5T6DA

2.10 a resolution structure of norovirus 3cl protease in complex with the dipeptidyl inhibitor 7l (hexagonal form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
174
Chain Sequence
HHHAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based exploration and exploitation of the S4 subsite of norovirus 3CL protease in the design of potent and permeable inhibitors.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Protease/protease inhibitor
molecule keywords Genome polyprotein
total genus 40
structure length 174
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t6dA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5t6dA01
2A4RA 1O2OA 2ZTZA 2R9PA 4BANB 4UDWH 4IBLH 1Q2WA 4AB8A 3GY3A 3UR9A 9ESTA 1LCYA 2G00A 3KF2A 7LPRA 3MO3A 1N6YA 2Z9IA 1H4WA 2XBYA 1P2QA 2A0QB 1V2VT 4H4FA 1Z8GA 1GHAF 1EKBB 2ODQA 1NM6A 2PV9B 1O3AA 3T25A 1KXAA 3SNAA 1AU8A 3NWUA 5CHAC 3M3TA 3RXDA 2G8TA 4AYYB 1EQ9A 3ZZ7A 3M5LA 1AIXH 1NRPH 1BTXA 1C5WB 1MAYA 2ZIQH 4OS5A 2IJOB 2C93B 5C3NA 1TONA 2JH5D 1GMDF 1C1RA 3PLBA 2UWLA 1ANDA 3GOVB 2D2DA 2R0LA 2GVFA 2A7JA 3OX7U 1O35A 5LGOA 3K65B 1LO6A 2Q6GA 1KIGH 4WXVA 3A83A 3B23B 2GT7A 4GHTA 4H6TA 4WVPE 2F9PA 2B8OH 3SZNA 3UOUA 1SQOA 3UR6A 3SNEA 5GCHG 3ZVAA 1PQ5A 1QURH 1G2MA 3GY4A 1UO6A 2QXIA 1AWFH 1RS0A 2PFEA 2BDAA 2Y5HA 3RXGA 3ATWA 3F6UH 4CRAA 2EI8A 2SFAA 3RXQA 1RIWC 1O2LA 2CXVA 3LGYA 1DWCH 2RDLA 2BDYA 1J14A 1HFDA 5F8XA 3SORA 2LNCA 1P0SH 1MCTA 2XRCA 2CGAA 1A5IA 3T29A 1K28D 4IN2A 1CBWB 5G4BA 1MTVA 3Q76A 4NA9H 2A4OA 4WMEA 2P8OC 4Z6AH 3A7TA 1BMNH 1O3EA 1ARBA 1HAVB 1YPKH 1BMMH 2F83A 1S83A 2OBQA 3TIUA 2Z3DA 2ZGBH 4PROA 2CN0H 5IYTA 2VIQA 1W0ZU 2VH6A 4Y8ZA 1DSTA 8ESTE 3RC4A 3BIVH 1W8BH 3BTEE 2XBVA 1GHBG 1VGCC 7GCHG 1DLKB 2PSXA 3SV2H 1Z1IA 3P8FA 1CHOG 1FUJA 1E36B 1ZGIA 1OWIA 2ALPA 3SGQE 4DVAU 4I33A 1V3XA 1BTYA 1A3BH 2O8WA 1ZPZA 1V2OT 1H8IH 1BJUA 1Z6JH 1O0DH 1TPPA 1RTFB 4MG3A 4O03A 3S7HB 3SUGA 2W26A 3W95A 2A5IA 4YT6H 1L0ZA 2PUXB 1NTPA 2BQ6B 1WV7H 3H7OA 3A87A 1J17T 1P57B 2PUQH 2ZCLP 1XM1A 1HB0B 4DURA 3EGKH 1ZOMA 3TGIE 1YPGH 1AO5A 1G3BA 1TPAE 3GDUA 1YPHC 2FI3E 3HPTB 2UUFB 2H9EH 1FJSA 2A5AA 1GDNA 1W10U 3SU1A 1K22H 3VGCC 2F9NA 1AMHA 3S0NA 1NRRH 5LPRA 1CQQA 3MU8A 4YTAA 5L2YH 1V2UT 1UCYE 4NWKA 1GJCB 3U8OH 1O31A 3ENSB 2PWXA 1BT7A 3JZ2B 5JBAS 1U6QA 1QJ1B 5E0JA 1FMGA 1E34B 3VGCB 3LDXH 4TWYA 4JZFH 6CHAC 2NWNA 5E2PA 3MH7A 5TCCA 1HAZB 2BD2A 3P17H 1G30B 1GI1A 2PTCE 3TNSA 3ZZDA 1O3DA 4Z0KA 1TGBA 4ZAEA 1BBRH 1TIOA 1SOZA 1VITH 2PKSC 4ZMAH 4RKJB 5A8ZA 1AB9B 3QGNB 8GCHF 1S84A 2Y7XA 1CHOF 4ABFA 3HKJB 2XCFA 4WXIA 3MNSA 2TBSA 3GCHC 1WYKA 1AI8H 1BBRE 3MI4A 1C5OH 4NIYA 2XXLA 1BMLA 1ELAA 4WH8A 1HXEH 2F9OA 4X8SH 4CHAC 3HGNA 1OSSA 5JBBS 1EASA 1SGPE 3GCHB 1QRWA 3SJ8A 2EA3A 4AFUA 4AN7A 4MNWA 4HTCH 4INHA 5AFZH 3M5NA 3F9EA 4MTBA 4E7RG 1A61H 4XBDA 2WYJA 4CH8B 1IQHA 2OTVA 3TPIZ 1ZPBA 2ZP0H 2PLXA 3BG4C 5CHAB 1ETTH 1FPHH 1DITH 3FFGA 1MAXA 1UTNA 3NXPA 3O8CA 1NFYA 1ZGVA 1TGSZ 3UFAA 1GJ5H 1TGTA 2FOMB 3PTBA 4O97A 5GJ4B 1NT1A 3BEFB 3BV9B 4FVBA 4GUXA 1HLTH 2ZHQH 2BD8A 1TPSA 1UVUH 1YCPM 3EQ0H 1CT2E 4GCHG 1RTLA 5DP5A 5FX6A 1V2KT 1Y5AT 1EPTC 4OS1A 2P3FH 4ISHH 3UQVA 1UTKA 4Y10E 2BX4A 3IWMA 1C4V2 1MKWK 1HAPH 1O39A 1YYY1 3SGBE 1TNJA 1KXDA 4KTSA 1C5XB 4U30A 1SGQE 2QGRA 4I31A 1G3CA 1AVGH 1PYTD 1UK4A 1GI6A 1ORFA 1OWJA 1QNJA 3PO1B 1EJMA 1RIWB 3ZZ4A 4FUBA 4X1QU 3BTME 4DCDA 1AVWA 1XUFA 2CF8H 3SV7A 3MNCA 4UD9H 2P16A 1BA8B 1ABJH 2Z9LA 1K1OA 4Q7XA 2SGPE 3MYWA 3FANA 1C4U2 3K9XB 3D65E 3P8NA 2ZDNA 1TBZH 3BTGE 1QL8A 1BB0B 1LHGH 3DFLA 3LU9B 5FXLA 4AG1A 3QTVH 1FN6A 1F7ZA 1EP6A 3D62A 3QTOH 3M7TA 2ZGCA 1GMDG 4X1RU 2BDCA 2WPJS 1C9TA 1GBLA 1NFXA 2A31A 1MCVA 4JCNA 4MPUA 3U8TH 4X2YA 5AFYH 1HJ8A 1H9HE 1O3MA 5ETXA 1SOTA 2GD4B 1BTZA 2PKAB 1YPJH 1PYTC 2EC9H 1KDQB 3MO9A 4CR5A 3SU4A 1EXFA 4I8LA 1HUTH 2J9NA 2VU8E 3URDA 4DJZB 1SGCA 1PJPA 1K1MA 4I7YH 1GVZA 1HV7A 2VIDA 3BN9A 3NK8A 4D9RA 3HK3B 1ELDE 2ESTE 1UTOA 4Y7AA 3MH4A 5E2OA 1O38A 3FAOA 1BRUP 3ATMA 3UNRA 2HLCA 3RP2A 1SHHB 5SGAE 1QBNA 1G3EA 1P9SA 3MFJA 1ZLRA 3MH6A 1VITF 2QXJA 3GCTG 4K69A 5JDUB 1Q31A 3QN7A 1RGQA 3GY8A 5C1UA 1Y5UT 2UWOA 1WUNH 2FOFA 1RTKA 1AKSB 1OXGA 1XMNB 1S5SA 1H1BA 5FCRA 3GYMA 1Z71A 4ZH8A 2VGCB 3BEUA 1SGRE 1IHSH 1C2HA 3AW0A 3GDVA 3OTJE 4WMDA 3TJUA 1S6FA 1C4Y2 5GCHF 1FY1A 1O2WA 5GXPA 1CE5A 2A4GA 4K8BA 2ZFFH 1MKXH 1EAIA 1C2LA 4A1XA 1GPZA 1IQMA 2G4UA 1NROH 1FIWA 1THPB 3V13A 1FNIA 1C2EA 4YT7H 1GHVH 1A5HA 6CHAB 2HNTE 2FI5E 1AD8H 3TGJE 5AF9H 1O2IA 1C5TA 2ASUB 2F9UA 1DICA 1ETRH 1LQDB 1XVOA 1UTLM 5JB9S 1E35B 1IQNA 1ELCA 1SI5H 1O34A 1O37A 4GVUA 3BEIB 1QJ6B 4M7GA 2WPLS 2R2MB 4Q7YA 1BITA 4INLA 1ELTA 3VB3A 1SLVB 3V7TA 2NU4E 2ZDMA 1UTJA 4MDSA 2VIOA 1SG8B 4X8TH 1V2TT 3A80A 4NIWA 1DLEA 2D26C 2WUCA 1OWDA 4B75A 2VB0A 3CP7A 4JK5A 3TLOA 1WTHD 3RXFA 5C20A 1FLEE 1O2QA 1NY22 3E90B 1OOKB 1GG6C 1SGYE 2AGGX 1QJ7B 4AFSA 1G3DA 1ACBE 4CRCA 1ANCA 1YF4A 4Q2KA 4FU8A 1F92A 2BDGA 3A81A 1L2EA 3RXMA 1PFXC 4BAQB 3LH3A 2H5CA 2ZU1A 2BDBA 1P9UA 1H9IE 3UQOA 2I6SA 4H42U 5JYIA 1JBUH 1GJAB 1YC0A 1DVAH 2QF3A 4TY7A 3SI4H 2VWNA 4Q7ZA 3V12A 1CT0E 5K7RA 2FMJA 3T27A 3TH4H 2PTNA 1O3OA 3BG4B 1ZSLA 4KKDA 5B6OA 1K21H 1SQTA 1SB1H 1NZQH 1B0EA 3B8JA 3RXIA 1VJAU 2ALVA 1C2KA 3MMGA 3C27B 2XTTB 1GL0E 1TBQH 2ZHWH 4BNRA 3BF6H 1FY5A 2OBOA 4XOJA 2EEKA 2SGEE 1S85A 1O3PB 5EXNA 2XNIA 1C5YB 4XBBA 2ZKSA 4ZKOU 3L3TA 1L4ZA 1ID5H 2FOCA 3RXCA 1AZ8A 2P8OB 2ZNKH 4OS4A 5ESBA 3A86A 3SHAH 3VB7A 4BOHA 9LPRA 3QWCH 2EI6A 1TAWA 2V6NA 1WSSH 3GCNA 1ZTJA 4JYUH 1QIXB 1ZMNA 3KQEA 3SU0A 4AFQA 3VB5A 1QB1A 4X6PA 1O30A 4NWLA 8KME2 3KCGH 3MU4A 3R0FA 2AMDA 2GCHG 4XE4A 5A8YA 3V0XA 1LKAA 3D23A 3TITA 1AE5A 4B74A 5J4QA 5FPYA 1O2SA 1KLJH 1YGCH 1EX3A 3LH1A 1O5FH 3SGAE 1YKTA 2D1JA 5LPFA 1BTHH 2ZGXH 3L33A 2XYAA 2H5DA 2BY8X 5EQRA 2O8LA 1WU1A 1QCPA 1DY8A 2HGTH 1LHDH 2BYAX 3ATIA 3RDZA 1PQAA 3M35A 1KLIH 3STIA 4DIIH 1O3IA 2M5TA 4YLQH 1QFKH 3RMNH 5DP3A 2H2ZA 3A82A 1O2HA 1EAUA 3SW2B 3DA9B 4MNXA 5A0CA 2ZQ2A 1NESE 2ANYA 2G81E 1ESTA 3ELAH 1KXFA 1AB9C 1AY6H 1HJAB 2J94A 4A7IB 1O2MA 3UREA 4FU9A 5CE1A 1PPEE 1HRTH 1VR1H 5I25A 1FIZA 1PPFE 1W2KH 1O3CA 2QY0B 4NSYA 2P3UB 3UWIA 1NRNH 2TPIZ 1TB6H 4D9QA 2A7HA 2R2WU 1C5MD 3D49H 1GGDB 4U32A 4DOQA 4Y0ZE 4B73A 4GAWA 3FZDA 3AAVA 2WPMS 2WV5A 2AIQA 5DP4A 3TJVA 2Z9JA 4X1NU 1HJ9A 2ANWA 4HGCA 2FOEA 5T3HA 1V2JT 4E06H 1GGDC 1O5AB 2SNWA 4FUGA 1TX7A 1O2KA 1CA8B 4TWWA 1MTUA 3EA9A 2ZF0H 5A09A 1GJ4H 1MTNC 2BLVA 4D8NA 3K2UA 2XC4A 2KAIA 3PLKA 3AASA 1YPMH 2W7UA 4JMYA 2WV4A 1LVMA 1XUKA 1PPZA 3LGWA 4NIVA 2BD7A 2BX3A 3P8OA 2ZCKP 3QUMP 5C1XA 1BMAA 1AN1E 1A1RA 3M36A 1XX9A 2OC7A 4Y71A 1K1JA 2P3TB 1EAWA 4I8JA 3FP7E 2HPQH 5T6GA 4RKOB 1GJDB 2FZZA 4CRFA 1GBIA 2VJ1A 2GDEH 5EG4A 3RXKA 1TNIA 3M3SA 4GPGA 3SUDA 3ZZAA 1D3QB 7KMEH 1TRYA 5FCKA 3BIUH 2ZI2H 1SLUB 2OUAA 4I8GA 4SGBE 1SLWB 5FBEA 3KGPA 3LC5A 1XXDA 3OY6U 1ELFA 1LPKB 1P3EA 3PO1C 1BTUA 3S69A 2BQ7B 3Q00A 5FBIA 2VVVA 1AZZA 1SGFG 1N1LA 1UVOA 2J4IA 2WPHS 4FVDA 1P2KA 4I8KA 4A5TS 6GCHF 3MH5A 3T26A 3RXUA 3VXEH 2HNTF 4ZROA 3ZVGA 1G2LA 3EYDA 3SU6A 1AFQB 4FUCA 2FOGA 1HAGE 2J34A 3SUFA 1HAXB 1OWKA 2Z3CA 2D8WA 4CRBA 2O9QA 2BXTH 5BRRE 3UNQA 1GBAA 3PM3A 2OP9A 5HYOA 1T7CA 5ABWA 5F6MA 2OXSA 3P70B 3LIWA 2OLGA 1O5DH 2PR3A 3F9GA 3LT3A 1SQAA 3SHCH 3GCOA 2ZHDA 4ISIH 1LHEH 5GDSH 3EDXB 1DSUA 1KLTA 1OKXA 1W12U 5CMXH 1S81A 5DGJA 1VITG 2C3SA 1LPZB 1TRNA 3E6PH 5DPAA 1YPLH 2FLBH 3LGVA 4Y76A 1TMBH 1FPCH 2J38A 3F1SB 2FTMA 1Y5BT 3HATH 1CSOE 1WQSA 4Y11E 4ABBA 1DPOA 3EA8A 2CHAB 1EUFA 3SV8A 1T8LA 4NIXA 2NU1E 1LMWB 1MZAA 3ZYEA 2JH0D 5A8XA 1P2MA 1TNLA 4FUHA 1XUIA 2G52A 2Y5GA 2ZHEH 1XKBC 2AIPA 1W13U 1O5CB 2BD5A 2TIOA 5EGMA 1E37B 2ILNA 2A5KA 2H9HA 4VGCC 1GVLA 2P59A 3E91A 1D3PB 4GHQA 2FX6A 5A2MH 3MU1A 3NCLA 1TALA 2FOBA 1TNGA 1XXFA 1V2NT 1SFIA 3ZVCA 1GI8B 1THSH 2BLWA 2CV3A 4MLFB 4UE7H 1C5VA 1LKBA 1O5BB 4BAMB 2RCEA 1EOJA 4VGCB 4YLUA 7ESTE 4U2WA 2FI4E 2NU0E 3UOPA 5EODA 5HXFA 2GKVE 2GGVB 3JZ1B 4UFGH 4YOJA 1Q3XA 1D6RA 1GJ9B 4IMQA 1NU7B 2TRMA 2Y80A 3M37A 5C67A 1KYNA 1J16A 2QAAA 4CH2B 5H4IB 1GI0A 1SSXA 1AHTH 2W5EA 3TK9A 5EXMA 1UTQA 1GJ8B 1D3TB 1O2XA 1QB6A 3ZVEA 1ESBA 3DD2H 2VGCC 2VIPA 1C5LH 3UWJH 2FYQA 3EAJA 5GPIB 1YPHE 4LK4A 2GCTC 4OS7A 1TQ0B 2Z9KA 2B9LA 3FVFB 1DE7H 5EU8A 1MQ6A 3RXEA 1QB9A 1TOCB 1W3CA 2ZG0H 1YCPH 2QV1A 3TJOA 1CA0B 1GL1A 1V2WT 1GI5A 1VGCB 3RM2H 1DM4B 5FPSA 1EZUC 1UVTH 1FDPA 1MTWA 1P12E 3NZIA 1XKAC 2TGDA 2QA9E 1W7XH 2BLOA 1YCPK 1GJ7B 4X2XA 2Y7ZA 2Q6DA 2PGBB 4KGAA 4NGAH 4O9VA 3U8RH 2FEQH 2I6QA 1T4UH 2SGDE 1IOEA 1SHYA 3SNBA 2CMYA 4FXGH 2STAE 1BDAA 1A2CH 4DW2U 2W3IA 2FLRH 4XFQA 4Y0YE 1KTSB 4B76A 3TU7H 1GHBF 2F3CE 7GCHF 2IOTA 1BRCE 1KXEA 5F8ZA 1S6HA 2GDDA 1A4WH 3URCA 3KQCA 2TGPZ 4F4OC 1OWEA 2VWOA 3MTYA 4D76A 5F03A 2ZEBA 2K1QA 2HNTC 3LGUA 3SJ9A 3KEEA 1GMHF 1BOQA 1Z6EA 3FP6E 2FOHA 2HVXA 4ISOA 2ZHFH 8LPRA 4F49A 3UIRA 3H5CB 2C4FH 1O36A 4NZLA 1ZMJA 1OS8A 3SU5A 1MU6B 1GBCA 1CHGA 1T8MA 1TOMH 2A1DB 3CS7A 3PMBB 2VINA 5C1YA 1RD3B 1HAVA 4CBNA 4B2AA 1KXCA 2ZPSA 1TPOA 4WJG2 3T62A 5HM9A 1GBTA 1YPEH 1J9CH 2ODYB 3S9BA 1Y8TA 1SPJA 1T32A 1DY9A 1EAXA 3BTTE 3SNCA 1EB1H 1NRSH 3KL6A 3TGKE 4HZHA 1C5QA 1ABIH 3RXPA 5PTPA 1G37A 4TYDA 1MMJN 1TA6A 2PKSB 3V3MA 1TWXB 1FXYA 4AYVB 2TGAA 3LGIA 1QQUA 1QBOA 1EPTA 5L30H 2FO9A 4ABGA 2AMQA 1K1PA 4D7FA 1P01A 4JZDH 3A7WA 1CO7E 1O2ZA 2BD4A 3PTNA 3MU0A 3CENA 4R8TB 3TNTA 2ZGJA 2G5NA 1DANH 1MZDA 1MU8B 1LVOA 3GY2A 1V6DA 4HI3A 2P94A 1QQ4A 1V2QT 1J8AA 2GP9B 2XWAA 1PQ8A 2A32A 1NRQH 1SGTA 4X0WU 1P2IA 2O8MA 4D7GA 4DIHH 4JK6A 1UHBA 1GMHG 1TABE 4IC6A 3RC5A 4ZXXH 1G36A 1IQKA 2YNAA 5BPEA 1ELVA 3MU5A 2DE9A 2GV7A 4Y79A 2HRVA 1CVWH 2Z94A 1ETSH 2C8XB 3E3TA 2AGEX 3W94A 1FY3A 1T31A 1RXPA 3PMAB 1MKWH 2VVUA 2ZU2A 1P03A 5JPMH 3TJNA 1ZR0A 3Q3KA 1WTGH 3PYHA 2ZCHP 2BQWB 1TMTH 1UVPA 2HALA 1CU1A 2UUYA 1QL7A 2CHAC 3GISB 3SJOA 1O3GA 5DO4H 3LKWA 4UONA 4AFZA 2R3UA 2C8YB 2OQ5A 3CS0A 4DY7B 4THNH 1C1NA 1FN8A 1AWHB 2VIVA 1HAOH 2BOHB 3Q77A 2FDAA 1DWBH 2BOKA 4BAOB 1GI7B 3K6ZA 1GBDA 3LONA 4TPYA 3SNDA 4OGYA 3HKIB 5FPTA 4GLYA 3ZVFA 1X7AC 2BY9X 3P92A 5EPNA 1GHAG 4NZQA 3QO6A 3OY5U 3ZYDA 1C2JA 1GJBB 1RFNA 4GSOA 3RLWH 4B2BA 5HGGA 4ABEA 1A3EH 3NKKA 5FX5A 3KN2A 1O2NA 2AERH 3RU4T 1EATA 1ZSJA 4O3UA 1ZHRA 3A84A 3A8BA 4UFFH 1O5EH 3RXJA 4SGAE 1C2GA 2FX4A 1GI4A 4WWYA 1A46H 2R3YA 3UNSA 5AVDA 4AZ2B 4TPIZ 4X6OA 4K8YA 1GVKB 1C2IA 4IGDA 2BXUH 5DP8A 4B2CA 3QGJA 1T4VH 1GBHA 1OPHB 3U69H 1A5GH 1EB2A 2VH0A 1V2MT 3TK5A 3AVZA 5C5NA 2ULLA 3PV4A 1CBWC 3RXLA 1BQYA 3I77A 1C1WH 1AUJA 3GICB 1O33A 4A1VA 4NCYA 1HBTH 3M5OA 6LPRA 4KTCA 3ESTA 1O3LA 2BVSH 1AUTC 1C5NH 2FWWA 4JZEH 4MQAA 1DDJA 3P95A 1QL9A 1MUEB 1K9OE 3QZRA 2SNVA 5E0HA 5L2ZH 4Y8YA 1ARCA 3U1IB 3I78A 1MBQA 3MOCA 1C1QA 1SGDE 1HIAA 4A92A 1ZRBA 3SN8A 5EW2H 1K1NA 2J95A 1BCUH 3LPRA 1GHWH 3T5FH 1YP9A 4ABAA 2ZPQA 3A8CA 1AQ7A 3RXBA 1F0TA 3GDSA 4K60A 1KY9A 3RUOA 1KXBA 1IQFA 5DJ7A 2QYIA 3ZZBA 1QRXA 1GI9B 2BHGA 2GX4A 1P05A 1WCZA 2G5VA 4KTUA 4NFEA 1UCYK 4ABHA 3P8GA 3MWIU 4X1PU 2KAIB 3BSQA 1TNHA 1VCQA 1ZHPA 4FUEA 4ZUHA 1GBJA 4XDEA 1N6XA 2QXGA 3KHVA 1OYTH 3SQHE 2YOLA 1IQEA 1DUEA 4BTUB 2PGQB 1UMAH 3BTKE 3S9AA 1C1TA 1QBVH 1O3JA 2ZFPH 1C1UH 2OD3B 3HGPA 1Z8IB 2ZA5A 3A85A 2LPRA 1P02A 2JKHA 2ZDAH 1Y3VA 3KQBA 2QC2A 1UTPA 1O3NA 1VCWA 3VB4A 1G32B 1XUJA 2GV6A 1TMUH 1W0YH 1TBRH 1OYQA 2J92A 1PPHE 1THRH 1C5UA 1OP8A 1FZZA 1MTSA 1P2NA 1GBBA 2A2XH 1W14U 4J1YA 2ODPA 2BY6X 2FOAA 4K1EA 5T6DA 2FM2A 3OU0A 3STJA 4ZHLU 1C1OA 2RA3A 2V0BA 2JETB 1V2PT 2IPHA 4X6MA 3VXFH 4CR9A 1C2DA 3PWBA 3F9HA 3LC3A 1TQ7B 5JBTA 3TH3H 3UY9A 1PPCE 1O3FA 3Q3XA 1HXFH 3F68H 1AGJA 1EZXC 4INKA 3RU4E 1SL3A 2YNBA 2G4TA 3TK6A 5DK1A 2OQUA 2EI7A 3BTHE 5TJXA 1A7SA 2VIWA 3A7ZA 3A88A 2FYRA 1LQEA 1O3KA 2C90B 4K1TA 5T6FA 1UK3A 2O8UA 5DP7A 8GCHG 4QT8C 2AYWA 1IQGA 1GMCG 1NO9H 3NUMA 1LVBA 1GBEA 1B7XB 1F0SA 2XC0A 2FTLE 2W3KA 4DGJA 4YZUA 1ZTKA 1WAYB 3MHWU 1Y3UA 2GZ8A 2UWPA 2ZTYA 4H6SB 1KTTB 4DT7B 3TH2H 1TA2A 1GG6B 4WH6A 3KQDA 2P95A 1BRAA 2ZU5A 4MVNA 1PPBH 4JYVH 2OC8A 2ZZUH 5K0HA 3ZZ6A 1LVYA 4LZ1H 1C2FA 4WMFA 1O2RA 1BUIA 1L1NA 2ZDKA 3FP8E 2Y5FA 1W7GH 3SV9A 1ZRKA 4KELA 5C2ZA 2SGFE 1ZMLA 4IC5A 1NPMA 2B7DH 3SJKA 4AX9H 3RXTA 4CHAB 1EOLA 1ELBA 2ZFSA 3ODDA 3BTQE 3E1XB 1SLXB 2AGIX 2AS9A 3L6PA 3DHKH 4AOQA 2PHBA 1UK2A 1IQJA 4JZIA 1K1IA 2AH4X 2G51A 1C1SA 2FS9A 1FAXA 1SBWA 5IDKA 1HAHH 2WPIS 1BHXF 4DG4A 1ELEE 1MD8A 1A0JA 5F8TA 4X8UH 3ZVBA 1WQVH 1GCDA 1T8OA 2Y6TA 1V2ST 1MH0A 3SU2A 4UFEH 2WPKS 1JXPA 2C8WB 1G9IE 1FAKH 2IN2A 1JIRA 2GZ7A 2BD3A 4AG2A 1ANBA 1AE8H 5HMAA 3O8RA 1C5SA 5C5OA 3GY6A 3RLYH 2JH6D 1Y3YA 1EZQA 4CREA 1MQ5A 2Y81A 3M3VA 1ELGA 1O2GH 5E0GA 1DS2E 1BIOA 1BTPA 1Z8JB 2BDIA 4XSKU 2FODA 4IN1A 1VJ9U 1WBGB 2VWMA 3A89A 1GJ6A 4I32A 1MKXK 1BTWA 1DFPA 4I8HA 3ZZ9A 1CGIE 1D6WA 5TCAA 4CRDA 1C5ZB 4BXSA 3M7QA 3G01A 5JBCS 1N8OB 4ZXYH 4O3TA 5L6NH 2GZ9A 3R3GB 4X2WA 1LTOA 2BVXH 4K5ZA 2ZFRH 4JZ1A 3PLPA 3VEQB 1DT2A 1NS3A 2H9TH 3U98H 2VNTA 4BTTB 1ZSKA 4Y7BA 1AKSA 3DFJA 3K6YA 4CRGA 4ESTE 1FQ3A 1QGFA 2J2UA 1XUHA 2VVCA 1HNEE 4X1SU 1V2RT 2ZECA 1GBMA 1JRTA 3A7XA 5EOKA 1OP2A 2CJIA 2H6MA 1IAUA 4X6NA 2A7CA 3A8DA 2PSYA 1CGJE 5HM2A 2G55A 4B1TA 3MNBA 2SGQE 1IQLA 4XBCA 3GCTF 3ZVDA 3SBKA 4OS2A 2FESH 3WY8A 4U01A 5DP6A 1E0FD 4A6LA 3LJOA 2XBWA 2PKAA 4ZKSU 4YM9A 1MTNB 2Q6FA 1KDQA 1O2PA 2QCYA 4AGJA 3NPSA 3RXSA 1GI3A 5DG6A 1Z1JA 1ZYOA 4WF8A 1JWTA 3SU3A 2ZFQH 2ZPRA 3BTFE 1D3DB 3TVJB 4CBOA 4NSVA 4LXBH 2XWBI 3F9FA 1GBKA 1VCPA 4BXWA 1OP0A 3OYPA 1KSNA 4ISLA 3MO6A 1O2YA 3KNXA 1F5KU 1TYNA 4MNVA 2ZGHA 4LZ4B 2BY5X 1P2JA 4X8VH 2WUBA 3LGTA 3RMMH 1BBRK 1EP5A 1TFXA 3O8BA 1PQ7A 4J2YB 1S82A 4ZKNU 3S9CA 2A2QH 3RMLH 2XW9A 1HYLA 3FZZA 3ITIA 4ABJA 6GCHG 2VWLA 1GHYH 1PPGE 3BTDE 4X2VA 1MBMA 2P93A 2ZDVH 3RXHA 1GBFA 3S7KB 3AAUA 5E8EH 1FI8A 1P09A 1OX1A 1QHRB 2UUKB 2Z6BD 1DXWA 1UTMA 4ASHA 2AFQB 2PW8H 2BMGB 1JMOH 1JOUB 1QTFA 4Y8XA 1TX8A 1SGFA 2R0KA 2F9VA 1BZXE 1QR3E 1W11U 2SGAA 3PWCA 2Z9GA 1C5PA 1NFUA 1INCA 2BB4A 3ZZ5A 3ODFA 2GMTB 1VZQH 1OWHA 1FY4A 1CA0C 1UJ1A 1TLDA 4UFDH 4Y6DA 3OSYA 1DUAA 4IS5A 5EPYA 2NU3E 3M7UA 3UTUH 3Q3YA 2TGTA 1UVSH 3E8LA 3U1JB 4LOYH 1F0RA 4ABDA 3PMJA 1YBWA 3SO3A 4NG9H 1ZJDA 4YOGA 2HPPH 1FONA 2ZWLH 1O5GH 3N7OA 1LPGB 3IITA 4BAHB 1F0UA 3E0PB 1SFQB 3SQEE 3BG8A 2OINA 2THFB 4AORA 2OCVB 3I29A 2ZDLA 1NC6A 1E38B 1Y3XA 3SOSA 1SGNE 2BDHA 4BTIB 1YLCA 3RU4D 5ESTE 2NU2E 3QX5H 1SC8U 2AEIH 5DKMA 1GDQA 2AMPA 4JYTA 1C2MA 1NN6A 2GTBA 1P8VC 2QN5T 1DWEH 1Z8RA 1XVMA 5EXLA 1O2UA 3T2NA 1NU9A 2WINI 2BD9A 2QF0A 5FHTA 3PROA 3VB6A 1DX5M 1BJVA 4MPVA 1GMCF 3ZZ8A 2ZO3H 1H9LB 2XBXA 1HDTH 2H1UA 1C1VH 2RG3A 1EJNA 1RJXB 3C1KA 4FUDA 4A1TA 2FPZA 5A0AE 3BTWE 2QXHA 4TY6A 2WYGA 1D4PB 4FUIA 4NA7A 1V2LT 2GCHF 1XUGA 2O8TA 1F5RA 2GCTB 1L1GA 2ZU4A 5DP9A 1HAIH 1P10A 4ABIA 5LH8A 2B5TB 4IW4E 4YESB 1P04A 1IQIA 1B5GH 2W7SA 2V35A 1QRZA 2F9BH 3AW1A 1SVPA 3LOXA 1C1MA 2BZ6H 4K3JA 1Y59T 5JB8S 4MPWA 3DUXH 2XC5A 3ZZCA 1TE0A 1T8NA 4NA8A 2Y82A 1K1LA 3ZV8A 3ATLA 1O2JA 4OS6A 3RMOH 2ANKH 1SGIB 3QDZB 3QLPH 3A8AA 3EA7A 4HFPB 5FAHA 1DWDH 3PB1E 3U9AH 2V3HH 1L1JA 1HPGA 1C5RA 3IG6B 2HWLB 3E16B 2ZTXA 4FUJA 1AFEH 1LDTT 4RSPA 2C8ZB 2OC1A 1ZZZA 2OC0A 3LJJA 3P6ZB 1HAYB 1TGNA 1H8DH 4K1SA 2JETC 3MNXA 1CGHA 5AHGH 4Q80A 1LHCH 1S0QA 1SMFE 3O8DA 2RA0A 3RC6A 1GCTB 3GYLB 1QY6A 1HJAC 1HGTH 1M9UA 3T28A 3SV6A 3SJIA 1RRKA 3EE0B 3ATKA 4ZKRU 1ANEA 1TNKA 1HIAB 1AVXA 2BM2A 1FY8E 2A45B 2DUCA 1GI2A 4RN6A 4UEHH 5GIBA 4AGKA 1Z7KA 1QA7A 2FIRH 1ZJKA 6ESTA 2Z7FE 1GCTC 4MPXA 1F2SE 1DOJA 1S0RA 1Y3WA 1K2I1 1IHTH 1FV9A 3UUZA 1JIMA 3VFEA 1MD7A 1QA0A 1TRMA 1P06A 2BLQA 4YO9A 3SI3H 4AB9A 4OGXA 1P2OA 2FXRA 4K2YA 1LHFH 2ZQ1A 3QZQA 1GDUA 3QK1A 4E7NA 2HOBA 2A4QA 2STBE 1SR5C 2V3OH 1BRBE 2GT8A 1ZTLA 4ISNA 3SUEA 2DE8A 5A0BA 2ZU3A 1P3CA 4MNYA 5LPEA 1ZHMA 3H7TA 2ANMH 4KP0A 1N8OC 1UCYH 1O2TA 1B0FA 3KIDU 1ESAA 3M5MA 2Z3EA 1A0HB 4NFFA 4YOIA 4GCHF 3A7VA 3GY7A 3RM0H 3A7YA 3PMHB 1ZPCA 3ZV9A 5GWZA 5EW1H 2F91A 2ZC9H 1GWAA 4WY3A 1TX6A 1WOFA 2B0FA 5I46H 1UHBB 2ZFTA 2Q1JA 3ZZ3A 3B9FH 1EJAA 1NFWA 2BVRH 4BAKB 1C9PA 4E05H 3HK6B 1O32A 2FS8A 1C1PA 1P11E 3GY5A 1BHXB 2BZAA 5EQSA 3RXRA 4ZHAA 2GMTC 1F5LA 1O2VA 1CT4E 4FUFA 1DXPA 1GHZA 5J4SA 3RXAA 1SGEE 2BY7X 1EPTB 3RXOA 4ZHMU 4FU7A 3DT0H 3VPKA 2FP7B 2UUJB 1O3BA 1TGCA 3UPEA 3E0NB 2BTCE 1J15A 1HCGA 2QIQA 1O3HA 2XCNA 1A0LA 4IMZA 4B71A 2CF9H 1L4DA 5EQQA 1EZSC 3M61U 3RXVA 1GHXH 1YLDA 1JRSA 1AFQC 1YM0A 1D9IA 4R0IA
chains in the Genus database with same CATH superfamily
2A4RA 1O2OA 2ZTZA 2R9PA 4BANB 4UDWH 4IBLH 1Q2WA 4AB8A 3GY3A 3UR9A 9ESTA 1LCYA 2G00A 3KF2A 7LPRA 3MO3A 1N6YA 2Z9IA 2QF4A 1H4WA 2XBYA 1P2QA 2A0QB 1V2VT 3F0PA 4H4FA 1Z8GA 1GHAF 1EKBB 2ODQA 1NM6A 2PV9B 1O3AA 3T25A 1KXAA 3SNAA 2XNDD 1AU8A 3NWUA 5CHAC 3M3TA 3RXDA 2G8TA 4AYYB 1EQ9A 3ZZ7A 3M5LA 1AIXH 1NRPH 1BTXA 1C5WB 1MAYA 2ZIQH 4OS5A 2IJOB 2F43B 2C93B 5C3NA 1TONA 2JH5D 1GMDF 1C1RA 3PLBA 2UWLA 1ANDA 3GOVB 2D2DA 2R0LA 2GVFA 2A7JA 3OX7U 1O35A 5LGOA 3K65B 1LO6A 2Q6GA 1NBME 1KIGH 4WXVA 3A83A 3B23B 2GT7A 4GHTA 4H6TA 4WVPE 2F9PA 1YWUA 2B8OH 3SZNA 3UOUA 1SQOA 3UR6A 3SNEA 5GCHG 3ZVAA 1PQ5A 1QURH 1G2MA 3GY4A 1UO6A 2QXIA 1AWFH 1RS0A 2PFEA 2BDAA 2Y5HA 3RXGA 3ATWA 3F6UH 4ACBA 4CRAA 2EI8A 2SFAA 3RXQA 1RIWC 1O2LA 2CXVA 3LGYA 1DWCH 2RDLA 2BDYA 1J14A 1HFDA 5F8XA 3SORA 2VBCA 2LNCA 2KZ4A 1P0SH 1MCTA 2XRCA 2CGAA 1A5IA 3T29A 1K28D 4IN2A 1CBWB 5G4BA 1MTVA 3Q76A 4NA9H 2A4OA 4WMEA 2P8OC 4I86A 4Z6AH 3A7TA 1BMNH 1O3EA 1ARBA 1HAVB 1YPKH 1BMMH 2F83A 1S83A 2OBQA 3TIUA 2Z3DA 2ZGBH 4PROA 2CN0H 5IYTA 2VIQA 1W0ZU 2VH6A 4Y8ZA 1DSTA 8ESTE 3RC4A 3BIVH 5FL7D 1W8BH 3BTEE 2XBVA 1GHBG 1VGCC 7GCHG 1DLKB 2PSXA 3SV2H 1Z1IA 3P8FA 1CHOG 1FUJA 1E36B 1ZGIA 1OWIA 2ALPA 3SGQE 4DVAU 4I33A 1V3XA 2O8WA 1BTYA 1A3BH 1ZPZA 1V2OT 1H8IH 1BJUA 1Z6JH 1O0DH 1TPPA 1RTFB 4MG3A 4O03A 3S7HB 4FOUC 3SUGA 2W26A 3W95A 2A5IA 4YT6H 1L0ZA 2PUXB 1NTPA 2BQ6B 1WV7H 3H7OA 3A87A 1J17T 1P57B 2PUQH 2ZCLP 1XM1A 1HB0B 4DURA 3EGKH 1ZOMA 3TGIE 1YPGH 1AO5A 1G3BA 1TPAE 3GDUA 1YPHC 2FI3E 3HPTB 2UUFB 2H9EH 1FJSA 2A5AA 1GDNA 1W10U 3SU1A 1K22H 3VGCC 3FKSD 2F9NA 1AMHA 3S0NA 1NRRH 5LPRA 1CQQA 3MU8A 4YTAA 5L2YH 1V2UT 1UCYE 4NWKA 1GJCB 3U8OH 1O31A 3ENSB 2PWXA 1BT7A 3JZ2B 5JBAS 1U6QA 1QJ1B 5E0JA 1FMGA 1E34B 3VGCB 3LDXH 4TWYA 4JZFH 6CHAC 2NWNA 5E2PA 3MH7A 5TCCA 1HAZB 2BD2A 3P17H 1G30B 1GI1A 2PTCE 3TNSA 3ZZDA 1O3DA 4Z0KA 1TGBA 4ZAEA 1BBRH 1TIOA 1H8ED 1SOZA 1VITH 2PKSC 4ZMAH 4RKJB 5A8ZA 1AB9B 5T1VA 3QGNB 8GCHF 1S84A 2Y7XA 1CHOF 2WPDD 4ABFA 3HKJB 2XCFA 4WXIA 3MNSA 2TBSA 3GCHC 1WYKA 1AI8H 1BBRE 3MI4A 4OM9A 1C5OH 4NIYA 2XXLA 1BMLA 1ELAA 4WH8A 1HXEH 2F9OA 4X8SH 4CHAC 3HGNA 1OSSA 5JBBS 1EASA 1SGPE 3GCHB 1QRWA 3SJ8A 2EA3A 4AFUA 4AN7A 4MNWA 3W1EA 4HTCH 4INHA 5AFZH 3M5NA 3F9EA 4MTBA 4E7RG 1A61H 2KM0A 4XBDA 2WYJA 1VKYA 4CH8B 1IQHA 2OTVA 5DSFA 3TPIZ 1ZPBA 2ZP0H 2PLXA 3N99A 3BG4C 5CHAB 1ETTH 1FPHH 1DITH 3FFGA 1MAXA 1UTNA 3NXPA 3O8CA 1NFYA 1ZGVA 1TGSZ 3UFAA 1GJ5H 1TGTA 2FOMB 3PTBA 4O97A 4RT0A 5GJ4B 1NT1A 3BEFB 3BV9B 4FVBA 4GUXA 1HLTH 2ZHQH 2BD8A 1TPSA 1UVUH 1YCPM 3EQ0H 1CT2E 4GCHG 1RTLA 5DP5A 3EE7A 5FX6A 1V2KT 1Y5AT 1EPTC 4OS1A 2LELA 2P3FH 4ISHH 3UQVA 1UTKA 4Y10E 2BX4A 3IWMA 1C4V2 2OK5A 1MKWK 1HAPH 1O39A 1YYY1 3SGBE 1TNJA 1KXDA 4KTSA 1C5XB 4U30A 1SGQE 2QGRA 4I31A 1G3CA 1AVGH 1PYTD 1UK4A 1GI6A 1ORFA 1OWJA 2XOKD 1QNJA 3PO1B 1EJMA 1RIWB 3ZZ4A 4FUBA 4X1QU 3BTME 4DCDA 1AVWA 1XUFA 2CF8H 3SV7A 3MNCA 4UD9H 2P16A 1BA8B 1ABJH 2Z9LA 1K1OA 4Q7XA 2SGPE 3MYWA 3FANA 1C4U2 3K9XB 3D65E 3P8NA 2ZDNA 1TBZH 3BTGE 1QL8A 1BB0B 1LHGH 3DFLA 3LU9B 5FXLA 4AG1A 4HG6A 3QTVH 1FN6A 1F7ZA 1EP6A 3D62A 3QTOH 3M7TA 2ZGCA 1GMDG 4X1RU 2BDCA 1C9TA 2WPJS 1GBLA 1NFXA 2A31A 1MCVA 4JCNA 4MPUA 3U8TH 3GS9A 4X2YA 5AFYH 1HJ8A 1H9HE 1O3MA 5ETXA 1SOTA 1E1RD 2GD4B 1BTZA 2PKAB 1YPJH 1PYTC 2EC9H 1KDQB 3MO9A 4CR5A 3SU4A 1EXFA 4I8LA 1HUTH 2J9NA 2VU8E 3URDA 4DJZB 1SGCA 1PJPA 1K1MA 4I7YH 2K0QA 2EY4C 4XRNA 1GVZA 1HV7A 2VIDA 3BN9A 3NK8A 4D9RA 3HK3B 1ELDE 2ESTE 1UTOA 4Y7AA 3MH4A 5E2OA 1O38A 3FAOA 1BRUP 3ATMA 3UNRA 2HLCA 3RP2A 1SHHB 5SGAE 1QBNA 1G3EA 1P9SA 3MFJA 1ZLRA 3MH6A 1VITF 2QXJA 2V3MA 3GCTG 4K69A 4RI0A 5JDUB 1Q31A 3QN7A 1RGQA 3GY8A 5C1UA 1Y5UT 2UWOA 1WUNH 2FOFA 1RTKA 1AKSB 1OXGA 1XMNB 1H8HD 1S5SA 1H1BA 5FCRA 4P02A 3GYMA 1Z71A 4ZH8A 2VGCB 3BEUA 1SGRE 1IHSH 1C2HA 3AW0A 3GDVA 1FX0B 3OTJE 4WMDA 3TJUA 1S6FA 1C4Y2 5GCHF 1FY1A 1O2WA 5GXPA 1CE5A 2A4GA 4K8BA 2ZFFH 1MKXH 1EAIA 1C2LA 4A1XA 1GPZA 1IQMA 2G4UA 3DSOA 1NROH 4ZCNA 1FIWA 1THPB 3V13A 1FNIA 1C2EA 4YT7H 1GHVH 1A5HA 6CHAB 2HNTE 2FI5E 1AD8H 3TGJE 5AF9H 1O2IA 1C5TA 2ASUB 2F9UA 1DICA 1ETRH 1LQDB 1XVOA 1UTLM 5JB9S 1E35B 1IQNA 1ELCA 1SI5H 1O34A 1O37A 4GVUA 3BEIB 1QJ6B 4M7GA 2WPLS 2R2MB 4Q7YA 1BITA 2KFWA 4INLA 1ELTA 3VB3A 1SLVB 3V7TA 2NU4E 2ZDMA 1UTJA 4MDSA 2VIOA 1SG8B 4X8TH 1V2TT 3A80A 4NIWA 1DLEA 2D26C 2WUCA 1OWDA 4B75A 2VB0A 3CP7A 4JK5A 3TLOA 1WTHD 3RXFA 5C20A 1FLEE 1O2QA 3WW7A 1NY22 4XD7D 3E90B 5KEDA 1OOKB 1GG6C 1SGYE 2AGGX 1QJ7B 4AFSA 1G3DA 1ACBE 4CRCA 1ANCA 1YF4A 4Q2KA 4FU8A 1F92A 2BDGA 3A81A 1L2EA 3RXMA 1PFXC 4BAQB 3LH3A 2H5CA 2ZU1A 2BDBA 1P9UA 1H9IE 3UQOA 2I6SA 4H42U 5JYIA 1JBUH 1GJAB 1YC0A 1DVAH 2QF3A 4TY7A 3SI4H 3U28C 2VWNA 4Q7ZA 3V12A 1CT0E 5K7RA 2FMJA 3T27A 3TH4H 2PTNA 1O3OA 3BG4B 1ZSLA 4KKDA 5B6OA 1K21H 1SQTA 1SB1H 1NZQH 1B0EA 3B8JA 3RXIA 4ACAA 1VJAU 2ALVA 1C2KA 3MMGA 3C27B 2XTTB 1GL0E 1TBQH 2ZHWH 4BNRA 3BF6H 1FY5A 5CHBA 2OBOA 4XOJA 2EEKA 2SGEE 1S85A 1O3PB 5EXNA 2XNIA 1C5YB 4XBBA 2ZKSA 4ZKOU 3L3TA 1L4ZA 1ID5H 2FOCA 3RXCA 1AZ8A 2P8OB 2ZNKH 4OS4A 5ESBA 3A86A 3SHAH 3VB7A 4BOHA 9LPRA 3QWCH 2EI6A 2PP6A 1TAWA 2V6NA 1WSSH 3GCNA 1ZTJA 4JYUH 1QIXB 1ZMNA 3KQEA 3SU0A 4AFQA 3VB5A 1QB1A 1E79D 1O30A 4NWLA 4X6PA 8KME2 3KCGH 3MU4A 3R0FA 2AMDA 2W6JD 2GCHG 4XE4A 5A8YA 3V0XA 1LKAA 3D23A 3TITA 1AE5A 4B74A 5J4QA 1SKYE 5FPYA 1O2SA 1KLJH 2WHXA 1YGCH 1EX3A 3LH1A 1O5FH 3SGAE 1YKTA 2D1JA 5LPFA 1BTHH 2ZGXH 3L33A 2XYAA 2H5DA 2BY8X 5EQRA 2O8LA 1WU1A 1QCPA 1DY8A 2HGTH 1LHDH 2BYAX 3ATIA 3RDZA 1PQAA 3M35A 1KLIH 3STIA 4DIIH 1O3IA 2M5TA 4YLQH 1QFKH 3RMNH 5DP3A 2H2ZA 3A82A 1O2HA 1EAUA 3SW2B 3DA9B 4MNXA 5A0CA 2ZQ2A 1NESE 2ANYA 2G81E 1ESTA 3ELAH 1KXFA 1AB9C 1AY6H 1HJAB 2J94A 4A7IB 1O2MA 3UREA 2J98A 3DSGA 4FU9A 5CE1A 5EJ1A 1PPEE 1HRTH 1VR1H 5I25A 1FIZA 1PPFE 1W2KH 1O3CA 2QY0B 3AK5A 4NSYA 2P3UB 3SZEA 5HKKD 3UWIA 1NRNH 2TPIZ 1TB6H 3F3BA 4D9QA 2A7HA 2R2WU 1C5MD 3D49H 1GGDB 4U32A 4DOQA 2JIZD 4Y0ZE 4B73A 4GAWA 3FZDA 2WZQA 3AAVA 2WPMS 2WV5A 2AIQA 5DP4A 3TJVA 2Z9JA 4X1NU 1HJ9A 2ANWA 4HGCA 2FOEA 5T3HA 5C94A 1V2JT 4E06H 1GGDC 5CDFE 1O5AB 2SNWA 4FUGA 1WDIA 1K0HA 1TX7A 1O2KA 1CA8B 4TWWA 1MTUA 3EA9A 2ZF0H 4RT1A 5A09A 1GJ4H 1QZ8A 1MTNC 2BLVA 4D8NA 3K2UA 2XC4A 2KAIA 3PLKA 3AASA 1YPMH 2W7UA 4JMYA 2WV4A 1LVMA 1XUKA 1PPZA 3LGWA 4NIVA 2BD7A 2BX3A 3P8OA 2ZCKP 3QUMP 5C1XA 1BMAA 1AN1E 1A1RA 3M36A 1XX9A 2OC7A 4Y71A 1K1JA 2P3TB 1EAWA 4I8JA 3FP7E 2HPQH 5T6GA 4RKOB 1GJDB 2FZZA 4CRFA 1GBIA 2VJ1A 2GDEH 5EG4A 3RXKA 1TNIA 3M3SA 4GPGA 3SUDA 3ZZAA 1D3QB 7KMEH 5EJLA 1TRYA 5FCKA 3BIUH 2ZI2H 1SLUB 2OUAA 2YMSB 4I8GA 4SGBE 4Z1MD 2JJ2D 1SLWB 5FBEA 3KGPA 3LC5A 1XXDA 2IPQX 3OY6U 1ELFA 1LPKB 1P3EA 3PO1C 1BTUA 3S69A 2BQ7B 5C0TA 3Q00A 5FBIA 2VVVA 1AZZA 1SGFG 1N1LA 1UVOA 2J4IA 2WPHS 4FVDA 1P2KA 4I8KA 4A5TS 6GCHF 3MH5A 3T26A 3RXUA 3VXEH 2HNTF 4ZROA 3ZVGA 1G2LA 3EYDA 3SU6A 1AFQB 5KECA 4FUCA 2FOGA 1HAGE 2J34A 3SUFA 1HAXB 1OWKA 2Z3CA 2D8WA 4CRBA 2O9QA 2BXTH 5BRRE 3UNQA 1GBAA 3PM3A 2OP9A 5HYOA 1T7CA 3OEHD 5ABWA 5F6MA 2OXSA 3P70B 3LIWA 2OLGA 4TT3D 1O5DH 2PR3A 3F9GA 3LT3A 1SQAA 3SHCH 3GCOA 2ZHDA 2RDEA 4ISIH 1LHEH 5GDSH 3EDXB 1DSUA 1KLTA 1OKXA 1W12U 2JJ1D 5CMXH 1S81A 5DGJA 1VITG 5GNDA 2C3SA 1LPZB 1TRNA 3E6PH 5DPAA 1YPLH 2FLBH 3LGVA 1MABB 4Y76A 1TMBH 1FPCH 2J38A 3F1SB 2FTMA 1Y5BT 3HATH 1CSOE 1WQSA 4Y11E 4ABBA 1DPOA 3EA8A 2CHAB 1EUFA 3SV8A 1T8LA 4NIXA 2NU1E 1LMWB 1MZAA 3ZYEA 4P00A 2JH0D 5A8XA 3KYFA 1P2MA 1W0JD 1TNLA 4FUHA 1XUIA 2G52A 2Y5GA 2ZHEH 1XKBC 2AIPA 2L74A 1W13U 1O5CB 2BD5A 2TIOA 5EGMA 1E37B 2ILNA 2A5KA 2H9HA 4VGCC 2J97A 1GVLA 2P59A 3E91A 1D3PB 4GHQA 2FX6A 5A2MH 3MU1A 3NCLA 1TALA 2FOBA 1TNGA 1XXFA 1V2NT 1SFIA 3ZVCA 1GI8B 1THSH 2BLWA 3WWBA 2CV3A 4MLFB 4UE7H 1C5VA 1LKBA 1O5BB 3SYJA 4BAMB 2RCEA 1EOJA 2L6OA 4VGCB 4YLUA 7ESTE 4U2WA 2F4LA 2FI4E 2NU0E 3OE7D 5EODA 3UOPA 5HXFA 4ASUD 2GKVE 2GGVB 3JZ1B 4UFGH 4YOJA 1Q3XA 1D6RA 2QE7D 1GJ9B 4IMQA 1NU7B 2TRMA 2Y80A 3M37A 5C67A 1KYNA 1J16A 2QAAA 4CH2B 5H4IB 3UAIC 1GI0A 1SSXA 1AHTH 2W5EA 3TK9A 5EXMA 1UTQA 1GJ8B 1D3TB 1O2XA 1QB6A 3ZVEA 1ESBA 3DD2H 2VGCC 2VIPA 1C5LH 3UWJH 2FYQA 3EAJA 3CNRA 5GPIB 1YPHE 4LK4A 2GCTC 4OS7A 1TQ0B 2Z9KA 2B9LA 3FVFB 1DE7H 5EU8A 1MQ6A 3RXEA 1QB9A 1TOCB 1W3CA 2ZG0H 1YCPH 2QV1A 3TJOA 1CA0B 1GL1A 1V2WT 1GI5A 1VGCB 3RM2H 1DM4B 5FPSA 1EZUC 1UVTH 1FDPA 1MTWA 1P12E 3NZIA 1XKAC 2TGDA 2QA9E 1W7XH 2BLOA 1YCPK 1GJ7B 4X2XA 2Y7ZA 2Q6DA 2PGBB 4KGAA 4NGAH 4O9VA 3U8RH 3KQ5A 2FEQH 2I6QA 1T4UH 2SGDE 1IOEA 1SHYA 1OHHD 3SNBA 2CMYA 4FXGH 2STAE 1BDAA 2RFKC 2KR7A 1A2CH 4DW2U 2W3IA 2FLRH 4XFQA 4Y0YE 1KTSB 4B76A 3TU7H 1GHBF 2F3CE 7GCHF 2IOTA 1BRCE 1KXEA 5F8ZA 1S6HA 2GDDA 1A4WH 3URCA 3KQCA 2TGPZ 4F4OC 1OWEA 2VWOA 3MTYA 4D76A 5F03A 2ZEBA 2K1QA 2HNTC 3LGUA 3SJ9A 1KMHB 3KEEA 2YMSD 1GMHF 1BOQA 1Z6EA 5HIZA 3FP6E 2FOHA 2HVXA 4ISOA 2ZHFH 8LPRA 4F49A 3UIRA 3H5CB 2C4FH 1O36A 4NZLA 1ZMJA 1OS8A 3SU5A 1MU6B 1GBCA 1CHGA 1T8MA 1TOMH 2A1DB 3CS7A 3PMBB 2VINA 1BMFD 4TSFD 5C1YA 1RD3B 1HAVA 4CBNA 4B2AA 1KXCA 2ZPSA 1TPOA 4WJG2 3T62A 5HM9A 1GBTA 1YPEH 1J9CH 2ODYB 3S9BA 1Y8TA 1SPJA 1T32A 1DY9A 1EAXA 3BTTE 3SNCA 1EB1H 1NRSH 3KL6A 3TGKE 4HZHA 1C5QA 1ABIH 3RXPA 5PTPA 1G37A 4TYDA 1MMJN 1TA6A 2PKSB 3V3MA 1TWXB 1FXYA 4AYVB 2TGAA 3LGIA 1QQUA 1QBOA 1EPTA 5L30H 2FO9A 4ABGA 2AMQA 1K1PA 4D7FA 1P01A 4JZDH 3A7WA 1CO7E 1O2ZA 2BD4A 3PTNA 3MU0A 3CENA 3H09A 4R8TB 3TNTA 2ZGJA 2G5NA 1DANH 1MZDA 1MU8B 1LVOA 3GY2A 1V6DA 4HI3A 2P94A 1QQ4A 1V2QT 1J8AA 2GP9B 2XWAA 1PQ8A 3OFND 2A32A 1NRQH 1SGTA 4X0WU 1P2IA 2O8MA 4D7GA 4DIHH 4JK6A 1UHBA 1GMHG 1TABE 4IC6A 3RC5A 4ZXXH 1G36A 1IQKA 2YNAA 5BPEA 1ELVA 3MU5A 2DE9A 2GV7A 4Y79A 2HRVA 1CVWH 2Z94A 2V7QD 1ETSH 2C8XB 3E3TA 2AGEX 3W94A 1FY3A 1T31A 2HVYB 1RXPA 3PMAB 1MKWH 2VVUA 2ZU2A 1P03A 5JPMH 3TJNA 1ZR0A 3Q3KA 1WTGH 3PYHA 2ZCHP 2BQWB 1TMTH 1UVPA 2HALA 1CU1A 2UUYA 1QL7A 2CHAC 3GISB 3SJOA 1O3GA 5DO4H 3LKWA 4UONA 4AFZA 2R3UA 2C8YB 2OQ5A 3CS0A 4DY7B 4THNH 1C1NA 1FN8A 1AWHB 2VIVA 1HAOH 2BOHB 3Q77A 2FDAA 1DWBH 2BOKA 4BAOB 1GI7B 3K6ZA 1GBDA 3LONA 4TPYA 3SNDA 4OGYA 3HKIB 5FPTA 4GLYA 3ZVFA 1X7AC 2BY9X 3P92A 5EPNA 1GHAG 4NZQA 3QO6A 3OY5U 3ZYDA 1C2JA 1GJBB 1RFNA 4GSOA 3RLWH 4B2BA 5HGGA 1WXRA 4ABEA 1A3EH 3NKKA 5FX5A 3KN2A 1O2NA 2AERH 3RU4T 4Q63A 1EATA 1ZSJA 4O3UA 1ZHRA 3A84A 3A8BA 4UFFH 1O5EH 4FETA 3RXJA 4SGAE 1C2GA 2FX4A 1GI4A 4WWYA 1A46H 2R3YA 3UNSA 5AVDA 2M2AA 4AZ2B 4TPIZ 4X6OA 4K8YA 3VG8A 1GVKB 1C2IA 4IGDA 2BXUH 5DP8A 4B2CA 3QGJA 1T4VH 1GBHA 3NRLA 1OPHB 3U69H 1A5GH 1EB2A 1V2MT 2VH0A 3TK5A 3AVZA 5C5NA 2ULLA 3PV4A 1CBWC 3RXLA 1BQYA 3I77A 1C1WH 1AUJA 3GICB 1O33A 4A1VA 2J98B 4NCYA 1HBTH 3M5OA 6LPRA 4KTCA 3ESTA 1O3LA 2BVSH 1AUTC 1C5NH 2FWWA 3N7EA 4JZEH 4MQAA 1DDJA 3P95A 1QL9A 1MUEB 1K9OE 3QZRA 2SNVA 5E0HA 5L2ZH 2YMSC 4Y8YA 1ARCA 3U1IB 3I78A 1MBQA 4DT4A 3MOCA 1C1QA 1SGDE 1HIAA 4A92A 1ZRBA 3SN8A 5EW2H 1K1NA 2J95A 1BCUH 3LPRA 1GHWH 3T5FH 1YP9A 4ABAA 2ZPQA 3A8CA 1AQ7A 3RXBA 1F0TA 3GDSA 4K60A 1KY9A 2W6ID 3RUOA 1KXBA 1IQFA 5DJ7A 2QYIA 3ZZBA 1QRXA 1W0KD 1GI9B 2BHGA 2GX4A 1P05A 1WCZA 2G5VA 4KTUA 4NFEA 1UCYK 4ABHA 3P8GA 3MWIU 4X1PU 1YY3A 2KAIB 3BSQA 1TNHA 1VCQA 1ZHPA 4YXWD 4FUEA 4ZUHA 1GBJA 4XDEA 1N6XA 2QXGA 3KHVA 1OYTH 3SQHE 2YOLA 1IQEA 1DUEA 4BTUB 2PGQB 1UMAH 3BTKE 3S9AA 1C1TA 1QBVH 1O3JA 2CK3D 2ZFPH 1C1UH 2OD3B 3HGPA 1Z8IB 2ZA5A 3A85A 2LPRA 1P02A 2JKHA 2ZDAH 1Y3VA 3KQBA 2QC2A 1UTPA 1O3NA 1VCWA 3VB4A 1G32B 1XUJA 2GV6A 1TMUH 1W0YH 1TBRH 1OYQA 2J92A 1PPHE 1THRH 1C5UA 3OTPA 1OP8A 1FZZA 1MTSA 1P2NA 1GBBA 2A2XH 1W14U 4J1YA 2ODPA 2BY6X 2KCAA 3F0OA 2FOAA 4K1EA 5T6DA 2FM2A 3OU0A 3STJA 2K8IA 4ZHLU 1C1OA 2RA3A 2V0BA 2JETB 1V2PT 2IPHA 4X6MA 3VXFH 4CR9A 1C2DA 3PWBA 3F9HA 3LC3A 1TQ7B 5JBTA 3TH3H 3UY9A 1PPCE 1O3FA 3FN8A 1HXFH 3Q3XA 3F68H 1AGJA 1EZXC 4INKA 3RU4E 1SL3A 2YNBA 2G4TA 3TK6A 5DK1A 2OQUA 2EI7A 3BTHE 5TJXA 1A7SA 2VIWA 3A7ZA 3A88A 2FYRA 1LQEA 1O3KA 2C90B 4K1TA 5T6FA 1UK3A 2O8UA 5DP7A 8GCHG 2LP6A 2AYWA 4QT8C 1IQGA 3ZIAD 1GMCG 1NO9H 3NUMA 1LVBA 1GBEA 1B7XB 5IK2D 1F0SA 2XC0A 2FTLE 2W3KA 4DGJA 3DSPA 4YZUA 1ZTKA 1WAYB 3MHWU 1Y3UA 2GZ8A 2UWPA 2ZTYA 4H6SB 1KTTB 4DT7B 3TH2H 1TA2A 1GG6B 4WH6A 3KQDA 2P95A 1BRAA 2ZU5A 4MVNA 1PPBH 4JYVH 2OC8A 2ZZUH 5K0HA 3ZZ6A 1LVYA 4LZ1H 1C2FA 4WMFA 1O2RA 1BUIA 1L1NA 2ZDKA 3FP8E 2Y5FA 1W7GH 3SV9A 1ZRKA 4KELA 5C2ZA 3DCLA 2SGFE 1ZMLA 4IC5A 1NPMA 2B7DH 3SJKA 4AX9H 3RXTA 4CHAB 1EOLA 1ELBA 2ZFSA 3ODDA 3BTQE 3E1XB 1SLXB 2AGIX 2AS9A 3L6PA 3DHKH 2AHME 4AOQA 2PHBA 1UK2A 1IQJA 4JZIA 1K1IA 2AH4X 2G51A 1C1SA 2FS9A 1FAXA 1SBWA 5IDKA 1HAHH 2WPIS 1BHXF 5DN6D 4DG4A 1ELEE 1MD8A 1A0JA 5F8TA 4X8UH 3ZVBA 2EQNA 1WQVH 1GCDA 1T8OA 2KCPA 2Y6TA 1V2ST 1MH0A 3SU2A 4UFEH 2WPKS 1JXPA 2C8WB 1G9IE 1FAKH 2IN2A 5B6LA 1JIRA 2GZ7A 2BD3A 4AG2A 1ANBA 1AE8H 5HMAA 3O8RA 1C5SA 5F53A 5C5OA 3GY6A 3RLYH 2JH6D 1Y3YA 1EZQA 4CREA 1MQ5A 2Y81A 3M3VA 1ELGA 1O2GH 5E0GA 1DS2E 1BIOA 1BTPA 1Z8JB 2BDIA 4XSKU 2FODA 4IN1A 1VJ9U 1WBGB 2VWMA 3A89A 1GJ6A 4I32A 1MKXK 1BTWA 1DFPA 4I8HA 3ZZ9A 1CGIE 1D6WA 5TCAA 4CRDA 1C5ZB 4BXSA 3M7QA 3G01A 5JBCS 1N8OB 4ZXYH 4O3TA 5L6NH 2GZ9A 1S6LA 3R3GB 4X2WA 1LTOA 2BVXH 3FOAA 4K5ZA 2ZFRH 4JZ1A 3PLPA 3VEQB 1DT2A 1NS3A 2H9TH 3U98H 2VNTA 4BTTB 1ZSKA 4Y7BA 1AKSA 3DFJA 3K6YA 4CRGA 4ESTE 1FQ3A 1QGFA 2J2UA 1XUHA 2VVCA 1HNEE 3PV5A 4X1SU 1V2RT 2ZECA 1GBMA 1JRTA 3A7XA 5EOKA 1OP2A 2CJIA 2H6MA 1IAUA 4X6NA 2A7CA 3A8DA 2PSYA 5EJZA 1CGJE 5HM2A 2G55A 3F2GA 4B1TA 3MNBA 2SGQE 1IQLA 4XBCA 3GCTF 3ZVDA 3SBKA 4OS2A 4B6EA 2FESH 3WY8A 4U01A 5DP6A 1E0FD 4A6LA 3LJOA 5KGOA 2XBWA 2PKAA 4ZKSU 4YM9A 1MTNB 2Q6FA 1KDQA 1O2PA 2QCYA 4AGJA 3NPSA 3RXSA 1GI3A 5DG6A 1Z1JA 1ZYOA 4WF8A 1JWTA 3SU3A 2ZFQH 2ZPRA 3BTFE 1D3DB 3TVJB 4CBOA 4NSVA 4LXBH 2XWBI 3F9FA 1GBKA 1VCPA 4BXWA 1OP0A 3OYPA 1KSNA 4ISLA 3MO6A 1O2YA 3KNXA 1F5KU 1TYNA 4MNVA 2ZGHA 2WSSD 4LZ4B 2BY5X 1P2JA 4X8VH 2WUBA 3LGTA 3RMMH 1BBRK 1EP5A 1TFXA 3O8BA 1PQ7A 4J2YB 1S82A 4ZKNU 3S9CA 2A2QH 3RMLH 2XW9A 1HYLA 3FZZA 3ITIA 4ABJA 6GCHG 2VWLA 1GHYH 1PPGE 3BTDE 4X2VA 1MBMA 4B6FA 2P93A 2ZDVH 3RXHA 1GBFA 3S7KB 3AAUA 5E8EH 1COWD 1FI8A 1P09A 1OX1A 1QHRB 2UUKB 2Z6BD 1DXWA 1UTMA 4ASHA 2AFQB 2PW8H 2BMGB 1JMOH 1JOUB 1QTFA 4Y8XA 3PRDA 1TX8A 1SGFA 2R0KA 2F9VA 1BZXE 1QR3E 1W11U 2SGAA 3PWCA 2Z9GA 1C5PA 1NFUA 1INCA 2BB4A 3ZZ5A 3ODFA 2QF5A 2GMTB 1VZQH 1OWHA 1FY4A 1CA0C 1UJ1A 1TLDA 4UFDH 4Y6DA 3OSYA 1DUAA 4IS5A 5EPYA 2NU3E 3M7UA 3UTUH 3Q3YA 2TGTA 1UVSH 3E8LA 3U1JB 4LOYH 1F0RA 4ABDA 3PMJA 1YBWA 3SO3A 4NG9H 1ZJDA 4YOGA 2HPPH 1FONA 2ZWLH 1O5GH 1E1QD 3N7OA 1LPGB 3IITA 4BAHB 1F0UA 3E0PB 1SFQB 3SQEE 3BG8A 2OINA 2THFB 4AORA 2OCVB 3I29A 2ZDLA 1NC6A 1E38B 1Y3XA 3SOSA 1SGNE 2BDHA 4BTIB 1YLCA 3RU4D 5ESTE 2NU2E 3QX5H 1SC8U 2AEIH 3F2FA 5DKMA 1GDQA 2AMPA 4JYTA 1C2MA 1NN6A 2GTBA 1P8VC 2QN5T 1DWEH 1Z8RA 1XVMA 5EXLA 1O2UA 3F2HA 2GJGA 3T2NA 1NU9A 2WINI 2BD9A 2QF0A 5FHTA 3PROA 3VB6A 3OAAD 1DX5M 1BJVA 4MPVA 1GMCF 1UW7A 3ZZ8A 2ZO3H 1H9LB 2XBXA 1HDTH 2H1UA 1C1VH 2RG3A 1EJNA 1RJXB 3C1KA 4FUDA 4A1TA 2FPZA 5A0AE 2WV9A 3BTWE 5C17A 3KYGA 2KCYA 2QXHA 4TY6A 2WYGA 1D4PB 4FUIA 4NA7A 4AC9A 1V2LT 2GCHF 1XUGA 2O8TA 1F5RA 2GCTB 1L1GA 2ZU4A 5DP9A 1HAIH 1P10A 4ABIA 5LH8A 2B5TB 4IW4E 4YESB 1P04A 1IQIA 1B5GH 2W7SA 2V35A 1QRZA 2F9BH 1YLNA 3AW1A 1SVPA 3LOXA 1C1MA 2BZ6H 4K3JA 1Y59T 5JB8S 4MPWA 3DUXH 2XC5A 3ZZCA 1TE0A 1T8NA 4F48B 4NA8A 2Y82A 1K1LA 3ZV8A 3ATLA 1O2JA 3MQKC 4OS6A 3RMOH 2ANKH 1SGIB 3QDZB 3QLPH 3A8AA 3EA7A 4HFPB 5FAHA 1DWDH 3PB1E 3U9AH 2V3HH 1L1JA 1HPGA 1C5RA 3IG6B 2HWLB 3E16B 2ZTXA 4FUJA 1AFEH 1SQRA 1LDTT 4RSPA 2C8ZB 2OC1A 1ZZZA 2OC0A 3LJJA 3P6ZB 3PV2A 1HAYB 1TGNA 1H8DH 5EIYA 4K1SA 2JETC 3MNXA 1CGHA 5AHGH 4Q80A 1LHCH 1S0QA 4Q4LA 1SMFE 4F55A 3O8DA 1EFRD 2RA0A 3RC6A 1GCTB 3GYLB 1QY6A 1HJAC 1HGTH 1M9UA 3T28A 3SV6A 3SJIA 1RRKA 3EE0B 3ATKA 4ZKRU 1ANEA 1TNKA 1HIAB 1AVXA 1NBMD 2BM2A 1FY8E 2A45B 2DUCA 1GI2A 4RN6A 4UEHH 5GIBA 4AGKA 1Z7KA 1QA7A 2FIRH 1ZJKA 6ESTA 2Z7FE 1GCTC 4MPXA 1F2SE 2IJD1 1DOJA 1S0RA 1Y3WA 1K2I1 1IHTH 1FV9A 3UUZA 1JIMA 3VFEA 1MD7A 1QA0A 1TRMA 1P06A 2BLQA 4YO9A 3SI3H 4AB9A 4OGXA 1P2OA 2FXRA 4K2YA 1LHFH 2ZQ1A 3QZQA 1GDUA 3QK1A 4E7NA 2HOBA 2A4QA 3WWFA 2STBE 1SR5C 2V3OH 1BRBE 2GT8A 1ZTLA 4ISNA 3SUEA 2DE8A 5A0BA 2ZU3A 1P3CA 4MNYA 5LPEA 1ZHMA 3H7TA 2ANMH 4KP0A 1N8OC 1UCYH 1O2TA 2J5UA 2JDID 1B0FA 3KIDU 3UB0A 1ESAA 3M5MA 2Z3EA 1A0HB 4NFFA 4YOIA 4GCHF 3A7VA 3GY7A 3RM0H 3N7DA 3A7YA 3PMHB 1ZPCA 3ZV9A 5GWZA 2KX4A 5HIYA 5EW1H 2F91A 2ZC9H 1GWAA 4WY3A 1TX6A 1WOFA 2B0FA 3FO8D 5I46H 1UHBB 2ZFTA 2Q1JA 4M9FA 3ZZ3A 3B9FH 1EJAA 1NFWA 2BVRH 4BAKB 2HLDD 1C9PA 4E05H 3HK6B 3OEED 1O32A 2FS8A 3PRBA 1C1PA 1P11E 3GY5A 1BHXB 2BZAA 5EQSA 3RXRA 4ZHAA 2GMTC 1F5LA 1O2VA 1CT4E 4FUFA 1DXPA 1GHZA 5J4SA 5C0UA 3RXAA 1SGEE 2BY7X 1EPTB 3RXOA 4ZHMU 4FU7A 3DT0H 3VPKA 2FP7B 2UUJB 1O3BA 1TGCA 3UPEA 3E0NB 2BTCE 1J15A 1HCGA 2QIQA 1O3HA 2XCNA 1A0LA 2KCOA 4IMZA 4B71A 2CF9H 1L4DA 5EQQA 1EZSC 3M61U 3RXVA 1GHXH 1YLDA 1JRSA 1AFQC 1YM0A 1D9IA 4R0IA
chains in the Genus database with same CATH topology
2A4RA 1O2OA 2ZTZA 2R9PA 4BANB 4UDWH 4IBLH 1Q2WA 4AB8A 3GY3A 3UR9A 9ESTA 1LCYA 2G00A 3KF2A 7LPRA 3MO3A 1N6YA 2Z9IA 1H4WA 2XBYA 1P2QA 2A0QB 1V2VT 4H4FA 1Z8GA 1GHAF 1EKBB 2ODQA 1NM6A 2PV9B 1O3AA 3T25A 1KXAA 3SNAA 1AU8A 3NWUA 5CHAC 3M3TA 3RXDA 2G8TA 4AYYB 1EQ9A 3ZZ7A 3M5LA 1AIXH 1NRPH 1BTXA 1C5WB 1MAYA 2ZIQH 4OS5A 2IJOB 2C93B 5C3NA 1TONA 2JH5D 1GMDF 1C1RA 3PLBA 2UWLA 1ANDA 3GOVB 2D2DA 2R0LA 2GVFA 2A7JA 3OX7U 1O35A 5LGOA 3K65B 1LO6A 2Q6GA 1KIGH 4WXVA 3A83A 3B23B 2GT7A 4GHTA 4H6TA 4WVPE 2F9PA 2B8OH 3SZNA 3UOUA 1SQOA 3UR6A 3SNEA 5GCHG 3ZVAA 1PQ5A 1QURH 1G2MA 3GY4A 1UO6A 2QXIA 1AWFH 1RS0A 2PFEA 2BDAA 2Y5HA 3RXGA 3ATWA 3F6UH 4CRAA 2EI8A 2SFAA 3RXQA 1RIWC 1O2LA 2CXVA 3LGYA 1DWCH 2RDLA 2BDYA 1J14A 1HFDA 5F8XA 3SORA 2LNCA 1P0SH 1MCTA 2XRCA 2CGAA 1A5IA 3T29A 1K28D 4IN2A 1CBWB 5G4BA 1MTVA 3Q76A 4NA9H 2A4OA 4WMEA 2P8OC 4Z6AH 3A7TA 1BMNH 1O3EA 1ARBA 1HAVB 1YPKH 1BMMH 2F83A 1S83A 2OBQA 3TIUA 2Z3DA 2ZGBH 4PROA 2CN0H 5IYTA 2VIQA 1W0ZU 2VH6A 4Y8ZA 1DSTA 8ESTE 3RC4A 3BIVH 1W8BH 3BTEE 2XBVA 1GHBG 1VGCC 7GCHG 1DLKB 2PSXA 3SV2H 1Z1IA 3P8FA 1CHOG 1FUJA 1E36B 1ZGIA 1OWIA 2ALPA 3SGQE 4DVAU 4I33A 1V3XA 1BTYA 1A3BH 2O8WA 1ZPZA 1V2OT 1H8IH 1BJUA 1Z6JH 1O0DH 1TPPA 1RTFB 4MG3A 4O03A 3S7HB 3SUGA 2W26A 3W95A 2A5IA 4YT6H 1L0ZA 2PUXB 1NTPA 2BQ6B 1WV7H 3H7OA 3A87A 1J17T 1P57B 2PUQH 2ZCLP 1XM1A 1HB0B 4DURA 3EGKH 1ZOMA 3TGIE 1YPGH 1AO5A 1G3BA 1TPAE 3GDUA 1YPHC 2FI3E 3HPTB 2UUFB 2H9EH 1FJSA 2A5AA 1GDNA 1W10U 3SU1A 1K22H 3VGCC 2F9NA 1AMHA 3S0NA 1NRRH 5LPRA 1CQQA 3MU8A 4YTAA 5L2YH 1V2UT 1UCYE 4NWKA 1GJCB 3U8OH 1O31A 3ENSB 2PWXA 1BT7A 3JZ2B 5JBAS 1U6QA 1QJ1B 5E0JA 1FMGA 1E34B 3VGCB 3LDXH 4TWYA 4JZFH 6CHAC 2NWNA 5E2PA 3MH7A 5TCCA 1HAZB 2BD2A 3P17H 1G30B 1GI1A 2PTCE 3TNSA 3ZZDA 1O3DA 4Z0KA 1TGBA 4ZAEA 1BBRH 1TIOA 1SOZA 1VITH 2PKSC 4ZMAH 4RKJB 5A8ZA 1AB9B 3QGNB 8GCHF 1S84A 2Y7XA 1CHOF 4ABFA 3HKJB 2XCFA 4WXIA 3MNSA 2TBSA 3GCHC 1WYKA 1AI8H 1BBRE 3MI4A 1C5OH 4NIYA 2XXLA 1BMLA 1ELAA 4WH8A 1HXEH 2F9OA 4X8SH 4CHAC 3HGNA 1OSSA 5JBBS 1EASA 1SGPE 3GCHB 1QRWA 3SJ8A 2EA3A 4AFUA 4AN7A 4MNWA 4HTCH 4INHA 5AFZH 3M5NA 3F9EA 4MTBA 4E7RG 1A61H 4XBDA 2WYJA 4CH8B 1IQHA 2OTVA 3TPIZ 1ZPBA 2ZP0H 2PLXA 3BG4C 5CHAB 1ETTH 1FPHH 1DITH 3FFGA 1MAXA 1UTNA 3NXPA 3O8CA 1NFYA 1ZGVA 1TGSZ 3UFAA 1GJ5H 1TGTA 2FOMB 3PTBA 4O97A 5GJ4B 1NT1A 3BEFB 3BV9B 4FVBA 4GUXA 1HLTH 2ZHQH 2BD8A 1TPSA 1UVUH 1YCPM 3EQ0H 1CT2E 4GCHG 1RTLA 5DP5A 5FX6A 1V2KT 1Y5AT 1EPTC 4OS1A 2P3FH 4ISHH 3UQVA 1UTKA 4Y10E 2BX4A 3IWMA 1C4V2 1MKWK 1HAPH 1O39A 1YYY1 3SGBE 1TNJA 1KXDA 4KTSA 1C5XB 4U30A 1SGQE 2QGRA 4I31A 1G3CA 1AVGH 1PYTD 1UK4A 1GI6A 1ORFA 1OWJA 1QNJA 3PO1B 1EJMA 1RIWB 3ZZ4A 4FUBA 4X1QU 3BTME 4DCDA 1AVWA 1XUFA 2CF8H 3SV7A 3MNCA 4UD9H 2P16A 1BA8B 1ABJH 2Z9LA 1K1OA 4Q7XA 2SGPE 3MYWA 3FANA 1C4U2 3K9XB 3D65E 3P8NA 2ZDNA 1TBZH 3BTGE 1QL8A 1BB0B 1LHGH 3DFLA 3LU9B 5FXLA 4AG1A 3QTVH 1FN6A 1F7ZA 1EP6A 3D62A 3QTOH 3M7TA 2ZGCA 1GMDG 4X1RU 2BDCA 2WPJS 1C9TA 1GBLA 1NFXA 2A31A 1MCVA 4JCNA 4MPUA 3U8TH 4X2YA 5AFYH 1HJ8A 1H9HE 1O3MA 5ETXA 1SOTA 2GD4B 1BTZA 2PKAB 1YPJH 1PYTC 2EC9H 1KDQB 3MO9A 4CR5A 3SU4A 1EXFA 4I8LA 1HUTH 2J9NA 2VU8E 3URDA 4DJZB 1SGCA 1PJPA 1K1MA 4I7YH 1GVZA 1HV7A 2VIDA 3BN9A 3NK8A 4D9RA 3HK3B 1ELDE 2ESTE 1UTOA 4Y7AA 3MH4A 5E2OA 1O38A 3FAOA 1BRUP 3ATMA 3UNRA 2HLCA 3RP2A 1SHHB 5SGAE 1QBNA 1G3EA 1P9SA 3MFJA 1ZLRA 3MH6A 1VITF 2QXJA 3GCTG 4K69A 5JDUB 1Q31A 3QN7A 1RGQA 3GY8A 5C1UA 1Y5UT 2UWOA 1WUNH 2FOFA 1RTKA 1AKSB 1OXGA 1XMNB 1S5SA 1H1BA 5FCRA 3GYMA 1Z71A 4ZH8A 2VGCB 3BEUA 1SGRE 1IHSH 1C2HA 3AW0A 3GDVA 3OTJE 4WMDA 3TJUA 1S6FA 1C4Y2 5GCHF 1FY1A 1O2WA 5GXPA 1CE5A 2A4GA 4K8BA 2ZFFH 1MKXH 1EAIA 1C2LA 4A1XA 1GPZA 1IQMA 2G4UA 1NROH 1FIWA 1THPB 3V13A 1FNIA 1C2EA 4YT7H 1GHVH 1A5HA 6CHAB 2HNTE 2FI5E 1AD8H 3TGJE 5AF9H 1O2IA 1C5TA 2ASUB 2F9UA 1DICA 1ETRH 1LQDB 1XVOA 1UTLM 5JB9S 1E35B 1IQNA 1ELCA 1SI5H 1O34A 1O37A 4GVUA 3BEIB 1QJ6B 4M7GA 2WPLS 2R2MB 4Q7YA 1BITA 4INLA 1ELTA 3VB3A 1SLVB 3V7TA 2NU4E 2ZDMA 1UTJA 4MDSA 2VIOA 1SG8B 4X8TH 1V2TT 3A80A 4NIWA 1DLEA 2D26C 2WUCA 1OWDA 4B75A 2VB0A 3CP7A 4JK5A 3TLOA 1WTHD 3RXFA 5C20A 1FLEE 1O2QA 1NY22 3E90B 1OOKB 1GG6C 1SGYE 2AGGX 1QJ7B 4AFSA 1G3DA 1ACBE 4CRCA 1ANCA 1YF4A 4Q2KA 4FU8A 1F92A 2BDGA 3A81A 1L2EA 3RXMA 1PFXC 4BAQB 3LH3A 2H5CA 2ZU1A 2BDBA 1P9UA 1H9IE 3UQOA 2I6SA 4H42U 5JYIA 1JBUH 1GJAB 1YC0A 1DVAH 2QF3A 4TY7A 3SI4H 2VWNA 4Q7ZA 3V12A 1CT0E 5K7RA 2FMJA 3T27A 3TH4H 2PTNA 1O3OA 3BG4B 1ZSLA 4KKDA 5B6OA 1K21H 1SQTA 1SB1H 1NZQH 1B0EA 3B8JA 3RXIA 1VJAU 2ALVA 1C2KA 3MMGA 3C27B 2XTTB 1GL0E 1TBQH 2ZHWH 4BNRA 3BF6H 1FY5A 2OBOA 4XOJA 2EEKA 2SGEE 1S85A 1O3PB 5EXNA 2XNIA 1C5YB 4XBBA 2ZKSA 4ZKOU 3L3TA 1L4ZA 1ID5H 2FOCA 3RXCA 1AZ8A 2P8OB 2ZNKH 4OS4A 5ESBA 3A86A 3SHAH 3VB7A 4BOHA 9LPRA 3QWCH 2EI6A 1TAWA 2V6NA 1WSSH 3GCNA 1ZTJA 4JYUH 1QIXB 1ZMNA 3KQEA 3SU0A 4AFQA 3VB5A 1QB1A 4X6PA 1O30A 4NWLA 8KME2 3KCGH 3MU4A 3R0FA 2AMDA 2GCHG 4XE4A 5A8YA 3V0XA 1LKAA 3D23A 3TITA 1AE5A 4B74A 5J4QA 5FPYA 1O2SA 1KLJH 1YGCH 1EX3A 3LH1A 1O5FH 3SGAE 1YKTA 2D1JA 5LPFA 1BTHH 2ZGXH 3L33A 2XYAA 2H5DA 2BY8X 5EQRA 2O8LA 1WU1A 1QCPA 1DY8A 2HGTH 1LHDH 2BYAX 3ATIA 3RDZA 1PQAA 3M35A 1KLIH 3STIA 4DIIH 1O3IA 2M5TA 4YLQH 1QFKH 3RMNH 5DP3A 2H2ZA 3A82A 1O2HA 1EAUA 3SW2B 3DA9B 4MNXA 5A0CA 2ZQ2A 1NESE 2ANYA 2G81E 1ESTA 3ELAH 1KXFA 1AB9C 1AY6H 1HJAB 2J94A 4A7IB 1O2MA 3UREA 4FU9A 5CE1A 1PPEE 1HRTH 1VR1H 5I25A 1FIZA 1PPFE 1W2KH 1O3CA 2QY0B 4NSYA 2P3UB 3UWIA 1NRNH 2TPIZ 1TB6H 4D9QA 2A7HA 2R2WU 1C5MD 3D49H 1GGDB 4U32A 4DOQA 4Y0ZE 4B73A 4GAWA 3FZDA 3AAVA 2WPMS 2WV5A 2AIQA 5DP4A 3TJVA 2Z9JA 4X1NU 1HJ9A 2ANWA 4HGCA 2FOEA 5T3HA 1V2JT 4E06H 1GGDC 1O5AB 2SNWA 4FUGA 1TX7A 1O2KA 1CA8B 4TWWA 1MTUA 3EA9A 2ZF0H 5A09A 1GJ4H 1MTNC 2BLVA 4D8NA 3K2UA 2XC4A 2KAIA 3PLKA 3AASA 1YPMH 2W7UA 4JMYA 2WV4A 1LVMA 1XUKA 1PPZA 3LGWA 4NIVA 2BD7A 2BX3A 3P8OA 2ZCKP 3QUMP 5C1XA 1BMAA 1AN1E 1A1RA 3M36A 1XX9A 2OC7A 4Y71A 1K1JA 2P3TB 1EAWA 4I8JA 3FP7E 2HPQH 5T6GA 4RKOB 1GJDB 2FZZA 4CRFA 1GBIA 2VJ1A 2GDEH 5EG4A 3RXKA 1TNIA 3M3SA 4GPGA 3SUDA 3ZZAA 1D3QB 7KMEH 1TRYA 5FCKA 3BIUH 2ZI2H 1SLUB 2OUAA 4I8GA 4SGBE 1SLWB 5FBEA 3KGPA 3LC5A 1XXDA 3OY6U 1ELFA 1LPKB 1P3EA 3PO1C 1BTUA 3S69A 2BQ7B 3Q00A 5FBIA 2VVVA 1AZZA 1SGFG 1N1LA 1UVOA 2J4IA 2WPHS 4FVDA 1P2KA 4I8KA 4A5TS 6GCHF 3MH5A 3T26A 3RXUA 3VXEH 2HNTF 4ZROA 3ZVGA 1G2LA 3EYDA 3SU6A 1AFQB 4FUCA 2FOGA 1HAGE 2J34A 3SUFA 1HAXB 1OWKA 2Z3CA 2D8WA 4CRBA 2O9QA 2BXTH 5BRRE 3UNQA 1GBAA 3PM3A 2OP9A 5HYOA 1T7CA 5ABWA 5F6MA 2OXSA 3P70B 3LIWA 2OLGA 1O5DH 2PR3A 3F9GA 3LT3A 1SQAA 3SHCH 3GCOA 2ZHDA 4ISIH 1LHEH 5GDSH 3EDXB 1DSUA 1KLTA 1OKXA 1W12U 5CMXH 1S81A 5DGJA 1VITG 2C3SA 1LPZB 1TRNA 3E6PH 5DPAA 1YPLH 2FLBH 3LGVA 4Y76A 1TMBH 1FPCH 2J38A 3F1SB 2FTMA 1Y5BT 3HATH 1CSOE 1WQSA 4Y11E 4ABBA 1DPOA 3EA8A 2CHAB 1EUFA 3SV8A 1T8LA 4NIXA 2NU1E 1LMWB 1MZAA 3ZYEA 2JH0D 5A8XA 1P2MA 1TNLA 4FUHA 1XUIA 2G52A 2Y5GA 2ZHEH 1XKBC 2AIPA 1W13U 1O5CB 2BD5A 2TIOA 5EGMA 1E37B 2ILNA 2A5KA 2H9HA 4VGCC 1GVLA 2P59A 3E91A 1D3PB 4GHQA 2FX6A 5A2MH 3MU1A 3NCLA 1TALA 2FOBA 1TNGA 1XXFA 1V2NT 1SFIA 3ZVCA 1GI8B 1THSH 2BLWA 2CV3A 4MLFB 4UE7H 1C5VA 1LKBA 1O5BB 4BAMB 2RCEA 1EOJA 4VGCB 4YLUA 7ESTE 4U2WA 2FI4E 2NU0E 3UOPA 5EODA 5HXFA 2GKVE 2GGVB 3JZ1B 4UFGH 4YOJA 1Q3XA 1D6RA 1GJ9B 4IMQA 1NU7B 2TRMA 2Y80A 3M37A 5C67A 1KYNA 1J16A 2QAAA 4CH2B 5H4IB 1GI0A 1SSXA 1AHTH 2W5EA 3TK9A 5EXMA 1UTQA 1GJ8B 1D3TB 1O2XA 1QB6A 3ZVEA 1ESBA 3DD2H 2VGCC 2VIPA 1C5LH 3UWJH 2FYQA 3EAJA 5GPIB 1YPHE 4LK4A 2GCTC 4OS7A 1TQ0B 2Z9KA 2B9LA 3FVFB 1DE7H 5EU8A 1MQ6A 3RXEA 1QB9A 1TOCB 1W3CA 2ZG0H 1YCPH 2QV1A 3TJOA 1CA0B 1GL1A 1V2WT 1GI5A 1VGCB 3RM2H 1DM4B 5FPSA 1EZUC 1UVTH 1FDPA 1MTWA 1P12E 3NZIA 1XKAC 2TGDA 2QA9E 1W7XH 2BLOA 1YCPK 1GJ7B 4X2XA 2Y7ZA 2Q6DA 2PGBB 4KGAA 4NGAH 4O9VA 3U8RH 2FEQH 2I6QA 1T4UH 2SGDE 1IOEA 1SHYA 3SNBA 2CMYA 4FXGH 2STAE 1BDAA 1A2CH 4DW2U 2W3IA 2FLRH 4XFQA 4Y0YE 1KTSB 4B76A 3TU7H 1GHBF 2F3CE 7GCHF 2IOTA 1BRCE 1KXEA 5F8ZA 1S6HA 2GDDA 1A4WH 3URCA 3KQCA 2TGPZ