5T8IA

Pi3kdelta in complex with the inhibitor gs-9901
Total Genus 240
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
240
sequence length
916
structure length
808
Chain Sequence
VKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNLWSLEQPFSIELIEGRKVNAMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVCPIAWANLMLFDYKDQLKTGERCLYMWPSVLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELLREILEYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic sub
publication title The Discovery of GS-9901: A Potent, Selective and Metabolically Stable Inhibitor of PI3Kd
rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 240
structure length 808
sequence length 916
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2016-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 5t8iA05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5t8iA01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 5t8iA03
3.10.20.760 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5t8iA02
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 5t8iA04
3LS8A 4DK5A 2K4AA 4XZ4A 1E8XA 4Y1SA 3LJ3A 3CSFA 1UOWA 4F92B 1GMIA 4EZLA 2EP6A 2K3HA 2YOAA 4AJWA 4PH4B 2NQ3A 4IQHA 2WXFA 1DJWA 2X6JA 4NP9A 3IHYA 4WWNA 4PS3A 3ML9A 3HIZA 1YRKA 1RSYA 2X6KA 2CM5A 5CCHE 3W57A 4L1BA 4TV3A 5ENNA 2Q3XA 1BCIA 3TL5A 4PS7A 1DQVA 3L08A 2X6IA 2WXMA 2FJUB 3QR1A 2WXLA 2ISDA 4ANXA 4DNLA 3L54A 5JHBA 1DJIA 4QJ5B 1W16A 4LDCA 4QAMB 3KWTA 5EDSA 4UWKA 2ENJA 4LCVA 1UGKA 2WXHA 1RLWA 4OVVA 4HLEA 2Q0ZX 2WXJA 3HN8A 4NPJA 4TS6A 4FULA 3SD5A 1A25A 4L2YA 3PS6A 3PYCA 4A55A 1CJAA 2LHAA 4WEEA 5H4YA 1RH8A 4QJ4B 4KITB 3F00A 2CHWA 3R7QA 1BYNA 3QR0A 3OHMB 3W56A 2QZQA 5KJ7E 2X38A 3PREA 4KZCA 4OYSA 2K45A 2WXNA 3DPDA 4ANWA 3IM1A 3F01A 4GB9A 1V27A 2WXQA 4ANVA 4EZKA 2Z0UA 4LT7A 4BFRA 3MJWA 3IBEA 4TUUA 5CCGE 2ENPA 4WAFA 5ANLA 1WFMA 2I9CA 2RD0A 2CJSA 3RDJA 3QAQA 3KWUA 4JPSA 5H4ZA 3ZIMA 1DJZA 5G55A 3L4CA 3HHMA 1DJGA 3TWYA 2JQZA 3L17A 3R7RA 3ML8A 4UWLA 3ZVVA 3QARA 3NSJA 1QASA 4QJ3B 1WFJA 2K8MA 5CCJA 3F04A 3TJPA 4AOFA 4G11A 1DJXA 4GNKB 4ICWA 4NS0A 3L16A 4WWPA 1E7UA 3F05A 1DSYA 3NZUA 4ANUA 2A4ZA 1DJYA 3APCA 4FLHA 1QATA 3DBSA 4FHJA 4UWGA 1K5WA 3QJZA 3L13A 3FDWA 2CJTA 4URKA 1TJMA 2A5UA 2X6FA 4FJZA 1E90A 1DJHA 1BDYA 2WXIA 3APDA 2BWQA 2CHDA 2NSQA 2R83A 4PS8A 4HVBA 2CM6A 3FBKA 2DMHA 4Y1TA 3N5AA 4FA6A 3APFA 3S2AA 2KI6A 4F1SA 2QZ5A 2Y3AA 4IHBA 4FJYA 3PFQA 1E8YA 1UOVA 3L9BA 4UWFA 4L23A 5G2NA 2DMGA 2WXPA 2NCEA 5T8IA 1CJYA 1W15A 4NPKA 4BGDA 1E8ZA 3P2BA 2YRBA 1HE8A 2V4LA 5JHAA 4F91B 1E8WA 4V11A 3ZW3A 3B7YA 4MJJA 2WXRA 3PRZA 4XX5A 3ENEA 2B3RA 3RPBA 2D8KA 2X6HA 4KZ0A 2N1TE 4J6IA 2FK9A 2WXGA 3OAWA 4WWOA 2ENQA 4F93B 4L1LA 2UZPA 2CHZA 2CHXA 3T8MA 4FHKA 1E7VA 4UWHA 2ZKMX 4EZJA 2WXOA 3QK0A 3M7FB 4FADA 3JZYA 4XE0A 1TJXA 4ICXA 2WXKA 3NZSA 3CSTA 4OVUA 3GPEA
chains in the Genus database with same CATH superfamily
3IAPA 1E5CA 5SWZA 5DHVA 5F71A 3HNTH 3EA6A 1IAIM 3CDFA 3KPNA 3AS1A 4O9HH 1PMYA 4ZODA 3QJHA 4N90D 1RIUH 2Q3AA 4EN3A 2DQDH 4PV9B 3UIYA 4HS8L 1JPST 1OTUD 2WJ7A 5K9KB 5D6JB 3SGDI 1UM6H 4OZHF 2VN5A 3FKUS 3FQ4A 4UCFA 1YY9C 1PJWA 3OXSA 4UINH 4P6VF 3G7TA 1YUHA 3RD2A 2N0SB 4KFZC 2PTTA 2H8PA 4Y2DA 3MKQA 2LUMA 1SA5A 2C26A 4JY4B 3IDJA 4KMTL 1WAAA 4QTHB 4G7QB 3EFUA 1G7PB 1JZEA 1YN5A 1B3IA 3ZYQA 3FSVA 4N0UE 5LCWC 2H2PC 2WV3A 2ZVOA 2ETBA 1PJ9A 3WFDL 3C3OA 1KB3A 2K3UA 1EDUA 5CO1A 4LASL 2L7JA 3MRQB 2AYOB 3QR0A 2CAKA 3T3ME 5HDBF 2BZDA 1VERA 3MKKA 4AZ8B 5IJDC 2JWUA 3PGEA 3I6LE 1EVTC 2XA8L 2UZXA 3MYZA 2KZWA 4RQQA 4G80A 3C19A 2K22A 4HDOA 1NC2D 1BQ5A 3IDUA 4GG8A 4KC3B 3UC2A 3TP4A 2M63A 5J1SC 3O2VL 3BRDA 2X4PB 5TF0A 3SO5A 4M3KB 4N9GB 5L8KB 3UI2A 3LJNA 2CUIA 1WMHB 3QPQC 2AKRA 2BYEA 4M7CA 2DI8A 2WLJA 2XWCA 1RUML 4JDZA 3IT8D 3LY9A 3AS0A 5I1KL 1PYWA 4RVBA 2ODIA 4WI0A 4KX9A 3CK0H 3UT4A 1OGTB 2VDKL 1B0RA 4F9PC 4XXDB 4GNKB 5AW4B 4BHUA 3L16A 1CFQA 2J1KA 2NY6B 1SEQH 1NJ9A 3ROLA 1SUJA 1XCQL 1PLBA 4F2MB 2LTQB 4NKDA 2H26B 4LRNL 4XPTH 4WNQA 3TEZA 1SW6A 2X0WA 4K4KA 4DVBA 3ZT5A 3H42H 4DGVH 3K4ZA 3VRJA 3N41F 3VXUA 5HHXH 4F1SA 3DBHI 4C55A 5KJNA 5JLZA 1L7YA 3QNZA 3KXFD 5CAYB 1JHTA 2O5YL 3S3DB 1N19A 4BFNA 4HGMA 3SKJL 3NCYS 2PXYC 3QO1B 4LPCA 3WKML 5FJYA 5IUCA 3B9JA 4AUQC 1WI0A 2XXCB 2IDTA 3WKNA 1MAMH 2NBVB 4PJ8C 2YN5A 3O6LL 2BHYA 4DVRL 4O02A 3FNKA 2G3XA 2IJGX 2GRQB 4TNVK 3MOAH 1PNCA 4QOKA 4XC3L 1DQQB 1F90H 3QQNA 3N1MC 2PUQT 1E9QA 4OIIL 2E9IA 4RGOH 4YBLB 4NZLB 2E6PA 3NZSA 1EFXA 3JXIA 3A47A 2GG1A 4Y4FB 2WAHA 5GMVA 1EDHA 2JX5A 2KM4A 4RMVA 4YSAA 2F53B 3C6LC 1E42A 1IUZA 1X5XA 3LDBC 1W6LA 4AVXA 2WSKA 3CH1A 4F92B 3T0EA 3PE9A 3B2UD 3G5YA 1WITA 4JO4H 2N7JA 1PGXA 4A7TA 2CRZA 3QNKA 4PR5B 2BSTA 3BHBB 1QBLL 2Q6WB 2YMXH 4BZ2H 4BWUA 2CLVA 2ICCA 2WUCL 2ZYIA 4PJIA 4XPHH 1LO0L 3QIWB 4L1BA 1SIFA 3BH9B 2C9UA 3GSWB 4PJEB 5HHQA 4YK4C 3KMDA 3ONSA 1D5ZB 3ZLQC 1UUPA 3SCMD 4UAOB 4FCAA 4YR6B 1CFSA 2WY3B 1D9KD 1Q1JH 3JBG7 4OLWL 2E59A 4LRIC 2GTWA 4P4RB 3SDCA 1MNNA 2VN3A 4PLJC 1RJYB 4LVHC 3KL0A 2N9EB 3C6SB 1KBGL 3E0GA 4Q9QH 1U3CA 3V4VH 3QJVB 2FZ3B 2GRLA 4WV1B 4HIHB 4O2CB 3B34A 4N28A 1UACL 2NTSP 2NYYD 2Z7UA 3BGMB 2Z1KA 3OC8A 1JYVA 1OTSD 2BF0X 3LCYA 4JL2A 5FO2A 1BZ8A 5DZPA 3S5ZA 5SX5H 5I1JH 1WR1A 1XFPA 3L5IA 1O7DE 3QIUC 3V4PB 4F9LC 2OAAA 5KYXA 3A5VA 5G4OA 3VDCA 1JYWA 4LCWA 1D6EC 3LNDA 3MJWA 3UP6A 3ARFC 3QOUA 1XTLA 3REVA 4PWFA 4Q14A 4A7GA 1PVHA 2IH1B 3RJDA 3SPGA 4AX3A 5EF0A 5I1AA 1XCTL 1UCTA 4GU2A 4O2FB 3WAKA 1NCUA 5IBLC 1XGWA 3TO4A 4MA8H 4NUJB 3Q9UC 1L5GA 4J28A 1WZLA 4IGBA 1Z1WA 2F6AA 3TT1L 3FT4B 4PJHB 2E4TA 3QUMH 5KVMC 1G94A 3VXSD 5EULV 1OQXA 3CIRB 1NWOA 1XQQA 1FNLA 1KBPA 3QC1A 4N2DA 1WXQA 3CVIL 3BUYA 1NAKL 1P9MC 4WWKC 3WJLA 3SGDH 2G9KA 3VWKC 1OLLA 3D85A 2NXZC 4JFPB 1R3HB 2GCYA 1A8JH 5TQ2L 2LW3A 1VADA 3ETTA 3TEXA 4YHPB 5EB9A 5DS8B 4CT0A 5C9JB 3TBVA 1AP2A 5B22A 2BYFA 5EOQH 5K93A 3OWEB 5DEFB 1CDBA 2EVJA 3OHXA 2EDDA 4S11A 1WYWB 3GMNB 1SN5A 2R23B 3S35H 2IWFA 3PG2A 2XTJC 3DV4A 4K8RL 1BMGA 2OJZH 1BZQK 5BRQA 5D94A 2UWQA 4R4ND 1RULH 1XSOA 2BX5A 2ATPA 4MNQB 5CILL 4AP4C 5DZ9A 1S7TB 4XCEB 3MRCB 2IBZX 2ZPYA 4F1PA 3DVNA 4G59C 3TEUA 2CA4A 5C0GB 3UOAB 1FNFA 3CLFH 4TF4A 4UNTA 5KVGE 3SKNB 2HT3D 4R7LA 5EF3A 4QQIA 1OQRA 4OVUA 3X3FL 3FTUA 1B9RA 1JPFA 5FPIA 1WIPA 1S78D 5J6GB 4AV0A 3K5RA 1V1OA 3MAWA 3HM3A 5D1QB 2D2CC 2VMCA 3PIQA 5DD3H 4ZFQA 2NW2B 3U3WA 4NNYB 2O6VD 4GW1B 2QPSA 3V0AC 3NJNA 5I30L 3EGXA 2FTAA 4QHUA 4LNUD 2CA3A 4M8VA 1GHFH 2FWOA 4HIEB 4JJ5B 1ETJA 3DO3A 5D70L 2B4CC 4JKKA 4NB7A 3MMEB 1TY2A 4ZQKB 5CFHA 2FDBP 4U1LB 3WS6A 4FQPA 1VZ6A 1AIFB 1CK1A 4RGOS 2DMCA 4GKOA 4K5LA 2NOYA 3OJ4B 4M1CC 3PYCA 1W6WA 1WPCA 4XDCA 1JZ3A 3VVWA 3ZO5B 5JOFA 3K6FA 3VI4E 5CFAA 1COBA 1M2OA 2VRQA 3ARDD 3FOMA 4JFDA 3GOEA 3V0WL 3RJVA 1BGXL 2PYFA 4JKPH 1M2VB 4NO0B 2X89D 5F70A 3U7AA 3HK0A 4KJQC 4W9LC 4NENB 3O3BB 3X14B 5JUEH 4NAQA 3F12A 3MXWH 5LCVL 1BAWA 1NGQH 3MX3A 4W9DA 1C5DA 2XJLA 3IU4H 3GS2A 1OGAB 3ZO0A 1TYGB 4D3CH 4QRRD 5AKTA 3NRZA 1YECH 3KYAA 1USZA 4FGMA 3TXNA 1P5QA 4Z7WB 4YWGG 2NY1C 3EJCA 3JWNG 5ACZA 3ABVB 4OZIB 1FNEA 2OL3H 4IHOB 1YEJL 3N85H 3WO3B 2IGHA 3MXVH 3GJEA 1URLA 3AE1B 4MS6A 2PTUA 3L1OH 3TPUB 1SYVA 2CXKA 4JZOB 1XEDA 3Q8FA 3ZTDC 3W5UB 3E6FA 3MLWH 2HRPL 3PEVB 3S4SA 4PS8A 2P1YA 1SXTA 2G2RA 4P2QB 1NGPL 4F7EA 4OR1A 3H9SD 1K85A 1A6VL 5DD5L 1I75A 4X98B 4KO7A 5SV4A 3OSKA 3T6XA 2NTSA 3RK6A 4RWYL 3N6YA 2E0IA 2R59A 1AYRA 1KJMA 1AR2A 3KPOB 1NDDA 2JKWA 2IGTA 4U6TA 3QZBA 4ZUVA 4HC1A 5T3ZD 5GSVB 1AR1C 1OSZB 3BGAA 1ASQA 4ZHBA 1ROWA 3WY4A 3ZGZA 5KHOA 5AG8A 3S5YA 3T8XA 5LXVA 1PG7X 2AV7A 2UZPA 5AAWA 1DFXA 1UJKA 1I8IB 2CS4A 1FH5H 4AYFB 3OAYH 4MS8D 1JTPA 3EUDA 1ZT1A 3IDXL 1R5IB 1EUVB 4Y4KC 1UT9A 2DY2A 4XVJH 5HGAB 3RHWK 3FT3B 2Q3ZA 1JWBD 2VWEE 2DLEA 4S1RL 4JQIL 1FFTB 3S7BA 1ZSDA 3B4NA 3M46A 4MQSB 4XO8A 3SBWC 1ORQA 3GJFK 3QQDB 4NT6B 5DGQA 1LD9B 1JD9A 2Z7WA 3UF8A 5CSGA 3B2DC 2J4BA 5EN5D 1O6VA 5GS0C 2B9AA 3BDYL 5GJTH 4ZFOL 3HRAA 2AK1L 3T0XA 4HKBA 3AG4B 3W5NA 3MNZB 4P23A 5E94A 1P5UC 1BPVA 3RY6A 3V9EA 3GSUA 4OLZL 5FYKE 4WFHD 2VGYA 5GGQH 2DWEB 3MRDA 5I28A 4IBLT 1VDVA 3OKOB 3CF6E 4U33A 5HHDG 1UFGA 4NRXA 3VD5A 5ITBH 1TQCC 1VB9A 1KCSH 3BLKA 3I9GH 1GOGA 1UNSA 2KLTA 3CIAA 5J4MA 3I2CL 3P3RA 4U1KB 2IAMA 3SE6A 4YTMB 1YJIA 1XF4A 3KR3L 1WZ1L 1OW0C 3ILDA 2W9EL 1JL8A 2QTVA 3I5JC 5FKAC 4OYSA 2CJUH 2BP3A 4G9FE 4H26A 3QUZB 5ETUA 3SQBA 2AJZA 4M4RA 2KWVB 5TDOB 4ZYSA 5AZFA 3THMH 5F7DB 4GAGH 1ZE3C 1ZHNB 2GY7B 3MRGB 4MD4A 1Y07A 3FT1A 3RFZC 3CFJB 2DQCL 2RR9A 3UT8A 4EKXA 3SE4C 2VH5H 4HYTB 3WN5B 4KJWC 2ZSVB 4PREB 2O30A 4I9EA 4PV9A 4QHPA 1FPYA 5ECGA 3B83A 1KUMA 4QRPB 3AITA 1BEXA 5C2BH 3KYCD 4IRSC 4PJBB 1H9VA 4BQ8A 4KGLA 1QSED 2ZISA 2LVQA 4NACA 4J8YA 1G1KA 3DIVA 2VAAA 3V0JA 4NC1E 4JY4A 4FNLH 2KHAA 1B6UA 2Z8VC 3MV9B 3ZKJC 4APOA 4HS3A 3GBNL 1G7PA 3EH4B 5EG6C 4EIZC 4ZYNA 2P9NG 3A3YB 4RAUA 5E5MB 4X7SH 4CUCA 1BG1A 5CBNA 4CGWA 4UDTB 4K9JA 1XCQA 2P5WE 4AY0A 1JV2B 2EINB 4W4OC 5LXGL 4JE0A 1C9FA 4WHYG 3NRQA 3Q8BA 2PF6A 5F7MC 1ODAA 2GBMA 3MRQA 1GYCA 4U0ZA 5BV7C 4AZ8A 3CC1A 1M7IA 4XEIG 1EXUB 2I24N 4AV7A 2AVFA 2CBOA 3H53A 1DQKA 1T0PB 4BZYA 1T22B 2FR4B 5EIBE 3VR9B 3VJ6B 3FUDA 5E08L 3CHPA 1KYAA 2W07B 5KVEL 3KNBB 2QKIC 5K1JA 2I32A 3V7MA 2X4PA 1NCWL 3T8MA 3HHSB 4N9GA 5IVOA 2OSYA 3S34H 1CYXA 2JJTA 1WMHA 2ZKMX 3QA3B 1PZ3A 3QRGH 1NKGA 4LESA 4OAWB 5BVPH 4TQPA 3RMKC 5HYJA 3CZJA 4ZNEA 5IO9A 2NNCA 4PJCA 2R51A 2V5QC 1AGBB 1JZGA 4NP9A 3U48A 5LQBH 3F58L 1OGTA 12E8L 1G7MB 3FQXB 3IGAB 4FHBD 2G3ZA 1T0SC 1T5XB 2FE0A 2RPVA 2PCPB 3MJ8B 4M4PA 2J1WA 1TNMA 1WQVT 4J8QA 5ENRD 3UMTA 4O60A 3ARBD 4M7ZB 2XKUA 1ZLUK 1PCXA 5KEZA 4PS3A 4P46D 5B1BB 3IMRA 3VXWA 2BJMH 2I6HA 2R29H 4U3XA 1XCWA 3ZTEA 2VXSL 4PS7A 3HXFA 4GBXC 3VQMA 4G82A 3WKQA 1FVEA 4ECNA 4F33B 5ARFA 4TVPH 3FILB 1KPVB 3LV3B 5D2NC 3QO1A 4YDJB 4AQ1B 2CGRH 3OJ2C 4I1RA 1QG3A 4M8NA 2FBNA 1I85C 2Y25A 2XZTG 4J3UA 4B0ZA 2M1KA 2VLLB 4IIQB 4HXBH 4X7TB 3G5ZB 2DLFH 2DH3A 4ISVB 1BYNA 2X05A 3SDXE 2ONDA 2YK1L 1DQQA 3RFRA 1BXXA 3T2QA 2TRYA 5EIQA 1T20B 4ACFA 4ANWA 2LVPA 4FTVA 5MENE 4K3CA 2WQ8A 5L9DL 3JCKC 4AP2A 1BVLB 4DBGA 1L6ZA 3UMNA 2F53A 2YKLH 1AFVH 2VN6A 3L7EA 3RJQB 1FZKA 2GHZA 4UQCA 3HOGA 2L6BA 4PR5A 2WNMA 1DBML 1UXSB 4GXVH 5I23A 1MI5D 2GITA 3KJ4B 3QIWA 4LLAA 1OARH 1FHNA 3OLGA 4PJEA 1I7UB 2ZCZA 3GSWA 4Z7UB 3FU5A 1QTPA 1XCTA 2KQNA 3BPNB 4JM4L 1V3KA 2IGGA 4M6NL 4YR6A 4S2SB 3C3RA 2EE9A 1ROCA 4AM9A 4XZUB 1A4BA 4C56E 4M48L 2HRLA 3GO1H 4GKSB 1U8OB 5A2LH 1TETL 1RJYA 4NQQA 5GXBB 4R83A 3CIQA 3UO1H 1KCBA 2OR8A 5BO1H 3AY4C 4ZMOA 4B50A 4B95C 2V4IB 4PTTB 3VU1A 3KUDB 3IJEB 3QDJA 1T6VN 4O2CA 3HI5H 4ODVL 3UAEA 3N32A 4TTGA 4WQOA 2R0LH 1QYGL 4X7EC 3UGUA 3NH7H 4UUJB 2K0RA 3HVDA 2PTVA 4AQZA 2PJHA 3WGUB 3HBZA 4UU9B 1GJIA 3TIDA 1XZWA 1GSMA 3KYNB 2WXRA 3V4PA 4TUJB 2EDWA 3RPBA 2KBGA 2Y7QB 1V81A 3ABZA 3O6ML 4H5SA 3OKNA 3SE3A 5EO0A 3UG4A 3WIIL 4AENB 5JW4Q 1RZ8B 2CR6A 2OBGA 1Q1PA 2IH1A 5ANRA 3C5XA 3H6AA 3CFCL 4DUWA 5B7FA 4HPMB 3FO0L 5IG7B 4RGNE 2XWDA 3IU3B 4NUJA 2W5PA 5EA0H 1Y6IA 5AQ7A 3N44F 4LLVB 5FFLA 1S7UA 1LE9B 4OI8A 3BKCL 4H25A 2P80D 1N18A 1FNAA 3F83A 1U8MB 4XP4H 3FPXA 2KN4A 3LXFA 5BS0A 1YDPB 3GF8A 5C0AB 1B3JA 2D3LA 3TUOA 3EO1A 4K3DL 5AFAA 3SBQA 4C7YA 5E9AA 2Q7YB 3VTMA 4J3XA 2V9UA 1CLOL 4UTBA 1D5XA 4MCZA 3VXQB 5HTSA 2B0SL 2ISDA 2DM2A 4JG0H 4E41D 4JFWA 3K9OB 1KJ3L 2ZX5A 1UWXH 4XWGL 4YHPA 4RG9A 2D5GA 1Z9PA 4HS8H 4U2YA 1WWAX 4ZMAT 3OWEA 1KLUB 1T0RC 1RLWA 5CEXB 2IY0C 3LKPB 1FT2A 1JK8B 4MX7A 1KLGB 1G0YR 2XDHA 3GMNA 4XMKL 2R23A 3PS6A 1E9PB 3KUZA 2KC2A 4IOFC 4QJ4B 2A6JB 1XCXA 1NPNA 4N8VG 4J3VA 3II1A 2Z91A 1NEZA 1S7TA 2AL3A 3MRCA 3OPUA 2ZGDA 4KMTH 5J11C 5BUAA 1SLWA 2A83A 2JIXB 2IPUK 3HLAA 4XNZC 4I1MA 5C0GA 3VUWA 3RWIA 1D5MB 3SKNA 2AEHA 3F5WA 2XPZA 5HHME 3NBNA 1OK0A 4B9ZA 2ERJB 3PZ3A 5CS7A 3DSTA 4XBGB 2DZEA 5J17A 3PZ4A 5E24E 1YJJA 1VEMA 1X5LA 2DAJA 1IZKA 2VLKD 2W80C 4GP8B 2F15A 4IKKA 4FZ8L 5DO8A 5IKCB 2NW2A 4NNYA 2XA8H 3RB5A 3VD1A 2L7EA 4HIXL 2APWA 3L9RB 2AITA 3H56A 3O2VH 1RAXA 3K0WA 4BFGA 4Z5RB 4P1BC 1IBBA 4JJ5A 2OW6A 3RRUA 3MUUA 5CU5A 3UTPD 4AYEC 2KLGA 2F8XK 1KFGA 2R05A 3S5LA 1V7MH 5G05C 3CX5K 4HUVB 1M1XB 5I1KH 5I6LA 3UABA 5C71A 4U1LA 1I1FA 1WO2A 2I7OA 2V2WA 3B2GA 3RNCC 2GBJA 1AIFA 4XCNB 1N2RB 4K3JH 5L4IA 4AQOA 5JPMC 1E28B 1XSKA 2FUHB 3FQUA 3UBGA 2D0FA 1YJ1A 1OOAA 4JA9A 2EDKA 3PABB 1XBRA 4JB8P 1PLCA 4CT4A 5C08B 3N1ZC 5C1DA 4LRNH 5DURD 4TUOB 4WI3A 1UWFA 1VKXA 3CXHJ 2DMBA 4B9YA 1DBBL 1KMGA 3DOHA 3V4UL 2ATAA 1ONQB 4IK6A 4YE0A 4DUXA 1F2RI 2W60A 3JQ1A 2V8SE 2WK2A 4MJIE 3ZJUA 1OGAA 1XH1A 1JXJA 1BQHG 1GS8A 3SKJH 1TPXB 3AG1B 4Z7WA 3BG1B 1LILA 1TEYA 1KFAL 1OIOA 4OZIA 2PWEA 4JN1L 4IHOA 4BSVB 2KX0A 3MNWB 4MQ7B 3TPUA 3S36L 2LABA 1UOWA 4JZOA 3OSVA 2K5PA 4P2OD 4EI5D 4GO6B 4FYSA 2PE9A 3VSUA 1E2ZA 4FZEL 2AEPL 2YRLA 3CCHB 4IMLA 3WXXA 1XT5A 2CDFB 4IRZH 1EMTL 4J4PC 2Z65C 4XC3H 4PG2C 4XMWA 5TH2B 4QGYA 4UTAL 2FSEB 2CM5A 2VT0A 1R0AL 4P5TA 2XRYA 4JQIA 4P2QA 4TNWF 4WI2A 1U4EA 3WO4C 4OV6F 1P0SE 3T1FB 3TYGL 3D9HA 3MLZL 1YZZA 3G04B 4UMSA 2OHFA 3L3JB 1OHQA 1Z5SC 3REWA 4P48A 4RMBA 1I3UA 5C0CB 3CSBA 4DO4A 3CPLB 5J1TC 1QBLH 4P9MH 3JV0A 4HISA 2AK4B 2WUCH 1OWLA 3T6QC 1V80A 3LKRB 5E1GA 5CHFA 4LB8A 7CGTA 1L9SA 3T6ZA 4DKEH 4DKDC 2YLKA 1I4RA 2G30A 1LGVA 1NBQA 2YPKB 4GS7C 1XD3B 1C3TA 1OCWL 3KM1A 4OLWH 4MNGE 4DP8X 43CAB 4AYFA 3G6DL 1N94A 4M5SA 3GSOB 4WUUD 5CKGA 1M6UA 1T2XA 4N25A 1BQHB 1R5IA 2AXFB 1KBGH 4RDQF 2V3SA 1INDL 2B39A 4PYZA 1A8ZA 5HGAA 3FT3A 1U3HD 4MB4A 2N9KA 1I82A 1UACH 3ZNGC 3QAQA 1SPDA 3ZDYF 4APQA 4NERA 4UI9K 4NT6A 1KWGA 4JL0A 4N2CA 1LD9A 3DVFA 4G1TA 5HVHB 3O4ZA 2O6EA 1KZQA 3BSGA 4CGTA 4KXZI 1EH9A 4TQEL 4TSAH 4Y16B 2EELA 2X09A 4RCOA 1UWEL 4L3ED 3WEXB 3MNZA 4AT6B 5SWSE 4A39A 1ASOA 4E5XB 3R8BA 4P9HC 2E7CA 2CHDA 2DWEA 4GAYB 2ZX9A 5IVXF 3KPTA 1C8PA 1ZJBA 1AGEB 2OSXA 4F5CA 4XAWL 2R15A 2F58H 4L48A 2KK8A 3B9VA 2XQ0A 5D7LD 1HWGB 1WSST 4AGOA 2HKAA 2OMVB 4G2VA 3CDGB 4GW5B 3FTZA 1RURL 3EFFA 3CVIH 4Y5VB 5E0FA 5B3JE 1NAKH 4ZXBD 5F3BB 3NCFB 4DK3A 3QI9D 2E7LA 1ZV2A 1P6FA 2YD2A 4KSLC 1IBZA 4DDID 5LBSA 4E9YA 1B0IA 1BFOA 3FTYA 3QO0B 3QUZA 4KUZL 4K5PA 4OI9A 2NVUI 3INUL 3PNWB 5TDOA 1CBVL 4ENEC 1ZHNA 1Z9NA 2M1MA 4N3BA 3V2OA 3QJOA 4CYEA 3QUGA 2FH6A 4NAMA 3P3SA 2ADIB 1ET6A 4PREA 1DQLH 2ZSVA 1F4WH 4ORGB 3WXWH 2EYSA 3KJ6L 1YPZE 5D1XD 4E9XA 5BW7C 4QRPA 1BD2E 3IFWB 3IFLL 1IBGH 3IDIA 4POZD 3VXMA 2H0EA 4K8RH 4UILL 2VDLB 1J8HB 4PJBA 1J18A 5TDNB 4LUNU 1XSJA 3MO1A 5DJ2B 1ZXIA 1JNLL 1YNTF 3FYEB 2XV3A 1TKWB 3MLVL 2BVQA 3O3AA 2YINA 2WLIB 2X70B 2MEJB 3MV9A 3HUJE 3OXFA 2K1FA 3FPYA 3VLFA 1S7QB 2BP0B 2L4OA 3X3FH 5ENOD 2H0PA 5KG9B 2E2EA 4G8IA 5E5MA 3Q2AC 3QHZL 4UDTA 3T3MF 1FO0L 4F58L 1JV2A 3DMMC 2EEFA 5DU7A 5GS1C 1NZRA 4ZMYA 3T1WA 1V3JA 2VR3A 1II4E 3WI9A 3V60A 4YDVB 1G9NC 1MEXL 5HKPA 3ILQC 3L7FB 2CHNA 1KENL 4K5NA 3AE9B 4S0TD 4NURA 4WFHE 5G04J 1EXUA 3ASOB 4EQ3A 15C8L 4HZLB 4QTFA 1CDUA 1O7SA 5D7SH 3WE6B 4X5RA 5C0RL 1T22A 2YHGA 3HG1E 3Q6GL 5F7KC 2DN7A 1IKNC 3VJ6A 1HQRB 2X2IA 3OG6B 3OG4B 3KNBA 1JAEA 2F0CA 3RURA 5D70H 3NFPA 4ZBJA 3HHSA 3PWUA 1H8CA 2VZTA 3CVQA 1Q9KB 1S9XB 3QA3A 1SMAA 3AG2B 3QWOA 4OAWA 3BAYA 4Q0XL 3I9V1 5IA7A 3QUHA 1V7NL 1BI8B 3U0WL 4XMVA 4LEBA 1AGBA 1JIBA 5LGKA 2B59A 5KWDA 2J2ZB 3D9MA 2R2LA 3VO0A 1G7MA 4JR9L 1A1OA 4J12A 5L4FA 1A5RA 3FFCB 1T5XA 4WTZG 1ITBB 1MLCB 2VDPL 3BKML 1N8OE 2PCPA 3MJ8A 5LNGA 1ZHBB 3B7UX 4GZDA 1G1CA 4UBDD 4DHJD 1U8NB 3AGWA 4NZTL 2V7NA 1L9NA 3I75B 4P06A 1O1RA 3UPVA 5IOKA 5C0NC 2DQUL 5DJZB 2BYTA 4N2IA 3QCTH 4YSQA 2IVFC 5LCVH 1CGXA 4XWOC 3QG6A 3NZUA 2GMIC 3EYQC 3C8DA 2YUZA 4J2XA 1ETZA 2GAZB 3HVEA 3E80A 1QSEE 4FP8H 1BJ8A 1D8DA 1P4UA 4KVCH 4ZMQA 4PBWD 3C2SA 4YDJA 2VSOE 1IGDA 3CHQA 1QKZL 3ZKXB 1J9TA 1JMLA 1J8RA 2DYSE 1YYLL 5CEAA 4PJDB 3O3UN 4MEMA 1N60A 4KQ4L 1XBDA 1SFDA 2VLLA 4IIQA 4X7TA 2PTLA 2PPEA 3G5ZA 2Z31C 3QUXB 4I3RL 3MLUH 3AQYA 2IONA 3BZ5A 3MRIA 2HRPH 2B3AA 3U30B 3UIOC 3N2JA 3DXKG 1J05A 3KLHC 5HP5A 3VH8B 5D7IF 3UAAA 4HKQA 1E4WL 4AUUA 3A6OA 1NFDF 1HXYB 3MRBB 1NGPH 2B3RA 3V6OA 3AV8A 3FTVA 2CCVA 1WSPA 3QUYC 4Q94A 1A6VH 5DD5H 1RK1B 2LJIA 2OVBA 1O6TA 4OUOA 5CJQH 4RWYH 3AU5A 4M4RB 3U0PA 5JPNA 3HG2A 4ILIA 2XWJB 32C2A 1IC7L 1JNHA 4Z7QE 4GINA 1UGMA 2NY4D 1CLZL 3HE7B 1QAWA 3FUNA 4KOBA 4PJ5D 1VGKA 4Y1AB 5ACMA 5L8JB 1IO4C 3U6XA 3NB2A 1I7UA 1L3WA 3NSDA 4Z7UA 4B5ZA 4Z7VE 4ATGA 2XQYK 4U07A 4UT7L 4D7BA 3VA6A 1ICTA 4S2SA 4BA0A 4A90A 5CHWA 3IDXH 4GKSA 2SEBB 4KXZH 4OLVH 2VWEC 3DDFA 4AC4A 3HPLA 1GR7A 2D7QA 1XB6A 4W9EA 4JIOU 3RGBA 3TWUA 1IAOB 5HFYA 4JVWA 3IBOA 4S1RH 5H7PA 4Y2OA 4CU7A 4YPGB 4QLRA 3RA7L 3MREB 2DQTL 5BVJB 4GRWF 4MACA 1KXHA 4PJAE 5LVEA 1BHGA 1TSHA 3HN8A 1KBKA 2E27L 1A25A 3BDYH 3KYNA 4KJYA 4FCHA 4TUJA 3TT3L 3RZFA 1UZ6F 2Y7QA 2XZAH 1AMXA 2YXVA 5F9OH 1CTOA 1A9VA 4QXVA 4AENA 4OLZH 1MX6A 3K6NA 4NN5B 2YAQA 4UQIM 4QXWA 3LMJL 1W3BA 1CS6A 5FGCE 4I1PA 1WM2A 5LBVA 2H45A 3TV3L 1PDKB 4X6FB 3D2UD 2O2VB 3AB5A 3IU3A 3VXRB 1XLNA 1MX2A 4BFRA 1EERB 4LLVA 3ABLE 1N70A 2PL2A 1F0LA 3I2CH 1IEBB 1QEWA 4XVUC 1KIUB 2Z3FA 1ZGLB 5DR5L 1U8MA 4F8PA 3KR3H 1WZ1H 1R33A 5FECB 1DVFB 5DD0L 1YDPA 5CP3A 2EO1A 3ALBA 2WQUA 1J0IA 3N1PC 3RKDC 1VRAB 3CZSA 1CE1H 3TJPA 4ICWA 4S1DD 5FM5O 4Q52A 3CHSA 4Z7NF 4AK1A 4BK4A 5J6HB 4K7FB 4AE1A 4HRLA 2ITDB 4IKJA 3VXQA 4H13C 4ZMNA 3JSSA 4BFOA 3U83A 4MGIE 4PRID 2DWXA 4JFFB 3WNJA 3CN2A 3PP3H 3FSZA 3HI1B 3LKPA 3D9NA 1CDCA 4U1JB 1JK8A 1KLGA 1WF5A 2WVUA 3IXSA 1O75A 2H2SC 2BNQB 3AI5A 5E5LA 1IB5A 2ZICA 4HHWA 3QKYA 4NC1C 5JXEC 2A6JA 3U25A 1QFWM 4PRPE 3AS5A 1X5ZA 1ORSB 1OZUA 5FCUL 4GTQA 3QZWG 2XZQL 4ZDHA 3CFDB 4OCNC 4F7CB 2JIXA 5I5IA 2H9GB 1QWNA 3PWLB 1D5MA 3V4LA 1JPTH 5IHBA 1TJFA 1H3WM 4KZ0A 3MGBA 1UD2A 4R97C 4KFMA 1V05A 4XBGA 5GZNC 1OY3D 4P4KD 3QSKB 4LDTB 4TYUA 3EHBD 5E6IC 1CIDA 1FFNA 4CEMA 1U6AL 3CZGA 4XI5C 3STBA 4NQDD 4GA1A 1A6AA 2IH3B 5JO5B 1OAKL 5IKCA 4MAYC 1ZT4B 4IMKA 3NCXA 3WGVB 4G23A 3WXVL 1TZ8A 4GPVA 3VHTC 5AQ0A 2H6IA 5KVEH 1ELWA 3KH4A 1FC2D 2J6EL 5KHQA 1S8DA 4Z5RA 3WFBL 3V61A 1EEYB 4I77L 4OGYL 4Y19B 1TGZB 9CGTA 4LHQB 3HS0B 2EVHA 2HAZA 5F44A 2PEAA 3D5OF 1YRKA 4HUVA 1M1XA 4PVNA 2DQEH 3HG4A 5D4IA 1WWTA 4HLJA 2P5PA 1BMLC 2KDMA 12E8H 3WLWD 4Z3GA 4GXUM 1TBEA 1I8LA 2NY3B 5T5NG 3HVZA 1E28A 5G5HA 3W9EB 5EU4B 3LPOA 2KYWA 3VFPB 3PABA 4UTAA 4Z77B 2RG8A 2ZJSL 5C08A 3D0LB 2A74A 4Y2NA 2XHEA 3JWDL 2WYTA 4HWZB 2LHAA 1ONQA 1FAIL 1L9OA 2B77A 2VXSH 3VTWA 4I2XB 4QKTA 4U2ZA 1NA0A 4YBQC 2K6YA 1XH3A 1EHKB 2EIJE 3ZZLA 3ZYKA 4ZO7A 4J8RB 4R3SB 4KXDA 2G75B 2L0TB 1FZJB 2PP7A 2DLHA 4G5ZH 4W9RA 4TPRL 1XIWC 4YSUA 3LKNB 5K59F 1HK6A 4BSVA 2BKFA 3HE6B 3I6GB 1S7WB 3MNWA 4KPHL 3K81A 4MQ7A 1PEWA 5C09E 2FNWA 1MN4A 3FULA 4XMUA 1KY6A 2M56B 1CFMA 4D10C 4LVEA 4Z8FL 1A5FL 2EXWD 3ZXSA 4UDUA 2YK1H 5DQJA 3U0TA 2AJUH 4L8DB 4JCWA 5TH2A 4Y88A 1E5AA 3ATBA 2XEHA 3A6CH 3DRTB 3MEKA 1NL0L 1WBZB 4A8XC 3MBEC 4LIQL 4L4TE 3T1FA 4AL8H 2ZWLT 1MHPL 3FQRB 3L3JA 5AW5B 4MH0E 3U2SC 4DKFL 2UV3A 2QQLL 5C0CA 3LEXA 4KVNH 4AYDC 1DBMH 4WK4B 5L0QC 3PNLB 4LCIL 2AK4A 1C4PA 4L5FH 1OV8A 2IANB 3LKRA 2DIBA 1E8YA 3FF7A 3MJGX 2GBRA 1H15B 3ULVD 5C1ZA 1WGDA 1N6QH 1NYQA 5AQAA 3LRSB 4LQFH 1HZLA 4K5AB 1S5IH 3AS4A 1E2WA 4KV5E 4M6NH 2CSPA 1FVFA 4M48H 2VZ1A 43CAA 2N0MA 2F5BL 5D5MF 4YLQT 2VLRB 4C4KT 3BP6B 2DI7A 2AXFA 5MI0C 5EBGA 4JRYA 1N3NB 3PEUB 4HFWB 4ZSOE 4KKPA 4WWOA 4QHMA 4UM9D 4X6CB 3T3NA 1OP3H 1LD8A 4Y4HC 1RXLA 1URIA 4GYYA 4A7SA 4EN3D 3ECQA 4RG6A 1SBSL 4G71B 3S8WA 5ISZD 2X2JA 1MCIA 4V1DB 2A4EA 4I9XA 4HKZE 3PHAA 2D3CA 1N6UA 4HAKA 4RZKA 3LS8A 1PCSA 3PWVB 3O8XD 2FGZA 4BBNC 4Y16A 1T03H 4Y2DD 3WIIH 2HX7A 3ZHEB 1Q9OA 1N4RA 4KVOA 3WEXA 3FP3A 2XOTA 4M5YH 3CFCH 2MNUA 4OZFH 4PYGA 2P5EB 2V0PA 2P44B 2D4FA 3ARRA 2X0UA 3FO0H 2DD8H 4FQXA 5IW1B 4EDXB 1M9WA 1WFIA 3QWQB 4ZUTB 2MPAL 3BSZA 3PHQB 4LP4A 4XMPL 5ESQB 3L3GB 2FAUA 3AB0B 4R0LB 3BKCH 5DD1L 5KBMA 1FGVL 1AS6A 2EDFA 5L4MA 3MV3B 4JJOA 3STLB 5F7EH 1FSKC 5J12B 4I6JA 3UGBB 2RJMA 3GHPA 4K3EH 2OMVA 3GZ2A 1KGIA 2CGYA 2V8LA 3CDGA 2GJZA 3N06B 4X6BA 1LXMA 3TBSA 5F3BA 1M3IA 3EIFA 2KDFB 4HSCX 4U3HA 2YWZA 1NINA 1U42A 3PL6C 5H2BB 3WEMA 3BU8A 1FO0A 4G6JL 4JKMA 4Y0GA 5H4YA 4IWPA 1CLOH 2JSVX 1GGYA 5C0JB 5J0BA 1CK0L 4GI9A 4G1EB 2B0SH 1P1VA 1UOKA 3RKPA 3SKOB 1D9KC 4RLDA 1KJ3H 2XJKA 2GSGB 4XWGH 3S2CA 1N59B 3WKYA 5DCNA 1PYWD 1CICB 1WBXA 2YNQA 4ORGA 4OBSA 1I8KB 5FYLL 1PL3A 4WVRA 1KB5L 4XMKH 5GGUA 4LT7A 1S7RB 3UTTE 3GD1C 3IBEA 3ECVA 1PEZA 1J8HA 2CGZA 4D8OA 4K9EL 4LLWB 5TDNA 4NLHA 4JE3B 1K4CA 4JANB 3O11B 5DJ2A 4N3UA 1ZGLP 2KJRA 2WMPB 5B39A 4LCUA 2R0KL 1MCBA 3OR7B 1GTFA 1MG4A 2WLIA 5AZHA 3VXUD 2I1JA 3VFTA 2BP0A 5D7KE 1YQBA 3QAZC 2FBWB 1C08B 4ZRPA 4B0EA 4JM2B 5L6YL 2B16A 1ET8A 3TM6A 2N1WA 3GINA 4X4ME 2GYSA 5E70A 5BUPA 1E5UI 1KIPB 4YDVA 4DX6D 3QT2A 4PH8A 3L7FA 3SDAA 5IM7B 3GI8L 2Y1ZA 1HL5A 3AQZA 4FL4B 4HIXH 4HZLA 1SVXA 3WE6A 1AY1L 3EOTH 3BISA 5KJRL 4MMXC 4XTRD 4B53A 2OS7A 1HQRA 2VO5A 2GB1A 4TOYL 1QKZA 5CZXC 3P2BA 1I9EA 3FU7B 3F7YB 2W3SA 1FDLH 1EFXD 4D9LL 5BMFL 4WW2C 1DN2A 3BJ91 3ZDZF 2N1TE 5C3IA 3H6JA 3PPSA 4XGAB 1FH2A 4P3WA 2MJDA 3L4ZA 4JX0A 3QZNA 3FFCA 4HOXA 4MXVE 4PJGE 1MLCA 4QNPE 3ZE0F 3U8ZA 3UGEA 4G8KA 4PGCA 3FB5B 5GGRY 4HJJH 4DEPB 1ZHBA 3KPMB 4Z9KB 5AW6B 1CGSH 1U8NA 3NSYA 2VDRB 1NM4A 1NCHA 3B2MA 1BAFL 2X44D 3HB3D 1DBBH 1MFUA 3DV6B 1DOYA 3V4UH 2EH7H 1KCKA 4G7RB 2WO4A 3UGXA 5FLVA 1U95B 4GYOA 4R4NC 3ZL2A 3ZSTA 2F0YA 3RTQA 3ZXAC 5ANHA 3NQPA 2BC4B 3ELQA 3SDCD 3ZE1E 3C98A 3QHTC 1I8MA 3CVYA 1KFAH 2E9JA 4HMDA 2EE2A 3FY4A 4KHXL 4NQCB 3S3JA 3ZRCC 4KIKA 3Q1SL 4PJDA 3FQTB 5ARGA 1YYHA 5BQ7A 2C7MB 3QEGL 5D2MB 3GSXB 1EJ6A 3S36H 4YXHL 1MW0A 4HX1B 3QUXA 4FZEH 2AEPH 1JWMA 4QAMB 1U3ZA 4ME2A 1DP0A 5HGDB 3C5ZA 1EMTH 3RJOA 3HCVA 2REXA 3U30A 4LCVA 5T33L 4L8SA 3VH8A 5EIDA 4R5XA 3STZB 1ZDSA 2JJSC 2WVVA 5HYEA 1R0AH 2VR6A 4UIKL 3VUAA 3MRBA 4H7YA 1X44A 5CXPA 1SHWA 1A7BA 1ZWIB 3TYGH 3MLZH 5I71B 1JYXA 1F45A 3IAM1 1RZ7L 4K5CA 3OB0K 4KRLB 3KGSA 1A14L 3MVSA 5DJDB 1EYHA 4B7LA 3I4RB 4W9FA 3UYPB 3MV8B 2KATA 2D7MA 2J8UE 2K45A 3QIBB 1AZZC 3LAFA 3B9KC 4IGBD 2W81C 4GJTB 4OB5L 4G8GB 5KAQF 2FEZA 1JZHA 4DW2H 2BT6A 4IYPA 3HE7A 1H3VA 2XPGB 4Y1AA 4HH9A 4OLEA 3RVXC 5CCGE 3F7VA 2YMTA 2WP3O 3DCGA 2VSCA 1OCWH 5F1IB 4WHTB 3OZKA 4AY6A 3M17B 3ARSA 3IF1A 4MZ3A 5CEZD 1VZIA 2SEBA 4KDTA 2LGSA 1YIWA 4X7DC 3FC4A 4FEMA 1ZA6A 2F8OA 4Z78B 4OHJA 3UAFA 3JTSA 1F4HA 1IE5A 2FX8L 3ZE2F 1E67A 2DLGA 1TNNA 2AXHA 1FC1A 3M1BA 3MREA 5ANMB 2J4WL 5HDLA 5BVJA 4PJXB 3TN0B 3MJ7B 5EUOE 1MFNA 2NY0B 3VMPA 3IDMA 3ZIYA 4X4YB 5A2BA 2NX5E 4BBNF 5KVDL 4PB0L 1GPOL 3VG9C 4LCDE 4WCYL 5T8IA 3TWRA 2VKWA 3EFCA 4OW0A 1ZVNA 4EI0A 1QZEA 2V3NA 3P11L 5EU7E 3B0AA 4IM2A 2HT2C 1XB8A 3ZGQA 3BVTA 3MX0B 4EHMA 4Q6IC 1X9RA 4ZUSB 4E9QA 2P9RA 1PDKA 1KELH 1QRND 4X6FA 1I4GA 2O2VA 1A4AA 5AVRB 2GRMA 4YNDA 1AMYA 1J5IA 4EBAG 2SODB 1NUDA 1IEBA 2VISB 4FABL 4J2QA 4Z7IA 1HHHA 1KIUA 4JPVL 1ZGLA 5B8CC 4L18A 1RURH 5E2WL 2FULA 3CG8A 5AAMC 1RUKL 4B0MB 3IDNA 4JHWH 3HR6A 3L3KB 4GTPA 1A2YA 4LVOC 5FECA 5DI8A 3FONB 2B4CH 4P2AA 4ZMTA 3L4PA 2P3YA 3QE5A 1GS6X 1V5JA 4XZ4A 4KNTA 1BIHA 4DGYL 1CBVH 4JHKA 1P7FA 3ULUD 3FAWA 5J6HA 2GKIA 5FO8B 2NPTB 4K7FA 4PJ5E 5D3IB 3BN9D 1VESA 2ITDA 4J39A 2XN0A 2H32A 1J7VR 1TF4A 3ZJAA 1PC2A 3TLRA 1GG3A 2AC0A 1NAMB 3DRAA 3I85A 2XG4B 3O2WH 3HI1A 3OKYA 2FGWL 4ZQTA 4GYBA 4NIKB 4YJZL 4UILH 4M29A 2BNQA 1GS7A 2LEKA 2YD0A 2Q9OA 3GZQA 4ZNCD 1PNDA 3E37A 1BEYL 1KT2B 1JNLH 2X4UB 3Q2LA 1NP7A 3MLVH 1ORSA 1QFUH 5D2LB 4BSZB 1WJ4A 1AO7E 4YAQB 3NJTA 4P05A 1ZOYB 1WLHA 3CFDA 2H9GA 4FULA 3PWLA 5ELIA 1YG9A 2N1VA 2CJOA 4RGMC 3FO9B 4PY8J 3DTXB 4H8VA 5C3JB 3EUVA 1HZKA 4F58H 5E4AA 5HI4D 3D39B 2V9QA 1KM7A 5MEOB 4ONGH 4Q7DA 3BESR 2C3WA 3JZ7A 2GW5A 3SDDB 1KENH 1GYVA 2IH3A 4N2EA 4ZAKA 3DSNA 3BZEA 4GI6A 1JXFA 5I66B 5I9QC 5C0RH 1R34A 4B8AA 1JCQA 3FCGA 1T1WB 3Q6GH 1LWRA 5E2UL 3WNOA 1JW9D 3DARA 2F18A 3QQ4B 3CFBB 3ULSA 1ZJAA 1O0VA 1G7HB 4GZ6A 3D52A 2G60L 1AOHA 3LEYL 3UM1A 2O5XH 4GG6B 1RW2A 1FYTB 2ZYHA 4Y19A 5F97E 4ABNA 4Q0XH 1KYDA 4BT8A 5KS9F 2KN5A 3HS0A 4NJ7A 2UZIH 1V7NH 4AIZA 3Q7FA 5J13C 2QSCL 1SVBA 2V5RA 4G11A 3O6FA 4WW2F 4OSUH 2MCAA 2IEPA 3QDNA 4LCYB 1L0PA 4JR9H 1DN0B 4M56A 5DMJB 1G9MC 1AYFA 3EDTB 1MVKA 3BKMH 1YEFL 1CGWA 5EU4A 2VDQB 3EIQC 3SOBL 3VFPA 4NWTL 4NZTH 2KVRA 3OKEB 1YEKL 5FFGA 2Q5BA 4H1LH 2LAAA 2DQUH 1GPXA 4WGKA 1KTDB 4NKOA 2FCMA 3L9TA 3PV6B 2Y5TB 3AULA 4HWZA 4NQEA 3LDZE 2DMGA 2EUVA 5AEKB 1AGCB 4L1DA 5E8OB 5A6LA 4OV5A 1CQVA 2CDEB 2HFEB 2MJWA 4POUB 5F72S 1R3IL 2Q86B 3HM6X 5DJCB 2LT9A 3VXOB 4PS4H 4TQIA 5C0BA 3PRMB 4HGWB 2G75A 2VDMB 4NOFA 2L0TA 4AW7A 1P7BA 4JQVA 4M7KL 1I8UA 1J1OH 1FNHA 2QT6A 3LKNA 2ZTBA 3PY9A 4GP4B 5E8NB 4KQ4H 2TSSA 4Y9FA 1THAA 4QIRA 1QOAA 2JB6A 1KYUA 5AYQA 1INZA 2VR5A 3AXIA 1E7VA 4ODXA 5JDJA 1U30A 3MCKB 1U21A 4KKNA 5I8EB 4Q58C 3OAZK 3SO3B 4FADA 3WMPA 5E95B 2C3XA 4M43L 2IPKB 1X4YA 3I50L 4GH7B 4L8DA 2DJSA 1VENA 1IHGA 1UH4A 2YIHA 4C00A 3AXHA 3DRTA 4P2RE 4AUJA 2BS4B 4R5TA 1KOTA 1U92B 3R0NA 4FQ1L 3U9UB 4Z7OF 1QEXA 2YJLA 3MN8A 3QFJB 5IK3A 5B3NA 5I76B 1J5HA 2PKDA 4NWUL 2WLKA 1GZHA 3FQRA 4RBPK 1YNTA 3BZ4A 1ZB1A 4MRCA 1FNUA 1IC7H 3F7RA 3PLUA 1AS7A 2IMNA 4FXTA 4HUXB 5CCHE 4UM8A 3T3OA 4ZPVB 1CLZH 2AQ2A 4PB9L 1IBXB 4YHZL 2JRIB 1CXHA 3D3MA 2GRRB 5BXOA 3AT8A 1H15A 1WBYA 4HW6A 1MJJB 3LRSA 4BSWB 4GSWA 2OMZA 1AC0A 1R4NB 3VWJC 2CBTA 1ZE3H 3DIFB 1NFKA 3ARBC 4P46C 3VD4A 1VEOA 1ES0B 1SXSA 1TTUA 5KYNA 5LO7A 1K3ZA 4LHUG 5FGRA 3BP6A 3UZEA 5GS2D 4HEPA 3WBDA 4EN2A 3QCVL 1RZFL 1N3NA 4HFWA 5CD5D 4PRHA 2DDQL 3EJRA 4PJ9A 4K94C 2MX2A 3VGAC 1X7TA 3A4RA 2DQTH 1W8EA 1WHPA 4KZCA 4V1DA 2WLMA 2DM3A 4JRLA 2IO3B 1WCBA 3DXAA 3P3YA 1Y8MA 3PWVA 1S4IA 3TT3H 1PY4A 3OXRB 5IBTL 5BXFA 5DHYA 1TTRA 3C12A 3ZIMA 3ZHEA 5C3LD 3SGJA 3LMJH 4F8NA 1DCQA 1KB5A 2P5EA 3IDGB 5E4EB 3U2IA 1WGVA 4JHZA 5E6UB 3TV3H 5I6XB 3F04A 4ZUTA 5BV7H 2D4DA 3PHQA 4Q56A 5ESQA 3L3GA 2EXTA 5AL8A 1ZK9A 4R0LA 3VXNB 3OJ3A 3ETBJ 1G6JA 1J0KA 2NDGA 5B3JF 1ZHLA 3EGDB 4JO1L 5MEQB 3RCZA 1LDSA 2KD0A 1LMIA 4HFUL 4OKDA 5DD0H 2JYTA 2MEKA 3MUY1 5BV1A 5DS1A 1HCZA 1OXYA 5CNHA 1WUZA 2V1YA 1S63A 4KXCA 4N2QA 1YMMA 3E34A 2IY1B 2DKSA 3PDGA 5H2BA 1XXGA 4BKGA 4G70B 5C0JA 1RZGB 2BY2A 3LIZL 4HJ0D 4LHUB 3P73B 4G1EA 4O1NA 4MLIA 1N9AA 4OGAD 2KLSA 2GSGA 2ZKWA 3VI3F 4ZTOL 4JDVA 2QHLA 1N59A 1NCOA 5D7IA 2ZONA 3OM3B 2Y69B 5DYOB 3PDOB 1I8KA 4C47A 5AB2A 1XLPA 1QNZH 1XAUA 5EEVA 1HU3A 2NY6D 3DUHA 5SWZE 1S0PA 2N59A 1G7LA 1DBKL 5INCA 2NMSA 4J7RA 2LMCA 1I53A 2BS3B 4JANA 3O11A 1B4TA 1LNUB 2XZQH 1IXVA 4DX2A 1NDTA 3BD5A 4JG1L 2PN5A 4U05A 5IROC 3O65B 4BKSA 1NKOA 3KPSB 1UD4A 1YOVB 4GGQA 4J27A 5SV3A 1E10A 3GSVB 2QKSA 1FGNH 4BESA 2KJHB 3TF7C 1IFRA 1LO4L 1I1AB 1QI3A 4JM2A 1LO5B 1G7QB 2ETAA 1O9WA 2WXFA 1WZAA 3IFOA 3ZTCA 2PETA 3A0OA 2QADC 4J3SA 4LEXL 1OAKH 4N3TA 3T2NL 4EQ2A 4OZAA 3CXFA 1WAAE 3WXVH 2VOTA 4AQAB 3VB8A 5EZOL 1ZDQA 3QDME 3AECB 5LKNA 3SDYL 1ZXHA 2NY5L 5I6PA 2WHVA 1DQVA 3MACL 3L08A 2J6EH 2VNCA 4I6LB 3WFBH 5IB4B 2X10A 3QGVA 3SFXA 2R2HB 3SY2A 2HJLB 1S7SB 3FU7A 3GMMA 3F7YA 3WNPA 4FOMA 2V5TA 2JFCA 1CG9A 4Y4FD 4IWQA 3CHMA 4NHUA 5ICZB 2ZPKH 2K9XA 2JV6A 4FJVB 4NJ6A 2F53D 3RRQA 1FHGA 2J8HA 4J5VA 4L9LC 4N0RA 3Q4AB 2RFXB 2C1PB 5CHVC 3P4OB 3OLIA 3FB5A 4RGTA 5ID1B 1SJVA 1RV6X 5IHLB 4LSTL 5DVLA 2B20A 1JGDA 1NCIA 2HJFA 3L3IB 3QIWD 4ANVA 1HZHH 3JWDH 4FERA 5D1ZI 4RH4A 1Y0LB 3RRMB 3DV6A 1NBVL 1UF0A 1FAIH 4UNUA 1U95A 2V33A 1YYMH 5I74C 1AG6A 3VVVA 3A9KB 4ELMA 2ZCLL 1HL9A 4MLSA 2VW7A 2QHOA 2YBGA 2VXUH 3RZCC 2VL5A 4BE6A 1KGYE 4AM0Q 1QO3B 2MQ3A 4TPRH 3MRJB 1L4DB 4IJ3B 4KK9D 4B60A 3EBIA 4KPHH 5JZ7D 2VSDA 1FV1B 2DIEA 5GRVK 4BBWA 4A2FA 1EHXA 5L4JA 3ZU8A 1D6VL 1MX4A 4UQXA 4OZFG 4HX1A 3BCDA 3RGVA 4Z8FH 5DQ9B 3G08B 3JW0X 5HGDA 4LHJB 1I9IH 1IC1A 4M93C 3AKJA 1URZA 5T1LB 1U8KA 1BQUA 4WIQA 3IK2A 1CGVA 3OPZL 2CBPA 3C60B 5AW3B 5D4JA 3CFNA 1ZWIA 4LLQB 1F4YL 1PW3A 4Z7QF 2CJNA 1E8ZA 4HUUA 2RQ8A 3FB8B 4DKFH 4QOKE 1Z9OA 3UYPA 1E4JA 2QQLH 1YY8A 2HG0A 3MV8A 1TJHH 3QIBA 4FXKB 5LG1A 2F8XC 2OSLA 4JHVA 4XP6L 4OTXH 1N5XA 3BEVB 3ABMB 4G8GA 4J6IA 2X9XA 1VRSA 3FCSB 3GLEA 3GXIA 5F7WC 2XPGA 1HH6B 5A6CA 3TCAA 2UXGA 5A2AA 2WWKO 4M6OL 4AIFA 1Y18B 5F1IA 3L3DB 3T0EE 4GTTA 2WZAA 4WHTA 3DRQB 1RD6A 3RWDB 1WXSA 4EPZA 1MCSA 4YHYC 3B6SB 3ZKND 1YYCA 4AQ7A 1ZLWH 1E4KC 5IV2B 3LRGA 3K5SA 1OEYA 4OM0L 4PJIE 1E8XA 1TLMA 3GNML 5EEXA 1X5IA 5TR5A 3N40F 5TE7L 2P45B 2C60A 4I18C 1SBSH 4I13B 5EC2A 4J7WA 2CH8A 2X6KA 1XAKA 2XXFA 3A4SC 5C97A 2J25A 1NTDA 1EEZA 2WLZA 4I87A 2WGSA 5I17B 4X4YA 2MRYA 4KHTL 3GXNA 4BIKA 4P2OC 4MNQD 2P49B 1Q0XL 2WYHA 5GGTL 4QTIL 2NNAA 2OZ4A 3MKRA 3NJIA 5D7JA 5TF1L 3ZYZA 4WGVB 3MX0A 3CXHK 2KDBA 1N12A 4QEGA 3W0WA 4ZUSA 3RDTB 1UJTA 1FGVH 1I31A 4ZUUB 3NOCD 4LCWE 1YJDL 2YO3A 2JPHA 4XX1E 3DHUA 5D1QD 1Z9LA 2VISA 4H8QA 4KI5D 4DQOL 2D3GA 4REZA 4MA7L 3CHRA 2YZ1A 3FHQA 4G8FB 4B0MA 3L3KA 3ZY7A 4ZTEA 2Q8BH 2WAQA 3FONA 4ES8A 5C2UB 3A1QB 5LGYA 3UDWA 2WKGA 5ESVA 3AG3B 4G6JH 1SXAA 4QHKI 1V5OA 4JKWA 3TBTA 2FQEA 1H3XA 3RDJA 5CRUA 1UB6B 5DGRA 4U0RC 3LS5H 1EAJA 2PPDA 2Y4SA 3B7SA 2DF3A 2XXMB 2BOLA 2FRGP 4JW1A 2HLEB 1NAMA 2XG4A 3UTSA 4BAXA 1I1YB 2ED9A 5IGXL 4CSZA 3PAVA 4NIKA 2PXYB 2WYIA 1H3UA 4K71B 4A67A 1OM9A 2ICEC 4K9EH 5C9KA 2ADFL 2A5UA 5A7BA 4GUQA 2ON8A 2B7DT 2W3RA 1KT2A 2X4UA 5AOMA 4GDKB 3EUUA 2R0KH 5CRVA 5LOZA 4JZJB 4NO0D 1FZMB 4YAQA 4U04A 4PV1C 3UO8B 2WZ6A 5GGVY 3IWUA 2P24B 3ATFA 1LM8V 4BCZA 4L23A 1UTDA 5C07A 2X2UA 1FJ1B 1OGAD 3DTXA 5L6YH 2PO6C 2AQPA 2XK5B 4W1TA 2IGFL 1OT8A 1KN2L 3E2HC 5MEOA 3BK1A 2K1MA 5FW6A 5IQ7L 1HWHB 4ZW3A 2Y7SA 1RP9A 3C6LB 2AJYL 3DVGA 1D8EA 3ILEA 3LDBB 4HPHA 2KDYA 1AY1H 3ARGC 1T1WA 1CXKA 5KJRH 2H3KA 3CFBA 3V9CA 3ZYMA 1G7HA 1FL6A 1PGRB 4GG6A 4TOYH 4ZXBC 4JLCA 1FYTA 1U4FA 3QI9C 4K15A 3RL2B 3EJZD 4D9LH 4QYAA 3BAEL 2CIKB 1MFAL 4JPWH 4YDLC 5BMFH 4P2QD 5I6MA 2E74C 4GLSC 3QJTB 3QPXL 2L0FA 4LCYA 1UA6L 3OXLA 2YBRB 1JNJA 2VTBA 1IGJA 3I9PA 5IMOB 2DQJL 1L9QA 1SJXA 4LVHB 1GAFH 4G8EB 5ADOL 1R4MI 3FTSA 3MBWB 5I75B 1U2VG 2OP4L 3H7BB 2WHIA 4Q2ZB 2BY0A 2HVBA 3HMWL 3QDAA 2X1QA 5EILA 1BAFH 2PCFA 3WD5L 3BWAB 5E9DB 2DJMA 1KTDA 4UZSA 1P3QU 1ZKAA 3PV6A 1ELKA 4OLUL 3Q5TA 1AGCA 2WKOF 3MA5A 3PHOA 3MUGB 4M62L 5E8OA 2HFEA 2VM4A 5DJCA 3W9CB 1D6EB 4I3SL 4JFDE 1USQA 1N5AB 1TFPA 2N3JA 1FCLA 4GRWH 4HGWA 2ZUQB 5ICYA 3NYKA 1C1EL 3QQ3B 4XE5B 5E8NA 2ORBH 4HCFA 4DZ8B 4YXHH 3CLEL 2VZOA 3BE1H 2CUHA 5DK2B 3ZGHA 1C5CL 2QPDB 2WPGA 4F80A 2IGDA 3W9GA 2GJ6B 4GO8A 1TZIB 3MCKA 4JB9L 2IBZY 3B7BA 2PZIA 1ETA1 1PKQE 2ZG3A 4MD0B 2HE0A 2BCMA 5T33H 3VXTB 4ACLA 2IPKA 3F01A 1XL4A 1MF2H 3EXJA 4UIKH 1J7BA 1EF1A 2Y9RT 3N50A 4JC8A 3RVTD 3DETC 4PJ7B 2YPVL 3P4NB 2JF5A 2N4FA 1BF2A 2J73A 3QXDB 1U92A 4JPSA 2JJWA 4UQZA 3TH4T 3HNSL 3VWKB 4LCTA 1A14H 1JCSA 5ENQD 4HJKA 3HLKA 2FI7A 1TOXA 3ML8A 1ZV9A 4I9WD 3NHEB 4ATZD 3HMXA 3LS4H 3PFUA 4ZPVA 1DJXA 2DZJA 1XGUA 4L37B 4WK2B 5LNK1 2XPYA 5T3ZL 4JHAL 1H8NA 3IMTA 2I9LA 3Q3FA 4XWTA 3Q2NA 1MJJA 5EN3A 1UN8A 2CWRA 1C4AA 3AEDB 5A3ID 4UBDC 1HDMA 4ZFHA 1R24B 1CYWA 3TFKD 3JQOB 3R66C 2XTJB 1YVLA 5EU5A 3PNRB 4I0KA 1P7KB 3QUZD 5IJKC 1N0RA 3U7ZA 2A6DB 3APFA 1DLFL 5IHZA 1CE6B 4K1RB 2ZOUA 3CFEA 4JFEE 2BP8A 1JPGB 2VC2H 5EUKB 2AWIA 4F8TA 2ASQA 4AH2A 4KDLB 4GFXA 2DIJA 1PGAA 7FABL 3TGOA 3TWVA 3QORA 1QMUA 1AQ8A 4MJJA 4QRPD 5KVGH 3TVMC 4X50A 3A4DA 3LIZA 4YQXL 2FUG1 5KVDH 4PB0H 3OXRA 4XT1C 3EKCA 4IIZA 4WCYH 5E99H 5EU7C 3SIKA 3T4AC 3ZDXF 3IMVA 2DLTA 3IMWA 5HPOA 4FQLL 5CF3A 1T1ZA 3MV9D 3IDGA 1C7SA 2VGXB 1XMWA 2IC2A 4A2GA 4ARCA 4HRMB 4KTDH 5GPRA 2AJVH 2EDNA 5BZXA 2KXJA 1T66D 2J7LA 3MRNA 4X9BA 4HIQA 3VXNA 1FZOB 4FABH 4JPQA 4DXGA 3BINA 3FO2B 4JPVH 4C7ZA 1AZRA 4W9JC 5E2WH 2HTKD 4X9GA 5EFIB 1RUKH 5MEQA 3BCFA 2ARWA 3FL7A 2NY4C 5KBKA 5ENNA 3HZVB 3NFSL 1FRGL 4IBTA 5F7NC 4DIXA 1YEHL 4QAWA 3DPYA 4UT6L 5CR8A 2RPQA 1MPAL 2YXFA 2UZYA 2BSED 3G6JB 3P73A 2XKSA 3P4SB 1WT5A 3VFNB 5BW8C 4H1LG 4NCC2 2ZKHL 4JLRB 3SD5A 1UKQA 2BS9A 1YMHA 2ZYSA 4MD5B 5DYOA 4GMVA 2FGWH 4KY2A 1YQ4B 1T5XD 3MOQA 3PJSA 1T7XA 1MFBL 4DOHB 2NY1B 2XCCA 1S7VB 1K2DB 3SF4A 2FNBA 1IAKB 4P59H 4KDWA 4HJUA 2HT4D 2GEQA 3LKSB 4WNJA 1C8QA 2WQWA 1C79A 4AGMA 1P4IL 1O5MA 2J08A 2ZUYA 1UKSA 4B9KC 1F4AA 3GSVA 4KO5A 4UQ3A 4HF5L 2HWZL 2L04A 1I1AA 1IUEA 1BPOA 1H6EA 5FDWB 5CLWA 4WHDA 3GZPA 1LO5A 4LGPB 3DDGA 1G7QA 5HY9B 1VGEL 5F0MB 4FG0A 2V37A 1WFTA 4N85A 3QARA 3OKLB 5IHUL 5AVZB 2J53A 3JSVA 3ZKQD 2DZOA 4MSWA 5GGSY 5E2UH 4AQAA 4MXQD 2YRPA 1NCDL 4YX2L 5FUCE 2DQGL 3BIBX 3KXFA 3LEYH 4Z3HA 2G60H 1HAWA 1KIRB 1QABA 4OI7A 1KGWA 1L2NA 1KJ2L 4CC4A 5BOJA 5IB4A 3MRMB 2HJLA 3L1EA 3NVWA 1KBVA 1S7SA 2X8XX 5AWNL 1X4XA 1JTTA 2EC9U 4DP1X 2A5EA 4ZOBA 3L8QA 3FB7B 4S1DC 4QNPF 3W9DA 4MXVF 4ICVA 4NCDA 3ZN3A 1EZUA 3K6OA 4WK0B 1NMBL 4CYMD 2AF2A 2H47C 2R0WL 3GLDA 4JFHE 2J1ZA 5AD0A 2RFXA 4KAQL 2WVSA 5JMRA 1F9JA 4Y5XB 1ADQL 4NWTH 5CGYD 1SZ9A 3K2UH 3P4OA 4FEIA 4Y4KB 3R0MA 1YEKH 2R9HC 2WTRB 2OYPA 2F54E 5LB1A 5HYJE 4GSXA 3VFVB 4PJCE 3L3IA 4ZUWA 4U95D 3Q79A 3M7OA 1GC1C 2ICWB 1Y0LA 1W80A 1DYZA 3QEQB 5EO9B 4FQ2H 3QCAA 1L3NA 3I5PA 4FG4A 2G0KA 3C5SB 2V3DA 3FAXA 5KZCB 4OF8A 1R3IH 3L81A 3A9KA 3A24A 2DBYA 4HWEL 4QDGA 1GA2A 3GPEA 1EO7A 3E9UA 4LKCB 1P5UB 2GIYA 3MRJA 3VD3A 4ABQA 3U6RB 3FKYA 1MY7A 3EF7A 3TWSA 4WI6A 4AYSA 4PWJA 1FL3A 1I7RB 2GW1A 4XR8C 1RYJA 3IEGA 3SCMA 2VZSA 3EHBC 1ZXKA 5LNDA 3U2JA 1WZ3A 4RM8A 5FYKH 3N44B 2LRUA 3DROB 5DQ9A 4E9SA 3G08A 1U91B 4ZO8A 3GYRA 3ML9A 2YVCA 3I50H 3LX9A 3BOVA 5T1LA 2YRZA 2EZ0D 1DVUA 3F64A 3WENA 2F1EA 3C60A 3MSPA 5IEKB 3NVVA 3IV0A 5FKAB 4FFZL 4FQ1H 4LLQA 4RCAA 4XPBL 2B5IC 4QHLB 4ZJ9A 2ADYA 5FLUA 2A6IA 4MJ6A 3HKZA 4R4BB 2VLJE 1F52A 4TXQA 2D03L 3LRLA 2R56H 4GMJA 4KXAA 1E30A 4YVUA 1ZHKB 1Z9SB 2VITB 4FXKA 3TEYA 3ZRSA 2BZCA 1JDDA 3BEVA 4FTVE 1TQTA 5GGTA 3FCSA 4DP0X 5LFAA 4AMKH 2P9KG 4JRXB 4XYCA 4FTDA 2IIJA 5C0AD 3HUIA 2WLLB 3QDGB 3DRQA 1CD1B 2JF1A 4KRMB 4X6DE 5DUML 3FUJA 5B1KA 3B6SA 3VAEA 2DOCA 4U1SA 3DX8B 3FOLB 4DP5X 1BVKB 3QCVH 5T5FL 1LLAA 3KEHA 1ZIBA 5CGBA 1JS4A 3P30L 4C80A 2FO1A 4BUQA 2KBXA 3ARTA 4PVLA 1TZGH 3LD8B 3QG7L 4RFNC 3NACH 1N68A 5CEYB 1S64A 1BX2A 2R1YB 1VCBC 1KLUD 5B3SB 4GMLA 2EIME 4GAAA 1NOFA 4YHLL 1SHMA 1KLGD 5AW0B 1BXTA 3GXTA 3TWTA 5TD4A 5I17A 3LKOA 5D71L 4JEHA 4BDVB 5BV7B 5HI3D 2G4EA 3GB1A 4ZDVA 5SWQB 4OCRH 1JHKL 1SF0A 3QDJE 2VE6B 1WXVA 5IREA 4CGUB 1IVLA 5DMIL 4C83B 2JIXD 2OCCB 3FSWA 1FVDB 4MBOA 3Q7JA 1N5YL 2XQBH 2N7DA 5DEGB 2QKIB 5AVTB 3HC4L 4CDNA 4OCYH 1TN8A 4I6NB 2VXTH 3RDTA 2WXPA 5FC9A 4OM1L 1HYRC 4ZUUA 5K5YA 1VHPA 2BKRB 1QLFB 1R3LA 1AS8A 1QBML 2J49A 3EOBB 5CCKL 3UADA 2IXQB 3UBXI 5AAOA 3GQFA 3HHRB 4P99A 4XNYL 3SYAA 4BEIA 4G8FA 3B7YA 3II3A 3DX0A 5LAXB 2ARJB 3MP9A 3DNKA 4HCRL 4PLKC 3FQ2A 4CADA 2KWUB 3BEWB 3A1QA 3PHSA 5BV0A 4F8QA 4OIFA 3DSUA 4YFLF 4F93B 2QLYA 2JE8A 3KPQB 2KZTA 1LQBC 3AZUA 1UB6A 5JMOC 1OWNA 5AOLA 3AE2B 4XN7A 4JM0A 1AANA 1BOYA 1N8ZB 5BS0E 5HHOB 4JA7A 2VZVA 4U49A 3EBGA 3S7GA 3EDEA 4GBXB 5BXUA 3NJGA 4NUGL 4DPRA 4RDQG 4EUPH 1LO3H 1I1YA 5DVPA 3EJJX 5D2NB 3H9DA 5FCSH 3N1FC 5EOCL 1I3GL 3DOIA 4AMXA 5DPSA 2RB8A 4EN3C 1DBKH 1L5PA 1FO4A 1GZPA 5C08D 2V5FA 4GDKA 3ETSA 2NR6D 2RH0A 4JG1H 1A22B 1KCLA 4JZJA 3DVGX 1FZMA 1JRHL 4AQEA 3MRKB 1Q0EA 2P24A 5E1AB 1F41A 2MPVA 4RZCB 1I1RA 1ZV5A 1U8QB 4Y2DC 1FJ1A 1BYPA 4L3FA 4ZX5A 1Q1OA 5LDSA 1H4RA 4Z3IA 1BFTA 1KPSB 1D5BB 1G6VK 2HYMA 2XWTB 4G8AC 1L0YA 4OD3L 1P1AA 5JJTA 2D73A 2NNFA 2BXYA 2Q0ZX 3RNFC 2G2NA 5F2FA 4P04A 2DEXX 3DSXA 5EZOH 4A3OA 3SDYH 2NY5H 5B38A 4XNAA 1CXEA 3CV5A 3LZRA 3OHMB 3ARXA 2BW2A 1BJ1H 3T3PB 5TK4A 2YEZB 3T0DA 5LGHL 4KI5E 2FJGB 3QW9A 4AG4L 5ESAB 2AVGA 2SAKA 5F89A 2EKIA 4LJOB 1V27A 2CIKA 4G1MA 1WWBX 4APXA 3KEDA 4G6MH 1KOAA 1A9EB 2A77L 4ACKA 1HTQA 5E1IA 1NMCB 3HXEA 2R5SA 3WAOA 2YBRA 2ZKXA 3BWUD 5IMOA 1DANU 4NZRL 3LH8A 2ITCB 4G8EA 4R90H 1IC0A 4DX1A 2PW1B 1CGYA 3TWYA 5C0CD 4X2UA 2EH8H 4FQHB 4WO4B 5CJOL 1C1YB 4H4NA 4Q2ZA 4LSTH 2D7TH 4C8XA 2AK4D 1BZDA 4GRLB 4PT5A 2IGLA 3QWPA 3BAXA 1NBVH 2FX7L 4R7DB 5J3HC 3H9SA 3X23A 1IM9B 4BTBA 2IOLA 2HJ8A 3WSQL 2F37A 1DJHA 3N40P 3PGDA 3P4MB 2K8QA 4KRPB 1FPTL 4LNKA 2NXPA 4PG9B 1GGBL 1JVLA 3D6GA 4CVUA 1QR1B 4KVMA 1IJNA 1KPUB 4DUVA 3CVVA 2MHKA 4YHOH 2GABA 2CFZA 1UOVA 3NIGE 4FFVD 4XCYA 4M6MH 4BQ6A 5FO7A 3NK4A 2IEJA 1D6VH 4FKHA 2DRUA 3D3VB 1UYWL 3EH2A 3OGCB 4MZRA 2GJ6A 4G7SB 1J10A 1NOLA 4CNIA 4BZAA 2V4LA 3JYSA 1TZIA 2AJXL 1MCPL 2E7HA 3PH0C 4MRBA 2DAFA 2JJUA 2Y5QA 4MD0A 4Z7WE 3VXTA 3PRZA 4AGPA 3OPZH 3O2DL 4OQTL 4H8WC 4Y16D 2E7DA 4WJ5B 1ASPA 4HXAH 2J57A 2APBA 5HKHA 3O4LB 1SMDA 2PM7A 1OL0A 3WKPA 1P98A 3QXDA 1WDYA 2LAIA 4LSRL 5AJDA 2LXAA 4XNQA 5EU6E 4NOBA 3CTTA 4P3DB 5BNXD 1JCKA 2EUXA 2W88A 2DIWA 1R46A 1B6DA 4FNSA 4XP6H 5FA4A 3WYRA 4KDIC 4LLYB 5I8CB 4L37A 3TJEH 4OZHE 4M8UA 3T0EC 2YHEA 4CDHA 4H8PA 4LSVH 5I1DA 1RAMA 4WDIB 2CKBL 2IY0B 1OEZW 1S7XB 1G6RB 1UHVA 4PGEB 4P57A 3AEAB 3IHYA 2DJ4A 1R24A 1NCAL 3HVNA 2YEPB 1TS5A 1P7KA 3HB3C 1HAUA 1UM5L 2WNWA 1CE6A 2X4OA 1K5NB 4OM0H 3S9DB 2KC7A 3VH3B 2R61A 4N0UB 5EUKA 3JTBA 5FWQA 2OTWB 1WTLA 3DX2A 3G5VA 4XNZB 5AUIA 4N3CA 3SDCC 2R0ZL 1OAJA 3GSRB 4DRXE 3LYAA 3KS0J 2LLLA 4PPTA 4NQ0A 5HDBE 3VGHA 1VZGA 3QB2A 2VM3A 1L6VA 3K2IA 3OAUL 3RIFK 4Z3FA 5BYSA 4AKOA 4M1GL 3TG5A 1HSBA 1YEWA 2ZX7A 4KHTH 3H4HA 1J8HD 3UAJD 5A1AA 4BRVA 1LXDA 3GTNA 4ZHOA 4N2OA 3VX1A 3CN4A 3CFTA 1IL1B 1Q0XH 3GZ1A 4QTIH 5IFHH 5A40E 1K50A 1N52A 1C7TA 3WIHH 1XGYL 5EPMA 3CMMB 5DFTA 4M9OA 5CINL 4FFYL 1KTRL 4TUKH 4B6WA 3EDJA 5GRUL 1HQ4B 4NPYA 2L3ZA 2OTUA 3ABGA 3L2LA 3LQZB 1KNOA 5HVFB 3K46A 3P77B 3QCUL 3JVGA 1YJDH 3DOSB 1KLXA 2LFEA 1FZOA 5F93C 4DQOH 1IM3B 1MVUB 3L4VA 2J4XA 1O1SA 5ADPL 2FIRT 1PS3A 3CSYB 4M8RA 1QTYT 2A73A 5ALCL 5EFIA 3TO4C 1HFUA 2XBDA 5JPMB 1GOFA 5E23A 3Q5OA 4IGBC 3KPLB 3EYSH 3ZHFA 1QVOB 1SE9A 1F4XL 1JSYA 3HZVA 3QEHB 5IMMB 3RVUC 3ZUVB 2XLLA 3ULVF 4HJGB 1HQRD 4F5CE 1ZLDA 3NFNB 3IRZA 4IU2B 1KPRA 3TNMB 3G6JA 2CG2A 3WJLC 4OT1H 3NZHH 1HXMA 2Q7AA 3US9A 1AD0A 3LN4B 1NC4B 4RX4D 5CECB 5CUSH 3FS9A 2FYYB 4HULB 3FFCD 4F20A 1DQDL 4A3VA 1X5BA 1QSFE 2DTML 2ADFH 1S7VA 1K2DA 5IWLA 1Z0NA 1IAKA 3L45A 3UG5A 3BG0B 4PAZA 3OHXC 4ZZFA 3LKSA 1QSZA 4N5EC 2NZIA 1D2PA 1RZKC 2J1YA 4D0CA 3LTVA 1Z5YD 2YFOA 3AM8A 4QRPE 5HYQB 4FC3E 5J13B 5KVEE 3VXME 2DL2A 1ML0A 4AI7A 3Q3JA 1ADQA 1FFQA 2QDFA 5FDWA 2IGFH 3OTTA 1KN2H 3DEPA 4XWWA 1DLHB 2DWDA 5HY9A 1WAAF 3CVBA 5DPWA 3BQOA 2WNXA 3O41A 5IQ7H 4HI8A 2V2XB 3OKMA 2AJYH 4LARH 3VFOA 3OKLA 2IO1B 3D9OA 1EXHA 4ODHL 5E5RB 1ZVYA 4L29B 2AAVA 3V5DB 2ZCBA 3LJ3A 3CSFA 2J5WA 5A6IA 3BPOB 1OCZE 3L5JA 3QUXD 2QELA 4F8CB 4OZGA 4EECA 3E38A 1BZ7B 1KIRA 2VN7A 2GIMA 3VQ2C 4OD2A 4GTOA 2EIZB 3MRMA 1MFAH 4I5BB 1DBAH 5DJ6B 1LEIB 2LOEA 1HXYD 4JN2B 3LKUA 2WM9A 1NLDL 3FB7A 2HTHA 4ZO6A 2EYTA 5BZDA 4XRCB 1IQUA 4HOZA 1UA6H 3FN0L 2I85A 3L3HA 1CD9B 1O1TA 1EAPB 4NM8H 5EDSA 3O6KL 3OAYK 4JY5H 3MC0B 2Q1EA 4Y5XA 4CSSA 3FHAA 4CN4A 4XH2B 1FNSL 2WTRA 4FD0A 1X5FA 4HJTA 3WD5H 5INDB 4AGQA 1TKEA 3HE7D 2CKNA 4FFZA 4Y1AD 2HMIC 2E9BA 2CLRB 1CJEA 1NUNB 1FXIA 4OLUH 1RU9L 1EV2E 3FRUB 1IBFA 3QEQA 5EO9A 4D7PA 1ZU2A 3O9WB 4I4WB 4PCYA 1HO8A 1NGXB 2DW5A 4M62H 2YA0A 4H0HB 2DWYA 2XHNA 1AZCA 4KNUA 2WDVB 1H2TC 1XX9C 4FQCH 2SEBD 2IF7A 2NY7L 2QLVB 3U6RA 2WCPA 1C1EH 1MI5A 2UYLB 5D4HA 3DDCB 1OLZA 4MMYA 2ATKA 4UV7L 3M45A 2QC8A 4FU3A 2OMYB 5IFAH 4XI0A 1P7EA 3L4CA 3EF4A 4JB9H 4G6FB 3KVDD 1U91A 3HC0B 1A64A 5T5FA 3SHQA 2K8MA 4FG6D 3FMGL 5IEHB 2M26A 4ODUB 4IUMB 1GGTA 4X5PA 3SY0B 3WAJA 4I1AA 1JV5B 4I6PA 2IG2H 5IEKA 2WPVA 2YPVH 2DWSA 3OF6D 3VE0A 3L13A 4F1ZA 3HNSH 4QHLA 2OKMA 2R2EB 4R4BA 3I3DA 4YZWA 3KZ8A 2ICWJ 4Y8DC 2C4XA 1ESOA 4S1QL 1H6FA 2WO3B 2VITA 1Z9SA 3FRPA 1UM4H 5MERB 2BMKB 2BLFA 1J9SA 2OSWA 3VXRD 4MCYA 1A6ZB 3V6OE 4JHAH 2FD6H 5LLIA 2C34A 1BSIA 3K8MA 4OJFL 1DVFD 1EU4A 3IFNH 4XXWA 3LCAA 4YE4H 2IDCA 1UXWA 2WLLA 3QDGA 1UENA 4PJIF 4ARIA 1DLFH 3PGFL 4JD2G 2WX1A 1B90A 4N1HB 3N1YC 1BVKA 4ZZKA 3DQVA 5AAWC 2MRIA 1KF6B 4JAMB 3FUIA 3L1FA 5BNWA 3D69B 3LXAA 2ZF8A 2YGVA 4HPPA 2QVFB 4JFFD 4HCRA 2IWKA 3EYOB 5CEYA 2QV4A 5TK2A 4NHCL 3D12B 3ZR5A 5JOPE 4KKJA 2WWMD 3EFDL 3P1VA 1WYGA 2MNWA 5KCMA 4KZDL 3OZ9L 5GS1B 2VDNB 1SMOA 5KANI 2BNQD 3GJFH 3RVWC 1WGGA 4BDVA 2FLMA 4P3CL 1DQJB 1AIZA 1OE2A 4LK4A 3MNVB 2VE6A 2Q76A 5DK0A 4C83A 4DT2A 1MW2A 3B7RL 5FZSA 1FVDA 4NRYB 1HTOA 3TAXA 1A3RL 1HI6B 1UFUA 1HCFX 2QEJA 2CQVA 3GKZA 5DEGA 3R2TA 1TXKA 1EO8L 3A4AA 3GBEA 3MJ9L 4P23C 4UIMB 2WXLA 4BKLB 4ANXA 1RIVL 4LDTD 1J1XL 1T21B 2DL9A 1QLFA 1CI3M 4UQYA 4MJ4A 1L5JA 4MBGA 4I88A 1MVYA 2IXQA 3VI4B 3KAEA 1HHIB 2F61A 5F8RC 3V5HA 3ESMA 4RRPA 5LAXA 2ARJA 5DJAB 3BEWA 3NFSH 5HG2A 2IAMC 2KMMA 1J1PL 4GXUN 1EX0A 1YEHH 4I89A 3FEXA 1GY1A 2PR4H 4UT6H 2LHDA 3KPQA 1MPAH 3DVIA 3L0WB 5EEYA 2QFPA 4Y19D 5DWPA 2XICA 3F6JA 3LQAC 1GYAA 4WJNA 3ZKMD 4LK0M 1U2HA 2Z1PA 1L6XA 2BQQA 2BVYA 5HHOA 2WBWB 1AQKH 2ZKHH 3VM7A 3Q9NC 1QFPA 2G0LA 4FXGC 5IMKA 3G2WA 2NY3D 5CD5C 1MFBH 3CMOH 5D2NA 3BIID 2ZW0A 1Y6MR 5DRZA 3RWGB 4AS1A 3CKBA 1DZ0A 1PZAA 4IDJH 5JNYB 4F15C 2UY7A 2QBWA 4UV4H 2XFGB 3AT0A 2O1AA 4MTMA 5GSRB 4TXPA 2PPFA 4TVPD 4X8JB 2Z93B 4XPFH 1FFVA 1FVCB 1P4IH 1RMFL 2GBUA 2WINB 3KLSA 3SGKA 2Z31B 1SE3A 3RVVD 1Z5LA 4MJSA 1NOAA 5E1QA 1DVXA 4HF5H 4MJ5B 4U6XB 4RZCA 4R84A 1U8QA 2I26N 3IETA 2GLSA 4Y5YB 1KV7A 3M88A 4ZX3A 3GHBL 3CH8A 4QXUL 2XWTA 1DDHB 5JXAL 3AUVA 4GZCA 4HORA 3QUYB 5FUCC 4XIFA 3HE6D 3B95A 5B1CA 4S0RA 4YX2H 3RB7A 1J0YA 3PAYA 4HZAA 2DQGH 2BVOB 1IC4L 1AN8A 2CCLA 1KJ2H 3I6KB 4NYLB 1RM6C 4YFDB 3FZUD 3H8NA 2J20A 1ZTMA 2FJGA 5E56A 2R17C 4FNRA 5AWNH 1TENA 2IF4A 2B2XH 3RIAK 3CVUA 3Q13A 4LNIA 1A9EA 3T09A 4BFFA 2JJTC 2R2QA 2V5YA 4EI5A 2EVIA 3M7FB 4QRTB 4PY7B 2ITCA 3CX5J 4JE4B 2L9BA 1CU4L 3ASNE 2CJTA 2PW1A 4OQTA 4WO4A 4FQHA 4I0CC 2PE6B 3OC5A 3DI2B 3RKVA 3ME0A 1KTJA 3GUTB 4G26A 2IAND 2LU4A 1OF0A 2E0PA 4GRLA 3L95B 5LN4A 2NY6C 3MV7E 2VXQL 1BMWA 1IM9A 5D96B 2F7OA 1ZLUH 2KPNA 4DEUA 1J12A 1CDJA 2LTQC 3LH2L 1RJCA 4PVMA 1F8TL 5ACLA 3P4MA 2WU2B 3NIDF 4HWEH 3P63A 4PG9A 2Q3XA 1EF5A 2VLRD 2KC0A 5C08E