 3F9HA 2P93A 2ZA5A 3DUXH 1WTGH 4MDSA 1QRWA 1C5RA 1TX6A 5AVDA 1GDQA 1C5SA 2GP9B 1UCYE 1OWEA 1AUTC 1ZRBA 1TB6H 1P57B 2HNTE 3OSYA 1C5UA 4H4FA 1QQ4A 2A7CA 2NU1E 3D49H 1NC6A 3LGYA 1S84A 1CT0E 3RXIA 2BDHA 1RD3B 5LPRA 4FVDA 1XKAC 2OCVB 1BJUA 2YNAA 1YPLH 3PB1E 3ATIA 1DVAH 1HAZB 4NCYA 2BYAX 1HPGA 3A7VA 3SQEE 3RXFA 3SJIA 8KME2 1A5IA 1AB9C 2I6SA 2JH0D 3A83A 1O2XA 1IQLA 2BY8X 2BQWB 1TX8A 3ZV9A 2ZPRA 1GBFA 2ALPA 4DIIH 1Q3XA 1G36A 2Z9KA 1AD8H 2XWBI 1JOUB 1D6WA 1L1NA 1GHAF 4Y71A 1O2MA 2UUYA 1Y3WA 1C5LH 3RMMH 1CU1A 3TJOA 1JXPA 1THRH 4ISNA 2HGTH 5T6GA 1XXFA 2WPIS 3S7KB 2DE8A 1F0SA 4WH8A 1CSOE 1P2IA 2A31A 4ZHMU 1GCDA 4ZXYH 1SGEE 4Y11E 2ZKSA 2AGIX 1Z6JH 1F0UA 1FONA 6GCHG 2LPRA 5DK1A 2AEIH 1A0JA 1QB6A 5GPIB 2C8XB 1SBWA 2V3HH 1ELDE 1GBAA 2G00A 3SI3H 1ESBA 2GZ9A 3LC5A 7GCHG 1C1NA 2ZFRH 4UFFH 2UWPA 5GCHF 3MH5A 4UE7H 1EQ9A 1EOJA 1W13U 2ZFSA 3RXQA 1FMGA 4WWYA 1GG6C 2XC0A 4MPUA 4Y6DA 1GG6B 2BDBA 1DY8A 4RKOB 2PKSC 4X2VA 5DP3A 3QN7A 4A1VA 3HKJB 3KN2A 1SLVB 1EP5A 3ZZCA 4KKDA 1BUIA 4Y10E 3PTNA 1DSTA 1DE7H 3M35A 4Y0YE 2GV6A 3P8OA 4X0WU 1W14U 3GY3A 4DJZB 4HTCH 4JCNA 3K6ZA 1NRPH 3CP7A 1K1OA 2BY6X 2FLRH 1VGCC 2IN2A 1C4Y2 1VITG 4IBLH 1CA0B 1DLKB 1W12U 3A81A 4CBNA 3SUFA 2ZDKA 2ZCLP 3TGKE 3R3GB 1GHWH 2ZU2A 1S81A 3MHWU 1AVWA 1GHXH 1O39A 1G3EA 3NXPA 1DX5M 3NZIA 2Y6TA 2F91A 2FOAA 1BTXA 2PTNA 1DANH 5EXNA 1O0DH 1SLXB 1BTZA 1C2FA 1TNGA 3ATMA 3UY9A 4U2WA 2OTVA 1TX7A 1CBWC 2ZP0H 3ZVGA 4OGXA 4ISIH 5GJ4B 1MKWH 1ELAA 5DPAA 1IQJA 1IOEA 3RXPA 4AYVB 3VGCB 2V35A 4YTAA 3VB6A 4ESTE 3FZDA 4LXBH 1KTTB 3QK1A 1HAHH 2AMDA 4X8VH 4D9QA 3PTBA 3JZ1B 3NK8A 3SU0A 1WCZA 3GY6A 4AG2A 2AIPA 3CENA 1CHOF 2A7HA 3UNRA 1ELCA 1HIAA 3A80A 3C1KA 3TIUA 1GDNA 1GJBB 2SGPE 4KTSA 1G3BA 2FO9A 2ZU1A 2GTBA 1FN6A 2F9BH 1XVOA 2Z6BD 1V2KT 2PSXA 2FZZA 1O3LA 4R8TB 1KTSB 1SQTA 2IJOB 3VPKA 1LMWB 1J15A 3ZZ7A 1LQEA 3UQOA 1CE5A 1UCYH 1QB1A 2BD5A 4UD9H 1B5GH 1OOKB 3GY8A 3TJNA 3ZZ5A 1V2TT 5F8ZA 2QGRA 1J8AA 1ETTH 4WH6A 3NPSA 1F2SE 2GMTC 2M5TA 2HALA 3PMAB 3BTME 5L2ZH 2WUCA 5AF9H 3AW1A 3U8OH 3ZVCA 1YPEH 1BMMH 5GCHG 2A4GA 2Q6DA 3LOXA 2WYGA 4ABGA 3H7TA 4Q7YA 3RC6A 1K1IA 5CHAC 1MTVA 1O5BB 3E1XB 1DWBH 4X6PA 1O2IA 1O2ZA 2GZ8A 5E0HA 1O32A 3RXRA 1AE8H 1FIWA 4JYVH 5DP4A 1GBTA 1TPSA 5JB9S 6CHAB 1K21H 1LHFH 2QYIA 2OQ5A 1C5VA 1HXFH 3TPIZ 1P02A 3GISB 3P8NA 1ZHMA 1LO6A 2RA0A 5C5OA 1Z7KA 5F8XA 1SL3A 3SJ9A 2BD2A 1GI1A 1QY6A 2PV9B 3DD2H 1DUAA 3S7HB 5CHAB 2O9QA 4BXWA 1BRBE 3MI4A 2VNTA 3H7OA 1EZSC 1CGJE 5DP5A 1KIGH 3E0PB 2PW8H 2Z9GA 1TBZH 1EAXA 5FXLA 3SU3A 3M3TA 3RXMA 2BQ6B 4UFGH 2VIPA 1FZZA 3P92A 2ZNKH 1NO9H 4K1TA 1EKBB 2D1JA 1IQKA 1UCYK 1UK4A 1GI6A 1L4ZA 4AFUA 2SGAA 3BEFB 2BY7X 4B74A 3O8RA 3ZZDA 2H2ZA 4K1SA 1NFXA 2PWXA 1LKBA 3PWCA 2QCYA 1HAGE 1SGTA 5FX5A 4AYYB 1K1LA 2HPPH 3P6ZB 1TRYA 4XBCA 1O5CB 1RJXB 3ZVAA 2JH6D 2ZG0H 3RUOA 1XUGA 4ZKSU 2STBE 2TGAA 2A7JA 1ZJDA 4NFEA 5IYTA 1GCTC 1AZ8A 2O8WA 4WF8A 3RXLA 2XBXA 4TYDA 3RP2A 5DG6A 8LPRA 4SGBE 1O5EH 5ESBA 5C2ZA 1FQ3A 1YCPM 1E38B 1MH0A 4ZHAA 1MKWK 1GBBA 3EDXB 1PQ8A 2WPLS 2Y81A 1DY9A 1SSXA 3UNSA 2P59A 5C67A 4AFZA 1O37A 2V6NA 1BQYA 2J34A 1C1PA 2G52A 3PMBB 1CGHA 1X7AC 3ENSB 5J4SA 1C1OA 2G8TA 4ABHA 1QR3E 1FY5A 1AMHA 4IC5A 1P01A 2ZFQH 3SZNA 2AMQA 1FPHH 1PQ7A 3FP8E 2HLCA 3JZ2B 2O8LA 1YKTA 2BOHB 1TMBH 2VH0A 3A7ZA 1T8MA 3ODDA 1D3DB 3GCHC 2BDAA 3B8JA 1HCGA 1Y5AT 3ZZ4A 2VWOA 2J9NA 3I77A 3AAVA 5C5NA 1A7SA 1EJMA 3B9FH 3TJUA 1E0FD 4KTCA 8GCHF 2UUJB 4I31A 3SU1A 1S0RA 3A84A 4ZHLU 2A5IA 3BTWE 2BVSH 1ZTJA 2AS9A 2ZU5A 4K5ZA 1SQOA 7LPRA 3S69A 2PSYA 5AHGH 1DLEA 3MNSA 1EB2A 2CMYA 2W7SA 4DCDA 2PKSB 4CR5A 1RIWC 3I78A 2ULLA 3T25A 3RLWH 1GBCA 1QRXA 1C2LA 4ZMAH 7ESTE 1NY22 3L3TA 4KGAA 4UONA 4BAKB 2ZTXA 3OTJE 3Q3XA 3QGNB 4IN1A 4GLYA 2P8OC 3PYHA 2BTCE 2ZF0H 1DPOA 1ESTA 1SMFE 2CHAB 3PLPA 2BVRH 1DS2E 2BD9A 1MKXH 1PPCE 2WPJS 3D65E 4GCHG 4D7GA 4FUBA 3O8BA 1WYKA 2AGEX 1AO5A 4OS7A 4BAOB 5LH8A 2FPZA 1YCPK 7KMEH 2HPQH 2XXLA 1Y59T 3MO3A 1UHBA 4PROA 1NRRH 4Z6AH 1QL8A 2IOTA 4YT7H 1XUJA 1IQMA 4K8BA 4INLA 2BQ7B 1J14A 2UUKB 1O3AA 1T4VH 4FUJA 3SHAH 3M7UA 3UR6A 1QURH 1RXPA 1Y3YA 5FPTA 3RU4E 5JYIA 1ZPZA 3ZYEA 4DOQA 2XRCA 5T6FA 1T8NA 1O2VA 2ZFPH 1MCVA 1ZPCA 1NRQH 1UHBB 3D62A 4NWKA 1TGSZ 2RA3A 3AASA 1KDQB 1VGCB 4OS4A 1A3EH 4AGJA 1O2RA 1FUJA 2OBQA 2VH6A 3V0XA 1NROH 4ISHH 1HGTH 1UVSH 1TE0A 1BBRH 1TA6A 3M5NA 1GBJA 1Z8RA 3DHKH 4YOIA 5DKMA 2BLOA 1BHXF 4JK5A 1SGFG 2Y7ZA 4CH8B 3E8LA 1C1UH 5L6NH 4THNH 4JMYA 5DP8A 1C5NH 4I8GA 4BTUB 2C4FH 4YLUA 1NRSH 2ZGXH 3GDVA 2W3IA 1QL7A 1DDJA 3LGIA 4A7IB 1MAYA 2BX4A 1MQ5A 4CRBA 2PTCE 1O3KA 1THPB 1S82A 2VIDA 3A7TA 4Y79A 1F5RA 2BD3A 1ZMNA 2P16A 3BV9B 3EQ0H 1TBRH 4XBBA 3RXJA 2GCTB 3SJKA 6CHAC 1VR1H 3F9GA 3KGPA 2ZDMA 1DOJA 1C1SA 1OYQA 1QCPA 1SGIB 3NCLA 1GL0E 1CHOG 1MU8B 4X6MA 1BTUA 1AGJA 2SGDE 1YPKH 2Z7FE 4NA7A 1OWJA 1NN6A 1HAOH 4K3JA 1XUFA 2BDYA 2SNWA 1JRTA 3SQHE 2VU8E 1V6DA 2Z3EA 3QUMP 6LPRA 1AY6H 2ZDLA 4WXVA 1A0LA 1ZYOA 1ZZZA 2TGPZ 2AERH 2ANYA 3GCTF 3SJOA 3MOCA 3A89A 1HAIH 1P0SH 1AQ7A 1BA8B 2P95A 3SN8A 1EASA 1GJDB 4X8TH 1LPGB 4JZIA 2ZHFH 2Q1JA 2R2WU 4O3TA 3VFEA 4A1TA 3BTDE 3TJVA 1HUTH 3GY5A 1A1RA 1O2PA 2ALVA 2FI4E 3UWIA 2OLGA 1JWTA 2V3OH 2ESTE 3P8GA 4WVPE 1E37B 3MU8A 2KAIA 1O2OA 3V13A 1LVOA 5F6MA 1MZDA 5SGAE 1Q31A 1ARBA 1IHTH 3HKIB 1WQSA 1SC8U 4FUHA 1Y5UT 2PKAA 5C1XA 3SO3A 1BRCE 2BVXH 4IW4E 1EP6A 1C5OH 1DWDH 4AG1A 2G5VA 3L33A 3BTTE 5L2YH 1K1PA 5JDUB 2H5DA 1CQQA 1V2LT 1O2HA 5EW2H 1D3PB 2BB4A 3ITIA 2ZGCA 3TH4H 3QLPH 1MTNC 2FOBA 4DURA 1C2HA 1O3PB 1TWXB 1U6QA 2ZDVH 2PHBA 3KQCA 2W3KA 3U69H 1HJAB 2A2XH 2PUQH 3T26A 3SHCH 2JETC 1ZMJA 3EAJA 3SOSA 3CS7A 2PKAB 5HGGA 1GVKB 5I46H 2NU4E 3M3SA 1GI3A 2B9LA 2HRVA 1GDUA 4O3UA 1RTFB 3IG6B 1UTLM 4NZLA 3BG4B 5AFZH 1OS8A 3MTYA 4ABAA 2OXSA 1O2WA 2F9PA 1GPZA 1ELGA 1YLCA 3LONA 4IMZA 4UEHH 5BRRE 1CA0C 1BMNH 1UTMA 2ZU4A 1UK2A 1OWHA 6GCHF 1J17T 1MZAA 3BG8A 2D8WA 1A3BH 4KP0A 2G4UA 1TBQH 5JPMH 3FFGA 5HMAA 4YO9A 2AMPA 2VIOA 5IDKA 2ZQ2A 2B5TB 1AFQC 1YGCH 3BIVH 3M7TA 3SGBE 3PMHB 3TU7H 1K1NA 1NS3A 4B75A 2OINA 4MQAA 1QA0A 3MO6A 3ATLA 2BZ6H 1P2OA 3MU4A 3RM0H 3LGVA 3SU6A 2BDCA 4OS2A 1MBMA 2R0KA 4X2XA 3ZZAA 3SNEA 1TGNA 5B6OA 1UVUH 4B1TA 1GJ6A 4E06H 4XDEA 3SV9A 4DVAU 1YPJH 3ZZBA 3NWUA 1MKXK 1IQGA 4I7YH 2G4TA 2CXVA 1K1JA 3KNXA 2XCFA 5C1YA 4Q7XA 2VIQA 3SI4H 1O2UA 5JBCS 3A86A 1C5ZB 3Q3YA 1FPCH 4CHAC 2Z94A 3TK6A 3A7XA 1C2KA 2QAAA 3HATH 6ESTA 3FZZA 5ABWA 3IITA 2WPHS 4J1YA 2W5EA 1BBRE 1WU1A 4HFPB 2RDLA 4ISOA 2P3FH 3SJ8A 2VVCA 1OPHB 1JIMA 1WBGB 2FDAA 4H6SB 2GGVB 3RU4D 3T2NA 3N7OA 1UTQA 2XCNA 3K2UA 1K9OE 2FI3E 4ABJA 1QIXB 4U01A 3PO1B 1OWDA 3ELAH 1MCTA 1V2NT 3STIA 1BITA 1FAXA 4IN2A 3STJA 5FHTA 1ELFA 2R2MB 3KIDU 2ZWLH 1CT2E 3RXBA 5EQSA 5FPSA 1C2DA 4Y8YA 1P9UA 3F1SB 2VWNA 1HFDA 4RN6A 1P11E 1V2MT 2TIOA 5EU8A 4F49A 1GL1A 1GI8B 1V2JT 1XUKA 2BDGA 4DY7B 3RXEA 2J2UA 1VCWA 1ZMLA 3DFLA 1O3HA 3LPRA 4FUGA 2A4OA 2ASUB 5EXLA 2LNCA 1SG8B 1TQ0B 2G55A 3MFJA 3MO9A 3TH2H 1C5YB 1GI2A 3SORA 2Z9JA 1D6RA 3HPTB 1LHDH 2XC4A 3Q76A 4X2YA 1N6XA 1N8OB 1E36B 1PPFE 1BHXB 1C5PA 5JBTA 3RXHA 3RDZA 2QF3A 3ZZ3A 2H9HA 5FBIA 3P17H 3V12A 2ZPQA 1GMCG 4ABFA 3M5LA 2PGBB 4GHQA 1O3NA 1O2JA 3L6PA 1O3BA 3ODFA 3UIRA 1Z8JB 3QZQA 5A2MH 1O30A 3Q00A 2FOMB 1UTKA 5A0AE 4FUFA 1NT1A 1AWFH 3SV8A 3QTOH 3TLOA 1EZQA 2O8UA 4TWYA 2P8OB 2ZU3A 1KXAA 2OC8A 4X6NA 4BANB 4NIYA 4E7NA 1GGDC 1P2KA 2XC5A 3DT0H 2HWLB 1V2QT 1SGPE 3LT3A 4OS5A 3T28A 1GVZA 1TALA 2TGTA 1TGTA 2C90B 1GHZA 4FXGH 4U30A 4CREA 2VGCC 1Z1JA 1NM6A 1ANDA 4WXIA 4B76A 3KHVA 1G3CA 2Z3DA 1GGDB 1C4U2 1NU7B 3M5OA 4A1XA 4JZDH 1C2IA 1FY8E 4CBOA 2A45B 1TLDA 1ESAA 1P2MA 5G4BA 1ZOMA 1ZTKA 3UTUH 1P05A 1P2NA 1LVYA 1TFXA 3S9BA 2VWMA 1L0ZA 1GBLA 2BD7A 3BTEE 3NUMA 1WV7H 1O35A 3GYLB 1V3XA 3OU0A 2QN5T 1HB0B 3Q77A 1SR5C 1BMLA 1EZUC 1OYTH 1YPHC 2XTTB 1WQVH 1IQIA 1C9TA 4RSPA 2PLXA 3SGAE 1GCTB 3KQEA 3URCA 2OBOA 2FS9A 1UO6A 3UFAA 2ZI2H 4H6TA 1SGDE 4ABDA 3C27B 4DW2U 4TPYA 5K0HA 3MU5A 1GBMA 1TGBA 2BD4A 1WTHD 3A8AA 4IC6A 4ABEA 3FVFB 2ZGJA 1NFUA 1YM0A 3P70B 2F83A 3G01A 1QTFA 1XUIA 4K1EA 3K65B 5PTPA 1QFKH 1SI5H 1QJ7B 1ZSKA 2NWNA 5FAHA 4TY7A 1N8OC 4AN7A 3SUEA 3E0NB 1BTHH 4YOGA 1SHHB 3SV6A 4MPXA 1P3CA 3UOPA 5EPYA 1TMUH 2UWLA 1GMHG 1L1JA 3KQBA 1C2JA 3P8FA 1CO7E 2C3SA 1TA2A 2EI8A 3P95A 1ELVA 1IQEA 3E91A 3VGCC 4OS6A 3QDZB 3RM2H 1C5MD 1HRTH 4D9RA 1AFEH 5J4QA 4QT8C 1ETRH 4XOJA 1RGQA 5F8TA 1HNEE 1EOLA 4X1SU 4XSKU 4NA9H 5CE1A 2FOHA 1FY3A 1VCQA 1YPHE 3ZV8A 2F3CE 1F92A 1YC0A 2VJ1A 4ZKOU 1C5QA 3Q3KA 1D9IA 3OY5U 1C5WB 2BLVA 1NESE 3E3TA 1EZXC 1AU8A 1H1BA 1Z6EA 1AUJA 4B2CA 4YT6H 5EOKA 1TABE 2ZTZA 1OWKA 1P04A 4A92A 2BY5X 2Y5HA 1YP9A 2VIVA 1A5GH 3VB7A 1KXCA 1HV7A 5CMXH 1TNIA 4Q80A 3M36A 2QIQA 5EXMA 3ZYDA 1QBOA 4WMDA 2BM2A 1AKSA 2OC1A 1EX3A 1WUNH 1DWEH 1J16A 2BDIA 4BXSA 1PYTC 1S5SA 1H9IE 2CHAC 1LQDB 1J9CH 3FAOA 1K28D 1AE5A 3LGTA 4ZH8A 1ARCA 3TITA 5A0CA 1GJ7B 3DA9B 1NFYA 2SFAA 3BTFE 1LKAA 2Y5GA 1TPAE 1LPZB 4J2YB 2R9PA 1ABIH 3SW2B 3ZVDA 3BTGE 4JYUH 5EW1H 4UDWH 3AVZA 3QZRA 3ATWA 1NU9A 1C2EA 4TY6A 1BMAA 2ZEBA 1G30B 4GSOA 3TK9A 4XBDA 1RS0A 4BTIB 3TK5A 1V2PT 4INKA 5GDSH 4X1NU 1RRKA 1SGNE 3PLKA 3K6YA 5JB8S 2CJIA 1LPKB 1OXGA 4TPIZ 2FP7B 1HJ8A 4U32A 1GI5A 2FYQA 4X2WA 2OD3B 1O2NA 3M37A 5LPEA 3UQVA 1LTOA 3SNDA 1ZR0A 2DE9A 3HGNA 4NSVA 2WV5A 1TMTH 4Y8ZA 1FN8A 2XYAA 1TOMH 2ZO3H 2JKHA 2KAIB 3SUDA 1E34B 4YM9A 4FUDA 2NU3E 1H4WA 1O38A 2ZHDA 2CGAA 1CBWB 5K7RA 1MTWA 3RMOH 1T31A 1ZHRA 1O3DA 2A5AA 2FXRA 1ANBA 3OY6U 4MPVA 2G5NA 1LVBA 1C4V2 3GICB 1TONA 1O3OA 2D26C 1FLEE 1MTNB 2GD4B 4X1RU 9LPRA 1GJ4H 3A8BA 1SVPA 1FIZA 1OWIA 1P8VC 4ZROA 1XMNB 1A4WH 1L4DA 1UVTH 3LU9B 3AAUA 1KLJH 1HAXB 2XNIA 1MTUA 2GKVE 1A2CH 1ZSJA 3ATKA 5EQRA 1UTPA 3KCGH 3SU4A 1MTSA 1CHGA 1O3EA 1QRZA 1WOFA 3PO1C 3RMNH 3QWCH 4NIXA 1SHYA 1XM1A 1H9LB 1KSNA 1GI4A 2FTMA 1QBVH 3BEIB 1XVMA 1ACBE 2WYJA 2AYWA 4INHA 1JIRA 4F4OC 1FV9A 2QF0A 3B23B 5DO4H 3A8CA 2D2DA 3LH1A 1YF4A 1NFWA 3GY2A 2H6MA 4AB8A 5LGOA 2TBSA 2VIWA 4NSYA 5GXPA 3KQDA 1MU6B 2FOFA 2Y5FA 3HK3B 1ZRKA 1DXWA 3LGWA 2XWAA 3S9AA 1ETSH 3LDXH 1FAKH 1EB1H 1TRNA 3FANA 1MUEB 2G81E 5T6DA 2RG3A 1SOZA 1KXBA 3NKKA 2A4RA 4OGYA 3U1JB 1BOQA 2ZFFH 2OQUA 3FP7E 1B0EA 3QGJA 5TCAA 3RXGA 5A8XA 1GI9B 1PPBH 2FMJA 1JBUH 4X6OA 1VITH 2BD8A 1NPMA 2JH5D 1ELEE 3RXVA 2BXUH 4AZ2B 1GMDG 5ESTE 1EAUA 4LZ4B 3E6PH 1HXEH 2OUAA 1D3QB 2AIQA 1EPTA 1HAPH 1SLWB 1V2RT 4D8NA 1D4PB 2O8MA 4O9VA 3U8TH 2J92A 2FX6A 5EPNA 3MYWA 1O36A 4MNXA 2GCHG 5A09A 2ZDAH 4IMQA 1DM4B 1W7XH 2ZC9H 1AN1E 4NIWA 3RXTA 3RXUA 3MWIU 2GT7A 3GCOA 1JMOH 1BT7A 4I8HA 1S6FA 1XKBC 5FCKA 4ASHA 1TNHA 1TPOA 4JZFH 2J94A 5LPFA 2BZAA 3F68H 1O3IA 4M7GA 1ZJKA 3PROA 1MMJN 5DP7A 1TRMA 4GPGA 3MNBA 1BCUH 1W0YH 1AB9B 2RCEA 1AKSB 3BG4C 1NRNH 3EA8A 3RXSA 1GI7B 4NFFA 1P09A 1E35B 1NTPA 1GBKA 4MPWA 1ZGVA 3ZVEA 2EC9H 4WMFA 2AFQB 1V2ST 1LHGH 3F9FA 4FUIA 1F0RA 4FU8A 1AWHB 1QNJA 2EA3A 1GJ8B 1AVXA 1NZQH 3ZVFA 3F9EA 4GCHF 4OS1A 2CF9H 3GCNA 3BEUA 2J38A 5AFYH 3S9CA 1S6HA 3M3VA 4JZEH 1MQ6A 1G32B 4Q7ZA 3BTQE 4ZUHA 1A46H 1C1WH 1CA8B 1XUHA 2BOKA 4MLFB 3V7TA 2WUBA 1TNKA 1SFIA 3EYDA 3PV4A 3KL6A 2C8ZB 2ODYB 5DP6A 4AFQA 4AGKA 4Y0ZE 3HK6B 4O03A 5EODA 1H8DH 1Z71A 5HM2A 2FIRH 2I6QA 4Y8XA 1BZXE 2PGQB 4CRFA 4SGAE 1P12E 5JBAS 1EJAA 3A8DA 1Y8TA 2BMGB 4YZUA 1ELTA 1GVLA 1S0QA 1XXDA 1FNIA 2OP9A 1PPHE 3VXEH 2Q6GA 3A7YA 1GMCF 1ZGIA 1TOCB 1V2OT 1W10U 1Y3UA 4LZ1H 1GJ5H 2ZIQH 1O2YA 1VJ9U 1TNLA 1PPEE 4YLQH 8GCHG 3UOUA 3SV2H 1C5TA 3MH6A 1HYLA 1EAWA 2BLQA 1IQFA 4D7FA 4ZAEA 2J95A 1SGCA 3RLYH 1GHBF 2UUFB 1RFNA 2STAE 4GVUA 4FU7A 5T3HA 2XBWA 1ANCA 3SV7A 1KY9A 2F9UA 3SNBA 1OSSA 5ETXA 1M9UA 3LGUA 3LKWA 1GBHA 1GI0A 4MNWA 4MNYA 4CRAA 2WPKS 2VINA 2P94A 5FBEA 3O8CA 2GCTC 4I8JA 3MU1A 3PMJA 3IWMA 5TJXA 2NU0E 1IQNA 3T27A 1KLTA 3LC3A 3U1IB 1MD8A 3GYMA 1UJ1A 1THSH 1D3TB 2ODPA 2CN0H 1DWCH 2GV7A 1QHRB 4K8YA 3SGQE 1XX9A 1C9PA 2A5KA 1YPMH 3MNXA 3VB4A 2ZCHP 1OP2A 5DGJA 1UTJA 1GJCB 1LCYA 1IHSH 1KDQA 3V3MA 1C1VH 1YLDA 5H4IB 3A87A 2FESH 2A32A 2GVFA 1O31A 4B73A 4HI3A 1YBWA 3KF2A 1SFQB 1HBTH 3BIUH 2Y80A 1BTPA 2GZ7A 3K9XB 1WSSH 4A5TS 3BN9A 1O3JA 1OKXA 4Z0KA 1GMDF 5FCRA 1P2JA 4A6LA 1VCPA 2ANKH 1O5GH 4JYTA 2W7UA 3SU2A 1HJAC 1LHCH 4GUXA 3SU5A 3PLBA 4BOHA 1QBNA 2WPMS 2C8YB 4AB9A 1F0TA 4DGJA 2ZTYA 2NU2E 1AIXH 2FEQH 4BNRA 1GBEA 3EA7A 1YCPH 4CRCA 4X1PU 5JBBS 1GHAG 3I29A 2B8OH 1EXFA 2FLBH 1OP8A 2V0BA 1O33A 1UK3A 1KYNA 2VB0A 8ESTE 1EATA 4CHAB 3UNQA 1AVGH 3A88A 1Y3XA 3EE0B 3W95A 3A82A 4H42U 1O3GA 3MNCA 3SNCA 3U98H 2SGEE 3RXDA 4X8UH 2F9VA 1H9HE 1EPTB 2QC2A 3SUGA 4HZHA 2A0QB 3E90B 3UUZA 2C93B 1OP0A 1SGYE 2C8WB 3T29A 4YESB 2THFB 2W26A 2ANMH 1F7ZA 4FUCA 1V2VT 4WY3A 2HOBA 1RTKA 1UVPA 1V2UT 1BIOA 5A8ZA 5E0JA 3UWJH 4DIHH 2PFEA 4BAQB 4FU9A 2PR3A 5C3NA 1G37A 1HDTH 4WJG2 4B71A 4FVBA 4ISLA 5TCCA 1EPTC 4FUEA 1HLTH 3U8RH 1GHYH 2QA9E 4I32A 1SLUB 4DT7B 3M7QA 3TGJE 4AX9H 4X8SH 1W8BH 4AOQA 2R3YA 1CT4E 1BDAA 1C1QA 2WINI 2ZECA 1UVOA 4ZKNU 3A85A 2GDDA 1EUFA 1HJ9A 4VGCC 4XE4A 3T5FH 1A61H 4KELA 2H9TH 4K60A 1UTOA 1HIAB 2ANWA 1MD7A 3TNTA 2ZQ1A 1Y3VA 4ZXXH 4IGDA 5FX6A 2BLWA 1QQUA 1GBIA 3EGKH 3GOVB 4UFEH 3H5CB 3T62A 3BTHE 3R0FA 1GHBG 2FOGA 2SNVA 2BHGA 1H8IH 3VB5A 3LIWA 1O2SA 4RKJB 3VB3A 1B0FA 1FY1A 2QXGA 1N6YA 1N1LA 1W2KH 2UWOA 1YPGH 2ZHEH 1BTYA 1S83A 4ZKRU 4Y7BA 5EQQA 4KTUA 1T8LA 1O2GH 1PPZA 3TGIE 3MH4A 4I8KA 1P06A 3LJJA 3MMGA 2TGDA 3KEEA 1QJ6B 5HM9A 1G3DA 1T8OA 1EJNA 4CR9A 2A4QA 1CVWH 1TYNA 1QB9A 4NA8A 5C20A 1VZQH 3TH3H 1S85A 2G51A 3ZZ6A 1SPJA 1P10A 2FI5E 2XBYA 2FOCA 3RXOA 1T4UH 2R0LA 3M5MA 1FXYA 1PQ5A 5GIBA 1QJ1B 1TNJA 5A8YA 1ZLRA 2BX3A 1PYTD 1VITF 4AFSA 2OC7A 3SBKA 1P2QA 3GDUA 1O3CA 2FYRA 4O97A 3UR9A 2WV4A 1EAIA 1AHTH 5BPEA 3S0NA 1AI8H 1C1RA 1LDTT 2Q6FA 1TQ7B 4AORA 1Z1IA 2XW9A 2F9NA 3GCTG 1IQHA 2XBVA 1QGFA 2EI7A 1V2WT 3ZZ8A 4XFQA 3BTKE 3F6UH 1VJAU 4BAMB 1SGFA 1TIOA 1HAYB 1L1GA 4Y76A 1W0ZU 3E16B 4GHTA 2FS8A 3BF6H 1K22H 2VVUA 3UPEA 1UMAH 1C5XB 2ZCKP 2DUCA 3OYPA 1TPPA 3ESTA 1O3MA 4MG3A 1AZZA 2ZGHA 3UREA 2SGFE 1ORFA 1WAYB 2H9EH 2QY0B 3CS0A 1PJPA 4Q2KA 1C2GA 1C1TA 1T7CA 4Y7AA 3AW0A 4IS5A 2FWWA 4LOYH 7GCHF 3GCHB 5E0GA 1O2QA 2GCHF 2YOLA 3RMLH 2F9OA 2QXHA 2P3TB 3GY4A 2FOEA 1AFQB 4NIVA 3RXKA 3MH7A 2A2QH 2HVXA 2ZHWH 1IAUA 3RC5A 4D76A 1T32A 1ZSLA 3WY8A 1O5FH 5C1UA 1Z8IB 2A1DB 2Y7XA 2P3UB 2TRMA 1O2KA 2CF8H 2B0FA 1FDPA 2GDEH 1MBQA 1SOTA 1W11U 1GMHF 1O5AB 4WMEA 5GWZA 5HXFA 2AH4X 3ZZ9A 3A7WA 2HNTF 2EI6A 2BY9X
chains in the Genus database with same CATH superfamily
5DJ7A 1ABJH 4YOJA 2VVVA 1DSUA 1HAVB 2Z3CA 4K69A 4ABIA 4K2YA 5A0BA 1G2MA 3ZVBA 4BAHB 3LH3A 4BTTB 5L30H 1W7GH 3M61U 1DUEA 1PQAA 2ZDNA 2Z9IA 5I25A 1KLIH 1RTLA 3VXFH 1Q2WA 3GDSA 3F3BA 5EG4A 1GJ9B 1A0HB 4JK6A 2WHXA 4JZ1A 3HGPA 1KXDA 1LVMA 5E2PA 1YYY1 1INCA 3SNAA 2ZHQH 1K2I1 1DITH 3PM3A 2QXJA 3QO6A 1A5HA 5DP9A 1DICA 2ODQA 1O2LA 4MVNA 1ZHPA 4GAWA 3U9AH 1PPGE 4CRGA 1BB0B 1GJAB 3BSQA 5E2OA 2ZGBH 1PFXC 1VKYA 1GBDA 1SGQE 2JETB 4UFDH 2GX4A 5EGMA 4I33A 5F03A 1ELBA 1Z8GA 1BTWA 4LK4A 2ZZUH 3GY7A 2B7DH 3D23A 5T1VA 3RU4T 5FL7D 4CRDA 2QXIA 1P9SA 2TPIZ 4E05H 5E8EH 4B2AA 1TAWA 1ID5H 2H5CA 1KXEA 3EA9A 1BBRK 2FTLE 1G2LA 1ZPBA 1DFPA 1QA7A 1QL9A 2QV1A 2K1QA 3URDA 3RXCA 1Y5BT 5FPYA 1ANEA 4I8LA 1C1MA 4VGCB 1DT2A 1DXPA 2H1UA 3H09A 2LP6A 2R3UA 2O8TA 4Q4LA 3TVJB 2J4IA 1BJVA 4ABBA 1O3FA 2ZPSA 3MU0A 1F5LA 1KXFA 3LJOA 3QTVH 3QX5H 4FOUC 9ESTA 4E7RG 1RIWB 1O2TA 3RC4A 1P3EA 1GWAA 4MNVA 1GHVH 4TWWA 4MTBA 1L2EA 2IPHA 2HNTC 1YLNA 1C2MA 2Y82A 4NZQA 1UTNA 4NG9H 1W3CA 4X1QU 4CH2B 3OX7U 3RXAA 1P03A 1TGCA 2VWLA 4HGCA 2GMTB 1SB1H 4R0IA 4RT1A 3VEQB 2Z9LA 3DSPA 2FODA 1MAXA 2EEKA 1HAVA 2CV3A 1BRAA 1CGIE 3FP6E 1LHEH 2FX4A 1O34A 2AGGX 2SGQE 1K1MA 3PWBA 2OC0A 3DFJA 5HYOA 4NGAH 1FJSA 2JDID 1O5DH 2VGCB 1ZTLA 2PUXB 3TNSA 2FM2A 1FI8A 3O8DA 1BRUP 2BXTH 1OX1A 1K0HA 1JRSA 2ILNA 1FY4A 4NWLA 1G9IE 2ZFTA 4B2BA 2YNBA 4DG4A 1F5KU 1SGRE 3W94A 1B7XB 1SQAA 2GT8A 3F9HA 2P93A 2ZA5A 3DUXH 3ZIAD 1WTGH 4MDSA 1QRWA 1C5RA 1TX6A 4M9FA 5AVDA 1GDQA 1C5SA 2GP9B 1UCYE 1OWEA 1AUTC 1ZRBA 1TB6H 1P57B 2HNTE 3OSYA 2VBCA 1C5UA 4H4FA 1QQ4A 2A7CA 2NU1E 3D49H 1NC6A 3LGYA 1S84A 1CT0E 3RXIA 2BDHA 1RD3B 5LPRA 4FVDA 1XKAC 2OCVB 1BJUA 2YNAA 3DSOA 1YPLH 1COWD 3PB1E 3ATIA 1DVAH 1HAZB 4NCYA 2BYAX 1HPGA 4XD7D 3A7VA 3SQEE 3RXFA 3SJIA 8KME2 1A5IA 1AB9C 2I6SA 1OHHD 2JH0D 3A83A 1O2XA 1IQLA 2BY8X 2BQWB 1TX8A 3ZV9A 2ZPRA 1GBFA 2ALPA 4DIIH 1Q3XA 1G36A 2Z9KA 1AD8H 2XWBI 1JOUB 1D6WA 1L1NA 1GHAF 4Y71A 1O2MA 2UUYA 1Y3WA 1C5LH 3RMMH 1CU1A 3TJOA 1JXPA 5C0TA 1THRH 4ISNA 3PRDA 2HGTH 5T6GA 1XXFA 2WPIS 3S7KB 2DE8A 1F0SA 4WH8A 1CSOE 1P2IA 2A31A 4ZHMU 1GCDA 4ZXYH 1SGEE 4Y11E 2ZKSA 2AGIX 1Z6JH 1F0UA 1FONA 6GCHG 2LPRA 5DK1A 2K0QA 2AEIH 1A0JA 1QB6A 5GPIB 2C8XB 1SBWA 2V3HH 1ELDE 1GBAA 2G00A 3SI3H 1ESBA 2GZ9A 3LC5A 7GCHG 1C1NA 2ZFRH 4UFFH 2UWPA 5GCHF 3MH5A 4UE7H 1EQ9A 1EOJA 1W13U 2ZFSA 3RXQA 1FMGA 4WWYA 1GG6C 2XC0A 4MPUA 4Y6DA 1GG6B 2BDBA 1DY8A 4RKOB 2PKSC 4X2VA 5DP3A 3QN7A 4A1VA 3HKJB 3KN2A 1SLVB 1EP5A 3ZZCA 1SKYE 4KKDA 1BUIA 4Y10E 3PTNA 1DSTA 1DE7H 3M35A 4Y0YE 2GV6A 3P8OA 4X0WU 1W14U 3GY3A 4DJZB 4HTCH 4JCNA 3K6ZA 1NRPH 4Z1MD 3CP7A 1K1OA 2BY6X 2FLRH 1VGCC 2IN2A 1C4Y2 1VITG 4IBLH 1CA0B 1DLKB 1W12U 3A81A 4CBNA 3SUFA 2ZDKA 2ZCLP 3TGKE 1H8ED 3R3GB 1GHWH 2ZU2A 1S81A 3MHWU 1AVWA 1GHXH 1O39A 2YMSB 1G3EA 3NXPA 1DX5M 3NZIA 2Y6TA 2F91A 2FOAA 1BTXA 2PTNA 1DANH 5EXNA 1O0DH 1SLXB 1BTZA 4I86A 1C2FA 1TNGA 3ATMA 3UY9A 4U2WA 2YMSD 2OTVA 3F0PA 1TX7A 4XRNA 1CBWC 2ZP0H 3ZVGA 4OGXA 4ISIH 5GJ4B 5HKKD 1MKWH 1ELAA 5DPAA 1IQJA 2F43B 1IOEA 3RXPA 4AYVB 3VGCB 2V35A 4YTAA 3VB6A 4ESTE 4P02A 3FZDA 4LXBH 1KTTB 3QK1A 2GJGA 1HAHH 2AMDA 4X8VH 4D9QA 3PTBA 3JZ1B 3NK8A 3SU0A 2HVYB 1WCZA 3GY6A 4AG2A 2AIPA 3CENA 1CHOF 2A7HA 3UNRA 1ELCA 1HIAA 3A80A 3C1KA 3TIUA 1GDNA 1GJBB 2SGPE 4KTSA 1G3BA 2QF4A 2FO9A 2ZU1A 2GTBA 1FN6A 2F9BH 1XVOA 2Z6BD 1V2KT 2PSXA 2FZZA 1O3LA 4R8TB 1KTSB 1SQTA 2IJOB 3VPKA 1LMWB 1J15A 3ZZ7A 1LQEA 3UQOA 1CE5A 1UCYH 1QB1A 2BD5A 4UD9H 1B5GH 1OOKB 3GY8A 5DSFA 3TJNA 3ZZ5A 1V2TT 5F8ZA 2QGRA 1J8AA 1ETTH 4WH6A 3NPSA 1F2SE 2GMTC 2M5TA 2HALA 3KYGA 3PMAB 3BTME 5L2ZH 2WUCA 5AF9H 3AW1A 3U8OH 3ZVCA 1YPEH 1BMMH 5GCHG 2A4GA 2Q6DA 3LOXA 2WYGA 4ABGA 3H7TA 4Q7YA 3RC6A 1K1IA 5CHAC 1MTVA 1O5BB 3E1XB 1DWBH 4X6PA 1O2IA 1O2ZA 2GZ8A 5E0HA 1O32A 3RXRA 1AE8H 1FIWA 4JYVH 5DP4A 1GBTA 1TPSA 5JB9S 6CHAB 1K21H 1LHFH 3CNRA 2QYIA 2J98B 2OQ5A 1C5VA 1HXFH 3N7DA 3TPIZ 1P02A 3GISB 3P8NA 1ZHMA 1LO6A 2RA0A 5C5OA 1Z7KA 5F8XA 1SL3A 3SJ9A 2BD2A 1GI1A 1QY6A 2PV9B 3DD2H 1DUAA 3S7HB 5CHAB 2O9QA 4BXWA 3AK5A 1BRBE 3MI4A 2VNTA 3H7OA 1EZSC 1CGJE 5DP5A 1KIGH 3E0PB 2PW8H 2Z9GA 1TBZH 1EAXA 5FXLA 3SU3A 3M3TA 3RXMA 2BQ6B 4UFGH 2VIPA 1FZZA 3P92A 2ZNKH 1NO9H 4K1TA 1EKBB 2D1JA 1IQKA 1UCYK 1UK4A 1GI6A 1L4ZA 4AFUA 2SGAA 3BEFB 2BY7X 4B74A 3O8RA 3ZZDA 2H2ZA 4K1SA 1NFXA 2PWXA 1LKBA 3PWCA 2QCYA 1HAGE 1SGTA 5FX5A 4AYYB 1K1LA 2HPPH 3P6ZB 1TRYA 4XBCA 1O5CB 1RJXB 3ZVAA 2JH6D 2ZG0H 3RUOA 1XUGA 5DN6D 4ZKSU 2STBE 2TGAA 2A7JA 1ZJDA 4NFEA 5IYTA 1GCTC 1AZ8A 2O8WA 4WF8A 3RXLA 2XBXA 2K8IA 4TYDA 3RP2A 5DG6A 8LPRA 4SGBE 1O5EH 5ESBA 5C2ZA 1FQ3A 1YCPM 1E38B 1MH0A 1E1QD 4ZHAA 1MKWK 2JIZD 1GBBA 3EDXB 1PQ8A 2WPLS 2Y81A 1DY9A 1SSXA 3UNSA 2P59A 5C67A 4AFZA 1O37A 2V6NA 1BQYA 2J34A 3F2FA 1C1PA 2G52A 3PMBB 1CGHA 1X7AC 3ENSB 5J4SA 1E1RD 1C1OA 2G8TA 4ABHA 1QR3E 1FY5A 1AMHA 4IC5A 1P01A 2ZFQH 3SZNA 2AMQA 1FPHH 1PQ7A 3FP8E 3OFND 2HLCA 3JZ2B 2O8LA 1YKTA 2V3MA 2BOHB 1TMBH 2VH0A 3A7ZA 1T8MA 3ODDA 1D3DB 3GCHC 2BDAA 3B8JA 1HCGA 1Y5AT 3ZZ4A 2VWOA 2J9NA 3I77A 3AAVA 5C5NA 1A7SA 1EJMA 3B9FH 3TJUA 1E0FD 4KTCA 8GCHF 2UUJB 4I31A 3SU1A 1S0RA 3A84A 4ZHLU 2A5IA 3BTWE 2BVSH 1ZTJA 2AS9A 2ZU5A 4K5ZA 1SQOA 7LPRA 3OEHD 3S69A 2PSYA 5AHGH 1DLEA 3MNSA 1EB2A 2CMYA 2HLDD 2W7SA 4DCDA 2PKSB 4ZCNA 4CR5A 1RIWC 3I78A 2ULLA 3T25A 3RLWH 1GBCA 1QRXA 1C2LA 4ZMAH 7ESTE 1NY22 3L3TA 4KGAA 4UONA 5B6LA 4BAKB 2ZTXA 3OTJE 3Q3XA 3QGNB 4IN1A 4GLYA 2P8OC 3PYHA 2BTCE 2ZF0H 1DPOA 1ESTA 1SMFE 2KM0A 2CHAB 3PLPA 2BVRH 1DS2E 2BD9A 1MKXH 1PPCE 2WPJS 3D65E 4GCHG 4D7GA 4FUBA 3O8BA 2JJ1D 1WYKA 2AGEX 1AO5A 4OS7A 4BAOB 5LH8A 2FPZA 1YCPK 7KMEH 2AHME 2HPQH 2XXLA 1Y59T 3MO3A 1UHBA 4PROA 1NRRH 4Z6AH 1QL8A 2IOTA 4YT7H 1XUJA 1IQMA 4K8BA 4INLA 2BQ7B 1J14A 2UUKB 1O3AA 1T4VH 4FUJA 3SHAH 3M7UA 3UR6A 1QURH 1RXPA 1Y3YA 5FPTA 3RU4E 5JYIA 1ZPZA 3ZYEA 4DOQA 2XRCA 5T6FA 1T8NA 1H8HD 1O2VA 2ZFPH 1MCVA 1ZPCA 1NRQH 1UHBB 3D62A 4NWKA 1TGSZ 2RA3A 3AASA 1KDQB 1VGCB 4OS4A 1A3EH 4AGJA 1O2RA 1FUJA 2OBQA 2VH6A 3V0XA 1NROH 4ISHH 2WV9A 1HGTH 1WXRA 1UVSH 1TE0A 1BBRH 1TA6A 3M5NA 3OE7D 1GBJA 1Z8RA 3DHKH 4YOIA 5DKMA 2BLOA 1BHXF 4JK5A 1SGFG 2Y7ZA 4CH8B 3E8LA 1C1UH 5L6NH 4THNH 4JMYA 5DP8A 1C5NH 4I8GA 4BTUB 2C4FH 3OAAD 1NRSH 2ZGXH 3GDVA 4YLUA 2W3IA 1QL7A 1DDJA 3LGIA 4A7IB 1MAYA 2BX4A 1MQ5A 4CRBA 2PTCE 1O3KA 5EIYA 1THPB 1S82A 2VIDA 3A7TA 4Y79A 1F5RA 2BD3A 1ZMNA 4B6FA 2P16A 3BV9B 3EQ0H 1TBRH 4XBBA 3RXJA 2GCTB 3SJKA 4B6EA 1VR1H 3F9GA 6CHAC 3KGPA 3DCLA 2ZDMA 1DOJA 1C1SA 1OYQA 1QCPA 1SGIB 3NCLA 1GL0E 1CHOG 1MU8B 4X6MA 2V7QD 3DSGA 1BTUA 1AGJA 2SGDE 1YPKH 2Z7FE 4NA7A 1OWJA 3SYJA 4ACBA 1NN6A 1HAOH 4K3JA 1XUFA 2BDYA 2SNWA 1JRTA 3SQHE 2VU8E 1V6DA 2Z3EA 3QUMP 6LPRA 1AY6H 2ZDLA 4WXVA 1A0LA 1ZYOA 1ZZZA 2TGPZ 2AERH 2ANYA 3GCTF 3SJOA 3MOCA 3A89A 1HAIH 1P0SH 1AQ7A 1BA8B 2P95A 3SN8A 1EASA 1GJDB 4X8TH 1LPGB 2JJ2D 4JZIA 2ZHFH 2KCPA 2Q1JA 2R2WU 4O3TA 3VFEA 3BTDE 4A1TA 3TJVA 1HUTH 3GY5A 1A1RA 1O2PA 2ALVA 2FI4E 3UWIA 2OLGA 1JWTA 2V3OH 2ESTE 3P8GA 4WVPE 1E37B 5C17A 3MU8A 2KAIA 2KCYA 1O2OA 3V13A 1LVOA 5F6MA 1MZDA 5SGAE 1Q31A 1ARBA 1IHTH 3HKIB 1WQSA 1SC8U 4FUHA 1Y5UT 2PKAA 5C1XA 3SO3A 1BRCE 2BVXH 4IW4E 1EP6A 1C5OH 1DWDH 4AG1A 2G5VA 3L33A 3BTTE 5L2YH 1K1PA 5JDUB 2H5DA 1CQQA 1V2LT 1O2HA 5EW2H 1D3PB 2BB4A 3ITIA 2ZGCA 3TH4H 5KEDA 3QLPH 1MTNC 2FOBA 4DURA 1C2HA 1O3PB 1TWXB 1U6QA 2ZDVH 2PHBA 3KQCA 4Q63A 2W3KA 3U69H 1HJAB 2A2XH 2PUQH 3T26A 3SHCH 2JETC 1ZMJA 3EAJA 3SOSA 3CS7A 2PKAB 5HGGA 1GVKB 5I46H 2NU4E 2W6JD 3M3SA 1GI3A 2B9LA 2HRVA 1GDUA 4O3UA 4P00A 1RTFB 3IG6B 1UTLM 4NZLA 3BG4B 3FO8D 5AFZH 1OS8A 3MTYA 4ABAA 2OXSA 1O2WA 2F9PA 1GPZA 1ELGA 1YLCA 3LONA 4IMZA 4UEHH 5BRRE 1CA0C 1BMNH 1UTMA 2ZU4A 1UK2A 1OWHA 6GCHF 1J17T 1MZAA 3BG8A 2D8WA 1A3BH 2EY4C 4KP0A 2G4UA 1TBQH 5JPMH 3FFGA 5HMAA 4YO9A 2AMPA 2VIOA 5IDKA 2ZQ2A 2B5TB 1AFQC 1YGCH 3BIVH 3M7TA 3SGBE 3PMHB 3TU7H 1K1NA 1NS3A 4B75A 2OINA 4MQAA 1QA0A 3MO6A 3ATLA 2BZ6H 1P2OA 3MU4A 5F53A 3RM0H 3LGVA 3PV2A 2BDCA 3SU6A 4OS2A 1MBMA 3MQKC 2KCOA 2R0KA 4X2XA 3ZZAA 3SNEA 1TGNA 5B6OA 1UVUH 4B1TA 1GJ6A 4E06H 4XDEA 3SV9A 4DVAU 3PRBA 1YPJH 3ZZBA 3NWUA 1MKXK 1IQGA 4I7YH 2G4TA 2CXVA 1K1JA 3KNXA 2XCFA 5C1YA 4Q7XA 2VIQA 3SI4H 1O2UA 5EJ1A 5JBCS 3A86A 1C5ZB 3Q3YA 1FPCH 4CHAC 2Z94A 3TK6A 3A7XA 1C2KA 2QAAA 3HATH 6ESTA 3FZZA 5ABWA 3IITA 2WPHS 4J1YA 2W5EA 1BBRE 1WU1A 4HFPB 2RDLA 4ISOA 2P3FH 3SJ8A 1EFRD 2VVCA 1OPHB 3OEED 5KGOA 1JIMA 1WBGB 2FDAA 4H6SB 2GGVB 3RU4D 3T2NA 3N7OA 1UTQA 4RT0A 2XCNA 3K2UA 1K9OE 2FI3E 4ABJA 1QIXB 4U01A 3PO1B 1OWDA 3ELAH 1MCTA 5C0UA 1V2NT 3STIA 1BITA 1FAXA 4IN2A 3N99A 3STJA 5FHTA 1SQRA 1ELFA 2R2MB 1FX0B 3KIDU 4F48B 2ZWLH 1CT2E 3RXBA 5EQSA 5FPSA 1C2DA 4Y8YA 1P9UA 3F1SB 2VWNA 1HFDA 1E79D 4RN6A 1P11E 1V2MT 3EE7A 2TIOA 5EU8A 4F49A 1GL1A 1GI8B 1V2JT 1XUKA 2BDGA 4DY7B 3RXEA 2J2UA 2RDEA 1VCWA 1ZMLA 3DFLA 1O3HA 3LPRA 4FUGA 2A4OA 2ASUB 5EXLA 2LNCA 1SG8B 1TQ0B 2G55A 3MFJA 3MO9A 3TH2H 1C5YB 1GI2A 3SORA 2Z9JA 1D6RA 3HPTB 5EJZA 1LHDH 2XC4A 2IPQX 3Q76A 4X2YA 1N6XA 1N8OB 1E36B 1PPFE 1BHXB 1C5PA 5JBTA 3RXHA 3RDZA 2QF3A 3ZZ3A 2H9HA 5FBIA 3P17H 3V12A 2ZPQA 1GMCG 4ABFA 3M5LA 2PGBB 4GHQA 1O3NA 1O2JA 3L6PA 1O3BA 3ODFA 3UIRA 1Z8JB 3QZQA 5A2MH 1O30A 3Q00A 2FOMB 1UTKA 5A0AE 4FUFA 1NT1A 1AWFH 3W1EA 3SV8A 3FN8A 3QTOH 3TLOA 1EZQA 2O8UA 4TWYA 2P8OB 2ZU3A 1KXAA 2OC8A 4X6NA 4BANB 4NIYA 4E7NA 1GGDC 1P2KA 2XC5A 3DT0H 2HWLB 1V2QT 1SGPE 3LT3A 4OS5A 3T28A 3F0OA 1GVZA 1TALA 2TGTA 1TGTA 2C90B 1GHZA 4FXGH 4U30A 4CREA 3PV5A 2VGCC 1Z1JA 1NM6A 1ANDA 4WXIA 4B76A 3KHVA 1G3CA 2Z3DA 1GGDB 1C4U2 1NU7B 3M5OA 4A1XA 2WZQA 4JZDH 1C2IA 1FY8E 4CBOA 2A45B 1TLDA 1ESAA 1P2MA 5G4BA 1ZOMA 1ZTKA 3UTUH 1P05A 1P2NA 1LVYA 1TFXA 3S9BA 2VWMA 1L0ZA 1GBLA 2BD7A 3BTEE 3NUMA 1WV7H 1O35A 3GYLB 1V3XA 3OU0A 2QN5T 1HB0B 3Q77A 1SR5C 1BMLA 1EZUC 1OYTH 1YPHC 2XTTB 1WQVH 1IQIA 1C9TA 4RSPA 2PLXA 3SGAE 1GCTB 3KQEA 3URCA 2OBOA 2FS9A 1UO6A 3UFAA 2ZI2H 4H6TA 1SGDE 4ABDA 3C27B 4DW2U 3F2GA 4TPYA 5K0HA 3MU5A 1GBMA 1TGBA 2BD4A 1WTHD 3A8AA 4IC6A 4ABEA 1YY3A 3FVFB 2ZGJA 1NFUA 1YM0A 3P70B 2F83A 3G01A 1QTFA 1XUIA 4K1EA 3F2HA 3K65B 5PTPA 1QFKH 1SI5H 1QJ7B 1ZSKA 2NWNA 5FAHA 4TY7A 1N8OC 4AN7A 1YWUA 3E0NB 3SUEA 1BTHH 4YOGA 1SHHB 3SV6A 4MPXA 1P3CA 3UOPA 5EPYA 1TMUH 2UWLA 1GMHG 1L1JA 3KQBA 1C2JA 3P8FA 1CO7E 2C3SA 1TA2A 2EI8A 3P95A 2J98A 1ELVA 1IQEA 3E91A 3VGCC 4OS6A 3QDZB 3RM2H 1C5MD 1WDIA 1HRTH 4D9RA 1AFEH 5J4QA 4QT8C 1ETRH 4XOJA 1RGQA 5F8TA 1HNEE 1EOLA 4X1SU 4XSKU 4NA9H 5CE1A 2FOHA 1FY3A 1VCQA 1YPHE 3ZV8A 2F3CE 1F92A 1YC0A 2VJ1A 4ZKOU 1C5QA 3Q3KA 1D9IA 3OY5U 1C5WB 2BLVA 1NESE 3E3TA 1EZXC 1AU8A 1H1BA 1Z6EA 2J5UA 1AUJA 4B2CA 4YT6H 5EOKA 1TABE 2OK5A 3VG8A 2ZTZA 1OWKA 1P04A 4A92A 2BY5X 2Y5HA 1YP9A 2VIVA 1A5GH 3VB7A 1KXCA 1HV7A 2KFWA 5CMXH 1TNIA 4Q80A 3M36A 2QIQA 5EXMA 2L74A 3ZYDA 1QBOA 4WMDA 2BM2A 1AKSA 2OC1A 1EX3A 1WUNH 1DWEH 1J16A 2BDIA 2J97A 4BXSA 1PYTC 1S5SA 1H9IE 2CHAC 1LQDB 1J9CH 3FAOA 3NRLA 1K28D 1AE5A 3LGTA 4ZH8A 1ARCA 3TITA 4AC9A 1GJ7B 3DA9B 5A0CA 1NFYA 2SFAA 3BTFE 1LKAA 2Y5GA 1TPAE 1LPZB 2XOKD 4J2YB 2R9PA 1ABIH 3SW2B 3ZVDA 3BTGE 4JYUH 5EW1H 4UDWH 3AVZA 3QZRA 3ATWA 1NU9A 1C2EA 4TY6A 1BMAA 2ZEBA 1G30B 4GSOA 3TK9A 4XBDA 1RS0A 4BTIB 2WPDD 3TK5A 1V2PT 4INKA 5GDSH 4X1NU 1RRKA 1SGNE 2KCAA 3PLKA 3K6YA 5JB8S 2CJIA 1LPKB 1OXGA 4TPIZ 2FP7B 1HJ8A 4U32A 1GI5A 2FYQA 4X2WA 2OD3B 1O2NA 3M37A 5LPEA 3UQVA 1LTOA 3SNDA 1ZR0A 2DE9A 3HGNA 4NSVA 2WV5A 1TMTH 4Y8ZA 1FN8A 2XYAA 1TOMH 2ZO3H 2JKHA 2KAIB 3SUDA 1E34B 4YM9A 4FUDA 2NU3E 1H4WA 1O38A 2ZHDA 2CGAA 1CBWB 5K7RA 1MTWA 3RMOH 1T31A 3SZEA 1ZHRA 5HIYA 1O3DA 2A5AA 2FXRA 1ANBA 3OY6U 4MPVA 2G5NA 1LVBA 1C4V2 3GICB 1TONA 1O3OA 2D26C 1FLEE 1MTNB 2GD4B 4X1RU 2KR7A 9LPRA 1GJ4H 3A8BA 1SVPA 4ASUD 1FIZA 1OWIA 1P8VC 4ZROA 1XMNB 1A4WH 1L4DA 1UVTH 3LU9B 3AAUA 1KLJH 1HAXB 2XNIA 1MTUA 4FETA 2GKVE 1A2CH 1ZSJA 3ATKA 5EQRA 1UTPA 3KCGH 3SU4A 1MTSA 1CHGA 1O3EA 1QRZA 1WOFA 3PO1C 2M2AA 3RMNH 3QWCH 4NIXA 1SHYA 1XM1A 1H9LB 1KSNA 1GI4A 2FTMA 1QBVH 3BEIB 1XVMA 1ACBE 2AYWA 2WYJA 4INHA 1JIRA 4F4OC 1FV9A 2QF0A 3B23B 5DO4H 3A8CA 2D2DA 3LH1A 1YF4A 1NFWA 3GY2A 2H6MA 4AB8A 5LGOA 2TBSA 2VIWA 4NSYA 5GXPA 3KQDA 1MU6B 2FOFA 2Y5FA 5GNDA 3HK3B 1ZRKA 1DXWA 3LGWA 2XWAA 3S9AA 1ETSH 3LDXH 1FAKH 1EB1H 1TRNA 3FANA 1MUEB 2G81E 5T6DA 2RG3A 1SOZA 1KXBA 1NBMD 3NKKA 2A4RA 4OGYA 3U1JB 1BOQA 2KX4A 2ZFFH 5HIZA 2OQUA 3FP7E 1B0EA 3QGJA 5TCAA 3RXGA 5A8XA 1GI9B 2L6OA 1PPBH 2FMJA 1JBUH 4X6OA 1VITH 2BD8A 1NPMA 2JH5D 1ELEE 3RXVA 2BXUH 4AZ2B 1GMDG 5ESTE 1EAUA 4LZ4B 3E6PH 1HXEH 2OUAA 1D3QB 2AIQA 1EPTA 1HAPH 1SLWB 1V2RT 4D8NA 1D4PB 2O8MA 4O9VA 3U8TH 2J92A 2FX6A 5EPNA 3MYWA 1O36A 4MNXA 2GCHG 5A09A 2ZDAH 4IMQA 1DM4B 1W7XH 2ZC9H 1AN1E 4NIWA 3RXTA 3RXUA 3MWIU 2GT7A 3GCOA 1JMOH 1BT7A 4I8HA 1S6FA 1XKBC 5FCKA 4ASHA 1MABB 1TNHA 1TPOA 4JZFH 2J94A 5LPFA 2BZAA 3F68H 1O3IA 3N7EA 1ZJKA 3PROA 4M7GA 1MMJN 5DP7A 1TRMA 4GPGA 3MNBA 2QE7D 1BCUH 1W0YH 4YXWD 1AB9B 2RCEA 1AKSB 3BG4C 1NRNH 3EA8A 3RXSA 1GI7B 4NFFA 1P09A 1E35B 1NTPA 2XNDD 1GBKA 4MPWA 1ZGVA 3ZVEA 2EC9H 4RI0A 4WMFA 2AFQB 1V2ST 1LHGH 3F9FA 4FUIA 1F0RA 2CK3D 4FU8A 1AWHB 1QNJA 2EA3A 1GJ8B 1AVXA 1NZQH 3ZVFA 3F9EA 4GCHF 4OS1A 2CF9H 3GCNA 3BEUA 2J38A 5AFYH 3S9CA 1S6HA 3M3VA 4JZEH 1MQ6A 1G32B 4Q7ZA 3BTQE 4ZUHA 1A46H 1C1WH 1CA8B 1XUHA 2BOKA 4MLFB 3V7TA 2WUBA 1TNKA 1SFIA 3EYDA 3PV4A 3KL6A 2C8ZB 2ODYB 5DP6A 4AFQA 4AGKA 4Y0ZE 3HK6B 4O03A 5EODA 1H8DH 1Z71A 5HM2A 2FIRH 2I6QA 4Y8XA 1BZXE 2PGQB 4CRFA 4SGAE 1P12E 5JBAS 1EJAA 3A8DA 1Y8TA 2BMGB 4YZUA 1ELTA 1GVLA 1S0QA 1XXDA 1FNIA 2OP9A 1PPHE 3VXEH 2Q6GA 1BMFD 3A7YA 1GMCF 1ZGIA 1TOCB 1V2OT 1W10U 1Y3UA 3UB0A 4LZ1H 1GJ5H 2ZIQH 1O2YA 1VJ9U 1TNLA 1PPEE 4YLQH 8GCHG 4ACAA 3UOUA 3SV2H 1C5TA 3MH6A 1HYLA 1EAWA 3WWBA 2BLQA 1IQFA 4D7FA 4ZAEA 2J95A 1SGCA 3OTPA 1GHBF 2UUFB 3RLYH 3WWFA 1RFNA 2STAE 4GVUA 4FU7A 5T3HA 2XBWA 1ANCA 3SV7A 1UW7A 1KY9A 2F9UA 3SNBA 1OSSA 3KYFA 5ETXA 1M9UA 3LGUA 3LKWA 1GBHA 1GI0A 4MNWA 4MNYA 4CRAA 2WPKS 2VINA 2P94A 5FBEA 4HG6A 2F4LA 4DT4A 3O8CA 2GCTC 4I8JA 3MU1A 3PMJA 3IWMA 5TJXA 2NU0E 1IQNA 3T27A 1KLTA 3LC3A 3U1IB 1MD8A 3GYMA 1UJ1A 1THSH 1D3TB 2ODPA 2CN0H 1DWCH 2GV7A 1QHRB 4K8YA 3SGQE 1XX9A 1C9PA 2A5KA 1YPMH 3MNXA 3VB4A 2ZCHP 1OP2A 5DGJA 1UTJA 1GJCB 1LCYA 1IHSH 1KDQA 3V3MA 1S6LA 1C1VH 1YLDA 5H4IB 3A87A 2FESH 2A32A 2GVFA 1O31A 4OM9A 4B73A 4HI3A 1YBWA 3KF2A 1SFQB 1HBTH 3BIUH 2Y80A 1BTPA 2GZ7A 5CDFE 3K9XB 1WSSH 4A5TS 3BN9A 1O3JA 1OKXA 4Z0KA 1GMDF 5FCRA 1P2JA 4A6LA 1VCPA 2ANKH 1O5GH 4JYTA 2W7UA 3SU2A 1HJAC 1LHCH 4GUXA 3SU5A 3PLBA 4BOHA 1QBNA 2WPMS 2C8YB 4AB9A 1F0TA 5KECA 4DGJA 2ZTYA 2NU2E 1AIXH 2FEQH 4BNRA 1GBEA 3EA7A 1YCPH 4CRCA 4X1PU 5JBBS 1GHAG 3I29A 2B8OH 1EXFA 2FLBH 1OP8A 2V0BA 1O33A 1UK3A 1KYNA 2VB0A 8ESTE 1EATA 4CHAB 3UNQA 1AVGH 3A88A 1Y3XA 3EE0B 3W95A 1KMHB 3A82A 4H42U 1O3GA 3MNCA 3SNCA 3U98H 2SGEE 3RXDA 4X8UH 2F9VA 1H9HE 1EPTB 2QC2A 3SUGA 4HZHA 2A0QB 3E90B 3UUZA 2C93B 1OP0A 1SGYE 2C8WB 3T29A 4YESB 2THFB 2W26A 2ANMH 1F7ZA 4FUCA 1V2VT 4WY3A 2HOBA 1RTKA 1UVPA 1V2UT 1BIOA 5A8ZA 5E0JA 3UWJH 4DIHH 2PFEA 4BAQB 4FU9A 2PR3A 5C3NA 1G37A 1HDTH 4WJG2 4B71A 4FVBA 4ISLA 5TCCA 3WW7A 1EPTC 4FUEA 1HLTH 3U8RH 1GHYH 2QA9E 4F55A 4I32A 1SLUB 4DT7B 3M7QA 3TGJE 4AX9H 4X8SH 1W8BH 4AOQA 2R3YA 1CT4E 1BDAA 1C1QA 2WINI 2ZECA 1UVOA 5EJLA 4ZKNU 3A85A 2GDDA 1EUFA 2IJD1 1HJ9A 1W0JD 4VGCC 1A61H 4KELA 2H9TH 4XE4A 3T5FH 4K60A 1UTOA 1HIAB 2ANWA 1MD7A 3TNTA 2ZQ1A 1Y3VA 4ZXXH 4IGDA 5FX6A 2BLWA 1QQUA 1GBIA 3EGKH 3GOVB 4UFEH 3H5CB 3T62A 3BTHE 3R0FA 1GHBG 2FOGA 2SNVA 1QZ8A 2BHGA 1H8IH 3VB5A 4TT3D 3LIWA 1O2SA 4RKJB 3VB3A 1B0FA 1FY1A 2LELA 2QXGA 5C94A 1N6YA 1N1LA 1W2KH 2UWOA 1YPGH 2ZHEH 1BTYA 1S83A 4ZKRU 4Y7BA 5EQQA 4KTUA 1T8LA 1O2GH 1PPZA 4TSFD 3TGIE 3MH4A 2WSSD 4I8KA 1P06A 3LJJA 2YMSC 3MMGA 2TGDA 3KEEA 1QJ6B 5HM9A 1G3DA 1T8OA 1EJNA 4CR9A 2A4QA 1CVWH 1TYNA 5CHBA 1W0KD 1QB9A 4NA8A 5C20A 1VZQH 3TH3H 1S85A 2G51A 3ZZ6A 1SPJA 1P10A 2FI5E 2XBYA 2FOCA 3RXOA 1T4UH 2R0LA 3M5MA 1FXYA 1NBME 1PQ5A 5GIBA 1QJ1B 1TNJA 5A8YA 1ZLRA 2BX3A 3FOAA 1PYTD 1VITF 4AFSA 2OC7A 3SBKA 1P2QA 3GDUA 1O3CA 2FYRA 4O97A 3UR9A 2WV4A 1EAIA 1AHTH 5BPEA 3S0NA 1AI8H 1C1RA 1LDTT 2Q6FA 1TQ7B 4AORA 1Z1IA 2XW9A 2F9NA 3GCTG 1IQHA 3GS9A 2XBVA 1QGFA 2EI7A 1V2WT 3ZZ8A 4XFQA 3BTKE 3F6UH 1VJAU 4BAMB 1SGFA 1TIOA 1HAYB 1L1GA 4Y76A 1W0ZU 3E16B 4GHTA 2FS8A 3BF6H 1K22H 2VVUA 3UPEA 1UMAH 1C5XB 2ZCKP 2DUCA 3OYPA 1TPPA 3UAIC 3ESTA 5IK2D 1O3MA 4MG3A 1AZZA 2ZGHA 3UREA 2SGFE 1ORFA 1WAYB 2H9EH 2QY0B 3CS0A 1PJPA 4Q2KA 1C2GA 1C1TA 1T7CA 4Y7AA 3AW0A 4IS5A 2KZ4A 2FWWA 4LOYH 7GCHF 3GCHB 5E0GA 1O2QA 2GCHF 2YOLA 2RFKC 2PP6A 3RMLH 2F9OA 2QXHA 3FKSD 2P3TB 3GY4A 2FOEA 1AFQB 4NIVA 3RXKA 3MH7A 2A2QH 2HVXA 2ZHWH 1IAUA 2QF5A 3RC5A 4D76A 2W6ID 3U28C 1T32A 1ZSLA 3WY8A 1O5FH 5C1UA 3KQ5A 1Z8IB 2A1DB 2Y7XA 2P3UB 2TRMA 1O2KA 2CF8H 2B0FA 1FDPA 2GDEH 1MBQA 1SOTA 1W11U 1GMHF 1O5AB 4WMEA 5GWZA 5HXFA 2EQNA 2AH4X 3ZZ9A 3A7WA 2HNTF 2EI6A 2BY9X
chains in the Genus database with same CATH topology
5DJ7A 1ABJH 4YOJA 2VVVA 1DSUA 1HAVB 2Z3CA 4K69A 4ABIA 4K2YA 5A0BA 1G2MA 3ZVBA 4BAHB 3LH3A 4BTTB 5L30H 1W7GH 3M61U 1DUEA 1PQAA 2ZDNA 2Z9IA 5I25A 1KLIH 1RTLA 3VXFH 1Q2WA 3GDSA 5EG4A 1GJ9B 1A0HB 4JK6A 4JZ1A 3HGPA 1KXDA 1LVMA 5E2PA 1YYY1 1INCA 3SNAA 2ZHQH 1K2I1 1DITH 3PM3A 2QXJA 3QO6A 1A5HA 5DP9A 1DICA 2ODQA 1O2LA 4MVNA 1ZHPA 4GAWA 3U9AH 1PPGE 4CRGA 1BB0B 1GJAB 3BSQA 5E2OA 2ZGBH 1PFXC 4UFDH 1GBDA 1SGQE 2JETB 2GX4A 5EGMA 4I33A 5F03A 1ELBA 1Z8GA 1BTWA 4LK4A 2ZZUH 3GY7A 2B7DH 3D23A 3RU4T 4CRDA 2QXIA 1P9SA 2TPIZ 4E05H 5E8EH 4B2AA 1TAWA 1ID5H 2H5CA 1KXEA 3EA9A 1BBRK 2FTLE 1G2LA 1ZPBA 1DFPA 1QA7A 1QL9A 2QV1A 2K1QA 3URDA 3RXCA 1Y5BT 5FPYA 1ANEA 4I8LA 1C1MA 4VGCB 1DT2A 1DXPA 2H1UA 2R3UA 2O8TA 3TVJB 2J4IA 1BJVA 4ABBA 1O3FA 2ZPSA 3MU0A 1F5LA 1KXFA 3LJOA 3QTVH 3QX5H 9ESTA 4E7RG 1RIWB 1O2TA 3RC4A 1P3EA 1GWAA 4MNVA 1GHVH 4TWWA 4MTBA 1L2EA 2IPHA 2HNTC 1C2MA 2Y82A 4NZQA 1UTNA 4NG9H 1W3CA 4X1QU 4CH2B 3OX7U 3RXAA 1P03A 1TGCA 2VWLA 4HGCA 2GMTB 1SB1H 4R0IA 3VEQB 2Z9LA 2FODA 1MAXA 2EEKA 1HAVA 2CV3A 1BRAA 1CGIE 3FP6E 1LHEH 2FX4A 1O34A 2AGGX 2SGQE 1K1MA 3PWBA 2OC0A 3DFJA 5HYOA 4NGAH 1FJSA 1O5DH 2VGCB 1ZTLA 2PUXB 3TNSA 2FM2A 1FI8A 3O8DA 1BRUP 2BXTH 1OX1A 1JRSA 2ILNA 1FY4A 4NWLA 1G9IE 2ZFTA 4B2BA 2YNBA 4DG4A 1F5KU 1SGRE 3W94A 1B7XB 1SQAA 2GT8A 3F9HA 2P93A 2ZA5A 3DUXH 1WTGH 4MDSA 1QRWA 1C5RA 1TX6A 5AVDA 1GDQA 1C5SA 2GP9B 1UCYE 1OWEA 1AUTC 1ZRBA 1TB6H 1P57B 2HNTE 3OSYA 1C5UA 4H4FA 1QQ4A 2A7CA 2NU1E 3D49H 1NC6A 3LGYA 1S84A 1CT0E 3RXIA 2BDHA 1RD3B 5LPRA 4FVDA 1XKAC 2OCVB 1BJUA 2YNAA 1YPLH 3PB1E 3ATIA 1DVAH 1HAZB 4NCYA 2BYAX 1HPGA 3A7VA 3SQEE 3RXFA 3SJIA 8KME2 1A5IA 1AB9C 2I6SA 2JH0D 3A83A 1O2XA 1IQLA 2BY8X 2BQWB 1TX8A 3ZV9A 2ZPRA 1GBFA 2ALPA 4DIIH 1Q3XA 1G36A 2Z9KA 1AD8H 2XWBI 1JOUB 1D6WA 1L1NA 1GHAF 4Y71A 1O2MA 2UUYA 1Y3WA 1C5LH 3RMMH 1CU1A 3TJOA 1JXPA 1THRH 4ISNA 2HGTH 5T6GA 1XXFA 2WPIS 3S7KB 2DE8A 1F0SA 4WH8A 1CSOE 1P2IA 2A31A 4ZHMU 1GCDA 4ZXYH 1SGEE 4Y11E 2ZKSA 2AGIX 1Z6JH 1F0UA 1FONA 6GCHG 2LPRA 5DK1A 2AEIH 1A0JA 1QB6A 5GPIB 2C8XB 1SBWA 2V3HH 1ELDE 1GBAA 2G00A 3SI3H 1ESBA 2GZ9A 3LC5A 7GCHG 1C1NA 2ZFRH 4UFFH 2UWPA 5GCHF 3MH5A 4UE7H 1EQ9A 1EOJA 1W13U 2ZFSA 3RXQA 1FMGA 4WWYA 1GG6C 2XC0A 4MPUA 4Y6DA 1GG6B 2BDBA 1DY8A 4RKOB 2PKSC 4X2VA 5DP3A 3QN7A 4A1VA 3HKJB 3KN2A 1SLVB 1EP5A 3ZZCA 4KKDA 1BUIA 4Y10E 3PTNA 1DSTA 1DE7H 3M35A 4Y0YE 2GV6A 3P8OA 4X0WU 1W14U 3GY3A 4DJZB 4HTCH 4JCNA 3K6ZA 1NRPH 3CP7A 1K1OA 2BY6X 2FLRH 1VGCC 2IN2A 1C4Y2 1VITG 4IBLH 1CA0B 1DLKB 1W12U 3A81A 4CBNA 3SUFA 2ZDKA 2ZCLP 3TGKE 3R3GB 1GHWH 2ZU2A 1S81A 3MHWU 1AVWA 1GHXH 1O39A 1G3EA 3NXPA 1DX5M 3NZIA 2Y6TA 2F91A 2FOAA 1BTXA 2PTNA 1DANH 5EXNA 1O0DH 1SLXB 1BTZA 1C2FA 1TNGA 3ATMA 3UY9A 4U2WA 2OTVA 1TX7A 1CBWC 2ZP0H 3ZVGA 4OGXA 4ISIH 5GJ4B 1MKWH 1ELAA 5DPAA 1IQJA 1IOEA 3RXPA 4AYVB 3VGCB 2V35A 4YTAA 3VB6A 4ESTE 3FZDA 4LXBH 1KTTB 3QK1A 1HAHH 2AMDA 4X8VH 4D9QA 3PTBA 3JZ1B 3NK8A 3SU0A 1WCZA 3GY6A 4AG2A 2AIPA 3CENA 1CHOF 2A7HA 3UNRA 1ELCA 1HIAA 3A80A 3C1KA 3TIUA 1GDNA 1GJBB 2SGPE 4KTSA 1G3BA 2FO9A 2ZU1A 2GTBA 1FN6A 2F9BH 1XVOA 2Z6BD 1V2KT 2PSXA 2FZZA 1O3LA 4R8TB 1KTSB 1SQTA 2IJOB 3VPKA 1LMWB 1J15A 3ZZ7A 1LQEA 3UQOA 1CE5A 1UCYH 1QB1A 2BD5A 4UD9H 1B5GH 1OOKB 3GY8A 3TJNA 3ZZ5A 1V2TT 5F8ZA 2QGRA 1J8AA 1ETTH 4WH6A 3NPSA 1F2SE 2GMTC 2M5TA 2HALA 3PMAB 3BTME 5L2ZH 2WUCA 5AF9H 3AW1A 3U8OH 3ZVCA 1YPEH 1BMMH 5GCHG 2A4GA 2Q6DA 3LOXA 2WYGA 4ABGA 3H7TA 4Q7YA 3RC6A 1K1IA 5CHAC 1MTVA 1O5BB 3E1XB 1DWBH 4X6PA 1O2IA 1O2ZA 2GZ8A 5E0HA 1O32A 3RXRA 1AE8H 1FIWA 4JYVH 5DP4A 1GBTA 1TPSA 5JB9S 6CHAB 1K21H 1LHFH 2QYIA 2OQ5A 1C5VA 1HXFH 3TPIZ 1P02A 3GISB 3P8NA 1ZHMA 1LO6A 2RA0A 5C5OA 1Z7KA 5F8XA 1SL3A 3SJ9A 2BD2A 1GI1A 1QY6A 2PV9B 3DD2H 1DUAA 3S7HB 5CHAB 2O9QA 4BXWA 1BRBE 3MI4A 2VNTA 3H7OA 1EZSC 1CGJE 5DP5A 1KIGH 3E0PB 2PW8H 2Z9GA 1TBZH 1EAXA 5FXLA 3SU3A 3M3TA 3RXMA 2BQ6B 4UFGH 2VIPA 1FZZA 3P92A 2ZNKH 1NO9H 4K1TA 1EKBB 2D1JA 1IQKA 1UCYK 1UK4A 1GI6A 1L4ZA 4AFUA 2SGAA 3BEFB 2BY7X 4B74A 3O8RA 3ZZDA 2H2ZA 4K1SA 1NFXA 2PWXA 1LKBA 3PWCA 2QCYA 1HAGE 1SGTA 5FX5A 4AYYB 1K1LA 2HPPH 3P6ZB 1TRYA 4XBCA 1O5CB 1RJXB 3ZVAA 2JH6D 2ZG0H 3RUOA 1XUGA 4ZKSU 2STBE 2TGAA 2A7JA 1ZJDA 4NFEA 5IYTA 1GCTC 1AZ8A 2O8WA 4WF8A 3RXLA 2XBXA 4TYDA 3RP2A 5DG6A 8LPRA 4SGBE 1O5EH 5ESBA 5C2ZA 1FQ3A 1YCPM 1E38B 1MH0A 4ZHAA 1MKWK 1GBBA 3EDXB 1PQ8A 2WPLS 2Y81A 1DY9A 1SSXA 3UNSA 2P59A 5C67A 4AFZA 1O37A 2V6NA 1BQYA 2J34A 1C1PA 2G52A 3PMBB 1CGHA 1X7AC 3ENSB 5J4SA 1C1OA 2G8TA 4ABHA 1QR3E 1FY5A 1AMHA 4IC5A 1P01A 2ZFQH 3SZNA 2AMQA 1FPHH 1PQ7A 3FP8E 2HLCA 3JZ2B 2O8LA 1YKTA 2BOHB 1TMBH 2VH0A 3A7ZA 1T8MA 3ODDA 1D3DB 3GCHC 2BDAA 3B8JA 1HCGA 1Y5AT 3ZZ4A 2VWOA 2J9NA 3I77A 3AAVA 5C5NA 1A7SA 1EJMA 3B9FH 3TJUA 1E0FD 4KTCA 8GCHF 2UUJB 4I31A 3SU1A 1S0RA 3A84A 4ZHLU 2A5IA 3BTWE 2BVSH 1ZTJA 2AS9A 2ZU5A 4K5ZA 1SQOA 7LPRA 3S69A 2PSYA 5AHGH 1DLEA 3MNSA 1EB2A 2CMYA 2W7SA 4DCDA 2PKSB 4CR5A 1RIWC 3I78A 2ULLA 3T25A 3RLWH 1GBCA 1QRXA 1C2LA 4ZMAH 7ESTE 1NY22 3L3TA 4KGAA 4UONA 4BAKB 2ZTXA 3OTJE 3Q3XA 3QGNB 4IN1A 4GLYA 2P8OC 3PYHA 2BTCE 2ZF0H 1DPOA 1ESTA 1SMFE 2CHAB 3PLPA 2BVRH 1DS2E 2BD9A 1MKXH 1PPCE 2WPJS 3D65E 4GCHG 4D7GA 4FUBA 3O8BA 1WYKA 2AGEX 1AO5A 4OS7A 4BAOB 5LH8A 2FPZA 1YCPK 7KMEH 2HPQH 2XXLA 1Y59T 3MO3A 1UHBA 4PROA 1NRRH 4Z6AH 1QL8A 2IOTA 4YT7H 1XUJA 1IQMA 4K8BA 4INLA 2BQ7B 1J14A 2UUKB 1O3AA 1T4VH 4FUJA 3SHAH 3M7UA 3UR6A 1QURH 1RXPA 1Y3YA 5FPTA 3RU4E 5JYIA 1ZPZA 3ZYEA 4DOQA 2XRCA 5T6FA 1T8NA 1O2VA 2ZFPH 1MCVA 1ZPCA 1NRQH 1UHBB 3D62A 4NWKA 1TGSZ 2RA3A 3AASA 1KDQB 1VGCB 4OS4A 1A3EH 4AGJA 1O2RA 1FUJA 2OBQA 2VH6A 3V0XA 1NROH 4ISHH 1HGTH 1UVSH 1TE0A 1BBRH 1TA6A 3M5NA 1GBJA 1Z8RA 3DHKH 4YOIA 5DKMA 2BLOA 1BHXF 4JK5A 1SGFG 2Y7ZA 4CH8B 3E8LA 1C1UH 5L6NH 4THNH 4JMYA 5DP8A 1C5NH 4I8GA 4BTUB 2C4FH 4YLUA 1NRSH 2ZGXH 3GDVA 2W3IA 1QL7A 1DDJA 3LGIA 4A7IB 1MAYA 2BX4A 1MQ5A 4CRBA 2PTCE 1O3KA 1THPB 1S82A 2VIDA 3A7TA 4Y79A 1F5RA 2BD3A 1ZMNA 2P16A 3BV9B 3EQ0H 1TBRH 4XBBA 3RXJA 2GCTB 3SJKA 6CHAC 1VR1H 3F9GA 3KGPA 2ZDMA 1DOJA 1C1SA 1OYQA 1QCPA 1SGIB 3NCLA 1GL0E 1CHOG 1MU8B 4X6MA 1BTUA 1AGJA 2SGDE 1YPKH 2Z7FE 4NA7A 1OWJA 1NN6A 1HAOH 4K3JA 1XUFA 2BDYA 2SNWA 1JRTA 3SQHE 2VU8E 1V6DA 2Z3EA 3QUMP 6LPRA 1AY6H 2ZDLA 4WXVA 1A0LA 1ZYOA 1ZZZA 2TGPZ 2AERH 2ANYA 3GCTF 3SJOA 3MOCA 3A89A 1HAIH 1P0SH 1AQ7A 1BA8B 2P95A 3SN8A 1EASA 1GJDB 4X8TH 1LPGB 4JZIA 2ZHFH 2Q1JA 2R2WU 4O3TA 3VFEA 4A1TA 3BTDE 3TJVA 1HUTH 3GY5A 1A1RA 1O2PA 2ALVA 2FI4E 3UWIA 2OLGA 1JWTA 2V3OH 2ESTE 3P8GA 4WVPE 1E37B 3MU8A 2KAIA 1O2OA 3V13A 1LVOA 5F6MA 1MZDA 5SGAE 1Q31A 1ARBA 1IHTH 3HKIB 1WQSA 1SC8U 4FUHA 1Y5UT 2PKAA 5C1XA 3SO3A 1BRCE 2BVXH 4IW4E 1EP6A 1C5OH 1DWDH 4AG1A 2G5VA 3L33A 3BTTE 5L2YH 1K1PA 5JDUB 2H5DA 1CQQA 1V2LT 1O2HA 5EW2H 1D3PB 2BB4A 3ITIA 2ZGCA 3TH4H 3QLPH 1MTNC 2FOBA 4DURA 1C2HA 1O3PB 1TWXB 1U6QA 2ZDVH 2PHBA 3KQCA 2W3KA 3U69H 1HJAB 2A2XH 2PUQH 3T26A 3SHCH 2JETC 1ZMJA 3EAJA 3SOSA 3CS7A 2PKAB 5HGGA 1GVKB 5I46H 2NU4E 3M3SA 1GI3A 2B9LA 2HRVA 1GDUA 4O3UA 1RTFB 3IG6B 1UTLM 4NZLA 3BG4B 5AFZH 1OS8A 3MTYA 4ABAA 2OXSA 1O2WA 2F9PA 1GPZA 1ELGA 1YLCA 3LONA 4IMZA 4UEHH 5BRRE 1CA0C 1BMNH 1UTMA 2ZU4A 1UK2A 1OWHA 6GCHF 1J17T 1MZAA 3BG8A 2D8WA 1A3BH 4KP0A 2G4UA 1TBQH 5JPMH 3FFGA 5HMAA 4YO9A 2AMPA 2VIOA 5IDKA 2ZQ2A 2B5TB 1AFQC 1YGCH 3BIVH 3M7TA 3SGBE 3PMHB 3TU7H 1K1NA 1NS3A 4B75A 2OINA 4MQAA 1QA0A 3MO6A 3ATLA 2BZ6H 1P2OA 3MU4A 3RM0H 3LGVA 3SU6A 2BDCA 4OS2A 1MBMA 2R0KA 4X2XA 3ZZAA 3SNEA 1TGNA 5B6OA 1UVUH 4B1TA 1GJ6A 4E06H 4XDEA 3SV9A 4DVAU 1YPJH 3ZZBA 3NWUA 1MKXK 1IQGA 4I7YH 2G4TA 2CXVA 1K1JA 3KNXA 2XCFA 5C1YA 4Q7XA 2VIQA 3SI4H 1O2UA 5JBCS 3A86A 1C5ZB 3Q3YA 1FPCH 4CHAC 2Z94A 3TK6A 3A7XA 1C2KA 2QAAA 3HATH 6ESTA 3FZZA 5ABWA 3IITA 2WPHS 4J1YA 2W5EA 1BBRE 1WU1A 4HFPB 2RDLA 4ISOA 2P3FH 3SJ8A 2VVCA 1OPHB 1JIMA 1WBGB 2FDAA 4H6SB 2GGVB 3RU4D 3T2NA 3N7OA 1UTQA 2XCNA 3K2UA 1K9OE 2FI3E 4ABJA 1QIXB 4U01A 3PO1B 1OWDA 3ELAH 1MCTA 1V2NT 3STIA 1BITA 1FAXA 4IN2A 3STJA 5FHTA 1ELFA 2R2MB 3KIDU 2ZWLH 1CT2E 3RXBA 5EQSA