5T6DA

2.10 a resolution structure of norovirus 3cl protease in complex with the dipeptidyl inhibitor 7l (hexagonal form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
174
Chain Sequence
HHHAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based exploration and exploitation of the S4 subsite of norovirus 3CL protease in the design of potent and permeable inhibitors.
pubmed doi rcsb
molecule keywords Genome polyprotein
molecule tags Protease/protease inhibitor
source organism Norwalk virus
total genus 40
structure length 174
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t6dA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t6dA01
2EC9H 1S81A 4ZKOU 2QV1A 4K69A 3HKJB 1W0ZU 3BN9A 3KHVA 2AYWA 1NT1A 3MU5A 2VJ1A 3M61U 1RD3B 4E05H 2TPIZ 2D2DA 5SGAE 2CHAB 3TLOA 2BOKA 3SNBA 2G51A 4AYYB 3MNSA 1HV7A 3SO3A 3O8RA 1W7XH 3DT0H 4Q7YA 1SLUB 2Z3EA 1JIMA 2QXGA 1YGCH 3ZZ5A 4BANB 3MWIU 1GI3A 3GCOA 4YOGA 2OC0A 1QRWA 1EKBB 1S5SA 1CE5A 3EDXB 4JMYA 1QJ7B 1ZHRA 2ALPA 4AB8A 2LNCA 1VCWA 3C27B 2ZKSA 1LHCH 1EAWA 1V2QT 3TJVA 4ISNA 4FUJA 2ZGHA 4I31A 1ID5H 1GVKB 1UK3A 1EB2A 2J94A 1INCA 4DURA 1VGCC 1ZZZA 4KTUA 1QRXA 1UVUH 5FBEA 1C1RA 4B2AA 5FPTA 1LKBA 4I8GA 2STBE 1QCPA 4B71A 4CR9A 3NKKA 1OYQA 4LZ1H 2W3KA 5EQRA 1HRTH 1GHAF 2GD4B 3C1KA 4ZROA 1L4ZA 3M5NA 1P2IA 7LPRA 2A5IA 2FOAA 1HAOH 3GCHB 5PTPA 3ESTA 4O3TA 4NCYA 3IG6B 3SHCH 2ZGBH 2IN2A 4I8LA 1FN8A 5C20A 4HTCH 1AFEH 4LZ4B 2BQWB 1GHVH 2RCEA 4AFSA 1QRZA 2PSYA 1O3JA 1XUJA 1L4DA 2FP7B 1C5MD 1UCYK 1SGRE 4A7IB 1GBAA 1CHGA 1MKWK 1QA7A 2ZI2H 4FXGH 2PHBA 2CJIA 1BIOA 1CHOF 2JKHA 1CA0B 3QLPH 1EPTC 1FY1A 2J9NA 3MH7A 4FUHA 1GI5A 3L33A 5HMAA 1CBWC 1UTQA 1CQQA 3UR9A 1PPGE 1V2ST 1Z6EA 3FVFB 3EA7A 1RGQA 3MHWU 3BTDE 3ZZAA 5DKMA 1C1NA 1KIGH 2EI7A 1O5GH 1CGHA 1GDQA 1FY8E 2CN0H 3SV7A 3T2NA 1GBTA 1P2MA 4SGAE 1K1PA 5C5NA 1K22H 4O3UA 1DITH 4AG2A 8GCHF 1S6HA 2G4UA 1UJ1A 3RC5A 2RDLA 3QTVH 3RXIA 2PUXB 2B9LA 2XC4A 1G3CA 1TAWA 2GT8A 1GGDC 3VPKA 3U1JB 3MI4A 4X8SH 3SJKA 2ULLA 2FEQH 2TGPZ 1C5SA 4R0IA 1PPEE 2B0FA 4Y8YA 7GCHF 1MD8A 5E2PA 1P2JA 1W12U 3LC3A 1O31A 3SJ9A 2C8XB 4H6TA 1O3PB 1OPHB 3KEEA 3JZ1B 4K3JA 1TGCA 4ESTE 2FOEA 2G00A 5DP7A 3SU5A 1NU7B 2VU8E 2HPPH 5A8XA 1CT4E 1FJSA 5GPIB 1EOJA 4UONA 2I6QA 1SLXB 6LPRA 1Y3XA 2OC8A 3RXQA 4LOYH 1AE5A 1ELCA 2FTLE 1MKXK 2Y6TA 1JXPA 3E1XB 4FUGA 3MU1A 1TBQH 3MH4A 4OS5A 1S82A 1SGTA 2ZGJA 1S83A 1CHOG 2PUQH 1O2UA 4ABGA 1EQ9A 1TRYA 3B8JA 1GL1A 1BBRH 3NXPA 1E38B 3LGWA 1MCVA 4Y7AA 3GCTF 4ASHA 2FLBH 2BDYA 5I25A 3K2UA 1GCTB 1O2VA 2FS8A 5DK1A 1P9UA 3SHAH 4CRBA 1BITA 5EPNA 2ZU4A 1C1PA 5JYIA 1FPCH 2BLVA 1HJAB 1KLJH 2G5VA 3MTYA 1XUHA 2ZU5A 3STIA 8GCHG 2IOTA 2PGQB 5DP3A 4O97A 3HGPA 1B7XB 1GJ5H 3P95A 1NRNH 3RXBA 3SU2A 4ZMAH 2BD7A 1MZDA 4SGBE 3M3SA 2M5TA 4U32A 5K7RA 4CHAC 4WXIA 1WTHD 2BD9A 3VXFH 5L2YH 1P12E 4IMZA 2Z3CA 4U01A 1UVPA 2VVVA 3DHKH 2HOBA 1BRBE 1PQ7A 4Y7BA 5F8XA 3F68H 4J2YB 2P93A 3T29A 3I78A 3BTQE 1DOJA 4OGYA 1ZSJA 2FO9A 3SUFA 3UFAA 1C9PA 1QURH 1BB0B 3L3TA 3RLYH 1GI9B 5EXLA 4UFFH 1GHWH 3SOSA 2VIQA 3SV6A 4IC6A 1G37A 5FBIA 4ABJA 6GCHF 1VITF 2FYRA 1AB9C 1VR1H 2EA3A 1HDTH 2XCFA 2OTVA 4YZUA 1SBWA 2D8WA 3T28A 3D65E 4UD9H 2BZAA 1IQGA 1NFYA 1B0FA 2A7JA 1A0HB 1AFQC 1GDNA 1UTKA 1F5LA 3UTUH 1MTNC 4PROA 2V3OH 1OSSA 4ZKNU 1LKAA 3GCTG 1DX5M 4H4FA 1S84A 3ZZ6A 1MAXA 3AW1A 4DIHH 1O2SA 1HAHH 3E90B 4WY3A 3KF2A 4ZHLU 1HJ9A 3RXVA 3KIDU 2FM2A 2XBXA 3P8FA 2PR3A 2BXUH 3LGIA 1B0EA 4GUXA 2FLRH 3TU7H 3PMHB 1IQHA 1O2GH 1BUIA 3FFGA 1P04A 1MUEB 1G30B 4NG9H 5EW1H 4B75A 2ASUB 1V3XA 1YPKH 4MQAA 1TFXA 3DFLA 3QUMP 1ZJKA 1NU9A 1P9SA 3PTBA 1C1SA 1MMJN 1O3HA 1Q3XA 1KTSB 4X1SU 1ABJH 1YPHC 4IS5A 3AAVA 2HNTC 2ZDVH 4GAWA 1SSXA 3A86A 2A4GA 3U8RH 1GVZA 2XWAA 5FX6A 1PFXC 1CO7E 2PW8H 3U98H 2F9VA 3STJA 3LKWA 1E0FD 1P2KA 2VIPA 1Y5AT 3ATKA 1PYTD 1SGDE 2FODA 1P2OA 1GWAA 2STAE 5DP9A 3SORA 5EPYA 1ZSKA 4CBOA 1D4PB 4ZH8A 2BD8A 1UVTH 2A2QH 1AI8H 2BY5X 1SGNE 2AH4X 3FAOA 4K1EA 1NO9H 3DD2H 1UCYH 2BD4A 3AVZA 4THNH 1O3CA 3LIWA 1VITG 3MNBA 2ANKH 1TNKA 1SL3A 3V13A 3GY4A 2BHGA 1TX7A 2H1UA 4NIVA 3GY6A 1DS2E 4MTBA 4MPUA 1BBRE 1AVGH 2SGQE 1C5OH 1S0QA 1C5VA 1YP9A 2J2UA 1TYNA 1GCDA 3HKIB 1UHBB 2FOGA 3FZDA 2F91A 2GDEH 4MPWA 5DGJA 2W26A 4Q7ZA 1DT2A 5TJXA 4NFFA 1J17T 1Z8GA 2XW9A 1ZHPA 1OP8A 3FP6E 4RKOB 3UNRA 5T6DA 1K1JA 1AHTH 5IYTA 1G2MA 1C5ZB 3KN2A 2F83A 4B73A 4DCDA 1L0ZA 1QJ1B 4Y76A 1F5RA 1B5GH 5TCAA 1GBFA 2Z9IA 1QBNA 3LJOA 1MU8B 3SW2B 2P95A 2ANWA 5EQSA 2DE8A 5FPYA 3URDA 1W14U 1OWEA 3SNAA 2J92A 1BTZA 4I8KA 3A89A 1LVBA 4IN2A 1A3BH 3UNSA 3VGCC 1ELAA 2ZA5A 2JH5D 1P11E 2XXLA 3UREA 1J8AA 2YNAA 4HZHA 2QY0B 5C5OA 2OUAA 2XYAA 2ODPA 1V2NT 4ABAA 3P6ZB 4KP0A 2UWLA 1HB0B 1G3BA 3A7YA 3Q76A 1BZXE 2AEIH 1J15A 3ENSB 3S9AA 1MKXH 1W8BH 2XWBI 1IQLA 4CH8B 3WY8A 1GHBF 1KDQB 2ZCKP 1RXPA 1P02A 2AIQA 1J14A 6CHAB 1DXWA 1IQKA 4QT8C 4OGXA 2P94A 1D3DB 2QA9E 2SGDE 5L6NH 5A0CA 4K5ZA 5DP8A 3M36A 1EPTB 1RTKA 1GHZA 2HRVA 4WMEA 2ZWLH 1CBWB 3F6UH 3BTGE 2GX4A 1XUKA 1MBQA 3RDZA 2J95A 1BOQA 1GVLA 5FPSA 4AORA 3BTTE 4XBCA 1A7SA 1O2QA 1E35B 2C8WB 5BPEA 4ZKRU 5AHGH 4BOHA 4CRGA 1NZQH 1YM0A 3HK6B 2Y82A 2XNIA 3ZVCA 3U9AH 2ANMH 3H5CB 1HGTH 2XBYA 2VWNA 4MLFB 3F9EA 2AGEX 1IAUA 2GMTB 1TMBH 3NWUA 3V12A 1TPOA 4UFDH 1KXBA 1K21H 3BEFB 3D49H 4BXSA 1ETRH 5BRRE 1BRCE 1XKAC 1O2MA 1JOUB 4YLUA 1MTSA 1GGDB 2ZECA 1AO5A 2G4TA 2JH0D 4O9VA 1SQOA 3UQOA 2OC7A 3KQCA 1T4UH 1OP2A 1KXFA 4CBNA 1XVMA 4NA7A 4FU7A 2F3CE 5K0HA 3MU0A 1K9OE 5DP4A 2CGAA 4WVPE 1QIXB 1OWHA 1RIWC 2BX3A 1JRSA 4FU9A 1TPSA 4D7GA 4JK5A 3S69A 3ATMA 4IGDA 5C1YA 4ZXXH 3NZIA 3P17H 2QGRA 3LGUA 1P06A 4YOJA 1QA0A 3LPRA 1HUTH 1GBBA 4X2WA 4Y0ZE 1WQSA 2BDGA 1GHBG 1SOZA 1DWBH 2FESH 1TOMH 3ZZ9A 1YPJH 4D9RA 3T25A 4DVAU 1HIAB 4OS6A 1E36B 1LHDH 1CVWH 2ZCHP 1VJAU 1QNJA 2G55A 2EI8A 1KXDA 2H9HA 1SLWB 2IJOB 4MNXA 3TH4H 2OD3B 1O2JA 2Z9GA 1N6YA 3GISB 1BHXB 1GBKA 4NSYA 2VH0A 2CF8H 2GCTC 3NUMA 1GI6A 2SGAA 1NPMA 5HGGA 4FUBA 4RSPA 3I77A 8LPRA 1V2OT 1AWHB 1QR3E 3ZZ7A 1PPFE 2R0LA 1O5FH 2OQ5A 2PWXA 1O0DH 4AYVB 3LGYA 1EASA 1BTPA 9ESTA 4CHAB 3SNEA 3ZZ4A 2UUKB 2BDBA 4A1TA 1A5IA 4IC5A 1YF4A 1EJNA 1GHXH 4Q80A 1QHRB 2OBQA 1ACBE 1TQ7B 1TMTH 4BAOB 2P3TB 1P3EA 1TE0A 4A92A 3K6ZA 3RM2H 4D9QA 1HYLA 2NU1E 1MCTA 1P2QA 1F0TA 1L1JA 3FANA 1OKXA 5ETXA 2F9BH 2V6NA 1SGQE 5GDSH 5LPFA 1RTFB 2TGTA 2G81E 2ZEBA 4X1QU 2ZTXA 1LPKB 2FI5E 1C2GA 2WV4A 1Y3VA 3E0PB 1YCPH 1QTFA 3RC4A 1LVYA 4FUIA 1ZPBA 3QX5H 3RXDA 1H8DH 3M5LA 1D3QB 1DWCH 3QGJA 3GY2A 4NA9H 4B76A 1V2PT 2ZDNA 2ZDAH 1SGCA 2ZFTA 3BV9B 1UO6A 4Y8XA 2ZCLP 1DSTA 2BLQA 5J4QA 2XC5A 2YNBA 3ATIA 3GOVB 1O38A 2HGTH 3GDVA 2TBSA 2ZHEH 3VEQB 4CRDA 1GI7B 2A4RA 2H5CA 1EOLA 2OINA 3S0NA 4AGJA 3SJOA 5JB9S 1MTNB 2SNWA 2C8ZB 2GCHF 1T7CA 2H9TH 1LVOA 4Z0KA 3UY9A 2LPRA 1ZGIA 3SV2H 4NWLA 1WSSH 4K1SA 3F9HA 3MH6A 1F92A 4DJZB 1A4WH 3DFJA 1JRTA 1T8OA 3TIUA 4X6MA 1V2JT 3BSQA 5HM9A 3QWCH 5EG4A 1P2NA 5JDUB 5LPRA 1RS0A 2WUBA 2ESTE 1BRAA 3A8CA 2AIPA 5L30H 3ELAH 3LT3A 1SGIB 1QBVH 4NIXA 4J1YA 1EATA 2ZHQH 1N8OC 2O9QA 2FS9A 5LH8A 2FI3E 1O3FA 1YBWA 4Q7XA 4YO9A 4X8VH 1O3NA 2JH6D 1NRQH 1QB9A 1UTLM 2Y7XA 1O2NA 1DPOA 4IW4E 1TRNA 4JZEH 3O8CA 3LDXH 2Y5GA 3SU6A 1YYY1 1V2KT 3R3GB 4DGJA 4FVDA 1H8IH 3RXCA 4OS7A 3BTHE 1GBJA 3Q3XA 3TK5A 2W7UA 3OYPA 1KXAA 1NFWA 4RN6A 2A5KA 3QN7A 1UHBA 5EOKA 1SG8B 9LPRA 1TGNA 1THPB 1A61H 2ZPSA 2VB0A 4BAQB 2H2ZA 2BQ6B 1BTYA 1GMCF 3M5OA 3UWJH 3URCA 3SU0A 3ATLA 2V3HH 2ZF0H 4ISIH 1V2RT 2BVXH 1O2PA 1SGEE 3V0XA 4X1NU 2A4OA 4DY7B 2GCHG 1O2TA 2ZG0H 1O3AA 3P8GA 5TCCA 1ESTA 1ZPZA 1MAYA 1V2WT 4AB9A 1BCUH 3V3MA 2QIQA 2WPIS 5AFZH 2YOLA 3KGPA 1XXDA 2PTNA 2CHAC 1P03A 1BTWA 4WXVA 2J38A 2THFB 1NC6A 2VGCC 3RXTA 2Z6BD 2ODQA 3TJOA 2BOHB 1V2LT 2ZTZA 4CRCA 5EXMA 4ABEA 3ATWA 5E0JA 1P8VC 2ZFRH 1P05A 1RRKA 4TY7A 1O3IA 2OBOA 3A8AA 3KQBA 4X6NA 3LGVA 1A46H 1HLTH 1EZQA 1O37A 1MQ6A 4X2YA 2FX4A 4X8UH 3PMAB 5GCHF 3U69H 3PYHA 1RTLA 1AKSB 3R0FA 5GXPA 1F0SA 2WPMS 2TGDA 1S0RA 3LH1A 1OWIA 1DXPA 1O2WA 1QL9A 3EQ0H 4X8TH 3TGIE 1TBRH 3O8BA 4ISHH 1J9CH 5JBAS 1LQEA 1JIRA 3PLPA 4BXWA 1K2I1 1BTUA 3CS0A 1SC8U 1KDQA 1YCPM 4Y6DA 2FTMA 3SU1A 1C1MA 1ANCA 1TX8A 3SU4A 1GDUA 2J34A 1BMLA 3OX7U 2O8TA 5A0BA 1P10A 4WMFA 3ZYEA 3GCHC 2HLCA 4CR5A 4YM9A 1F2SE 1EPTA 1F0RA 2F9UA 3GDSA 1GI4A 1A5GH 2VH6A 3BEUA 4ABDA 3P70B 4AZ2B 2BY9X 3SZNA 1O3DA 1ZRKA 2VWMA 3GCNA 3H7TA 1C4U2 3MYWA 3VB4A 1HFDA 1YPGH 1C2KA 3TITA 1AE8H 1GMCG 2ILNA 3N7OA 1FDPA 1O3GA 1O2OA 2UUYA 1HAIH 2OXSA 3ZVEA 4FVBA 1ZLRA 1W10U 3F9FA 4GCHG 3QDZB 4JYVH 3HATH 1QQ4A 4X2XA 4TWWA 1TNLA 1XVOA 3SNCA 1O5EH 1K1IA 5C2ZA 1G3DA 2QF0A 1IOEA 1YPLH 4GVUA 4UEHH 3S9CA 2ZGXH 1H9HE 1Z8JB 1KY9A 4X6OA 2GZ8A 1C1QA 1UTPA 2HVXA 1O35A 4H6SB 1ABIH 1ELEE 1FI8A 2ALVA 1ZGVA 2Z3DA 2P16A 4E06H 7ESTE 1V2TT 1X7AC 3Q3KA 1UTMA 1BHXF 5T6FA 2GV6A 2Q6DA 1AZ8A 1C5UA 3HK3B 1HJ8A 4I8JA 5GCHG 2FDAA 1SGPE 3EGKH 4JCNA 2Z9LA 3A80A 2FYQA 5T3HA 2BQ7B 1W2KH 2PLXA 1GBMA 2ZPQA 3P92A 2O8WA 1ETSH 1HAPH 2BY7X 1G9IE 4BAHB 4ABFA 4X6PA 1O5CB 3QZRA 2WPJS 2GZ9A 1ELBA 1MKWH 1N6XA 1UTNA 2WYJA 1ELGA 3A81A 3ZVDA 1HIAA 1HCGA 1CSOE 3VB5A 1LCYA 2WPLS 1SLVB 1Z7KA 1C4Y2 3MU4A 1LPZB 2BX4A 2RG3A 2FXRA 2W7SA 2A2XH 2C3SA 3CS7A 4A1VA 4Y0YE 2ZPRA 3TH2H 3T26A 4UFGH 4NFEA 3PB1E 1ZPCA 4BTUB 1O30A 2TRMA 1FY3A 1Z1IA 3BTFE 2ZFPH 4IN1A 3U1IB 1UTOA 1Z8IB 2FOMB 3TJUA 3UUZA 5IDKA 3VB6A 1UTJA 3E0NB 1FXYA 1TQ0B 2KAIB 2BB4A 1EP6A 2AERH 1XX9A 2SGPE 5EXNA 4D76A 3U8TH 3HGNA 1SFQB 3PO1C 5JBCS 2XBVA 2GCTB 5C3NA 1GI0A 4WWYA 2BZ6H 1BA8B 5HYOA 2BDAA 4IMQA 3ZZ8A 1IHTH 3QZQA 3GY8A 5ESBA 4BNRA 1W13U 5E8EH 1MQ5A 5L2ZH 2P8OC 5A2MH 5CHAC 3RXSA 2QF3A 1GJBB 2HPQH 3MMGA 1HJAC 4ISLA 1G32B 2NU2E 4MNWA 2OLGA 1O2KA 2OCVB 1PJPA 2R2MB 1O3BA 1VGCB 3A7ZA 2SNVA 3BIVH 1FAKH 5FCRA 1K1NA 1ZRBA 1KTTB 1D3TB 2A4QA 4CRAA 4INHA 2Q1JA 1D6WA 3VB7A 2VIWA 1YPEH 2FPZA 3LU9B 1TLDA 2OQUA 2PSXA 1DE7H 1F7ZA 1QL7A 1A3EH 3MNXA 1UVSH 3SQEE 3TH3H 2PKAB 3M7TA 4MG3A 3PLKA 1WCZA 1P3CA 2G5NA 2ZDLA 4DT7B 5A8ZA 1Y59T 3MFJA 4CREA 4B74A 3VFEA 3A7VA 3S7KB 3ZVAA 2P3FH 5JBTA 4K8YA 4AFZA 1KXEA 5EQQA 1AGJA 1ZSLA 8ESTE 4YESB 5J4SA 3ZYDA 3U8OH 2HNTF 1PQ5A 1P09A 3SGQE 1MTVA 1TGTA 1AUTC 1DWEH 4ABHA 4CRFA 2ZZUH 2ZFQH 4K2YA 1OXGA 2FZZA 1EUFA 1DUEA 3SBKA 1NTPA 2F9OA 4JZ1A 4KTCA 2QAAA 1O2ZA 3A87A 5CMXH 2C4FH 4MPVA 2WINI 1O34A 3PWCA 2ZDMA 1BJUA 4O03A 3M5MA 3K9XB 2AMPA 2UWOA 3PROA 1C2IA 1GI2A 5AF9H 1SVPA 1BT7A 3M7UA 4YT7H 3LC5A 1BBRK 3EAJA 2Z7FE 3LJJA 4JYTA 5EGMA 4TY6A 3QO6A 4LK4A 4U2WA 1HAXB 1ZR0A 3PTNA 1RFNA 2H6MA 5DG6A 1PPCE 2Y7ZA 4JZDH 2QXJA 2XCNA 1NS3A 4AFUA 1Q31A 3OY5U 3E3TA 1NROH 1O32A 2A31A 1EX3A 2ZHFH 1NRRH 3BTKE 1QBOA 5I46H 2QC2A 1TIOA 2G52A 4YOIA 2IPHA 1ZMNA 1DANH 2BDCA 1GBDA 1AZZA 3V7TA 1W0YH 2A0QB 1WYKA 1LTOA 1THRH 1UCYE 2A1DB 1ETTH 3MH5A 1VZQH 3FZZA 3VB3A 1PPZA 3ZV9A 1ARCA 2A32A 3BG4C 3ZVFA 1KLTA 3FP7E 4Y79A 2CMYA 1OWJA 1GBCA 2OC1A 1M9UA 1YKTA 4I8HA 2BYAX 3Q77A 3ZVBA 2DE9A 5HXFA 3ZZCA 5JBBS 1ELVA 1NESE 4K1TA 4NIYA 3RXFA 3TPIZ 2WUCA 2QCYA 3GDUA 1BMNH 1AU8A 4TPIZ 5C1UA 4XDEA 1T32A 1O3MA 4XSKU 2BY6X 2P59A 4GSOA 3OY6U 2BVSH 3BTEE 1H9LB 1A1RA 1BJVA 3F1SB 4E7RG 3SI3H 3ITIA 1KYNA 4BTIB 1MZAA 3SJ8A 1C5QA 3SQHE 3I29A 2FWWA 2VIOA 1GBLA 2FMJA 2D26C 2UUJB 4XBBA 1WQVH 1H1BA 2AGGX 4U30A 4A6LA 4FUCA 1UK4A 1TABE 2QXHA 1THSH 2ZQ2A 2BD3A 5C67A 1BMAA 2C93B 2ZU2A 2VGCB 3RXPA 2FOFA 3M37A 4BAKB 4Y10E 3LOXA 4ABIA 3A84A 2GGVB 1HAGE 1TA2A 1TNJA 1AKSA 1E34B 1ZHMA 2GTBA 1SI5H 1GJ7B 4I32A 2H5DA 1C5NH 5JPMH 4UE7H 4GHQA 3A88A 5EU8A 1H9IE 2BDIA 2GV7A 1YPHE 3Q00A 2HNTE 1K1OA 1C2LA 3IWMA 3RP2A 1W11U 3SUGA 1LHFH 2GT7A 1OOKB 3SUEA 3UOUA 3M35A 1J16A 4MPXA 2B7DH 1HAZB 2Q6FA 1Y3WA 1AB9B 2AS9A 1C1UH 5LGOA 4R8TB 2ZQ1A 2V0BA 2O8LA 1SB1H 3K65B 1QGFA 4FU8A 4DG4A 3UWIA 4K8BA 1FY4A 1D6RA 1DY8A 2ZTYA 3BTWE 4VGCC 3RUOA 2XRCA 1ELTA 1GJ8B 1ZMJA 2W3IA 2Y5FA 3D62A 4YT6H 1EAIA 6CHAC 4B1TA 1DICA 1SHHB 1CU1A 2GP9B 1GMHF 2JETC 1D3PB 1AFQB 2GKVE 1O2YA 2ODYB 5EODA 1BRUP 4NIWA 4ZXYH 5A0AE 1V2MT 1C5RA 3BG8A 1NN6A 2SGFE 2WV5A 1ZTLA 3DUXH 2ANYA 3B23B 3AASA 1O3KA 1Z8RA 2BLWA 5E2OA 1SFIA 1LHGH 3LONA 1ESAA 4RKJB 1WUNH 1HBTH 1EZSC 2PKSC 2R0KA 1W3CA 4UFEH 3KNXA 3LH3A 3IITA 1C2MA 4FUEA 1V2VT 1C5WB 3A8DA 1BTXA 4JZFH 2ZFSA 1QQUA 1FIZA 3GYLB 4NA8A 5DO4H 1GL0E 2A7HA 1FAXA 2GMTC 1TA6A 2AGIX 4Y8ZA 4WH8A 5JB8S 1DM4B 1NM6A 4ZHMU 3RXEA 3S7HB 1D9IA 4AFQA 1QJ6B 3RXOA 1TWXB 1SPJA 1SQAA 1ZJDA 1Y3UA 4TPYA 4Z6AH 4A5TS 1AN1E 2PTCE 1IHSH 2P3UB 3M3VA 1PYTC 2B5TB 1UMAH 4X2VA 3TNTA 3E8LA 2BY8X 2AMQA 1GG6C 1QB1A 4CH2B 3GY3A 1AUJA 4NWKA 2VIDA 1GHAG 3KCGH 1V2UT 4BAMB 1LDTT 3Q3YA 1C2HA 1XM1A 1W7GH 2O8MA 1OS8A 1ZMLA 1HXFH 4OS4A 3TK6A 1G3EA 1P0SH 5E0GA 1ESBA 1DLKB 3A82A 5F8TA 1IQFA 1Z6JH 3TVJB 1PQ8A 2KAIA 4TWYA 2FOCA 3ZZBA 4YTAA 4AG1A 1DLEA 1GMHG 2TIOA 2BD2A 1E37B 4GCHF 4WH6A 1WTGH 1SHYA 2Z9JA 3QK1A 4HFPB 4XBDA 5HM2A 1HAVB 3D23A 1L1GA 1ZOMA 2SFAA 3PO1B 1Z1JA 2HALA 5EW2H 1ELDE 1KXCA 4DOQA 1C5YB 2Y81A 4Q2KA 3FP8E 4XFQA 2Y5HA 3M7QA 4OS2A 4AOQA 1TONA 4UDWH 1F5KU 2A7CA 4X1RU 1C1TA 2P8OB 2VWLA 1GI1A 1KLIH 2ZC9H 5CHAB 3RXHA 2ZHDA 2EI6A 2NWNA 3RU4T 3T5FH 3RC6A 2GDDA 2VVUA 2A5AA 1FUJA 3W94A 1C2DA 1MTUA 1O3EA 1C1OA 2BVRH 4DW2U 3MO9A 3E91A 3TJNA 2CF9H 1C9TA 4ZUHA 3VGCB 3RXUA 1O2HA 5FHTA 1EAUA 2VINA 1FZZA 4JZIA 5AVDA 1IQMA 1GI8B 5CE1A 2PKAA 2FIRH 1EZXC 1GHYH 3GYMA 1EP5A 1EJAA 1C1WH 1GBIA 1O5BB 1OWDA 3GY5A 1C2EA 5F03A 1QFKH 3BF6H 3CP7A 3T27A 3MO3A 1GJCB 3A7WA 2AMDA 2H9EH 4XE4A 1C2JA 3EA9A 1A5HA 1VITH 3E16B 3TGJE 1EZUC 3UIRA 4F4OC 1MH0A 1OWKA 2BM2A 3A8BA 4DIIH 1IQIA 1DSUA 1NRPH 2QYIA 4NZQA 3QGNB 7GCHG 3CENA 5DP5A 1G2LA 1MD7A 4D7FA 4GHTA 4X1PU 2C90B 1AY6H 3P8NA 2EEKA 1AVWA 2ZP0H 4FUFA 3ZVGA 5ABWA 1OYTH 1SMFE 1SQTA 1UK2A 4WJG2 1H4WA 4LXBH 5DP6A 3UPEA 4H42U 3TNSA 3LGTA 1RJXB 3L6PA 2BTCE 1S6FA 2RA0A 3RU4D 1CA0C 2R9PA 2O8UA 2AFQB 2ZDKA 3SNDA 5AFYH 1QY6A 3M3TA 3A83A 2F9PA 2R2WU 3AAUA 1T31A 3W95A 3SUDA 1IQEA 3UOPA 3ZZDA 1Y8TA 2XTTB 2G8TA 1O36A 4MNYA 5DPAA 1AWFH 1NFUA 1ORFA 3AW0A 1MTWA 2CV3A 3SI4H 2Z9KA 1BDAA 1DWDH 1C1VH 1T8NA 5GWZA 3SV9A 2CXVA 2FX6A 4M7GA 1P01A 1Q2WA 3SJIA 3MOCA 1FV9A 1MBMA 1AIXH 1DY9A 1PPBH 1WBGB 1GPZA 1OP0A 3KL6A 2TGAA 2ZNKH 1P57B 2ZHWH 4NSVA 1T4VH 1C2FA 1NRSH 1LQDB 3ODFA 1O39A 3MNCA 4HGCA 2DUCA 3KQEA 1FNIA 1TNIA 3PMJA 1XUFA 5LPEA 1RIWB 1PPHE 3OSYA 4IBLH 3PMBB 4F49A 1S85A 4Y71A 2FOBA 3RMNH 1PQAA 3BG4B 2R3YA 3NK8A 1JWTA 1EJMA 4A1XA 1L1NA 1UVOA 3B9FH 3GY7A 4ZHAA 1LO6A 3A85A 1Z71A 3RXGA 1ZYOA 5GIBA 4TYDA 5FCKA 1DDJA 1KSNA 3EE0B 2I6SA 3ZV8A 2B8OH 2VNTA 3H7OA 2W5EA 6GCHG 2UWPA 4KKDA 3RXRA 1LHEH 3RMLH 1A0LA 1GJAB 1YC0A 2WYGA 1G36A 4NZLA 1BTHH 1CGIE 1XMNB 1GMDF 4KGAA 1GBEA 1NY22 3RU4E 1GJ6A 1HPGA 4JK6A 1YCPK 3ODDA 1SOTA 3SU3A 1QL8A 1O2RA 1K1LA 1Y3YA 4B2BA 1TALA 1BQYA 5GJ4B 1MU6B 1DUAA 1LMWB 1IQNA 2A45B 1TRMA 3G01A 4K60A 1CA8B 4YLQH 5FAHA 1GCTC 1WU1A 1XUIA 8KME2 3TK9A 3BIUH 3F9GA 2NU4E 3RXMA 4E7NA 2ZO3H 3EA8A 2BLOA 1TGSZ 2NU0E 3RXLA 1TNGA 1ZTJA 1L2EA 1K28D 2ZGCA 1A0JA 3HPTB 1O3LA 1EB1H 3A7TA 1CT2E 2R3UA 4ISOA 1YPMH 3NCLA 1QB6A 1LVMA 2GVFA 1ANBA 1YLDA 3GICB 3PLBA 4FUDA 4MNVA 2D1JA 5A09A 4ZKSU 3OTJE 3PWBA 1TB6H 1LPGB 3JZ2B 4JYUH 3E6PH 1TGBA 1C5PA 2J4IA 4XOJA 1DVAH 3O8DA 2VWOA 1HAYB 3KQDA 2PV9B 4MVNA 2BMGB 3TGKE 4I33A 1BMMH 1C5XB 1WAYB 2ZU1A 1EAXA 3K6YA 3T62A 1FLEE 2PGBB 1WV7H 3S9BA 5DJ7A 3RXKA 3SGBE 1CT0E 3BTME 3MU8A 2WPKS 1ELFA 1SR5C 2BD5A 1VJ9U 2BXTH 1GJDB 1IQJA 1OX1A 3RMOH 4VGCB 1ARBA 3MO6A 2Y80A 3PV4A 1AVXA 4INKA 4OS1A 3RMMH 1TX6A 2K1QA 3A7XA 2QN5T 1AQ7A 2OP9A 1C5LH 1TNHA 2FI4E 1TPPA 2JETB 1K1MA 5C1XA 3VXEH 1Y5BT 1EXFA 1FONA 4WMDA 1GMDG 2ZIQH 3EYDA 1O2XA 1XXFA 1TPAE 4GLYA 1A2CH 2Q6GA 5F8ZA 5FX5A 1XUGA 4BTTB 3RLWH 4D8NA 1FN6A 1FIWA 2HWLB 1YLCA 1VCQA 1O2IA 1TOCB 4KELA 3UQVA 1GJ4H 3SV8A 1FPHH 2PKSB 1AMHA 2GZ7A 1HXEH 3UR6A 1ANEA 1T8LA 2RA3A 3ZZ3A 2NU3E 1V6DA 2C8YB 1FMGA 2XBWA 4Y11E 2V35A 2VVCA 1DFPA 1O3OA 1C4V2 1N8OB 1WOFA 6ESTA 1GJ9B 2F9NA 1SGFA 1T8MA 2ZU3A 1O33A 3SGAE 2XC0A 4ZAEA 3RXAA 4GPGA 3RM0H 1ZTKA 4INLA 4NGAH 2ZFFH 1SGYE 4KTSA 5T6GA 2WPHS 5B6OA 1TMUH 5A8YA 4I7YH 1N1LA 3DA9B 1FY5A 2FOHA 1ANDA 5G4BA 3SN8A 2Z94A 1JMOH 2VIVA 3NPSA 3UNQA 4AGKA 1NFXA 3PM3A 2QXIA 1GG6B 1XKBC 2BDHA 1VCPA 1O2LA 3BEIB 3OU0A 1HNEE 5FXLA 1C5TA 4AN7A 1O5AB 1U6QA 3QTOH 5E0HA 1Y5UT 4WF8A 2PFEA 4MDSA 2UUFB 1AD8H 1O5DH 5H4IB 7KMEH 1GBHA 5F6MA 1JBUH 5ESTE 2SGEE 4B2CA 1F0UA 1SGFG 1TBZH 4X0WU 4AX9H 1FQ3A 1HAVA 1CGJE 3P8OA 3RXJA 4HI3A 4ABBA
chains in the Genus database with same CATH superfamily
2EC9H 3PRBA 1S81A 4ZKOU 2QV1A 4K69A 3HKJB 1W0ZU 3BN9A 3KHVA 2AYWA 1NT1A 3MU5A 2VJ1A 3M61U 1RD3B 4E05H 2TPIZ 2D2DA 5SGAE 4P02A 2CHAB 2WZQA 3TLOA 2BOKA 3SNBA 2G51A 4AYYB 3MNSA 1HV7A 3SO3A 3O8RA 1W7XH 3DT0H 4Q7YA 1SLUB 2Z3EA 1JIMA 2QXGA 1YGCH 3ZZ5A 4BANB 3MWIU 1GI3A 3GCOA 4YOGA 2OC0A 1QRWA 1EKBB 1S5SA 1CE5A 3EDXB 4JMYA 1QJ7B 1ZHRA 2ALPA 4AB8A 2LNCA 1VCWA 3C27B 2ZKSA 1LHCH 1EAWA 1V2QT 3PV2A 3TJVA 4ISNA 4FUJA 2ZGHA 2F43B 4I31A 1ID5H 1GVKB 1UK3A 1EB2A 2J94A 1INCA 4DURA 1VGCC 1ZZZA 4KTUA 1QRXA 1UVUH 3SZEA 5FBEA 1C1RA 3WWBA 4B2AA 5FPTA 1LKBA 4I8GA 2STBE 1QCPA 4B71A 5C0UA 4CR9A 3NKKA 1OYQA 4LZ1H 2W3KA 5EQRA 1HRTH 1GHAF 2GD4B 3C1KA 1SQRA 4ZROA 1L4ZA 3M5NA 1P2IA 7LPRA 2A5IA 1KMHB 2FOAA 1HAOH 3GCHB 5PTPA 3ESTA 4O3TA 4NCYA 3IG6B 3SHCH 2ZGBH 2IN2A 4I8LA 1FN8A 5C20A 4HTCH 1AFEH 4LZ4B 2BQWB 1GHVH 2RCEA 4AFSA 4FOUC 1QRZA 2PSYA 1O3JA 1XUJA 1L4DA 2FP7B 1C5MD 1UCYK 1SGRE 4A7IB 1GBAA 1CHGA 1MKWK 1QA7A 2ZI2H 4FXGH 2PHBA 2XOKD 2CJIA 1BIOA 1CHOF 2JKHA 1CA0B 3QLPH 1EPTC 1FY1A 2J9NA 3MH7A 4FUHA 1GI5A 3L33A 5HMAA 1CBWC 1UTQA 1CQQA 3UR9A 1PPGE 1V2ST 5KGOA 1Z6EA 3FVFB 3EA7A 1RGQA 3MHWU 3BTDE 3ZZAA 5DKMA 1C1NA 1KIGH 2EI7A 1O5GH 1CGHA 1GDQA 1FY8E 2CN0H 3SV7A 3T2NA 1GBTA 1P2MA 4SGAE 1K1PA 5C5NA 1K22H 4O3UA 1DITH 4AG2A 8GCHF 1S6HA 4TSFD 2G4UA 1UJ1A 3RC5A 2RDLA 3U28C 3QTVH 3RXIA 2PUXB 2B9LA 2XC4A 1G3CA 1TAWA 2GT8A 1GGDC 3VPKA 3U1JB 3MI4A 4X8SH 3SJKA 2ULLA 2FEQH 2K8IA 2TGPZ 1C5SA 4R0IA 2HVYB 1PPEE 2B0FA 4FETA 4Y8YA 7GCHF 1MD8A 5E2PA 1P2JA 1W12U 3LC3A 2IPQX 1O31A 3SJ9A 2C8XB 4H6TA 1O3PB 1OPHB 3KEEA 3JZ1B 4K3JA 1TGCA 4ESTE 2FOEA 2G00A 5DP7A 3SU5A 1NU7B 2VU8E 2HPPH 5A8XA 1CT4E 1FJSA 5GPIB 1EOJA 4UONA 2I6QA 1SLXB 6LPRA 1Y3XA 2OC8A 3RXQA 4LOYH 1AE5A 1ELCA 2FTLE 1MKXK 2Y6TA 1JXPA 3E1XB 4FUGA 3MU1A 1TBQH 3MH4A 4OS5A 1S82A 1SGTA 4F55A 2ZGJA 1S83A 1CHOG 2PUQH 1O2UA 4ABGA 1EQ9A 1TRYA 3B8JA 1GL1A 1BBRH 3NXPA 1E38B 3LGWA 1MCVA 4Y7AA 3GCTF 4ASHA 2FLBH 2BDYA 5I25A 3K2UA 1W0JD 1GCTB 1O2VA 2FS8A 5DK1A 1P9UA 3SHAH 4CRBA 1BITA 5EPNA 2ZU4A 1C1PA 5JYIA 1FPCH 2BLVA 1HJAB 2W6JD 1KLJH 2G5VA 3MTYA 1E1RD 1XUHA 2ZU5A 3STIA 8GCHG 2IOTA 2PGQB 5DP3A 4O97A 3HGPA 1B7XB 4RT0A 1GJ5H 3P95A 1NRNH 3RXBA 3SU2A 4ZMAH 2BD7A 1MZDA 4SGBE 3M3SA 2M5TA 4U32A 5K7RA 4CHAC 4WXIA 1WTHD 1COWD 2BD9A 3VXFH 5L2YH 1P12E 4IMZA 5HKKD 2Z3CA 2L74A 4U01A 1UVPA 2VVVA 3DHKH 2HOBA 1BRBE 3F2FA 1PQ7A 4Y7BA 5F8XA 4ACBA 3F3BA 3F68H 4J2YB 2P93A 3T29A 3I78A 3BTQE 4TT3D 1DOJA 4OGYA 1ZSJA 2FO9A 3SUFA 3UFAA 1C9PA 2JDID 1QURH 1BB0B 3L3TA 3RLYH 1GI9B 5EXLA 4UFFH 1GHWH 3SOSA 2VIQA 3SV6A 4IC6A 1G37A 5FBIA 4ABJA 6GCHF 1VITF 2FYRA 1AB9C 1VR1H 2W6ID 2EA3A 1HDTH 2XCFA 2OTVA 4YZUA 1SBWA 2D8WA 3T28A 3D65E 4UD9H 2BZAA 1IQGA 1NFYA 1B0FA 2A7JA 1A0HB 1AFQC 1GDNA 1UTKA 1F5LA 3UTUH 1MTNC 4PROA 2V3OH 1OSSA 4ZKNU 1LKAA 3GCTG 1DX5M 4H4FA 1S84A 3ZZ6A 1MAXA 3AW1A 4DIHH 1O2SA 1HAHH 3E90B 4WY3A 3KF2A 4ZHLU 1HJ9A 3RXVA 3KIDU 2FM2A 2XBXA 3P8FA 2PR3A 2BXUH 3LGIA 1B0EA 4GUXA 2FLRH 1QZ8A 3TU7H 3KYGA 3PMHB 1IQHA 1O2GH 2RDEA 1BUIA 3FFGA 1P04A 1MUEB 1G30B 4NG9H 5EW1H 4B75A 2ASUB 1V3XA 1YPKH 4MQAA 1TFXA 3DFLA 1EFRD 3QUMP 1ZJKA 1NU9A 1P9SA 3PTBA 1C1SA 1MMJN 1O3HA 1Q3XA 1KTSB 4X1SU 1ABJH 1YPHC 4IS5A 3AAVA 2HNTC 2ZDVH 4GAWA 1SSXA 3A86A 2A4GA 3U8RH 1GVZA 2XWAA 5FX6A 1PFXC 1CO7E 2PW8H 3U98H 2F9VA 3OTPA 3STJA 3LKWA 1E0FD 1P2KA 2JJ1D 1Y5AT 2VIPA 3ATKA 1PYTD 1SGDE 2FODA 1P2OA 1GWAA 2STAE 5DP9A 3SORA 5EPYA 1ZSKA 4CBOA 1D4PB 4ZH8A 2BD8A 1UVTH 2A2QH 1AI8H 2KFWA 3N99A 2BY5X 1SGNE 2AH4X 3FAOA 4K1EA 1NO9H 3DD2H 1UCYH 2BD4A 3AVZA 4THNH 1O3CA 3LIWA 1VITG 3MNBA 2ANKH 1TNKA 1SL3A 3V13A 3GY4A 2BHGA 1TX7A 2H1UA 4NIVA 3GY6A 1DS2E 4MTBA 4MPUA 1BBRE 4ACAA 5FL7D 1AVGH 2SGQE 1C5OH 1S0QA 1C5VA 1YP9A 2J2UA 1TYNA 1GCDA 3HKIB 1UHBB 2FOGA 3FZDA 2F91A 2GDEH 4MPWA 5DGJA 2W26A 2V7QD 4Q7ZA 1DT2A 5TJXA 4NFFA 5DN6D 1J17T 1Z8GA 2XW9A 1ZHPA 1OP8A 3FP6E 4RKOB 3UNRA 5T6DA 1K1JA 1AHTH 5IYTA 1G2MA 1C5ZB 3DCLA 2F83A 3KN2A 4B73A 4DCDA 1L0ZA 1QJ1B 4Y76A 1F5RA 1B5GH 5TCAA 1GBFA 2Z9IA 1QBNA 3LJOA 1MU8B 3SW2B 2P95A 2ANWA 5EQSA 2DE8A 5FPYA 3URDA 1W14U 1OWEA 4I86A 3SNAA 2J92A 1BTZA 4I8KA 3A89A 1LVBA 4IN2A 1A3BH 3UNSA 2M2AA 3VGCC 1ELAA 2ZA5A 2JH5D 1P11E 2XXLA 3UREA 1J8AA 2YNAA 4HZHA 2QY0B 5C5OA 2OUAA 2XYAA 2ODPA 1V2NT 4ABAA 3P6ZB 4KP0A 3SYJA 2HLDD 2UWLA 1HB0B 1G3BA 3A7YA 3Q76A 1BZXE 2AEIH 3FO8D 1J15A 3ENSB 3S9AA 1MKXH 1W8BH 2XWBI 1IQLA 4CH8B 3WY8A 1GHBF 1KDQB 2ZCKP 1RXPA 5EJLA 1P02A 2AIQA 1J14A 6CHAB 1DXWA 1IQKA 4QT8C 4OGXA 2P94A 1D3DB 2QA9E 2SGDE 2WHXA 5L6NH 5A0CA 4K5ZA 2KCPA 5DP8A 3M36A 1EPTB 1RTKA 1GHZA 2HRVA 4WMEA 5EIYA 2ZWLH 1CBWB 3F6UH 3BTGE 2GX4A 3UB0A 1XUKA 1MBQA 3RDZA 2J95A 1BOQA 1GVLA 5EJ1A 5FPSA 4AORA 3BTTE 4XBCA 1A7SA 1O2QA 1E35B 2C8WB 5BPEA 4ZKRU 5AHGH 5EJZA 4BOHA 4CRGA 1NZQH 1YM0A 1H8HD 3HK6B 2Y82A 2XNIA 3ZVCA 3DSOA 3U9AH 2ANMH 3H5CB 1HGTH 2XBYA 2VWNA 4MLFB 3F9EA 2AGEX 1IAUA 2GMTB 1TMBH 3NWUA 3V12A 1TPOA 4UFDH 1KXBA 1K21H 3BEFB 3D49H 4BXSA 1ETRH 5BRRE 1BRCE 1XKAC 1O2MA 1JOUB 4YLUA 1MTSA 1GGDB 2ZECA 1AO5A 2G4TA 2JH0D 4O9VA 1SQOA 3UQOA 2OC7A 3KQCA 1T4UH 1OP2A 1KXFA 4CBNA 1XVMA 4NA7A 4FU7A 2F3CE 5K0HA 3MU0A 1K9OE 5DP4A 2CGAA 4WVPE 1QIXB 1OWHA 1RIWC 2BX3A 1JRSA 4FU9A 1TPSA 4D7GA 4JK5A 3S69A 3ATMA 4IGDA 5C1YA 4ZXXH 3NZIA 3P17H 2QGRA 3LGUA 1P06A 4YOJA 1QA0A 3LPRA 1HUTH 1GBBA 2F4LA 4X2WA 4Y0ZE 1WQSA 2BDGA 1GHBG 1SOZA 1DWBH 2FESH 1TOMH 3ZZ9A 1YPJH 4D9RA 3T25A 4DVAU 1HIAB 4OS6A 1E36B 1LHDH 1CVWH 2ZCHP 1VJAU 1QNJA 2G55A 2EI8A 1KXDA 2H9HA 1SLWB 2YMSC 2IJOB 1YLNA 4Q63A 4MNXA 3TH4H 2OD3B 1O2JA 2Z9GA 1N6YA 3GISB 1BHXB 1GBKA 4XD7D 4NSYA 2VH0A 2CF8H 3F2GA 2GCTC 3NUMA 4B6FA 1GI6A 2SGAA 1NPMA 2WV9A 3OE7D 5HGGA 4FUBA 4RSPA 3I77A 8LPRA 1V2OT 1AWHB 1QR3E 3ZZ7A 1PPFE 2R0LA 2J5UA 1O5FH 2OQ5A 2PWXA 1O0DH 4AYVB 3LGYA 3WW7A 1EASA 1BTPA 9ESTA 4CHAB 3SNEA 3ZZ4A 2UUKB 2BDBA 4A1TA 1A5IA 4IC5A 1YF4A 1EJNA 1GHXH 4Q80A 1QHRB 2OBQA 1ACBE 1TQ7B 1TMTH 4BAOB 2P3TB 1P3EA 1TE0A 4A92A 3K6ZA 3RM2H 4D9QA 1HYLA 2NU1E 1MCTA 1P2QA 1F0TA 1L1JA 3FANA 1OKXA 5ETXA 2F9BH 2V6NA 1SGQE 5GDSH 5LPFA 1RTFB 2TGTA 2G81E 2ZEBA 4X1QU 2JIZD 2ZTXA 1LPKB 2FI5E 1C2GA 2WV4A 1Y3VA 3E0PB 1YCPH 1QTFA 3RC4A 1LVYA 4FUIA 1ZPBA 3QX5H 3RXDA 1H8DH 3M5LA 1D3QB 1DWCH 3QGJA 3GY2A 4NA9H 4B76A 1V2PT 2ZDNA 2ZDAH 1SGCA 5C17A 2ZFTA 3BV9B 1UO6A 4Y8XA 2ZCLP 1DSTA 2BLQA 4ZCNA 5J4QA 2XC5A 2YNBA 3ATIA 3GOVB 1O38A 2HGTH 3GDVA 2TBSA 2ZHEH 3VEQB 4CRDA 1GI7B 2A4RA 2H5CA 1EOLA 2OINA 3OFND 3S0NA 4AGJA 3SJOA 5JB9S 1MTNB 2SNWA 2C8ZB 4Q4LA 2GCHF 1T7CA 2H9TH 1LVOA 4Z0KA 3UY9A 2LPRA 1ZGIA 3SV2H 4NWLA 1WSSH 4K1SA 3F9HA 3MH6A 1F92A 4DJZB 1A4WH 3DFJA 1JRTA 5KECA 1T8OA 3TIUA 3DSGA 4X6MA 1V2JT 3BSQA 5HM9A 3QWCH 5EG4A 1P2NA 5JDUB 5LPRA 1RS0A 2WUBA 2ESTE 1WXRA 1BRAA 3A8CA 2AIPA 5L30H 3ELAH 3LT3A 1SGIB 1QBVH 4NIXA 4J1YA 1EATA 2ZHQH 1N8OC 3WWFA 2O9QA 2FS9A 5LH8A 2FI3E 1O3FA 1YBWA 1YWUA 4Q7XA 4YO9A 4X8VH 1O3NA 2JH6D 1NRQH 1QB9A 1UTLM 2Y7XA 1O2NA 1DPOA 4IW4E 1TRNA 4JZEH 3O8CA 3LDXH 2Y5GA 3SU6A 1YYY1 1V2KT 3R3GB 4DGJA 1SKYE 4FVDA 1H8IH 3RXCA 4OS7A 3BTHE 1GBJA 3PV5A 3Q3XA 3TK5A 2W7UA 3OYPA 3W1EA 1KXAA 1NFWA 4RN6A 2A5KA 3QN7A 1UHBA 2EQNA 5EOKA 1SG8B 4B6EA 9LPRA 1TGNA 1THPB 1A61H 2ZPSA 2VB0A 4BAQB 2H2ZA 2BQ6B 1BTYA 1GMCF 3M5OA 3UWJH 3URCA 3SU0A 3ATLA 2V3HH 2ZF0H 4ISIH 1V2RT 2BVXH 1WDIA 2EY4C 1O2PA 1SGEE 3V0XA 4X1NU 2A4OA 2LELA 2GCHG 4DY7B 1O2TA 2ZG0H 1O3AA 3P8GA 5TCCA 1ESTA 1ZPZA 1MAYA 1V2WT 2KM0A 4AB9A 1BCUH 3V3MA 2QIQA 2WPIS 5AFZH 2YOLA 3KGPA 1XXDA 2PTNA 2CHAC 1E1QD 1P03A 1BTWA 4WXVA 2J38A 2THFB 1NC6A 2VGCC 2XNDD 3RXTA 2Z6BD 2ODQA 3TJOA 2BOHB 1V2LT 2ZTZA 4CRCA 5EXMA 4ABEA 3ATWA 5E0JA 1P8VC 3GS9A 2ZFRH 1P05A 1RRKA 2QF5A 4TY7A 1O3IA 2OBOA 3A8AA 3KQBA 4X6NA 3LGVA 1A46H 1HLTH 1EZQA 1O37A 1MQ6A 4X2YA 2FX4A 4X8UH 3PMAB 5GCHF 3U69H 3PYHA 1RTLA 1AKSB 3R0FA 5GXPA 1F0SA 2WPMS 2TGDA 1S0RA 3LH1A 1OWIA 1DXPA 1O2WA 1QL9A 3EQ0H 4X8TH 3TGIE 1TBRH 3O8BA 4ISHH 1J9CH 5JBAS 1LQEA 1JIRA 3PLPA 4BXWA 1K2I1 1BTUA 3CS0A 1SC8U 1KDQA 1YCPM 4Y6DA 2FTMA 3F0OA 3SU1A 1C1MA 5HIZA 1ANCA 1TX8A 3SU4A 1GDUA 2J34A 1BMLA 3OX7U 2O8TA 5A0BA 1P10A 4WMFA 3ZYEA 3DSPA 3GCHC 2HLCA 4CR5A 4YM9A 1F2SE 1EPTA 1F0RA 2F9UA 3GDSA 1GI4A 1A5GH 2VH6A 3BEUA 4ABDA 3P70B 4AZ2B 2BY9X 3SZNA 1O3DA 1ZRKA 2VWMA 3GCNA 3H7TA 1C4U2 3MYWA 3VB4A 1HFDA 1YPGH 1C2KA 3TITA 1AE8H 1GMCG 2ILNA 3N7OA 1FDPA 3AK5A 1O3GA 1O2OA 2UUYA 1HAIH 2OXSA 3ZVEA 4FVBA 1ZLRA 5DSFA 1W10U 3F9FA 4GCHG 3QDZB 4JYVH 3HATH 1QQ4A 4X2XA 4TWWA 1TNLA 1XVOA 4DT4A 3SNCA 1O5EH 1K1IA 5C2ZA 1G3DA 2QF0A 1IOEA 1YPLH 4GVUA 4UEHH 3S9CA 2ZGXH 2VBCA 1H9HE 1Z8JB 1KY9A 3ZIAD 4X6OA 2GZ8A 1C1QA 1UTPA 2HVXA 1O35A 4H6SB 1ABIH 1ELEE 1FI8A 2ALVA 1ZGVA 2Z3DA 2P16A 4E06H 7ESTE 1V2TT 1X7AC 3Q3KA 1UTMA 1W0KD 1BHXF 5T6FA 2GV6A 2Q6DA 1AZ8A 5F53A 1C5UA 3HK3B 1HJ8A 4I8JA 5GCHG 2FDAA 1SGPE 3EGKH 3F0PA 4JCNA 2Z9LA 3A80A 2FYQA 5T3HA 2BQ7B 1W2KH 2PLXA 3OEED 1GBMA 2ZPQA 3P92A 2O8WA 1ETSH 4YXWD 1HAPH 2BY7X 1G9IE 4BAHB 4ABFA 4X6PA 1O5CB 3QZRA 2WPJS 2IJD1 2GZ9A 1ELBA 1MKWH 1N6XA 1UTNA 2WYJA 1ELGA 3A81A 3ZVDA 1HIAA 1UW7A 1HCGA 4Z1MD 1CSOE 3VB5A 1LCYA 2WPLS 1SLVB 1Z7KA 1C4Y2 3MU4A 1LPZB 2BX4A 2RG3A 2FXRA 2W7SA 2A2XH 2C3SA 3CS7A 4A1VA 4Y0YE 2ZPRA 3TH2H 3T26A 4UFGH 4NFEA 3PB1E 1ZPCA 4BTUB 1O30A 2TRMA 1FY3A 1Z1IA 3BTFE 2ZFPH 4IN1A 3U1IB 5KEDA 1UTOA 1Z8IB 2FOMB 3TJUA 3UUZA 5IDKA 3VB6A 1UTJA 3E0NB 1FXYA 1TQ0B 2KAIB 2BB4A 1EP6A 2AERH 1XX9A 2SGPE 5EXNA 4D76A 3U8TH 3HGNA 1SFQB 3PO1C 5JBCS 2XBVA 1K0HA 2GCTB 5C3NA 1GI0A 4WWYA 2BZ6H 1BA8B 5HYOA 3FN8A 2BDAA 4IMQA 3ZZ8A 1IHTH 3QZQA 3GY8A 5ESBA 4BNRA 1W13U 5E8EH 1MQ5A 5L2ZH 2P8OC 5A2MH 5CHAC 3RXSA 2QF3A 1GJBB 2HPQH 3MMGA 1HJAC 4ISLA 1G32B 2NU2E 4MNWA 2OLGA 3OEHD 1O2KA 2OCVB 1PJPA 2R2MB 1O3BA 1VGCB 3A7ZA 2SNVA 3BIVH 1FAKH 5FCRA 1K1NA 1ZRBA 1KTTB 1D3TB 2A4QA 4CRAA 4INHA 2Q1JA 1D6WA 3VB7A 2VIWA 1YPEH 2FPZA 3LU9B 1TLDA 2OQUA 2PSXA 1DE7H 1F7ZA 1QL7A 1A3EH 3MNXA 1UVSH 3SQEE 5HIYA 3TH3H 2PKAB 3M7TA 4MG3A 3PLKA 2QE7D 1WCZA 1P3CA 2G5NA 2ZDLA 4DT7B 5A8ZA 1Y59T 3MFJA 4CREA 4B74A 3VFEA 3A7VA 3S7KB 3ZVAA 2P3FH 5JBTA 4K8YA 4AFZA 1KXEA 5EQQA 1AGJA 1ZSLA 8ESTE 4YESB 5J4SA 3ZYDA 3U8OH 2HNTF 1PQ5A 1P09A 3SGQE 1MTVA 1TGTA 1AUTC 1DWEH 4ABHA 4CRFA 2ZZUH 2ZFQH 4K2YA 1OXGA 2FZZA 1EUFA 1DUEA 3SBKA 1NTPA 2F9OA 4JZ1A 4KTCA 2QAAA 1O2ZA 3A87A 3FOAA 2C4FH 4MPVA 5CMXH 2WINI 1O34A 3PWCA 2ZDMA 1BJUA 4O03A 1S6LA 3M5MA 3K9XB 2AMPA 2UWOA 3PROA 1C2IA 1GI2A 5AF9H 5CHBA 1SVPA 1BT7A 3M7UA 4YT7H 3LC5A 1BBRK 3EAJA 2KCYA 2Z7FE 3LJJA 4JYTA 5EGMA 4TY6A 3QO6A 4LK4A 4U2WA 1HAXB 1ZR0A 3PTNA 1RFNA 2H6MA 5DG6A 1PPCE 2Y7ZA 4JZDH 2QXJA 2XCNA 1NS3A 4AFUA 1Q31A 3OY5U 3E3TA 1NROH 1O32A 2WPDD 2A31A 1EX3A 2ZHFH 2AHME 1NRRH 3BTKE 1QBOA 5I46H 2QC2A 1TIOA 2G52A 4YOIA 2IPHA 1ZMNA 1DANH 2BDCA 1GBDA 1AZZA 3V7TA 1W0YH 2A0QB 1WYKA 1LTOA 1THRH 1UCYE 2A1DB 1ETTH 3MH5A 1VZQH 1NBMD 3FZZA 3VB3A 1PPZA 3ZV9A 1ARCA 2A32A 3BG4C 3ZVFA 1KLTA 3FP7E 4Y79A 2CMYA 1OWJA 1GBCA 2OC1A 1M9UA 1YKTA 4I8HA 2BYAX 3Q77A 3ZVBA 2DE9A 5HXFA 3ZZCA 5JBBS 1ELVA 1NESE 4K1TA 4NIYA 3RXFA 3TPIZ 2WUCA 2QCYA 3GDUA 1BMNH 1AU8A 4TPIZ 5C1UA 2J97A 4XDEA 1T32A 4XRNA 1O3MA 4XSKU 2BY6X 2P59A 4GSOA 3OY6U 2BVSH 3BTEE 1H9LB 1A1RA 1BJVA 3F1SB 4AC9A 4E7RG 3SI3H 3ITIA 1KYNA 4BTIB 1MZAA 3SJ8A 3H09A 1C5QA 3SQHE 3I29A 2FWWA 2VIOA 1GBLA 2FMJA 2D26C 2UUJB 5C0TA 4XBBA 1WQVH 1H1BA 2AGGX 4U30A 4A6LA 4FUCA 1UK4A 1TABE 2QXHA 1THSH 2ZQ2A 2BD3A 5C67A 1BMAA 2C93B 2ZU2A 2VGCB 3RXPA 2FOFA 3M37A 4BAKB 4Y10E 3LOXA 4ABIA 5T1VA 3A84A 2GGVB 1HAGE 1TA2A 1TNJA 1AKSA 1E34B 1ZHMA 2GTBA 1SI5H 3MQKC 1GJ7B 4I32A 2H5DA 1C5NH 5JPMH 4UE7H 4GHQA 3A88A 5EU8A 1H9IE 2BDIA 2GV7A 1YPHE 3Q00A 2HNTE 3N7EA 1K1OA 1C2LA 3IWMA 3RP2A 1W11U 3SUGA 1LHFH 2GT7A 2K0QA 1NBME 1OOKB 3SUEA 3UOUA 3M35A 1J16A 4MPXA 2B7DH 1HAZB 5C94A 2Q6FA 1Y3WA 1AB9B 2AS9A 1C1UH 5LGOA 4R8TB 2ZQ1A 2V0BA 2O8LA 1SB1H 3K65B 1QGFA 4FU8A 4DG4A 3UWIA 4K8BA 1FY4A 1D6RA 1DY8A 2ZTYA 3BTWE 4VGCC 3RUOA 2XRCA 1ELTA 1GJ8B 1ZMJA 2W3IA 2Y5FA 3D62A 4OM9A 4YT6H 1MABB 1EAIA 6CHAC 4B1TA 1DICA 1SHHB 5CDFE 1CU1A 2GP9B 1GMHF 2JETC 1D3PB 1AFQB 2GKVE 1O2YA 2ODYB 5EODA 1BRUP 4NIWA 4ZXYH 5A0AE 3NRLA 1V2MT 1C5RA 3BG8A 1NN6A 2SGFE 2WV5A 1ZTLA 3DUXH 2ANYA 3B23B 3AASA 1O3KA 1Z8RA 2BLWA 5E2OA 1SFIA 1LHGH 2CK3D 3LONA 1ESAA 4RKJB 1WUNH 1HBTH 1EZSC 2PKSC 2R0KA 1W3CA 4UFEH 3KNXA 3LH3A 3IITA 1C2MA 4FUEA 1V2VT 1C5WB 3A8DA 1BTXA 4JZFH 2ZFSA 1QQUA 1FIZA 3GYLB 4NA8A 5DO4H 1GL0E 2A7HA 1FAXA 2GMTC 1TA6A 2AGIX 4Y8ZA 4WH8A 5JB8S 1DM4B 1NM6A 4ZHMU 3RXEA 3S7HB 1D9IA 4AFQA 1QJ6B 3RXOA 1TWXB 1SPJA 1SQAA 1ZJDA 1Y3UA 4TPYA 4Z6AH 2V3MA 4A5TS 1AN1E 2PTCE 1IHSH 2P3UB 3M3VA 1PYTC 2B5TB 1UMAH 4X2VA 3TNTA 3E8LA 3OAAD 2BY8X 4RI0A 2AMQA 1GG6C 1QB1A 4CH2B 3GY3A 1AUJA 4NWKA 2VIDA 1GHAG 5GNDA 2J98B 3KCGH 1V2UT 4BAMB 1LDTT 3Q3YA 1C2HA 1XM1A 1W7GH 2O8MA 1OS8A 1ZMLA 1HXFH 4OS4A 3TK6A 1G3EA 1P0SH 5E0GA 2KX4A 1ESBA 1DLKB 3A82A 5F8TA 1IQFA 1Z6JH 3TVJB 1PQ8A 2KAIA 4TWYA 2FOCA 3ZZBA 4YTAA 4AG1A 1DLEA 1GMHG 2TIOA 2BD2A 1E37B 4GCHF 4WH6A 1WTGH 2YMSD 1SHYA 2Z9JA 3QK1A 4HFPB 4XBDA 5HM2A 1HAVB 3D23A 1L1GA 1ZOMA 2SFAA 2WSSD 3PO1B 1Z1JA 2HALA 5EW2H 1ELDE 1KXCA 4DOQA 1C5YB 2Y81A 4Q2KA 3FP8E 4XFQA 2Y5HA 3M7QA 4OS2A 4AOQA 1TONA 4UDWH 1F5KU 2A7CA 4X1RU 1C1TA 2P8OB 2VWLA 1GI1A 1KLIH 2ZC9H 5CHAB 3RXHA 2ZHDA 2EI6A 2NWNA 3RU4T 3T5FH 3RC6A 2GDDA 2VVUA 2A5AA 1FUJA 1FX0B 3W94A 1C2DA 1MTUA 1O3EA 1C1OA 2BVRH 4DW2U 3MO9A 3E91A 3TJNA 2CF9H 1C9TA 4ZUHA 3VGCB 3RXUA 1O2HA 5FHTA 1EAUA 2VINA 1FZZA 4JZIA 5AVDA 1IQMA 1GI8B 5CE1A 2PKAA 2FIRH 1EZXC 1GHYH 3GYMA 1EP5A 1EJAA 1C1WH 1GBIA 1O5BB 1OWDA 3GY5A 1C2EA 5F03A 1QFKH 3BF6H 2QF4A 3CP7A 3T27A 3MO3A 1BMFD 1GJCB 2AMDA 2H9EH 3A7WA 4XE4A 1C2JA 3EA9A 1A5HA 1VITH 3E16B 3TGJE 1EZUC 3UIRA 4F4OC 1MH0A 1OWKA 2BM2A 3A8BA 4DIIH 1IQIA 1DSUA 1NRPH 2QYIA 4NZQA 3QGNB 7GCHG 3CENA 5DP5A 1G2LA 1MD7A 4D7FA 4GHTA 4X1PU 2C90B 1AY6H 3P8NA 2EEKA 1AVWA 2ZP0H 4FUFA 3ZVGA 5ABWA 1OYTH 1SMFE 1OHHD 1SQTA 1UK2A 1H4WA 4LXBH 4WJG2 5DP6A 3UPEA 4H42U 3TNSA 3LGTA 1RJXB 3L6PA 2BTCE 1S6FA 2RA0A 3RU4D 1CA0C 2R9PA 3KYFA 2O8UA 2AFQB 2ZDKA 3SNDA 5AFYH 1QY6A 3M3TA 3A83A 2F9PA 2R2WU 3AAUA 1T31A 3W95A 3SUDA 1IQEA 3UOPA 3ZZDA 1Y8TA 2XTTB 2G8TA 1O36A 4MNYA 5DPAA 2KCOA 2RFKC 1AWFH 1NFUA 1ORFA 3AW0A 1MTWA 2CV3A 3SI4H 2Z9KA 1BDAA 1DWDH 1C1VH 1T8NA 5GWZA 3SV9A 4M9FA 2CXVA 2FX6A 4M7GA 1P01A 1Q2WA 3SJIA 3MOCA 1FV9A 1MBMA 1AIXH 1DY9A 1PPBH 1WBGB 1GPZA 1OP0A 3KL6A 2TGAA 2ZNKH 1P57B 2ZHWH 4NSVA 1T4VH 1C2FA 1NRSH 1LQDB 3ODFA 4ASUD 1O39A 3MNCA 4HGCA 2DUCA 3KQEA 1FNIA 1H8ED 1TNIA 3PMJA 1XUFA 5LPEA 4RT1A 1RIWB 1PPHE 3OSYA 4IBLH 3PMBB 4F49A 1S85A 4Y71A 2FOBA 3RMNH 1PQAA 3BG4B 2R3YA 3N7DA 3NK8A 1JWTA 1EJMA 4A1XA 1L1NA 1UVOA 3B9FH 3EE7A 3GY7A 4ZHAA 1LO6A 3A85A 1Z71A 3RXGA 1ZYOA 5GIBA 2GJGA 4TYDA 5FCKA 1DDJA 1KSNA 3EE0B 3F2HA 2I6SA 2KCAA 3ZV8A 3PRDA 2B8OH 2VNTA 3H7OA 2W5EA 6GCHG 2UWPA 4KKDA 3RXRA 1LHEH 2YMSB 3RMLH 1A0LA 1GJAB 1YC0A 2WYGA 1G36A 4NZLA 1BTHH 1CGIE 1XMNB 1GMDF 4KGAA 1GBEA 1NY22 3RU4E 3VG8A 1GJ6A 1HPGA 4JK6A 3KQ5A 1YCPK 3ODDA 1SOTA 3SU3A 2KZ4A 1QL8A 1O2RA 1K1LA 1Y3YA 4B2BA 1TALA 1BQYA 5GJ4B 1MU6B 1DUAA 1LMWB 1IQNA 2A45B 1TRMA 3G01A 3CNRA 4K60A 1CA8B 4YLQH 5FAHA 1GCTC 1WU1A 1XUIA 8KME2 3TK9A 3BIUH 3F9GA 2NU4E 3RXMA 4E7NA 2ZO3H 3EA8A 2BLOA 1TGSZ 2NU0E 3RXLA 1TNGA 1ZTJA 1L2EA 1K28D 2ZGCA 1A0JA 3HPTB 1O3LA 1EB1H 3A7TA 1CT2E 2R3UA 4ISOA 1YPMH 1YY3A 3NCLA 1QB6A 1LVMA 2GVFA 1ANBA 1YLDA 3GICB 3PLBA 4FUDA 4MNVA 2D1JA 2OK5A 5A09A 4ZKSU 3OTJE 3PWBA 1TB6H 1LPGB 3JZ2B 4JYUH 3E6PH 1TGBA 1C5PA 2J4IA 4XOJA 1DVAH 3O8DA 2VWOA 1HAYB 3KQDA 2PV9B 4MVNA 2BMGB 3TGKE 4I33A 1BMMH 1C5XB 1WAYB 2ZU1A 1EAXA 3K6YA 3T62A 1FLEE 2PGBB 1WV7H 3S9BA 5DJ7A 3RXKA 3SGBE 1CT0E 3BTME 3MU8A 2WPKS 1ELFA 1SR5C 2BD5A 1VJ9U 2BXTH 1GJDB 1IQJA 1OX1A 3RMOH 4VGCB 1ARBA 3MO6A 2Y80A 3PV4A 1AVXA 4INKA 4OS1A 3RMMH 1TX6A 2K1QA 3A7XA 2QN5T 1AQ7A 2OP9A 1C5LH 1TNHA 2FI4E 1TPPA 2JETB 1K1MA 5C1XA 3VXEH 1Y5BT 1EXFA 1FONA 4WMDA 1GMDG 4F48B 2ZIQH 3EYDA 1O2XA 1XXFA 1TPAE 4GLYA 1A2CH 2Q6GA 5F8ZA 5FX5A 1XUGA 4BTTB 3RLWH 4D8NA 1FN6A 1FIWA 2HWLB 1YLCA 1VCQA 2L6OA 1O2IA 1TOCB 4KELA 3UQVA 1GJ4H 3SV8A 1FPHH 2PKSB 1AMHA 2GZ7A 1HXEH 3UR6A 1ANEA 1T8LA 2RA3A 2KR7A 3ZZ3A 2NU3E 5IK2D 1V6DA 2C8YB 1FMGA 2XBWA 4Y11E 2V35A 2VVCA 1DFPA 1O3OA 1C4V2 1N8OB 1WOFA 6ESTA 1GJ9B 2F9NA 1SGFA 1T8MA 2ZU3A 1E79D 1O33A 3SGAE 2XC0A 4ZAEA 3RXAA 4GPGA 3RM0H 1ZTKA 1VKYA 4INLA 2ZFFH 4NGAH 1SGYE 4KTSA 5T6GA 2WPHS 5B6OA 1TMUH 3FKSD 3UAIC 5A8YA 4I7YH 2J98A 1N1LA 3DA9B 1FY5A 2FOHA 1ANDA 5G4BA 3SN8A 2Z94A 1JMOH 2VIVA 3NPSA 3UNQA 4AGKA 1NFXA 3PM3A 2QXIA 1GG6B 1XKBC 2BDHA 1VCPA 1O2LA 2PP6A 3BEIB 3OU0A 1HNEE 4P00A 5FXLA 1C5TA 4AN7A 1O5AB 1U6QA 3QTOH 5E0HA 1Y5UT 4WF8A 2PFEA 4HG6A 4MDSA 2UUFB 1AD8H 1O5DH 5H4IB 2LP6A 7KMEH 1GBHA 5F6MA 1JBUH 5ESTE 2SGEE 2JJ2D 5B6LA 4B2CA 1F0UA 1SGFG 1TBZH 4X0WU 4AX9H 1FQ3A 1HAVA 1CGJE 3P8OA 3RXJA 4HI3A 4ABBA
chains in the Genus database with same CATH topology
2EC9H 1S81A 4ZKOU 2QV1A 4K69A 3HKJB 1W0ZU 3BN9A 3KHVA 2AYWA 1NT1A 3MU5A 2VJ1A 3M61U 1RD3B 4E05H 2TPIZ 2D2DA 5SGAE 2CHAB 3TLOA 2BOKA 3SNBA 2G51A 4AYYB 3MNSA 1HV7A 3SO3A 3O8RA 1W7XH 3DT0H 4Q7YA 1SLUB 2Z3EA 1JIMA 2QXGA 1YGCH 3ZZ5A 4BANB 3MWIU 1GI3A 3GCOA 4YOGA 2OC0A 1QRWA 1EKBB 1S5SA 1CE5A 3EDXB 4JMYA 1QJ7B 1ZHRA 2ALPA 4AB8A 2LNCA 1VCWA 3C27B 2ZKSA 1LHCH 1EAWA 1V2QT 3TJVA 4ISNA 4FUJA 2ZGHA 4I31A 1ID5H 1GVKB 1UK3A 1EB2A 2J94A 1INCA 4DURA 1VGCC 1ZZZA 4KTUA 1QRXA 1UVUH 5FBEA 1C1RA 4B2AA 5FPTA 1LKBA 4I8GA 2STBE 1QCPA 4B71A 4CR9A 3NKKA 1OYQA 4LZ1H 2W3KA 5EQRA 1HRTH 1GHAF 2GD4B 3C1KA 4ZROA 1L4ZA 3M5NA 1P2IA 7LPRA 2A5IA 2FOAA 1HAOH 3GCHB 5PTPA 3ESTA 4O3TA 4NCYA 3IG6B 3SHCH 2ZGBH 2IN2A 4I8LA 1FN8A 5C20A 4HTCH 1AFEH 4LZ4B 2BQWB 1GHVH 2RCEA 4AFSA 1QRZA 2PSYA 1O3JA 1XUJA 1L4DA 2FP7B 1C5MD 1UCYK 1SGRE 4A7IB 1GBAA 1CHGA 1MKWK 1QA7A 2ZI2H 4FXGH 2PHBA 2CJIA 1BIOA 1CHOF 2JKHA 1CA0B 3QLPH 1EPTC 1FY1A 2J9NA 3MH7A 4FUHA 1GI5A 3L33A 5HMAA 1CBWC 1UTQA 1CQQA 3UR9A 1PPGE 1V2ST 1Z6EA 3FVFB 3EA7A 1RGQA 3MHWU 3BTDE 3ZZAA 5DKMA 1C1NA 1KIGH 2EI7A 1O5GH 1CGHA 1GDQA 1FY8E 2CN0H 3SV7A 3T2NA 1GBTA 1P2MA 4SGAE 1K1PA 5C5NA 1K22H 4O3UA 1DITH 4AG2A 8GCHF 1S6HA 2G4UA 1UJ1A 3RC5A 2RDLA 3QTVH 3RXIA 2PUXB 2B9LA 2XC4A 1G3CA 1TAWA 2GT8A 1GGDC 3VPKA 3U1JB 3MI4A 4X8SH 3SJKA 2ULLA 2FEQH 2TGPZ 1C5SA 4R0IA 1PPEE 2B0FA 4Y8YA 7GCHF 1MD8A 5E2PA 1P2JA 1W12U 3LC3A 1O31A 3SJ9A 2C8XB 4H6TA 1O3PB 1OPHB 3KEEA 3JZ1B 4K3JA 1TGCA 4ESTE 2FOEA 2G00A 5DP7A 3SU5A 1NU7B 2VU8E 2HPPH 5A8XA 1CT4E 1FJSA 5GPIB 1EOJA 4UONA 2I6QA 1SLXB 6LPRA 1Y3XA 2OC8A 3RXQA 4LOYH 1AE5A 1ELCA 2FTLE 1MKXK 2Y6TA 1JXPA 3E1XB 4FUGA 3MU1A 1TBQH 3MH4A 4OS5A 1S82A 1SGTA 2ZGJA 1S83A 1CHOG 2PUQH 1O2UA 4ABGA 1EQ9A 1TRYA 3B8JA 1GL1A 1BBRH 3NXPA 1E38B 3LGWA 1MCVA 4Y7AA 3GCTF 4ASHA 2FLBH 2BDYA 5I25A 3K2UA 1GCTB 1O2VA 2FS8A 5DK1A 1P9UA 3SHAH 4CRBA 1BITA 5EPNA 2ZU4A 1C1PA 5JYIA 1FPCH 2BLVA 1HJAB 1KLJH 2G5VA 3MTYA 1XUHA 2ZU5A 3STIA 8GCHG 2IOTA 2PGQB 5DP3A 4O97A 3HGPA 1B7XB 1GJ5H 3P95A 1NRNH 3RXBA 3SU2A 4ZMAH 2BD7A 1MZDA 4SGBE 3M3SA 2M5TA 4U32A 5K7RA 4CHAC 4WXIA 1WTHD 2BD9A 3VXFH 5L2YH 1P12E 4IMZA 2Z3CA 4U01A 1UVPA 2VVVA 3DHKH 2HOBA 1BRBE 1PQ7A 4Y7BA 5F8XA 3F68H 4J2YB 2P93A 3T29A 3I78A 3BTQE 1DOJA 4OGYA 1ZSJA 2FO9A 3SUFA 3UFAA 1C9PA 1QURH 1BB0B 3L3TA 3RLYH 1GI9B 5EXLA 4UFFH 1GHWH 3SOSA 2VIQA 3SV6A 4IC6A 1G37A 5FBIA 4ABJA 6GCHF 1VITF 2FYRA 1AB9C 1VR1H 2EA3A 1HDTH 2XCFA 2OTVA 4YZUA 1SBWA 2D8WA 3T28A 3D65E 4UD9H 2BZAA 1IQGA 1NFYA 1B0FA 2A7JA 1A0HB 1AFQC 1GDNA 1UTKA 1F5LA 3UTUH 1MTNC 4PROA 2V3OH 1OSSA 4ZKNU 1LKAA 3GCTG 1DX5M 4H4FA 1S84A 3ZZ6A 1MAXA 3AW1A 4DIHH 1O2SA 1HAHH 3E90B 4WY3A 3KF2A 4ZHLU 1HJ9A 3RXVA 3KIDU 2FM2A 2XBXA 3P8FA 2PR3A 2BXUH 3LGIA 1B0EA 4GUXA 2FLRH 3TU7H 3PMHB 1IQHA 1O2GH 1BUIA 3FFGA 1P04A 1MUEB 1G30B 4NG9H 5EW1H 4B75A 2ASUB 1V3XA 1YPKH 4MQAA 1TFXA 3DFLA 3QUMP 1ZJKA 1NU9A 1P9SA 3PTBA 1C1SA 1MMJN 1O3HA 1Q3XA 1KTSB 4X1SU 1ABJH 1YPHC 4IS5A 3AAVA 2HNTC 2ZDVH 4GAWA 1SSXA 3A86A 2A4GA 3U8RH 1GVZA 2XWAA 5FX6A 1PFXC 1CO7E 2PW8H 3U98H 2F9VA 3STJA 3LKWA 1E0FD 1P2KA 2VIPA 1Y5AT 3ATKA 1PYTD 1SGDE 2FODA 1P2OA 1GWAA 2STAE 5DP9A 3SORA 5EPYA 1ZSKA 4CBOA 1D4PB 4ZH8A 2BD8A 1UVTH 2A2QH 1AI8H 2BY5X 1SGNE 2AH4X 3FAOA 4K1EA 1NO9H 3DD2H 1UCYH 2BD4A 3AVZA 4THNH 1O3CA 3LIWA 1VITG 3MNBA 2ANKH 1TNKA 1SL3A 3V13A 3GY4A 2BHGA 1TX7A 2H1UA 4NIVA 3GY6A 1DS2E 4MTBA 4MPUA 1BBRE 1AVGH 2SGQE 1C5OH 1S0QA 1C5VA 1YP9A 2J2UA 1TYNA 1GCDA 3HKIB 1UHBB 2FOGA 3FZDA 2F91A 2GDEH 4MPWA 5DGJA 2W26A 4Q7ZA 1DT2A 5TJXA 4NFFA 1J17T 1Z8GA 2XW9A 1ZHPA 1OP8A 3FP6E 4RKOB 3UNRA 5T6DA 1K1JA 1AHTH 5IYTA 1G2MA 1C5ZB 3KN2A 2F83A 4B73A 4DCDA 1L0ZA 1QJ1B 4Y76A 1F5RA 1B5GH 5TCAA 1GBFA 2Z9IA 1QBNA 3LJOA 1MU8B 3SW2B 2P95A 2ANWA 5EQSA 2DE8A 5FPYA 3URDA 1W14U 1OWEA 3SNAA 2J92A 1BTZA 4I8KA 3A89A 1LVBA 4IN2A 1A3BH 3UNSA 3VGCC 1ELAA 2ZA5A 2JH5D 1P11E 2XXLA 3UREA 1J8AA 2YNAA 4HZHA 2QY0B 5C5OA 2OUAA 2XYAA 2ODPA 1V2NT 4ABAA 3P6ZB 4KP0A 2UWLA 1HB0B 1G3BA 3A7YA 3Q76A 1BZXE 2AEIH 1J15A 3ENSB 3S9AA 1MKXH 1W8BH 2XWBI 1IQLA 4CH8B 3WY8A 1GHBF 1KDQB 2ZCKP 1RXPA 1P02A 2AIQA 1J14A 6CHAB 1DXWA 1IQKA 4QT8C 4OGXA 2P94A 1D3DB 2QA9E 2SGDE 5L6NH 5A0CA 4K5ZA 5DP8A 3M36A 1EPTB 1RTKA 1GHZA 2HRVA 4WMEA 2ZWLH 1CBWB 3F6UH 3BTGE 2GX4A 1XUKA 1MBQA 3RDZA 2J95A 1BOQA 1GVLA 5FPSA 4AORA 3BTTE 4XBCA 1A7SA 1O2QA 1E35B 2C8WB 5BPEA 4ZKRU 5AHGH 4BOHA 4CRGA 1NZQH 1YM0A 3HK6B 2Y82A 2XNIA 3ZVCA 3U9AH 2ANMH 3H5CB 1HGTH 2XBYA 2VWNA 4MLFB 3F9EA 2AGEX 1IAUA 2GMTB 1TMBH 3NWUA 3V12A 1TPOA 4UFDH 1KXBA 1K21H 3BEFB 3D49H 4BXSA 1ETRH 5BRRE 1BRCE 1XKAC 1O2MA 1JOUB 4YLUA 1MTSA 1GGDB 2ZECA 1AO5A 2G4TA 2JH0D 4O9VA 1SQOA 3UQOA 2OC7A 3KQCA 1T4UH 1OP2A 1KXFA 4CBNA 1XVMA 4NA7A 4FU7A 2F3CE 5K0HA 3MU0A 1K9OE 5DP4A 2CGAA 4WVPE 1QIXB 1OWHA 1RIWC 2BX3A 1JRSA 4FU9A 1TPSA 4D7GA 4JK5A 3S69A 3ATMA 4IGDA 5C1YA 4ZXXH 3NZIA 3P17H 2QGRA 3LGUA 1P06A 4YOJA 1QA0A 3LPRA 1HUTH 1GBBA 4X2WA 4Y0ZE 1WQSA 2BDGA 1GHBG 1SOZA 1DWBH 2FESH 1TOMH 3ZZ9A 1YPJH 4D9RA 3T25A 4DVAU 1HIAB 4OS6A 1E36B 1LHDH 1CVWH 2ZCHP 1VJAU 1QNJA 2G55A 2EI8A 1KXDA 2H9HA 1SLWB 2IJOB 4MNXA 3TH4H 2OD3B 1O2JA 2Z9GA 1N6YA 3GISB 1BHXB 1GBKA 4NSYA 2VH0A 2CF8H 2GCTC 3NUMA 1GI6A 2SGAA 1NPMA 5HGGA 4FUBA 4RSPA 3I77A 8LPRA 1V2OT 1AWHB 1QR3E 3ZZ7A 1PPFE 2R0LA 1O5FH 2OQ5A 2PWXA 1O0DH 4AYVB 3LGYA 1EASA 1BTPA 9ESTA 4CHAB 3SNEA 3ZZ4A 2UUKB 2BDBA 4A1TA 1A5IA 4IC5A 1YF4A 1EJNA 1GHXH 4Q80A 1QHRB 2OBQA 1ACBE 1TQ7B 1TMTH 4BAOB 2P3TB 1P3EA 1TE0A 4A92A 3K6ZA 3RM2H 4D9QA 1HYLA 2NU1E 1MCTA 1P2QA 1F0TA 1L1JA 3FANA 1OKXA 5ETXA 2F9BH 2V6NA 1SGQE 5GDSH 5LPFA 1RTFB 2TGTA 2G81E 2ZEBA 4X1QU 2ZTXA 1LPKB 2FI5E 1C2GA 2WV4A 1Y3VA 3E0PB 1YCPH 1QTFA 3RC4A 1LVYA 4FUIA 1ZPBA 3QX5H 3RXDA 1H8DH 3M5LA 1D3QB 1DWCH 3QGJA 3GY2A 4NA9H 4B76A 1V2PT 2ZDNA 2ZDAH 1SGCA 2ZFTA 3BV9B 1UO6A 4Y8XA 2ZCLP 1DSTA 2BLQA 5J4QA 2XC5A 2YNBA 3ATIA 3GOVB 1O38A 2HGTH 3GDVA 2TBSA 2ZHEH 3VEQB 4CRDA 1GI7B 2A4RA 2H5CA 1EOLA 2OINA 3S0NA 4AGJA 3SJOA 5JB9S 1MTNB 2SNWA 2C8ZB 2GCHF 1T7CA 2H9TH 1LVOA 4Z0KA 3UY9A 2LPRA 1ZGIA 3SV2H 4NWLA 1WSSH 4K1SA 3F9HA 3MH6A 1F92A 4DJZB 1A4WH 3DFJA 1JRTA 1T8OA 3TIUA 4X6MA 1V2JT 3BSQA 5HM9A 3QWCH 5EG4A 1P2NA 5JDUB 5LPRA 1RS0A 2WUBA 2ESTE 1BRAA 3A8CA 2AIPA 5L30H 3ELAH 3LT3A 1SGIB 1QBVH 4NIXA 4J1YA 1EATA 2ZHQH 1N8OC 2O9QA 2FS9A 5LH8A 2FI3E 1O3FA 1YBWA 4Q7XA 4YO9A 4X8VH 1O3NA 2JH6D 1NRQH 1QB9A 1UTLM 2Y7XA 1O2NA 1DPOA 4IW4E 1TRNA 4JZEH 3O8CA 3LDXH 2Y5GA 3SU6A 1YYY1 1V2KT 3R3GB 4DGJA 4FVDA 1H8IH 3RXCA 4OS7A 3BTHE 1GBJA 3Q3XA 3TK5A 2W7UA 3OYPA 1KXAA 1NFWA 4RN6A 2A5KA 3QN7A 1UHBA 5EOKA 1SG8B 9LPRA 1TGNA 1THPB 1A61H 2ZPSA 2VB0A 4BAQB 2H2ZA 2BQ6B 1BTYA 1GMCF 3M5OA 3UWJH 3URCA 3SU0A 3ATLA 2V3HH 2ZF0H 4ISIH 1V2RT 2BVXH 1O2PA 1SGEE 3V0XA 4X1NU 2A4OA 4DY7B 2GCHG 1O2TA 2ZG0H 1O3AA 3P8GA 5TCCA 1ESTA 1ZPZA 1MAYA 1V2WT 4AB9A 1BCUH 3V3MA 2QIQA 2WPIS 5AFZH 2YOLA 3KGPA 1XXDA 2PTNA 2CHAC 1P03A 1BTWA 4WXVA 2J38A 2THFB 1NC6A 2VGCC 3RXTA 2Z6BD 2ODQA 3TJOA 2BOHB 1V2LT 2ZTZA 4CRCA 5EXMA 4ABEA 3ATWA 5E0JA 1P8VC 2ZFRH 1P05A 1RRKA 4TY7A 1O3IA 2OBOA 3A8AA 3KQBA 4X6NA 3LGVA 1A46H 1HLTH 1EZQA 1O37A 1MQ6A 4X2YA 2FX4A 4X8UH 3PMAB 5GCHF 3U69H 3PYHA 1RTLA 1AKSB 3R0FA 5GXPA 1F0SA 2WPMS 2TGDA 1S0RA 3LH1A 1OWIA 1DXPA 1O2WA 1QL9A 3EQ0H 4X8TH 3TGIE 1TBRH 3O8BA 4ISHH 1J9CH 5JBAS 1LQEA 1JIRA 3PLPA 4BXWA 1K2I1 1BTUA 3CS0A 1SC8U 1KDQA 1YCPM 4Y6DA 2FTMA 3SU1A 1C1MA 1ANCA 1TX8A 3SU4A 1GDUA 2J34A 1BMLA 3OX7U 2O8TA 5A0BA 1P10A 4WMFA 3ZYEA 3GCHC 2HLCA 4CR5A 4YM9A 1F2SE 1EPTA 1F0RA 2F9UA 3GDSA 1GI4A 1A5GH 2VH6A 3BEUA 4ABDA 3P70B 4AZ2B 2BY9X 3SZNA 1O3DA 1ZRKA 2VWMA 3GCNA 3H7TA 1C4U2 3MYWA 3VB4A 1HFDA 1YPGH 1C2KA 3TITA 1AE8H 1GMCG 2ILNA 3N7OA 1FDPA 1O3GA 1O2OA 2UUYA 1HAIH 2OXSA 3ZVEA 4FVBA 1ZLRA 1W10U 3F9FA 4GCHG 3QDZB 4JYVH 3HATH 1QQ4A 4X2XA 4TWWA 1TNLA 1XVOA 3SNCA 1O5EH 1K1IA 5C2ZA 1G3DA 2QF0A 1IOEA 1YPLH 4GVUA 4UEHH 3S9CA 2ZGXH 1H9HE 1Z8JB 1KY9A 4X6OA 2GZ8A 1C1QA 1UTPA 2HVXA 1O35A 4H6SB 1ABIH 1ELEE 1FI8A 2ALVA 1ZGVA 2Z3DA