5T7LA

Pt(ii)-mediated copper-dependent interactions between atox1 and mnk1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
68
structure length
68
Chain Sequence
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pt(II)-mediated copper-dependent interactions between ATOX1 and MNK1
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Copper transport protein ATOX1
total genus 16
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2016-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5t7lA00
1KVJA 1YJRA 5B0AA 4ZA1A 1Q8BA 2RSQA 4Y2IA 4A48A 2OP5A 4NL5A 1QUPA 1N5SA 3LGMA 1JWWA 2FHMA 3LO3A 2K1RA 2OAUA 3HDSA 3HHLD 1X0PA 3QMQA 2XMUA 1N5VA 1YRXA 2ROEA 2W4CA 2QIFA 3E8OA 1FESA 1N5TA 2HLTA 4A4JA 2XMKA 4A47A 3HFKA 3BGUA 4Y2MA 1TL4A 2AJ1A 5B09A 2ROPA 1V3ZA 5F0UA 3KG0A 2GA7A 1AW0A 1X8DA 3LGNA 2AP6A 2BBEA 3K7RA 2IYIA 2PGCA 4EFAC 4OJHA 5T7LB 1OPZA 2G9OA 3VTIA 1YJTA 3CJKA 4DL0C 2XMTA 1LQ9A 4Q2MA 1U7LA 4HI2A 1MWYA 3WDOA 1CPZA 1URRA 3QGPA 1Y3KA 1Y0HA 3IWXA 3TNVA 1JK9B 2RU9A 4DN9A 1AFJA 3T9NA 2W4PA 1R6YA 4U9RA 1FE4A 2W4DA 2XMVA 5B0FA 2AW0A 3BF4A 3BM7A 3TOQA 1OSDA 1VQYA 2GFFA 2K7KA 1Y3JA 2OD4A 2GCFA 2BJDA 4Q2LA 2BYCA 2CRLA 4OJ3A 1FEEA 2FIUA 2HFOA 1GXTA 2OKQA 2JDJA 3KG1A 1Q8LA 2VV5A 1XBWA 2LQBA 5B0BA 2QLXA 1RJJA 2BJEA 2K1RB 4YDXA 1WD6A 1Y9OA 1AFIA 1YJVA 2GV1A 4NPOA 2RMLA 4YEAA 1Q53A 3I9ZA 2LQ9A 5T7LA 3HHLC 1K0VA 2HLUA 3UDCA 2HQIA 2RILA 4ZOSA 5B0GA 1P6TA 1IUJA 5A6WA 1ULRA 1TR0A 2N4CA 1FE0A 5B08A 1FVSA 2EW9A 4OJ1A 4QOTA 3FRYA 5A6PA 2OFGX 2XMWA 3HHLA 1OQ3A 4Y2KA 1TL5A 2GGPB 2IFXA 1X7VA 2ACYA 3KKFA 1P8GA 1KVIA 4HI1A 2VH7A 3F44A 2K2PA 1YJUA 4OJGA 4FNIA 4F67A 2FTRA 4FNHA 3BDEA 1KQKA 1MWZA 5IXUA 5B0CA 2QLWA 2KKHA 2OFHX 2PD1A 3GZ7A 2KYZA 1CC8A 1Q4RA 1GXUA 1TZ0A 2AJ0A 2LXFA 2N4DA 1S6OA 2ASYA 3BR8A 3FMBA 2OD6A 4A46A 1VQSA 3HF5A 3KNGA 1SI9A 2KT2A 2XMJA 2HIQA 3FGVA 5F0WA 2OMOA 3IWLA 3HX9A 5K9FA 4OIXA 4HL9A 1YG0A 4DPOA 2LDIA 1CC7A 2BUNA 3DXSX 3MCSA 3DCAA 4HH0A 1SB6A 1SQEA 1FD8A 3MZIA 5KAKA 1S6UA 2ZDPA 1OQ6A 2IYGA 1N5QA 2N7YA 2Q3PA 1FVQA 1TUVA 2XMMA 2GGPA 1APSA 2GO8A 2QYCA 2L3MA 3TRGA 5B0EA 2HFNA 2KT3A 3HHLB 2K7JA 4HH1A 3BN7A 3BB5A 3CJKB 1W2IA 2ROGA 5B0DA 2FB0A 2ZDOA
chains in the Genus database with same CATH superfamily
3V4IB 1JLCB 4DSLA 1NSKL 4LF9J 1RCXB 3SSRA 5K8NA 1VQ7S 1X5TA 4RW6B 4ER8A 2ZM6F 5EN1A 3SSQA 1ZTTA 3W66A 4MFBA 1S9GB 4TY9A 5K8MA 3V81B 2GQ2A 1IKYB 3FJ2A 3GYGA 2PI5A 2LXUA 4IG3A 4MK7A 4P2MA 5C2CA 5HROB 4ECYA 1SL1A 4K2XA 1WNEA 2JRSA 1RLDA 2Q1LA 5EWGA 4DR7J 3THVA 2Y0SD 1Q7YT 3MPDA 1UWAA 2XMKA 5KTQA 1KQFB 4USWA 2W2OP 2M70A 4USMA 1D9DA 3FQLA 5C42B 2JC1A 4YUDA 2HNDB 2GA7A 5L9XA 2ZH7A 1VDHA 1HW9A 3NWRA 1CJUA 3OPKA 3R3TA 3K59A 4FF2A 2AP6A 2VOOA 4RU9A 1MROB 4EFAC 3LWLA 3SZ2A 4XPCA 1W2BR 3VTIA 4YQWA 1ROFA 1GQEA 3NS5A 5ETNA 3JSBA 1PBAA 3CJKA 2HQCA 3CJ8A 3CDWA 4L72B 4DL0C 2DRDA 4NCGB 3NNHA 1U7LA 4IRCA 1URRA 3EPGA 1IBLJ 4JOUA 2IC3A 3BZQA 3CCRS 1T7PA 4NLTA 2B43A 3AD9C 2BKNA 3UVJA 3MEDB 4KQZA 3PW5A 1R6YA 2HWTA 3QSIA 3C8YA 2JEGA 3GV5B 4X4VA 3I32A 1UCNA 2CG4A 1FFWB 5KFHA 5J1PA 3S1TA 2YTCA 1FXLA 2KM8C 2ZH9A 1QY7A 5DQGA 2AIRB 1RACB 2BYCA 4UZBA 5LMUJ 1C1BB 2DB1A 3CO0P 3HULA 5J1EA 1N54B 1KRPA 3ZXWA 5J2PA 4EYHB 3R7SB 4ED3A 4LRDA 5M2UA 3HJFA 1DRZA 4WXWA 1U1RA 1WD6A 5ETSA 4DF4A 1HBNB 4ELTA 5EDWA 4QWCA 1MROA 1QDUB 3Q24A 4NZ6A 1UAWA 2IAJA 5IZHA 2WB4A 4ZOSA 5L1KA 2C2EA 4DR6J 2KI2A 2DKOB 4BLGA 1FD2A 1S6PB 1D8ZA 3LW5C 4DV7F 2AJ4A 4B9SA 2V8HA 2ZOMA 4O3SA 1U1LA 5A6PA 4YY3F 4ED8A 1PCAA 1U48A 3P5BP 1HWUA 3VCDA 4CZCA 5IT0A 1J5OA 3HHLA 2ERRA 1VQ6S 1TVRB 2LKZA 4PG8A 2GGPB 1B4SA 2ZD1B 3DU5A 1WC5A 4ZVOB 2R4FA 1NPKA 3QWPA 1JKHB 4FNIA 4C0OC 1U45A 4CT8A 4EZ9A 3HP6A 3I4PA 5BR8F 3QJLA 2V2KA 5J2NB 2CADA 2RKIA 2J5AA 3EDRB 3M2UA 1IR2A 1EZZB 1TVRA 5ETQA 3G6ES 1CC8A 3BGOP 4LSLA 2YNGA 1YQHA 1AZSB 2FHKA 2EWHA 4UW2A 5DQHA 1KDNA 1NBEB 1EIYB 4NWBA 1QVGR 2DNGA 1A9NB 2G2YA 2QZ8A 1VQSA 1RYSA 2GNKA 1UVLA 2GJIA 5IM0B 3HK2A 2JEJA 3HHDA 3DGPB 2B9EA 3CCES 4F4YA 2I8EA 2XCAA 4B17A 3MMBB 1VRTB 3DCAA 5HANA 5T14A 1E6VA 4QPTA 1JLFB 3UN3A 1FD8A 4N47A 5JUMA 2LVWA 2ZDPA 4ECWA 2VBXA 3CCWA 3BO4A 1QM9A 1RWKB 2GMJA 2N7YA 1KWMA 1FVQA 1HBOA 3BSCA 3DOLB 4H4MA 2YWKA 2OH2A 1Q8KA 1GMUA 2GHPA 3IG1A 3H5UA 3JSMB 4F3OA 3FCVA 1D1UA 5KOWA 1T03A 5C25A 2KTQA 3LTOA 4NLPA 1GMWD 2IJFA 2MKSA 4J9LA 2J7UA 1UWBA 4DMZA 2MZTA 2DH8A 3BBCA 2DIUA 2DR8A 3J81Y 1FX2A 2R7WA 3KLEA 2VZ9A 1LXNA 4OX8A 1HW8A 5BYRA 2W7OA 4L3NA 4W90B 4I68A 4B3SJ 3SIPB 3UN2A 3EVMA 3QFWA 1FESA 1TKDA 2QJ3A 2ILYA 1S72S 3L3CA 1CEZA 1X4DA 2UUBF 3G96A 1SKRA 2H1YA 1D8YA 1SJFA 4DF8A 1WF2A 2ZH8A 3UI3A 3G71S 2CQPA 3CMAS 2UU9J 4PPDA 5ETKA 5IC6B 2IY5B 4ECZA 2F4VF 1ZM9A 4DFMA 2AHOB 4KBIA 3MECB 1P9YA 3PRBA 4LFAF 4UOHA 1HHTP 1YZ6A 2XC9A 1OPZA 2XS5A 3KMQA 3ISNC 1T9WA 4UTGA 3VAGA 3PW4A 5CXTA 2R2TA 4DCJB 1CPZA 1OY8A 2YVSA 3CJ4A 4K8RA 3TNVA 2RS2A 1VGYA 4PXCA 2UUBJ 2B7CB 2BOPA 2F5GA 1YKWA 2OPSB 3ETOA 2ASLA 4WJBA 1RT1A 3CJQA 3UR0A 2Z2LA 3I87A 4J9MA 1T05A 1JJHA 4JBCA 1SKUB 3OR2B 2B0GA 3BF4A 3W2VB 4F4AA 4OZ0A 4YHHF 3BO2A 1SC4B 1OYEA 2K7KA 3SEOA 2OD4A 3UD5A 2UUCF 4W4MA 1Q81T 3D3BJ 2B5JA 2XG8A 1LWEB 3FCHA 2B9XA 4I2PA 3KG1A 3FSXA 1YITS 1FRKA 4PXBA 4C6AA 3W9HA 1VHIA 2A2CA 4Q8FA 1KLMA 2R7TA 5EX3A 4C48A 1T9YA 3PJXA 4JV5F 2HPUA 4NX9A 5A76A 4F0KA 5THWA 1YJVA 1ZM3A 2E44A 4RKUC 2HURA 3Q8YA 4UT4A 3DMJB 3SSSA 2AYBA 2XNQA 4NLRA 3FK4A 3OR1B 3TZXA 3KLHB 3MAAB 3MR2A 5J2QB 2R7SA 1KHVA 1REVA 1LFPA 2VFVA 2RNEA 3CJ5A 2QLBB 3D66A 1EKSA 3P45B 4DR2F 3ELHA 2LQ5A 2NUUG 2CQBA 5B08A 1S1TB 2F63A 3IO1A 3R5AA 2ZHBA 3U1LA 3OJUA 4DUZF 4NXNJ 2B51A 4R0EA 2U2FA 2UVVA 4QWEA 4PUOB 3DRSA 1B99A 1S1XA 3JB9k 5J1EB 5HMWA 3QGGA 3MR5A 4DV6F 3CD5A 1VMBA 1YJUA 2C3OA 2K2PA 1JLFA 4J9PA 1KQKA 1Y5LB 2N7CA 2KXFA 5HMZA 4NXMF 2DPJA 4OLPA 3D1OA 4LF6F 3UCUP 2BM0A 4EZ6A 1SVDA 1RB0A 1NK0A 1S49A 2FZGB 4CDIA 3MAAA 5J2QA 3JSMA 4RWXA 3GJRB 3BSOA 1CJUB 4AQYF 2Q43A 3CWJA 3LQVA 3BO3A 3CULA 1OPIA 3UE2A 2E5HA 3H2UB 3GJQB 3VGSA 3VGUA 1FJEB 2DRBA 3A8KA 1QLNA 1OO0B 2OTJS 4ED6A 2MDAA 1S6QA 3M32B 2FYXA 1XTZA 3M9NB 1EKRA 3D4JA 1FX4A 5ETOA 5KAKA 1SJ1A 2WBRA 5G4DA 1LK7A 2HK3A 1NDCA 2CZ9A 2XMMA 2GGPA 4CLLA 5JVGQ 4LF7F 2HFNA 1ZTWA 1DTTB 2QTWA 3T41A 2V63A 1QAYA 2VQEF 2ROGA 1FJGF 2AGOA 4DL7A 2CZ4A 4I7FB 1S6PA 2N3OA 2AEMA 5A8KB 1M90T 1VI7A 4U7UK 2QL7B 2MKIA 4JI7F 4Y2IA 2HHXA 2W7PA 3CO9A 1QUPA 1SBRA 1TKZB 1TKXA 2KO1A 3HM9A 4DV5F 2ATLA 3PYDA 5GAGI 2HNYB 1GNKA 2QA2A 3FRZA 2VHGA 1L3SA 4GKKJ 2VOPA 3UQSA 3CSKA 3AOCA 1CQMA 3H5YA 1JLBA 1M1HA 1NEEA 2K3IA 2MZRA 4C3KA 4R8UB 1HNXF 3UN5A 2XO7A 1H2UX 3QLHB 1WTFA 1R8PA 2DGTA 1VLYA 4A4JA 1C1BA 3KLFA 2LDYA 3G6XA 4F4KA 1S1VA 2AWZA 1L3VA 1M5SA 1SPBP 1TTHB 2ZOFA 2HIYA 4XIUA 3D3CJ 3Q86A 3N9UC 4DV4J 1V3ZA 3K17A 3MTKA 2ZNZA 3MPUB 2LU2A 4DPUA 1WUUA 2IJNA 5HL7Q 2ASDA 1D3WA 1DQ8A 1LFWA 1HBNA 3FEXB 2ZWPA 5C7PA 4OYMA 4DV0F 4E98A 5C24A 4QYZK 2BRKA 5LL6d 4NA2A 2OHDA 4Y3CA 4CM2A 4KTQA 3C16A 3EYZA 1JLGB 5HLFB 3N6MA 4CCHA 3ZC4A 1SQGA 3DLEB 1P9QC 1B0VA 4LF6J 1T9TA 2OPPA 4ANCA 1UW4A 3ZTOA 4JV0A 1FJGJ 1B7FA 4NLGA 5KFYA 1FE4A 3K5MA 4DQPA 3KUHA 3ET6A 3ZZYA 3PVXA 3MMCA 4OL8A 4RNNA 3J7YI 4KGZB 3AJ2A 4ES1A 1K44A 5D0EA 4ZP8A 2P9GA 3JYTB 1R8BA 5K8PA 1P1TA 5IM0A 1VCTA 2VC0A 2DNZA 8RUCA 4DX6A 1BQNB 5E3AA 2FHJA 3GSDA 2EC0A 4IKAA 4EBEA 1F60B 3BPDA 1YJNS 2CWXA 1PG5B 4AE5A 3AH6A 1FTRA 4KKOA 2LQBA 1XMOJ 3CDAA 2HNYA 1VIOA 1U2CA 2EVZA 2K1RB 2MZSA 1MU2B 2ZBPA 1DFDA 1H7XA 3HHLC 3F56A 3BQ2A 2NUHA 2DBBA 2WVBA 5HSPA 1HNWF 1KP6A 2HHTA 2DGQA 3DLGB 3LAKA 3H4DA 1NKEA 3PYGA 1M1KT 1U2FA 1Y5IB 4A8MP 1BQNA 3A3OB 4KB7A 4WXOA 3LANA 3M2UB 2HBQB 2OPSA 4MH8A 1P27B 4OX6A 2DIVA 1NJIT 2C2MB 1ZBTA 1BMQB 2HQFA 2KHCA 3IM9A 3F44A 2WSCC 3I96A 3MMCB 2Z57B 4OJGA 1XR6A 1I94F 4JI3J 1CVJA 3V6DB 3CCMS 4TY8B 4CLKA 1S10A 1HHSA 2D3UA 3PIPQ 4LF8J 1SXLA 1X4FA 3DFEA 4U8VA 1ACMB 5CYMA 4NLVA 3QNWB 3N6NA 3RZAA 1RUSA 3ISND 2AMCB 4KRWA 3QT5A 3H59A 4NYOA 1VC5A 4UOGA 3PCOB 1HD0A 2D41A 3JQJA 1FKOA 2HVEA 1NSQA 2MXYA 1SJ4P 1JJ2R 1HR0F 3AOAA 5KFLA 5KFCA 2GW8A 1RXOB 5LMNJ 4J9SA 1XC9A 1HWKA 2V4RA 1IN0A 3CD6S 3HI9A 2OPRA 4OZLA 1TL7B 4ZVPB 2V5HG 3HT3A 2R8HA 2BVZA 4CT9A 2A18A 3HKWA 4CYUA 4ERDA 2FHOB 3P6YC 1VQPS 1IBCB 4LVOP 2XB2D 2VG7A 2KXNB 1OQ6A 5KG4A 4Q5VA 2HFUA 1RT7A 2XO6A 3VR1A 5CABA 4EO6A 3M8YA 3N79A 1KOOA 1NPPA 4NLSA 4YB6A 5DDQC 4DJBA 1TFYA 3N4WA 3D5MA 3CJKB 4PXEA 5A2QY 4Y65A 1UA1A 4IOAQ 3MWBA 2B3TB 2GV1A 1TMJA 1T9XA 1ZZNA 2W9AA 3DRYA 3QRRA 1FKOB 4DS5A 1U1MA 4NLDA 3R6LB 1WHVA 4B9TA 4WWSA 1Q8BA 4DHVA 2MQMA 4DX8H 2DY9A 2NPFA 3JQMA 4JI6F 1DLOB 4E2FB 4I69A 2JFKA 4DV0J 2M0GB 3I6PA 2FJEB 1FKPB 3MMJA 3HHLD 3GG0A 2CJYB 4XAKA 3G87A 3TUZC 3DC2A 1H72C 2I0XA 3BBBA 1XNQF 1MMDA 1PJ7A 2HFZA 5AXLA 1HPZA 3DGPA 1BD6A 3W5YA 2UXBF 2ZH6A 3SXLA 4WFYA 4X66J 4CWBA 1S77D 1S6QB 2ZWOA 2AYMA 2DTJA 2F8HA 3DU6A 4Q7AA 1SKSA 2EK6A 4H4OB 3US5A 1X8DA 4ELVA 1VQMS 1F9EB 2XYHB 2JHEA 4DPTA 4WKYA 1QD1A 4JI2J 3LP1A 1U1OA 1NKCA 3ICLA 1TP7A 3KK2A 2DVIA 2LEAA 1X9MA 1OJ4A 4I64A 3V81A 2HZVA 3E2EA 1FRXA 4KV8B 4FZVA 1AUDA 3QPIA 3MOJB 1Z2ZA 2IRXA 4NXMJ 2HHVA 2RU9A 3M2RB 1JLCA 1RDRA 1R7IA 4DI6A 4DX5A 2G13A 3MM5B 3N01A 4ZIWA 5HVFA 2XMVA 2ZHAA 1NLKL 5KT7A 2YY3A 1X60A 3C66A 4DR7F 1M0SA 4I6WA 4IRDA 2FVQA 2CJBA 2HWHA 4OYIA 5CAAA 3I0RA 1O6XA 5B7WA 1GX6A 2HS4A 2H65B 1S1UB 2V69A 3L09A 3EXYA 4LF1A 4WFBQ 1VQ5S 4ED2A 1VQOS 4H4KC 4URSA 2DO0A 4PKDB 4F50A 1Q8LA 3HHKA 1NK7A 4DWIA 2GQCA 2VV5A 3F73A 4FYWB 1GMWA 2XSJB 1OYDA 1YGYA 1Q1KA 3CJSA 2J9EA 2IC3B 2DGSA 4EUVA 5F8NA 4ZPCA 4B08A 3R7BB 2R2UA 1BHNA 3KJVB 4W92B 4CQ1A 5H9FJ 2B6AB 4ANDA 2PDAA 3A1YG 1D09B 3PX4A 5LSRA 3O1LA 2XS7A 1X5PA 2XULA 1HWJA 5KFEA 3HHNB 4CLZA 2XZDB 3IBCB 1HBOB 3DOLA 2ZUGA 4HTJA 3LALA 4PYAA 4WP3A 5G0RB 3O5TB 2VQFF 1XR7A 1NDKA 2ACYA 3NLCA 3UVJB 3J81j 2RQCA 3SDEB 5D4NA 4UOCA 1RT1B 2RDJA 1JLBB 4X66F 2EKNA 4NCGA 4K4VA 5KFPA 2OEKA 4G6VB 1K47A 1Q95G 2HW3A 2H5JB 2JOQA 1QUVA 3Q2SC 2YPZA 1VIXA 1JXEA 1U8WA 2WW8A 2XHWA 1B0PA 2MHNA 1UFKA 3FQKA 3VWSA 4CLWA 3RB6A 4X64J 2AV5A 2W01A 1H73A 5BYQA 3KNGA 4ETZA 1SI9A 1KR4A 4AXIA 3PRDA 4P73A 2PEBA 3RBXA 2FLNA 4P72A 2WVDA 2EPIA 2HGMA 2MGZA 2HNZA 4NA1A 3SDEA 3RR8A 3RYLA 2VIHA 3AA8A 1FKAF 1JKHA 2BW7A 1S6UA 1HNWJ 5T41A 3K8VA 2RVJA 2VG5B 4KO0A 3MDFA 3ZZZA 1LWCB 2Q3PA 1NH8A 2DISA 4MT1A 1KBRA 5E3RA 1YSJA 2YKOA 1G3OA 3BGRA 3NCQA 4N8OA 4NLXA 5DETA 2W9CB 2IVMA 1CJTB 3BN7A 5H9EJ 3MURP 3EM1A 2B6AA 1FNXH 4M5HA 2ZKTA 2KJVA 3SI8A 5J2MA 2M9KA 4LT6A 2RSQA 2Y8YA 2X51A 3WIUA 2VJVA 2C2OB 4DSIA 1T94A 4ZPAA 5GMEA 1HQEB 2X1BA 4KGMA 2FHMA 2HQGA 2BQ3A 1WG5A 4EBDA 4A8SA 2VICA 3LP0A 3HDSA 3CCQS 4WE1A 4C0BA 4DPYA 4ID5B 1S1UA 2BDPA 2CQGA 3LPYA 5AXNA 2ZJRQ 2VA3A 4A47A 1YJ9S 2FY1A 4Y2MA 5DRKA 2O66A 4DR4F 1LEOA 3G86A 2HGNA 4WBFA 3MHYA 1Q78A 3ZFVA 3LGNA 3M05A 4PG7A 1L3UA 1JB0C 3TP2A 3NRBA 2LQ8A 1WHWA 1Q7LB 2D7SA 2VDHA 4JI2F 1KEKA 1F6TA 2QYGA 4AFFA 2XMTA 2AJQA 1LQ9A 2A6OA 2C3PA 1R89A 1Y3KA 3IWXA 4ZPBA 5F8MA 1FEHA 1JX4A 2FVRA 1X5OA 4W98A 5KG5A 1N32F 4DN9A 5HMXA 1TV6A 2YNIA 4LR7A 3W9IA 5U47A 3VAFA 2DNHA 3PV8A 3DYAB 1ZYQA 3UO0A 3VAIA 2A3JA 5K5MA 4DSFA 2LLZA 4DG1B 1RWPB 4L3KA 3M8QA 1YIJS 1LKZA 3D0GE 3T19A 2DEJA 1LW0A 4QIFA 2AD9A 4GKKF 2EFGA 3FBFA 3HVTB 4OJ3A 1RBAA 4E0DA 1E6YA 4P75A 2E29A 1PYOB 1IBKF 5FD1A 1S4FA 2L08A 1DLOA 2YX1A 3DRXA 4BC7A 4WFAQ 1SUQB 3VGVA 1NK8A 3TAPA 4K4UA 4MMOA 1JJCB 1NDPA 2RRNA 3H8YA 1HD1A 1HKAA 3N0VA 4AXJA 3BKFA 4RW7A 1Q53A 7FDRA 2QMXA 2QA4G 1F0XA 1KTQA 4USKA 1S57A 1IUJA 4DV1J 4HT5A 2YH1A 1RABB 1HIYA 1ULRA 2VUGA 3S6EA 5LOQA 1KSPA 1BQMB 2BJ7A 3G9CA 1PO6A 4G1QA 2CJXB 2FPHX 2FGCA 2FJVA 3EXCX 4O44B 4YB7A 5D15A 3ZNJ1 4U95A 4N41A 1PGZA 4PWDA 3J7AN 1RHUB 3NP5A 2VQFJ 3PJWA 1HMVA 1FNOA 2V67A 1OSCA 5B0CA 4B3TJ 1RT6A 1PIEA 4E8UA 1YWXA 2ZZTA 2RS8A 1JMTA 2VBWA 4O44A 4G3IA 4X65F 1F5AA 4DLGA 1B7YB 1XERA 1EP4B 1NCLA 2RAQA 2VFSA 2AX0A 4F7VA 2RU3A 2XMAA 1SV5B 4B9NA 1DQAA 3ONQA 4QIGA 5GAHU 1VLOA 3MEGA 2BQUA 3J7A1 3JTOA 3I56S 3RRKA 4A46A 3NGTA 3SYZA 3BN4A 4FS2A 2R8KA 4IG0B 4HEA9 3O2IA 4RL1A 3WIVA 4OIXA 1FWKA 2NXUA 2QL9B 3ENQA 2VFUA 1OMSA 3DGVA 2AYEA 2CVEA 3NNAA 1C4CA 5SUHA 4U96A 3HXMA 3OTOJ 3P5TL 2Z4PA 3UNYA 1SC6A 3MZIA 1GTEA 1HQ2A 3R5CA 5J1NA 3W64A 1F3FA 1FK9A 4MKVA 1IKWB 3SCIE 4HH1A 1QSYA 2E1PA 2LA6A 4K7QA 5FIIA 2D3ZA 4AUKA 1WHXA 3AB2B 3NGRA 4FN5A 4NE9C 4ZCLA 5HK4A 5L39A 3UPFA 3KYLA 4K4WA 2YNIB 2XCPA 2DEIA 1K73T 3QBCA 4TYBA 2YNGB 5E3PA 1HL6A 2VKZG 1JLAA 3KJVA 1N4LA 3W2WB 4PYDA 2YNHA 3OBIA 4OZ3A 4BDPA 2J0XA 4C4WA 4OYPA 4DL4A 1I3OB 3JXOA 3C6TA 3PHTA 3O8WA 4YB1P 4B3OA 3BH7B 2QX0A 4PCQA 2XMUA 1N36J 1N33F 4DDFA 2CIMA 3THTA 4K4YA 1NMEB 1U0HA 3OSNA 5A0YB 2ZZNA 2WVCA 4WP8A 1RHJB 3UW1A 3R2DJ 3AHPA 3GSIA 5BR8J 1VQ9S 2JZ5A 3EVOA 1IKWA 2MKCA 2O1PA 5H9FK 1YI2S 1VQNS 5DGBA 4WIQA 1KN6A 1TL3A 2NSCA 2RF2A 2Q6BA 3IS9A 4F4ZA 2HRTA 4QWAA 2ZE2B 2PGCA 3MD1A 4OHZA 3CTRA 4CLFA 1TMMA 3TW0A 2D74B 5A8WB 4O3NA 3W9JA 3FUYA 3MM6B 2CQ3A 1TKTB 4ICLA 4F02A 2AT1B 1FDNA 1MWYA 2W1BA 1Y0HA 1C2PA 3V6KA 4QW9A 3D2WA 4F2RA 4RW8B 2MY7A 4TYAA 4GKJF 4DLEA 4U9RA 1REGX 3GIJA 2LMIA 2W9BB 1SIZA 4GVBA 2NYIA 3VVTA 2JVOA 3QZ8A 1SJQA 2B4OA 4URQU 3POTA 2NS1B 5SZTA 3TEGA 2RF2B 1T8EA 4JI4F 1TL3B 5D77A 5IWAF 4ZDNA 9RUBA 5C5JA 3BQ0A 4LIRA 3T5KA 1N6QB 2MZJA 3EX7B 1FA0A 2CRLA 2N82B 4KH1B 4RJVA 2H54B 5EWEA 5FJ4A 2BRLA 4KV8A 2HG4A 1TKTA 2EC2A 4USIA 3RUBL 3ZO7A 1C0TA 2I38A 3G6YA 2G2ZA 3DM2B 3WC0A 1UTAA 3C15B 2CPFA 3TVYA 3R5DA 3SCKE 1TU0B 4DFJA 3M8WA 2LQ9A 5DS7A 3VZHA 4M8LA 3O3LA 1I6JA 4LQ3A 2XEXA 4DSEA 1S7IA 4ATNA 2ZUAA 5IT9U 4C8ZA 4JYAJ 4NLOA 3VAHA 3OXGA 2BR0A 1KTVA 4C98A 3V6DA 4OHWA 2UZAA 2ZJQQ 5L1LA 2B8QA 1KLNA 4C8LA 4Q0BB 2KU7A 5IT9Y 2DH7A 2HZAA 4LF4J 1FK9B 1SH3A 4FVMA 4N8NA 3AY0A 3ULHA 5GADU 1Y00A 2VH7A 3M32A 5A2QU 2JEFA 1UJ5A 2FTRA 2GVZA 4WK3A 2FZCB 1LW2B 3BR9A 5IXUA 2ZJPQ 4NCBA 2VODA 1XMQJ 3EVWA 5KFAA 4OYBA 4EK2A 3I4HX 4ZK7M 2IM1A 1WI8A 4QYZJ 3IXQA 3MPVA 3PXGa 2NSBA 1I51B 4X84A 1CJKA 2MHEA 3LP2A 4B9UA 2R2RA 3DLKA 1UEKA 3H0PA 1HBUB 4ENOA 1NJZA 5FLXY 2CXEA 4QU6A 2C2ZB 3FZ2A 2E9ZA 2BUNA 5IOLA 4HH0A 2ZKUA 3HKZD 4HHUA 5F8HA 4ZCKA 2WSEC 4NMLA 4U6PA 1P1LA 4V19J 4H4KA 3SCLE 5ADZA 3M9MB 4B3RF 2PIIA 4URGA 4RNOA 4DS4A 1UVMA 4ITSA 1N33J 1KOHA 1KKHA 2E1MC 1TELA 2H4YB 2QYCA 2WW4A 4RNFA 3Q0AA 3FCWA 2Z2YB 5A8WA 4WYLA 2V8PA 3GTYX 2DGWA 1YRUA 2YWHA 3OTDA 3KLHA 1YHQS 2DNQA 2UUAJ 3BJYA 2WONA 1VQ8S 2LA4A 3MR7A 2B8PA 4JI7J 4OYAA 1X4GA 4FBTA 2H4WB 2ATCB 5DG8A 2HZCA 4QZVB 2FLPA 2WVFA 2GC8A 2PSZA 3PG9A 2PO4A 2MLXA 4UUXA 4X64F 2CQ2A 4FPRA 3LO3A 2OAUA 3JQKA 1NXIA 3J7YU 4DCOB 1YRXA 2DHAA 2VPZB 4QCLA 2V4QA 3O44A 3SQGA 3L7UA 5LSLA 2HRYA 2EK1A 2XHCA 3HJVA 5F9NA 5I3UA 4PQUA 4GO5X 1CJTA 2RH3A 3KLGA 5ETTA 4NLYA 5KT6A 1TL4A 1U2RA 4WTYA 5CYQB 4QBUA 3DLBA 4AD6A 4RW9B 5HP1A 1CJKB 1DAXA 3IRXB 3LP2B 1MW7A 1U0HB 3GYNA 2BE7D 2CFXA 4UOFA 5K14A 1B64A 5CA5A 4Q43A 1D9AA 1XK8A 4OJHA 3IBFB 4AL6A 4FXWA 5HI7A 2EG1A 3PW7A 3A8IA 2NXCA 4Q2MA 4U7UD 5LXRA 2QGFB 4KKOB 3DM2A 2BACA 2VG6A 2E5LF 4JI4J 1C0TB 1RAJA 2UUAF 3T1YF 5KOXA 4CO5A 5GMDA 1FT8A 2R7QA 2GAGC 4WFXA 4FPIA 1FFSB 4WK1A 5GVQA 4GC7A 4ED7A 2BABA 4YFUA 3OHBA 2UUTA 5GAGU 3LPEA 4IOCQ 3X3UA 5A8RB 2DR9A 1KONA 4Y0FA 2KG1A 2M88A 1H0HB 1S9EB 2GX8A 2GMLA 2HFOA 2R7OA 5HJYA 2JDJA 3CDUA 5E0OA 3PW2A 5L9NA 3CCUS 1S97A 1S79A 3BV8A 1VRUA 2J6TA 1RT4A 4I67A 4OV1A 5DJBA 4UQTA 2SXLA 1FF2A 3TQEA 1F1BB 4YDXA 2M3DA 3VVUA 2QFJA 4J9RA 2UXCF 3TZYA 2EFVA 1HNZF 4UF4A 3TR5A 1C0UB 4DQRA 3UDCA 2HFSA 1LXJA 1VRUB 1Z2LA 2G1DA 3IC1A 5LXYA 4F04B 5KFNA 4N5SA 3MFHA 1RP5A 3RTVA 4N76A 5RUBA 2Y3YA 1RT7B 1RWXB 2BX6A 1S59A 2OFGX 1SC3B 1R31A 1N8RT 4NYPA 4DR3J 1F9HA 1UVKA 4O4RA 5F41A 3R27A 3IRWP 4CP5A 3IMQJ 2R7RA 1OY6A 3VQTA 1UJ6A 3M8RA 1WDDA 3LUYA 1EHWA 2RB7A 3GZ7A 3ETMA 3M1VB 1QE1B 4JI0F 3TVKA 3DHXA 4DEZA 2IMOA 4JI5J 1F5BA 1TZ0A 1L3KA 4DXLA 2KVQE 2PA8D 3NKYA 4RPFA 3UDEA 3MUMP 3V6HA 3AAWB 3OFFA 4DL6A 2IMWP 3Q22A 4RBUA 2PC6A 2F65A 2WSFC 2HVDA 2G1HA 2R7UA 2DCLA 4ZN3A 1O5JA 2VG5A 1Q82T 3GFXA 4WF9Q 2UU9F 2M8HA 4Y2AA 1ELOA 2OPQA 2MLYA 3I5CA 2JX2A 3CEDA 4RW9A 2J0WA 2GVZB 2X3GA 3KLIA 3ILIA 5CYJA 2L41A 5IS2A 5FLXU 5AJ3J 1WTBA 2HVIA 3FFIA 1WSVA 1WG4A 2LP4A 4DQQA 2ZZMA 3OLBA 5G0RA 1B0TA 1VBZA 4IR9A 3R97A 3RAQA 2FZKB 3OSPA 2KFNA 2FB0A 3TAMB 3RAMA 1KS2A 2C2NA 1IWGA 2P6TA 5B0AA 3KK1A 2D1CA 1LWFA 2BKOA 2Z30B 3NOCA 1NU4A 2VL1A 3A3PB 5H1SV 3LH2S 4MIBA 4NL5A 1SV5A 1RAOA 3G8QA 2IVFB 1ZH5A 1NZAA 1EP4A 1VC6A 3NOGA 2VPYB 2KL8A 2EBGA 4IRKA 5L38A 3D68A 5AE3A 2DY1A 1NZ8A 3F0NA 3CCSS 3LA0A 1N6QA 2WRMA 4P7TA 4NI2A 3FMWA 3MCMA 3HFKA 3CUNA 2CQ4A 3KUEA 5CH7B 3VAJA 3QYYA 2YXLA 5B09A 2K3KA 2YPYA 2EFNA 3RW7A 2UVRA 3MM7B 3D7SB 3CMQA 3DKDA 3MF5A 4RWWA 3HFVA 2IJRA 2IYIA 1HBUA 2LQJA 3L4BC 2RHQB 4DBQA 1QSLA 4DV5J 4HYKA 1YJWS 4TQRA 3ILJA 4DV3J 1HQEA 2ZBIA 5GAEI 5DDOC 3QWUA 1Y7PA 3MAHA 3AJDA 3GONA 2XYGB 5HMYA 2I5JA 3ZTRA 4M94A 4KR0B 3DRRB 1FDDA 2H3EB 3IAS9 4LJMA 3ZZTA 4U8YA 4DPWA 3G82B 4PPZA 3EWGA 1NK5A 2FVCA 3IA0A 2NXEA 4OI0A 3VF0B 6FDRA 4X4OA 2MJNA 3NCPA 4CRJA 2O5DA 2PFDA 2FQQB 4CLSA 1EJ7L 3HSDA 5F8GA 2FIUA 2UVWA 5L8RC 3L9ZA 3MMAA 4GC6A 4FYDA 3HSJA 1T9UA 2DNNA 3GU0A 2D3O1 5KG2A 2G2OA 2YQ3A 4J91A 1K1SA 2HQDA 5KFTA 5D4PA 5HQMA 2XZTB 4P9SA 2Y1RI 3H2LA 4PG5A 1T0TV 3JS9A 1RISA 1VHFA 4ZMMA 2DRAA 2HEKA 2NXNA 4J5OA 4DV3F 4DG1A 1RQ0A 2MPUA 3AD8C 2VDIA 3MM8B 1I1GA 1RAIB 3MOZA 2EW9A 3BYRA 4OJ1A 4OHXA 3JYTA 2XY6A 1WI6A 2F8MA 1X4AA 4HHJA 2KVIA 3P49B 2UV8A 2BM1A 1FJ7A 3BGFA 2IFXA 3OD2A 1X7VA 5KFGA 4BHQA 1N56A 1KVIA 3DLJA 1DQ9A 2DH9A 4C11A 3NS7B 4LFCJ 1CULA 4GVBB 4LREA 4LF5J 2JH3A 2QE5A 4QYRA 1H98A 2UXBJ 3QO9B 2CNLB 2R8IA 2J7KA 2N3LA 3H7HB 2YWFA 2X1FA 2KYZA 2N4DA 3T5LA 4C3MA 1S6OA 2IAJB 1NH7A 2PMHA 5E3CA 4DFKA 2WCXA 4F4WA 4DL2A 3BREA 4OZ2A 2YKNA 2AGQA 1IXKA 1REVB 3PKYA 3BR8A 3FMBA 5FDLA 1QVFR 2H48B 3D9BA 5J2MB 4DSJA 4ELUA 3ITHA 4LFBF 2RIJA 2ZEJA 4Z2XA 3H5SA 2ADCA 2VONA 1S1VB 3OXLA 5K20B 3CCTA 4TXSA 2MQ8A 5LMUF 4ZCMA 3MCSA 4DR5F 2UXDF 4C11B 1U09A 5KG3A 3PFOA 3PYFA 4Y2CA 1U6FA 4LF7J 1C4AA 1RTIB 4IH6A 3UD3P 1VK3A 3AFGA 1PJ5A 1SH0A 1AB8A 5KT3A 2HNZB 3KHRA 1HNIA 2R7VA 1S12A 1RCOB 1V5IB 3GMGA 3G4SS 3CCJS 1VFJA 3DLKB 1YVFA 4EO8A 2JL9A 1M5VC 1RAEB 2DR5A 3OHAA 3BGRB 3K2YA 1UL3A 3L7PA 1NUEA 3CJ0A 3DDNA 4LSLB 2OP5A 3V6JA 5IT4A 4RUAA 1X9WA 1U26A 4BS2A 1N5SA 2OO4A 4F0MA 4ZVGA 1RTJA 1S7HA 2K1RA 3P4UB 2B5JB 2WB1D 2Z8QA 5LM7E 4BBYA 1NRKA 2CNNB 1GT8A 2MTLA 1E6YB 2Z56B 3FDSA 4CO2A 3VQSA 3HVTA 3HSGA 2CPJA 1A7GE 4PABA 3ZZ0A 3DOKA 5D78A 4FKYA 3AXMA 3HHEA 4FF4A 4M5NA 2EBEA 4TN2A 2E1RA 2DNMA 2RQ4A 5BJRA 2BBEA 4QR1A 1XMBA 2O67A 1X31C 1S9GA 2XI2A 3H2VE 5HATA 3NEKA 5C2GA 5KFDA 4LBIA 4CLPA 1TUWA 2JWNA 3GJTB 5KFOA 2WBMA 2V2ZA 4KGKA 1BUXA 2C2DA 1WELA 3IGNA 4QIEA 1PC5A 2BJ1A 2IIHA 2PN6A 4UUWA 2XS2A 4MKAA 3ILLA 2Z58B 3UCZP 3MEEB 4NLQA 4DV4F 2UXCJ 4ZP9A 1KC8T 4OYZA 2XYPB 3GG1A 2ZH4A 3I0SA 1HI8A 2B4UA 2XWXA 3D6MB 2OGUA 3H90A 3LOUA 4KPCA 3PW0A 2K8GA 4CNYA 4F2SA 2BW2A 3TOQA 3UDLA 3MXHP 5D3GA 1UZDA 1VISA 3OJSA 3HFZB 1NDLA 3KUGA 1BY9A 4OX7A 5KFXA 4F0HA 3HMJG 3MUTP 2R3VA 4ECVA 4P2SA 1FEEA 3DRPB 3M8SA 2AU0A 3EGZA 4RNMA 3J80U 4D3HA 3GV8B 2VJUA 1S1XB 2R42A 2VASA 3KJNB 1JLGA 2JVRA 2ZM6J 2ILZA 3O6QA 1JLEA 4KH0B 1T11A 3ITHB 2DXFA 5B0BA 3G8SA 5HVHA 4HTIA 4P52A 2F1FA 1RBOB 4ZIVA 1YDLA 1XNRF 2FC8A 4PXDA 1GX5A 2HLUA 2HQIA 4G65A 1ZAVA 4ECXA 3KK2B 2ZC3A 4ZVFA 4A8QA 3HD2A 3EGVA 1MG7A 2YKAA 4ECRA 4R0JA 4RUCA 4QJVA 2HHPA 3A13A 3GB0A 1EETA 1FVSA 3F41A 3TA0A 1Q5YA 3CJRA 1PAUB 4ZITA 5KFFA 2PEHA 2RHSB 4OYWA 5D8HB 2EKYA 1WC1A 2C3UA 2IVYA 2X3DA 4V19X 3M2RA 1IM6A 2KYXA 4I2PB 4USUA 1RA6A 4XDDA 4IUFA 1PJ6A 2YQ0A 4FNHA 4JP8A 4NZ0A 4AQYJ 2PD1A 2GMHA 4I0WA 1MU2A 4LR9A 3EICA 2XBPA 3JSRA 3D1QA 2HGLA 2BE9B 3GR1A 2RQMA 3CCLS 4DR6F 1AT1B 1NPRA 1TK5A 4JI5F 2OEJA 4M5DA 4ZVQB 3NAIA 3KDNA 1SKWA 4AL5A 2A0FB 3EGNA 4H4OA 1DTTA 3EDQB 4MJKA 2LXIA 2C28A 4NLUA 1HHQA 1S48A 4MYUA 1SL0A 4FDFA 5F0WA 3IWLA 4K0KF 1UVJA 1Q16B 3B4MA 3MR6A 3B4DA 1UVIA 2HS0A 3K5OA 1UPPA 3TYTA 3BSNA 4LRAA 2E9RX 2CPEA 2OI2A 2P8IA 3H40A 1UFLA 3T3FA 5CZVA 1N5QA 3OL9A 3T6JA 4YP3A 4ID5A 4IYQA 4TVAB 3TO8A 4ZVRB 5HLFA 2KT3A 3MAQA 2V2VA 4V1Ak 2CYYA 5E7OB 3HPOA 2MSTA 5FDLB 3M7VA 2ZDOA 5LJ5Y 4A8FA 1RSCA 3QFHA 3V4MA 2V6AA 5E3QA 1U1NA 1IBMJ 1RTZA 2VB6A 3M6XA 4A48A 4C8MA 2QLJB 1ZAWA 4EI2A 3J7Z5 2KM8B 4DV2F 2CZVC 1HWLA 3C16B 2DPIA 3R5BA 4OFZA 2CPIA 2XSJA 4KYZA 4CYUB 1X5SA 2VF3A 5L46A 2C1EB 1IJFB 2W4CA 1VJQA 5D3GB 1N5TA 4KO0B 2IA6A 3KNAA 4QWDA 1EQMA 1IKVA 2IRYA 2VPWB 4MIAA 1R8AA 4CO0A 3T1YJ 1RLCL 4I56A 3BGUA 1S99A 4OZ5A 2BANA 2GJ2A 2CQHA 2MGZB 1K8AT 1GEHA 1AW0A 3DNCA 3W2VA 4CIOA 1QAIA 4RZRA 4LVNP 1NAQA 5A8KA 4QPXA 4LF4F 5LSOA 5ETLA 5LMNF 4LR8A 3GFHA 2ZOGA 4EU0A 1Q8IA 3W60A 2G9OA 2DHHA 1VK8A 3I82A 4JYAF 3A8EA 2M7SA 3DXBA 1KFDA 1RWWB 1S0NA 4HKQA 1FRJA 3KK1B 3OL6A 3KLVA 4M5GA 3CJ2A 3TAMA 4CLYA 2APOA 2YWEA 1AFJA 2W4PA 3GIIA 5KG7A 2JLFA 3DOKB 1QJHA 1W26A 4J9NA 2AQ4A 2P2CB 3CDBA 3QT8A 1ZZFA 1OSDA 2IBOA 1VQYA 2A2DA 2OSRA 4FP9A 1F3VA 2BJDA 5HO4A 5J2NA 2HKEA 4IFYB 1EX8A 2AKWB 4F4XA 1VBXA 4B9VA 1S5ZA 2DXDA 3TZZA 2A1BA 2V68A 2XWYA 4C8YA 1EB0A 2OELA 2GO9A 1ZM4A 2YKQA 2ZD1A 2O3DA 1VOMA 4LBPA 2ZBQA 4F26A 2JJ4D 1FCAA 2P5VA 1T3NA 1PYSB 2JLGA 3CC4S 5KG6A 4R5PA 2CPYA 1AUSL 5M2RA 1GK8A 2OPPB 3A3NB 1AXQA 2DXEA 4HLBA 1N32J 2F8EX 2HBZB 3TX0A 1CQNA 3VV2B 3M6UA 3HLUA 5B0GA 3SBMA 4I6AA 1AA1B 4TNOA 3ISZA 3HVAA 4U67Q 4OX9F 3PY8A 2EXUA 3T9ZA 1Q79A 2P6SA 1RTIA 1T02A 2EI5A 2V34A 2V2QA 3I0RB 3TVZA 1I94J 4JI3F 3Q8VA 2V9KA 1RI7A 2J6SA 1TL5A 1Y11A 3I0SB 3CGIA 3KKFA 3Q89A 3QT7A 2FUG9 2KH9A 3PYEA 4DU8A 1N5YA 3FBEA 1NK6A 4YS2A 3AA9A 3D67A 3GJSB 3K57A 3QSYB 4DL5A 4IH7A 3GIKA 4PG6A 1E6VB 2HAFA 3FBBA 4DOZA 3J7ZT 3CCVS 2KKHA 3GCXP 3PEJA 3PDNA 3RB4A 4CH1A 4K50A 2CPZA 2BMBA 2WOMB 1H6KX 4MKBA 3EE3A 4MIWA 3R5GA 3PKMA 3QRPA 1C0UA 2DGVA 1ICEB 3KG4A 4ECSA 1UJ4A 1O8BA 2AEJA 2W2PP 2ZVSA 4JV2A 3PR4A 4C8OA 4NCAA 3IG1B 4NRUA 4WZQA 1XMQF 4Q8EA 1T95A 1RBLA 1RT4B 3AQOA 3NNCA 4O0NA 1HQUA 4K5RA 4OI4A 1NJWA 1OY9A 2YWGA 3D54A 9ATCB 1K1QA 2M2BA 1OIAA 3E01B 3DXSX 4USTA 4O3OA 3VZIA 5DQIA 1R8HA 2XGPA 1YBUA 3IWNC 1WDTA 4DR2J 2QLFB 3OV7A 4ZVEA 3SMZA 4OX9J 4OZ1A 4KC5A 2MY8A 5DDPC 3OL8A 4M5LA 2CUYA 5HROA 1RA7A 3JAMY 1J5EJ 2YNFA 3IGVA 1Z4UA 3HHLB 3P96A 5DLGA 2K7JA 3OR2A 3OTOF 4XO0A 1KQSR 3KDOA 3I55S 4K4SA 2ZVIA 2HWIA 1XJWB 7AT1B 3CXCR 4RU2A 4M95A 4ZP7A 1KVJA 1H2TZ 4ZA1A 2DNYA 2BV3A 1WC0A 4R25A 2F4FA 5ETVA 4B9MA 3PNIA 4FYYB 1G7CB 2CG8A 3S7RA 2BEFA 3LGMA 3UWTA 3VAKA 3GILA 3MGJA 5IWAJ 4NMXA 1H38A 3M4XA 3EJMA 3M30B 1N5VA 2DK2A 4HACB 5ETRA 5JXSA 3KK3B 4ZLPA 1C1CA 2B9YA 2BKPA 4LRFA 4XPEA 2H51B 4J9VA 2W2QP 1R27B 2HHWA 3G82A 1G1XA 2QO3A 2QA1A 2CDRB 3PM9A 5CD4H 3GQCA 4TU7A 2KZMA 1YRTA 3HD1A 1U49A 4G1PA 5GAEU 2M4MA 1CLFA 2HHHF 3R1LA 1FWLA 3B82A 2WZ1A 2J9DE 3AQPA 2QV6A 3OR1A 4EWTA 3OVAA 3PX0A 2MKKA 2R8JA 4F8RA 5F8LA 4ZVUB 5J2PB 4C8KA 1B3TA 2PMWA 1U1QA 2IDEA 1CBKA 1IM4A 2A10A 4WU3A 3VHQA 4R5PB 1XIQA 3S8SA 1S9FA 1HNVB 2FLOA 4HT7A 3DRSB 3PR5B 2RT3A 2NZCA 1TL1B 1Y10A 3BPSP 4Q45A 5DGAA 2QA4S 3W8GA 1U25A 2RRAA 1RT2A 5EGYA 1N0VC 5D0HA 2CNOB 3RGIA 1GFWB 1CJVB 2HNDA 4CO3A 4X62J 3MM8A 3QO9A 1IBKJ 2GCFA 5F8IA 1PSDA 5CD4A 5DLFA 4DUZJ 2CQ0A 2FC9A 3CNQP 1MNEA 3B54A 5CQGA 1HARA 3C6UB 4ANEA 1X4CA 4TLQA 2E7XA 4RR5A 1NK4A 5DO2A 4BCAA 1RJJA 1U0SA 4H54A 4P2FA 4EGLA 3UR3C 2CJKA 2NZ4A 1FXRA 2RKIB 1AFIA 2NREA 1RHRB 2GZOA 2C42A 3I9ZA 5M2PA 2F7VA 5KFJA 2LEBA 2DGXA 3FNNA 5I3PA 2IPOB 2ALYB 1X9SA 1V5VA 4JUZA 1S1WA 2C2KB 1URNA 3TARA 3Q23A 4C2MA 1FE0A 1LW2A 3Q8PB 2BQRA 4KGVB 2QN6B 4FXDA 3FZBA 5F3ZA 3RBEA 4I4BA 3HVWA 3FVYA 4JB8B 3QJJA 1RHQB 4K0KJ 3DRRA 1RTJB 1RT2B 2OPQB 4Y00A 2KG0A 4ZPVR 1UKUA 3KHLA 2GVDB 2YX7A 3MCNA 1IR0A 2XLJA 4RW6A 4ECQA 1R0AB 2HSEB 5F9LA 1RT3B 5HQLA 2R7XA 1QAXA 3RRGA 2ASYA 3CIZA 3JAMU 1IKXB 1G2EA 2G0IA 1NO8A 5KFZA 1QE1A 1A6LA 1RU1A 1UEUA 3PTWA 2KT2A 4OLOA 3FGVA 5C25B 3K58A 1T03B 2FLLA 4M1KA 3MD3A 1IKVB 3ENAA 4YN3B 1YG0A 2DR6A 4O3QA 3THPA 1X4EA 5BXIA 4IQMA 3FEYB 4LF2A 3MUVP 3U7JA 3CDEA 4KFBB 2D9OA 4OI1A 4N56A 1SL2A 2B56A 1RADB 2HVHA 1W7WA 3G2XA 3KLEB 3M9OB 3MM7A 1C1CB 1HNXJ 2B4VA 2J7WA 3QATA 3TAQA 2BOAA 4ZVHA 1NSPA 1APSA 3BEGB 3C19A 3JSYA 4LSZB 1KHWA 3BB5A 2D9PA 4FYVB 2MLZA 4NI2B 4EEYA 2UXDJ 3QAEA 5B0DA 3BGLA 3L7OA 3GFZA 4YOEA 2E1CA 4ZP6A 5EX0A 2CQ1A 3MEDA 4HVZA 2LCWA 3M2VA 3H20A 3MEEA 4OYOA 4BC9A 5JJBA 2I1RA 2MKJA 1UPMB 2DT9A 4O4GA 1SH2A 1RT3A 3LGHA 4M5DB 1MSWD 2Y9HA 2VQEJ 3AD7C 1H7WA 2GHVC 2V8VA 5KFIA 1RAAB 1WORA 3SCJE 2COLA 2ROEA 1SC1B 2KFYA 2QIFA 2EFPA 1X4HA 2DGUA 3D0IE 3OFGA 1UMJA 4Z7CA 2XLIA 1IKYA 4I6YA 2AJFE 1V6HA 2IBKA 2J76E 1EQ0A 1T05B 1XEZA 2BZ2A 3MEKA 2C3MA 3BQ1A 3FFIB 4DR3F 2KRBA 1FFGB 2I6WA 2CJQA 2OUGA 3W2WA 5KFSA 4IQXA 4KHPJ 5AT1B 4IG3B 4J7CA 4DX7A 1HNIB 3RB3A 3CCZA 2H5EA 1CS4B 2NCKL 3DOMA 1W25A 5DG9A 2XZWA 2WOMA 1JK9B 1HNZJ 2LFVA 2J6UA 2W2NP 2FY8A 1R8CA 4F3MA 5I42A 1TQLA 3W65A 3OUYB 2PMZD 1TK8A 3FSIA 5CYQA 4ILLA 4QU7A 4KGXB 4Y6IA 1FRMA 4PWUA 4B3RJ 5KFQA 4LQ9A 2ZH2A 1HYSA 4K4ZA 4NXNF 4PUOA 1LK5A 1DHMA 1X0FA 1WKJA 2V4JB 2JEIA 4C7QA 1HA1A 2IRUA 4OI6A 3TJAA 1J27A 1GXTA 2HRUA 2EG2A 4IDKA 1HBMA 2QSWA 2Y0BB 5KFBA 1UP1A 4J9QA 4DV1F 4NLWA 3MCOA 1YBTA 3ZNUA 4IG0A 3NS6A 3DLHA 4X4TA 1U24A 4Y34A 3CB4A 5ITHA 5KFMA 2FVSA 5HJXA 5KT5A 1VBYA 2RILA 1ZPWX 2YKNB 5A6WA 4DUTA 3GLJA 4DCPB 1RZMA 3GCWP 4QW8A 4ECUA 4JV1A 4X4UA 4KHPF 5E33A 2V94A 2Z2MA 1M5KC 2KDOA 3D1HA 1HI1A 1GXLA 3TJ9A 1SIWB 4IFYA 4BWJA 2HBRB 4ZJQA 3K5PA 4OI2A 4P2XA 4UZCA 2H9ZA 1SJRA 3PO4A 3GE9A 1LNQA 4IO1A 3P3DA 1V3SA 1U6ZA 5LJ3Y 3KJQB 4TQSA 2ZNYA 1NSAA 4G1QB 1J2VA 3W1YC 2JFDA 3KLIB 1FI4A 2POKA 1NM2A 4G1IA 4CH0S 1HI0P 2KT5A 4JI1F 1TKXB 1TKZA 2DR7A 4WYWA 2YH0A 3EGWB 1JLQA 4MFBB 4AL7A 1YX2A 5KT2A 1NHUA 2YKMB 1F9FA 4LF8F 5HBMB 4I7FA 4KJIA 4PRFA 2RRBA 2NQPA 2AZ1A 3OXFA 3V4IA 3KJFB 4AYBD 3X1LB 2XMJA 3GP9A 4ZCIA 1ZOTA 2AZ3A 1XQIA 3C15A 4USHA 4DPOA 2MJUA 5JVHQ 3DLLQ 1FRHA 1JNRB 3MMAB 4OV6A 2NYHA 3GIMA 4NZ7A 5D0GA 1N88A 2E7VA 1SQEA 3TEHB 2HMIB 4CTAA 4IR1A 3GFYA 1FWPA 4B9LA 4B3SF 2DO4A 1QSSA 1WC6A 5B0EA 5IV3A 3NY0A 4K5SA 3DI6A 3WX8A 4ZVTB 3SFUA 3J80Y 2M5YA 2XY7A 4X2BA 2ZITA 1RHMB 3CPWR 3M8PA 2I5JB 4K4XA 4DZDA 3DDKA 2CDQA 3BKUA 2HMIA 2QMUB 2OLWA 4F36A 2BXJA 2QG9B 4P6QA 4LFAJ 3HVRA 1HR0J 1ZETA 1QTNB 2J9CA 4ICLB 4PZVA 1HMVB 3ZTQA 3G8TA 4DZ6A 4JI8J 3MPYA 2QEXS 2V4JA 3R2CJ 4ED5A 3DRPA 2VPXB 1XWLA 2HLTA 2VKRA 5E41A 3IFEA 4P7VA 4RW4A 2FJWA 3TJ8A 1FRLA 4YR3A 2AJ1A 3MMBA 1VYAA 4YDDB 2W9BA 3ENWA 3CF5Q 4DV6J 1RTDA 1VS3A 2CQIA 3WBZA 2G4BA 2M52A 3K89A 1F2HA 1EAYC 4J9KA 3MPWA 4ZPWR 2DNLA 4QQBA 4EMDA 2FGOA 3R7NB 2Y1JA 1YTYA 1U1KA 2Q66A 4LIWA 4TU8A 3OW2R 3CMES 1YJTA 1S76D 1WC3A 2ABYA 2C3YA 2PE8A 4A8WA 2BE2A 3Q8SB 2BJ8A 2JC0A 1KD1T 3Q8UA 2KZZA 2XI3A 3H25A 3IBWA 4DN0A 3UD4P 1NB7A 4IO9Q 4NEZA 1LWFB 3OT9A 3CJ3A 3WC2A 4ILMA 3BSAA 2DNRA 4EBCA 4LF5F 1NB2A 2RDDA 3HT0A 4O3RA 1U8SA 2W7AA 3FBCA 4K2JA 4B3MF 2L9WA 1WF1A 2VBYA 3BS9A 3CT9A 3NXZA 1Y3JA 4Q2LA 5JMNA 4DR1F 4ED0A 3V2UC 2VBZA 3FEZA 1L5UA 2MEWA 4YY3J 2GIQA 4DR5J 2DGOA 2WAQD 5CCLA 2OKQA 4YHHJ 1M1GA 1WOSA 1BWEA 1JLAB 3KTQA 2MQOA 2BE2B 4C97A 1N34J 1NHKL 4N77A 5KFRA 2F3JA 3M1VA 3SV4A 4GKJJ 3QIPB 2KN4A 4DSKA 2FJAB 1NK9A 1VQKS 5I4MA 1DBDA 3GV7B 2JSXA 2Z0GA 3Q83A 1K0VA 2LU1A 2E5IA 3HZEA 3NBPB 2MSSA 3AODA 4CO4A 4L76A 4ECTA 4IFVA 3CC2S 3CIMA 4J9UE 5CZXA 3HO1A 4EYIB 1CG2A 4U7CA 2YWWA 1BQXA 4LFCF 4D3GA 4MK9A 4A8OA 3BH6B 1PBUA 3ZZOA 4DFPA 2ZH1A 3P8BB 3KFWX 3ZTSA 4WP9A 4WE1B 2CVIA 1HWIA 4WIIA 2NXJA 1RWVB 1Y4ZB 4ETXA 2XTJP 3TQ1A 4L74A 3EUNA 1RE1B 1FERA 1U02A 2A6MA 3NAHA 3ZZUA 4YR0A 2DYAA 3E51A 4S0MA 5IQQA 5EWFA 1IVZA 1O51A 1IJEB 3T6BA 1S0MA 1N34F 4OHYA 3TX8A 1IWAA 4USVA 1PYTA 3B6BA 4RW7B 1N48A 2CAJA 4KE5A 1NKBA 4UY85 1M5HA 1LWCA 3CD0A 4C3LA 1S0OA 2LDIA 2MZ1A 1J5OB 4WKRA 2J9DA 1IBLF 4I2QB 2G0JA 4L6V3 1CULB 1RAGB 3R1HA 5DZ7A 1LV5A 4J37A 2XSFA 3IS9B 1A0OB 1DJ0A 2AJ2A 2GIFA 3NGDA 3R8YA 3RB0A 4B3MJ 1XNQJ 3HCXA 2QT7A 1X4BA 2GO8A 4QR0A 4WFZA 4ES2A 2KXHA 1TUGB 2C22A 4DR4J 1ZS6A 2BA9A 2PA3A 4LSNA 2YX4A 2DHSA 3AXKA 4RBTA 5F3TA 1WEYA 2X1AA 1RYRA 4FKXA 5HBMA 4TLRA 1MN7A 1YLXA 2KRRA 3QIDA 2JNJA 1YJRA 3R6GB 4PG4A 1NJYA 1K0TA 5K14B 4ZPTR 3I5BA 3R5JB 1GTHA 3JTPA 1JQGA 4XDCA 4M5JA 1VJWA 4HR2A 4RNHA 3TUJC 1N52B 3TA2A 1H2VZ 4A8KA 1JXLA 5BYSA 2RUSA 3VALA 1F2GA 2AF6A 3HZGA 3NGKA 3MI7X 3TA1A 4X62F 2P9EA 2YKPA 2F40A 3A4TA 2RJZA 3QMQA 3DDIA 3NG8A 4K59A 1LW0B 4PQUB 5AE1A 1YZ7A 3C14A 2ZHOA 4OYXA 1WF0A 2CQCA 3IR6B 3PRVA 4M63A 2I2YA 4XTTA 2Y1IA 2GAHC 2HFVA 1R0BG 2L48A 2ROPA 2UV8G 5F0UA 3KG0A 1PC4A 1WKLA 2MQLA 2QC3A 3A8JA 1RKIA 3PX6A 2V9WA 1Z1ZA 3I31A 1OS5A 1RGVA 2E9TA 4OMFG 2PT0A 1VC0A 4DQSA 1IBMF 5MAOA 3D6FB 2L9DA 1B70B 5AE2A 3KK3A 4FF1A 3KMSA 3RJMB 5DDRC 4ZVSB 2HHHJ 4HI2A 1KNZA 1RT6B 5IFMA 1JLEB 1RAHB 3GR0A 2IM0A 4ZHRA 4WFNQ 3MFIA 4OI3A 1HLWA 4JI1J 3OVBA 2KFZA 2PFFB 1BGXT 1DTQA 1RTHA 4O3PA 3T9NA 2W4DA 2KB2A 4FXVA 1ZA1B 1Y5NB 2J8SA 3NWGA 3AJ1A 3ZZPA 4X4QA 3PFEA 4YR2A 2YQ1A 2ALZA 4RUHA 3K8WA 1R0CB 1RWNB 3BM7A 4ZJOA 3DI6B 4USJC 1N36F 3I5AA 1V9OA 4DUYJ 2RQKA 5E5NA 4Z7YA 1JNZB 1XR5A 2DJWA 4O0IA 1DTQB 1RTHB 3QLHA 4RLEA 3UCGA 5KFKA 5L1IA 1U1PA 1M5PC 4WCEQ 4K4TA 2UUCJ 4DUYF 3IP0A 4ID8A 5DG7A 3TUIC 1RT5A 4PWDB 3CE8A 3D0HE 3GYXB 1CS4A 2IM2A 3DOMB 3ENVA 8AT1B 3OVSA 3G6VA 1BWVA 3CD7A 5HN0A 3IR5B 2HYIB 1BQMA 3W7BA 4HDGA 2ZE2A 3IR7B 2HAIA 4YEAA 3LP1B 2VC1A 3SV3A 3OFEA 2DD8S 2E1AA 4QIWD 4KAIA 1KQGB 2G0CA 3R9LA 2ZBCA 4KHMA 4MAKA 2N4CA 2HVZA 3M8QB 3PHEA 3AB4B 3IRXA 2ACMA 4QOTA 4ZPDA 3S01A 3UDVA 1AYEA 3WHIA 2ADBA 1JJ4A 1OQ3A 1D0EA 1V3RA 2F4VJ 1TV6B 2CPHA 3C6TB 1WACA 3PZPA 2Q6CA 5KFVA 2HHUA 2GHWA 4WZMA 4OZJA 2OFHX 2VU5A 5IV4A 5AXKA 3W5ZA 4CI0B 2UP1A 2I9SA 2LXFA 4O4GB 2VA2A 4X4RA 3EPIA 4KPYA 2KHDA 2W8LA 4P10A 2W8KA 1FHTA 4NASA 2UVUA 1MN9A 2QRRA 4L73A 3RU0A 4J9OA 5HAOA 2KJWA 2FDNA 1XMOF 1LOUA 3L95X 3KLGB 3D6TB 4PWWA 1RWOB 5ETMA 4HL9A 2QL5B 1GAOA 3N28A 1CC7A 2ZH5A 3TWZA 3PIOQ 3TANA 1RT5B 3VGTA 4ALZA 3IN5A 4ED4A 3LP0B 2OTLS 2IYGA 4B02A 1PILA 2IHR1 2OEMA 3DHWC 3BBFA 3N6LA 4O23A 1TK0A 3ET6B 1GMVA 1H74A 1WC4A 3POTB 2RE1A 1W2IA 1G6BA 1IKXA 3Q8QB 3RW6A 2GQQA 4HHHA 1IR1A 3OTCA 4IFVB 5KFWA 3T1HF 3M8ZA 4P74A 3MM5A 4RW8A 4ZHRB 2X7IA 5I42B 4LFBJ 3GWCA 2B4PA 1ZM2A 1RWUA 2W9CA 3H98A 1R0AA 1WEXA 1WG1A 5C24B 2OSQA 1JWWA 1KLMB 3MM6A 1JXVA 2WTFA 2MQNA 1Q5VA 2RD5C 2V50A 5CCMA 1X0PA 5IQ6A 1VQLS 3MM9A 2OIHA 1S0VA 1IQTA 1LWEA 1S9EA 4Q44A 2NR0A 3Q2TC 4A8XA 1XN9A 2WK4A 5A8RA 4ZN1A 1BLUA 3BKTA 3B8HA 3BYPA 2W25A 1NJXA 4ZS6A 4CO1A 3ADAC 2HHSA 2MQQA 1DURA 2OMLA 4CTAB 1SCJB 4CNZA 4M5KA 1QTMA 2XQCA 3K7RA 4RBVA 3QIPA 3CJTA 1UEVA 1PKUA 2CJ9A 2FD2A 5T7LB 2J0SD 4OQJA 3H5XA 4DV7J 4LSNB 1FKPA 1R43A 2EFQA 2YNHB 1WWHA 3NGSA 2IM3A 3WDOA 2MZQA 2DCUB 1QAJA 4C9DA 1ITPA 1CSJA 1LWXA 3B78A 3MECA 2CQDA 1Q0NA 2CWKA 1G4CA 2F9DA 4ZLNA 5HQ8A 2YNFB 1WOOA 4NEYA 3FC9A 4RX6A 5HP1B 5KT4A 1IQZA 2BANB 4WU2A 4F25A 4JI8F 2ASJA 1RTDB 3RBDA 4WPAA 3GIRA 3RR7A 4BWMA 2BJ3A 1TL1A 3LAMA 2YBVA 4N7TA 4X4SA 4RW4B 1XNRJ 5AXMA 3SQGB 5I3UB 3QGHA 3FKBA 4X4PA 4KIAA 5I3QA 4GO7X 2IA0A 4I2QA 4LF9F 3PO5A 3QT6A 4C0HA 2BJEA 1FXDA 3RRHA 3CW2C 3KWMA 3W5XA 4FVCA 1Y9OA 4PEOA 4ZKAA 2R9LA 2OPRB 2RMLA 1YBAA 3OQ2A 3FSYA 2BJ9A 1VQ4S 3MEGB 2GIRA 2XLKA 4L75A 3H42A 3WQPA 3U02A 4CLTA 2F9JA 2MKYA 4HDHA 1UVNA 4OHVA 3A12A 3EZUA 3FRYA 3RG6A 3QZ7A 3W63A 2XMWA 2AX1A 4ZLJA 4Y2KA 5CYMB 3Q8RB 3CC7S 3OUYA 3JTNA 1VRTA 3GPAA 3LWMA 3C46A 2DNKA 3W8PA 4GMKA 4NOHA 3BDEA 3KXDA 3BDPA 1FDAA 1R3NA 1RK8A 1FTCA 2EEYA 2QLWA 1F5CA 3RBZA 4TU9A 2HQ3A 2OJ3A 3M6WA 3C2PA 1GXUA 1Q4RA 2AJ0A 3IM8A 4LRCA 2AEFA 1T9VA 2Q79A 4CM0A 1Q86T 4FBUA 3OTBA 2HHQA 3DLGA 3NBPA 3OTEA 1S1WB 3I9V9 4ZLLA 2FVPA 2GS8A 5EHHA 4B3TF 5EUHA 2R8GA 3HF5A 4JV5J 3SFGA 2HIQA 4PQAA 3W61A 2RDIA 4NRTA 4KT0C 2V0NA 3HX9A 5MLCV 3C14B 5D4LA 1FJCA 5D4OA 3OLAA 5F8JA 4X4NA 1AROP 2H5IB 1WHYA 1DZ5A 1D9FA 6FD1A 2PI4A 3QJPA 3M6VA 4B3OB 3DN9A 3EMTA 1SB6A 3HSZA 2D3OR 2IDLA 3LF0A 3UFCX 1H3DA 3AT1B 3QQCD 2DNOA 1RU2A 3MR3A 3W3SA 4I1TA 2HBYB 3ILOA 1DY3A 2VD3A 3IAM9 2C2RA 2E66A 3N5FA 2DITA 2CA9A 4DU7A 2E5LJ 1FDBA 1RAFB 2W2MP 4DQIA 3NL0A 1FO1A 3D28A 2QFIA 1HNVA 4CLUA 3T5HA 2E7WA 1L3TA 3T1HJ 5DM7Q 1ZA2B 1MLAA 4P71A 3PJ9A 1R6VA 3ZZRA 2ZBRA 2ZFHA 3K0JA 3TUPA 4MTPA 1NNDA 1ZAXA 4DR1J 3M2VB 3MTJA 3EZOA 1DARA 2V8DA 3AOBA 2FJDB 2HS3A 1RKJA 4CH7A 3E8OA 3QRQA 1NHVA 1OWXA 3KHHA 2NPIA 1UA0A 4ILRA 5ETPA 2R2SA 3UNGC 1VR6A 2X1GA 4MKYA 2U1AA 1RWMB 1JIHA 1TL7A 1WEZA 2DHXA 2EFOA 2XM3A 4UY8T 1VRQC 3SQOP 1O0PA 1RHKB 4DPXA 2MMYA 1YJ7A 4A8YA 4FF3A 1GH8A 2VG7B 2AYGA 8ATCB 3M8PB 2MQPA 4Z37A 5HVGA 2CNKB 1UZHA 1TAQA 4PR6A 3U27A 3U1NA 2JLEA 2CKWA 5E2QA 4DV2J 2VFTA 2FJXA 1HBMB 3T1AA 7FD1A 3QGPA 4X65J 4ED1A 5D0RA 4UQGA 2FJBB 2Z2ZA 1SUQA 4MYTA 2B7BB 4QIVA 3OFHA 2K06A 4XK8C 4RO0A 5KG1A 1U47A 2B9WA 2Y8WA 1T3OA 2XNRA 2QMWA 1FRIA 1J5EF 5B0FA 2AW0A 2CJAA 5C42A 4DL3A 5L1JA 3KHGA 2GFFA 4LMZA 1BE4A 2LEPA 2GVDA 1UETA 3NCRA 3WX4A 2M8DB 2WHOA 3TZWA 4HACA 4Q0BA 2GJFA 5A0YA 1SQFA 4YB5A 1KFSA 3WZ0A 3DYAA 2YKMA 1HPZB 1I5OB 4KHRA 3E3XA 1SJ3P 3C3LA 1JLQB 4WTOB 1XBWA 3TI0A 5CHCB 2VG6B 2QLXA 5K8OA 3VAMA 2HK2A 4FYXB 1U6BA 2UUWA 1HQUB 2ZC4A 4NPOA 1ZPVA 3W62A 3K5LA 5T7LA 4FS1A 1AZSA 1BC6A 2CPDA 2AGPA 1P6TA 1WJ9A 2RUGA 2J8AA 3PACA 4IOBA 2XY5A 3QAUA 3N5BA 1TR0A 1EARA 4KY3A 4Y28C 4KSEB 4MK8A 5H9EK 3KOAA 2NLWA 4LUBA 1UFWA 4PAAA 4QR2A 1K9MT 3H4BA 1VBKA 2D69A 2LYVA 3U1MA 5D6GA 3OL7A 5DZ6A 1YK9A 1P8GA 3C6UA 2DHGA 3D6HB 1S4EA 2CPXA 3E01A 4GRSA 4HI1A 4C8NA 4YMEA 5LT5A 2E5JA 4F67A 2XGQA 1KVKA 3MM9B 1EETB 3NMRA 1MWZA 4J90A 4KFBA 3DLEA 4RUBA 5GAHI 1PAEX 1CJVA 2J0QD 6AT1B 2O01C 2QSFA 1WOPA 2ZH3A 1UWBB 1WSRA 3T5JA 2MKHA 3EZ5A 4M5IA 5GMKa 1N0UA 2Y1LB 1U4BA 2P9CA 4JI0J 4OZNA 4JI6J 2OD6A 3PEHA 3RAXA 2WONB 1UW9A 2LECA 3NGUA 5GADI 2VFRA 1HYSB 2WVEA 3DMJA 2OMOA 5K9FA 3QGIA 5DM6Q 4QWBA 3J81U 4H4MB 2L9NA 5IC4B 1TFWA 4GVLA 1N5YB 2E5GA 4NYZA 1FNMA 3CVKA 4F3QA 1TAUA 4IDKB 2W24A 1MWQA 4LRBA 4TY8A 4ES3A 4R8UA 1MMLA 2DNPA 3M30A 1HFEL 1S1TA 2V8GA 4ZJLA 2MYFA 1BXNA 1TUVA 4AT1B 1MMNA 4M5MA 4NA3A 4TKTA 2L3MA 1WKKA 4LBHA 3TRGA 3ZTPA 5AJ3F 3K5NA 3NMAA 5KFUA 3KLFB 2MB0B 2FHJD 4IH5A 3V5RA 5KG0A 1M5OC
chains in the Genus database with same CATH topology
3V4IB 1JLCB 4DSLA 3SSRA 5K8NA 1VQ7S 1X5TA 4RW6B 2ZM6F 5EN1A 3SSQA 1ZTTA 4MFBA 1S9GB 4TY9A 5K8MA 3V81B 2GQ2A 1IKYB 3FJ2A 2PI5A 2LXUA 4IG3A 4MK7A 4ECYA 5HROB 1SL1A 1WNEA 4K2XA 2JRSA 5EWGA 2Q1LA 3THVA 2Y0SD 1Q7YT 5KTQA 2XMKA 1KQFB 2M70A 1D9DA 3FQLA 5C42B 2JC1A 4YUDA 2HNDB 2GA7A 5L9XA 2ZH7A 1HW9A 3OPKA 3R3TA 3K59A 4FF2A 2AP6A 2VOOA 4RU9A 1MROB 4EFAC 3LWLA 4XPCA 1W2BR 3VTIA 4YQWA 1ROFA 1GQEA 3NS5A 3NNCA 3JSBA 3CJKA 4DL0C 3NNHA 3CDWA 4L72B 4NCGB 1U7LA 4IRCA 1URRA 3EPGA 4JOUA 2IC3A 3BZQA 3CCRS 1T7PA 4NLTA 2B43A 3MEDB 4KQZA 3PW5A 1R6YA 2HWTA 3C8YA 2JEGA 3GV5B 4X4VA 3I32A 2CG4A 5KFHA 5J1PA 3S1TA 2YTCA 1FXLA 2KM8C 2ZH9A 1QY7A 2BYCA 1C1BB 2DB1A 5J1EA 1N54B 1KRPA 5J2PA 4EYHB 4ED3A 5M2UA 3HJFA 1DRZA 4WXWA 1U1RA 1WD6A 4DF4A 1HBNB 4ELTA 5EDWA 4QWCA 1MROA 3Q24A 4NZ6A 1UAWA 2IAJA 5IZHA 2WB4A 4ZOSA 5L1KA 2C2EA 2KI2A 1FD2A 1S6PB 1D8ZA 3LW5C 4DV7F 2AJ4A 4B9SA 2V8HA 2ZOMA 4O3SA 1U1LA 5A6PA 4YY3F 4ED8A 1U48A 1J5OA 1HWUA 3VCDA 4CZCA 5IT0A 1VQ6S 3HHLA 2ERRA 1TVRB 2LKZA 4PG8A 2GGPB 2ZD1B 3DU5A 2R4FA 4C0OC 3QWPA 1JKHB 4FNIA 1U45A 4CT8A 4EZ9A 3HP6A 3I4PA 5BR8F 3QJLA 2V2KA 5J2NB 3M2UA 2RKIA 2J5AA 1TVRA 3G6ES 1CC8A 4LSLA 2YNGA 1YQHA 2FHKA 2EWHA 4UW2A 5DQHA 4NWBA 1QVGR 2DNGA 1A9NB 1RYSA 2QZ8A 1VQSA 2GNKA 1UVLA 2GJIA 5IM0B 3HK2A 2JEJA 3HHDA 3CCES 4F4YA 2I8EA 2XCAA 4B17A 3MMBB 1VRTB 3DCAA 5T14A 1E6VA 4QPTA 1JLFB 1FD8A 4N47A 5JUMA 2LVWA 2ZDPA 4ECWA 2VBXA 3CCWA 3BO4A 1QM9A 2GMJA 3BSCA 2N7YA 4H4MA 1FVQA 1HBOA 3DOLB 4M63A 3ZZOA 2YWKA 2OH2A 2GHPA 3IG1A 3H5UA 3JSMB 4F3OA 1D1UA 5KOWA 1T03A 5C25A 2KTQA 4NLPA 2IJFA 2MKSA 4J9LA 2J7UA 1UWBA 4DMZA 2MZTA 2DH8A 2DIUA 3J81Y 2R7WA 3KLEA 2VZ9A 1LXNA 4OX8A 1HW8A 5BYRA 4L3NA 4I68A 1FESA 1TKDA 2ILYA 1S72S 3L3CA 1CEZA 1X4DA 2UUBF 3G96A 1SKRA 1D8YA 1SJFA 4DF8A 1WF2A 2ZH8A 3UI3A 3G71S 2CQPA 3CMAS 4PPDA 4ECZA 2F4VF 1ZM9A 4DFMA 4KBIA 3MECB 3PRBA 4LFAF 3KMQA 1HHTP 2XS5A 2XC9A 1OPZA 3ISNC 3VAGA 3PW4A 5CXTA 2R2TA 1CPZA 2YVSA 3CJ4A 3TNVA 2RS2A 1VGYA 4PXCA 2B7CB 2BOPA 2OPSB 3ETOA 2ASLA 4WJBA 1RT1A 3UR0A 2Z2LA 3I87A 4J9MA 1T05A 1JJHA 4JBCA 3OR2B 3BO2A 2B0GA 3BF4A 3W2VB 4OZ0A 4YHHF 2K7KA 3SEOA 2OD4A 2UUCF 1Q81T 2B5JA 2XG8A 1LWEB 3FCHA 2B9XA 4I2PA 3KG1A 3FSXA 1YITS 1FRKA 4PXBA 2A2CA 4Q8FA 2R7TA 1KLMA 5EX3A 3PJXA 4JV5F 2HPUA 4NX9A 5THWA 1YJVA 1ZM3A 2E44A 4RKUC 1G1XA 3DMJB 3SSSA 2AYBA 2XNQA 4NLRA 3OR1B 3KLHB 5J2QB 3MR2A 2R7SA 1KHVA 1REVA 1LFPA 2VFVA 2RNEA 3CJ5A 3GV8B 4DR2F 2LQ5A 2NUUG 2CQBA 5B08A 1S1TB 3R5AA 3IO1A 2ZHBA 4DUZF 3U1LA 3OJUA 4PUOB 2B51A 4R0EA 2U2FA 2UVVA 4QWEA 3DRSA 1S1XA 3JB9k 5J1EB 5HMWA 3QGGA 3MR5A 4DV6F 3CD5A 1VMBA 1YJUA 2C3OA 2K2PA 1JLFA 4J9PA 1KQKA 1Y5LB 2N7CA 2KXFA 5HMZA 4NXMF 2DPJA 4OLPA 3D1OA 4LF6F 3UCUP 2BM0A 4EZ6A 1NK0A 1S49A 5J2QA 3JSMA 4RWXA 3BSOA 4AQYF 2Q43A 3CWJA 3LQVA 3BO3A 3CULA 1OPIA 3UE2A 2E5HA 3H2UB 1FJEB 2DRBA 2OTJS 1QLNA 1OO0B 4ED6A 2MDAA 1S6QA 3M32B 1XTZA 3M9NB 5KAKA 1SJ1A 2WBRA 5G4DA 1LK7A 2XMMA 2GGPA 5JVGQ 4LF7F 2HFNA 1ZTWA 1DTTB 2VQEF 1QAYA 2ROGA 1FJGF 2AGOA 4DL7A 2CZ4A 4I7FB 1S6PA 2N3OA 5A8KB 1M90T 1VI7A 4U7UK 2MKIA 4JI7F 4Y2IA 2HHXA 2W7PA 3CO9A 1QUPA 1SBRA 1TKZB 1TKXA 2KO1A 3HM9A 4DV5F 2ATLA 1L3SA 5GAGI 2HNYB 1GNKA 2QA2A 3FRZA 2VOPA 3UQSA 3CSKA 1CQMA 3H5YA 1JLBA 4R8UB 1NEEA 2K3IA 2MZRA 4C3KA 1HNXF 2XO7A 1H2UX 3QLHB 1WTFA 1R8PA 2DGTA 1VLYA 4A4JA 1C1BA 3KLFA 2LDYA 3G6XA 4F4KA 1S1VA 2AWZA 1L3VA 1M5SA 2ZOFA 4XIUA 3N9UC 1V3ZA 3MTKA 2ZNZA 2LU2A 2IJNA 5HL7Q 2ASDA 1D3WA 1DQ8A 1LFWA 1HBNA 3FEXB 4DV0F 4E98A 5C24A 2BRKA 5LL6d 4NA2A 4Y3CA 4KTQA 3EYZA 1JLGB 5HLFB 3N6MA 3ZC4A 3DLEB 1P9QC 1B0VA 2OPPA 1UW4A 4JV0A 1B7FA 4NLGA 5KFYA 1FE4A 3K5MA 4DQPA 3ZZYA 3PVXA 3MMCA 4OL8A 4RNNA 3J7YI 3AJ2A 4ES1A 4ZP8A 2P9GA 3JYTB 1R8BA 5K8PA 1P1TA 5IM0A 2VC0A 2DNZA 1BQNB 5E3AA 2FHJA 3GSDA 2EC0A 4IKAA 4EBEA 1F60B 1YJNS 4AE5A 3AH6A 1FTRA 4KKOA 2LQBA 3CDAA 2HNYA 1VIOA 2EVZA 2K1RB 2MZSA 1MU2B 1DFDA 1H7XA 3HHLC 3F56A 3BQ2A 2NUHA 2DBBA 1HNWF 2HHTA 2DGQA 3DLGB 3LAKA 3H4DA 1NKEA 1M1KT 1U2FA 1Y5IB 4A8MP 1BQNA 4KB7A 4WXOA 3LANA 3M2UB 4MH8A 2OPSA 1P27B 4OX6A 2DIVA 1NJIT 1ZBTA 2KHCA 5DQGA 3F44A 2WSCC 3I96A 3MMCB 4OJGA 1CVJA 1XR6A 1I94F 3V6DB 3CCMS 4TY8B 1S10A 1HHSA 2D3UA 3PIPQ 1SXLA 1X4FA 3DFEA 5CYMA 4NLVA 3N6NA 3RZAA 3ISND 4KRWA 4NYOA 3H59A 1VC5A 1HD0A 2D41A 2MXYA 1FKOA 1SJ4P 1JJ2R 1HR0F 2DR8A 5KFLA 5KFCA 1XC9A 2GW8A 4J9SA 1HWKA 2V4RA 1IN0A 3CD6S 3HI9A 2OPRA 4OZLA 2V5HG 3HT3A 2R8HA 2BVZA 4CT9A 2A18A 3HKWA 4ERDA 2FHOB 3P6YC 1VQPS 4LVOP 2XB2D 2VG7A 2KXNB 1OQ6A 5KG4A 4Q5VA 1RT7A 3VR1A 1IBMF 4EO6A 3N79A 4YB6A 1KOOA 4DJBA 4NLSA 1TFYA 5DDQC 3N4WA 3D5MA 3CJKB 4PXEA 5A2QY 4Y65A 1UA1A 4IOAQ 3MWBA 2B3TB 2GV1A 1ZZNA 2W9AA 3DRYA 1FKOB 4DS5A 1U1MA 4NLDA 1WHVA 4B9TA 1Q8BA 4DHVA 2MQMA 4DX8H 2NPFA 4JI6F 1DLOB 4I69A 2JFKA 2M0GB 3I6PA 2FJEB 1FKPB 3MMJA 3HHLD 3GG0A 4XAKA 3TUZC 3DC2A 2I0XA 1XNQF 1MMDA 2HFZA 5AXLA 1HPZA 3DGPA 1BD6A 2UXBF 2ZH6A 3SXLA 4WFYA 1S77D 1S6QB 2AYMA 2DTJA 2F8HA 3DU6A 4Q7AA 1SKSA 2EK6A 4H4OB 3US5A 1X8DA 4ELVA 1VQMS 2JHEA 4WKYA 3LP1A 1U1OA 1NKCA 3ICLA 1TP7A 3KK2A 2DVIA 2LEAA 1X9MA 4I64A 3V81A 3E2EA 1FRXA 4KV8B 4FZVA 1AUDA 3QPIA 3MOJB 1Z2ZA 2IRXA 2RU9A 3M2RB 1JLCA 1RDRA 1R7IA 2G13A 3MM5B 3N01A 2XMVA 2ZHAA 5KT7A 2YY3A 3C66A 4DR7F 1M0SA 4I6WA 4IRDA 2FVQA 2CJBA 2HWHA 3I0RA 5B7WA 1GX6A 2HS4A 1VQ5S 1S1UB 2HHVA 3L09A 3EXYA 4WFBQ 4ED2A 1VQOS 4H4KC 4URSA 2DO0A 4PKDB 4F50A 1Q8LA 3HHKA 1NK7A 4DWIA 2GQCA 2VV5A 3F73A 2XSJB 1YGYA 1Q1KA 2J9EA 2IC3B 2DGSA 4EUVA 5F8NA 4ZPCA 4B08A 2R2UA 3KJVB 4CQ1A 5H9FJ 2B6AB 2PDAA 3A1YG 3PX4A 5LSRA 3O1LA 2XS7A 1X5PA 2XULA 1HWJA 5KFEA 3HHNB 1HBOB 3DOLA 2ZUGA 4HTJA 3LALA 5G0RB 2VQFF 3O5TB 1XR7A 3NLCA 2ACYA 2RQCA 3SDEB 5D4NA 4UOCA 1RT1B 2RDJA 1JLBB 4X66F 4NCGA 4K4VA 5KFPA 4G6VB 2HW3A 2JOQA 1QUVA 3Q2SC 2XHWA 1VIXA 1JXEA 2WW8A 3FQKA 1B0PA 2MHNA 3VWSA 3RB6A 2AV5A 5BYQA 3KNGA 4ETZA 1SI9A 1KR4A 4AXIA 3PRDA 2FLNA 2EPIA 2HGMA 2MGZA 2HNZA 4NA1A 3SDEA 3RR8A 3RYLA 3AA8A 1FKAF 1JKHA 1S6UA 5T41A 3K8VA 2RVJA 2VG5B 4KO0A 3MDFA 3ZZZA 1LWCB 2Q3PA 1NH8A 2DISA 5E3RA 1J5OB 1YSJA 2YKOA 1G3OA 3BGRA 3NCQA 4N8OA 4NLXA 5DETA 2W9CB 2IVMA 3BN7A 5H9EJ 3MURP 2B6AA 1FNXH 2ZKTA 2KJVA 3SI8A 5J2MA 2M9KA 4LT6A 2RSQA 2X51A 4DSIA 1T94A 4ZPAA 1HQEB 2X1BA 4KGMA 2FHMA 2BQ3A 1WG5A 4EBDA 4A8SA 3LP0A 3HDSA 3CCQS 4WE1A 4C0BA 4ID5B 1S1UA 2BDPA 2CQGA 3LPYA 5AXNA 2ZJRQ 2VA3A 4A47A 1YJ9S 2FY1A 4Y2MA 5DRKA 2O66A 4DR4F 3G86A 2HGNA 3MHYA 1Q78A 3ZFVA 3LGNA 3M05A 4PG7A 1L3UA 1JB0C 3TP2A 3NRBA 1WHWA 1Q7LB 2D7SA 4JI2F 1KEKA 4AFFA 2XMTA 2AJQA 1LQ9A 2C3PA 1R89A 1Y3KA 3IWXA 4ZPBA 5F8MA 1FEHA 1JX4A 2FVRA 1X5OA 1N32F 5KG5A 4DN9A 5HMXA 1TV6A 2YNIA 5U47A 3VAFA 2DNHA 3PV8A 3DYAB 1ZYQA 3VAIA 2A3JA 5K5MA 2LLZA 4DG1B 3M8QA 1YIJS 1LKZA 3D0GE 3T19A 4QIFA 1LW0A 2AD9A 4GKKF 2EFGA 3HVTB 4OJ3A 4E0DA 1E6YA 2E29A 1IBKF 5FD1A 1S4FA 2L08A 1DLOA 2YX1A 3DRXA 4BC7A 4WFAQ 1SUQB 1NK8A 4K4UA 3TAPA 4MMOA 2RRNA 3H8YA 1HD1A 3N0VA 4AXJA 4RW7A 1Q53A 7FDRA 2QMXA 2QA4G 1F0XA 1KTQA 1IUJA 4HT5A 2YH1A 3S6EA 1ULRA 2VUGA 1KSPA 1BQMB 3G9CA 1PO6A 4G1QA 2FPHX 2FGCA 2FJVA 3EXCX 4O44B 4YB7A 4N41A 1PGZA 4PWDA 3NP5A 3PJWA 1HMVA 1FNOA 1OSCA 5B0CA 1RT6A 4E8UA 1YWXA 4O44A 2RS8A 1JMTA