5T8IA

Pi3kdelta in complex with the inhibitor gs-9901
Total Genus 240
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
240
sequence length
916
structure length
808
Chain Sequence
VKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNLWSLEQPFSIELIEGRKVNAMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVCPIAWANLMLFDYKDQLKTGERCLYMWPSVLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELLREILEYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Discovery of GS-9901: A Potent, Selective and Metabolically Stable Inhibitor of PI3Kd
rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
molecule keywords Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic sub
total genus 240
structure length 808
sequence length 916
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2016-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 5t8iA05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5t8iA01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 5t8iA03
3.10.20.760 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5t8iA02
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 5t8iA04
1TJXA 2CHDA 2V4LA 3PFQA 5CCHE 4PS3A 1WFMA 4KZCA 4L1BA 3TL5A 4KZ0A 2KI6A 3FBKA 4FHKA 4F92B 1DJZA 4JPSA 3PRZA 2UZPA 3QR1A 4EZKA 4BGDA 2WXIA 4PS7A 2JQZA 3JZYA 3ZW3A 3QR0A 4UWKA 1A25A 3HIZA 4UWHA 5G2NA 4DK5A 1DJWA 3LJ3A 1DJXA 3B7YA 3F05A 2EP6A 1RSYA 1E8WA 1K5WA 2YRBA 3PREA 4LCVA 1BCIA 4Y1TA 3PYCA 4NP9A 2CM5A 1DJYA 4QJ5B 2RD0A 3DBSA 4QJ3B 2WXPA 4Y1SA 4OYSA 2Q0ZX 4ANUA 2WXOA 4XX5A 3OHMB 4LDCA 1DJIA 2QZQA 2Z0UA 2CJTA 1CJYA 4TUUA 2X6IA 3M7FB 3ML8A 4F91B 2WXMA 3SD5A 3F00A 2QZ5A 4OVUA 2WXJA 4MJJA 2WXLA 4XE0A 3KWTA 3QAQA 4TS6A 2R83A 2K3HA 4FJZA 4HLEA 1W15A 3ML9A 4GNKB 3HN8A 1V27A 1RLWA 2B3RA 2CJSA 4IQHA 4FHJA 3FDWA 2YOAA 5KJ7E 5G55A 4F93B 3L9BA 3L4CA 2LHAA 4EZLA 2ISDA 4ANVA 3S2AA 1E7VA 4FADA 3PS6A 4GB9A 3QJZA 2WXKA 3R7RA 2X6FA 1DJHA 2BWQA 3CSTA 1WFJA 1YRKA 3QK0A 3ZIMA 4ANXA 4PS8A 3HHMA 3NZUA 2X38A 4UWGA 3W56A 1UGKA 2WXHA 4L2YA 4J6IA 1E90A 4QAMB 4WWOA 3NZSA 2X6KA 4ANWA 1E7UA 4V11A 1W16A 3MJWA 3RPBA 4UWLA 2Q3XA 4WWNA 1UOWA 2D8KA 3P2BA 3NSJA 2WXNA 3N5AA 4NPJA 3GPEA 3KWUA 4FLHA 2I9CA 3IHYA 4URKA 3CSFA 3F04A 3IBEA 4NS0A 3W57A 4UWFA 3L13A 4XZ4A 5JHBA 2NCEA 2NQ3A 1QASA 4KITB 3OAWA 4AJWA 4PH4B 1DSYA 2DMHA 4ICXA 3TWYA 5CCGE 2X6HA 3APFA 3IM1A 4LT7A 4A55A 2CHXA 3QARA 4L23A 2WXRA 2ENPA 4F1SA 4EZJA 4IHBA 3L17A 1UOVA 2K8MA 3LS8A 3TJPA 2CHWA 3ENEA 3L16A 3ZVVA 2DMGA 3F01A 4OVVA 1BYNA 2CM6A 3T8MA 4QJ4B 2NSQA 5ANLA 3L08A 3R7QA 4FULA 1BDYA 4G11A 3APDA 5JHAA 4HVBA 2A4ZA 5ENNA 2N1TE 2WXFA 1DQVA 1GMIA 2CHZA 2Y3AA 1E8XA 4WEEA 5EDSA 5T8IA 4FJYA 1TJMA 5H4YA 4DNLA 5CCJA 2ENQA 1E8YA 2ENJA 4ICWA 1DJGA 2A5UA 5H4ZA 1E8ZA 3L54A 4WWPA 2FJUB 3APCA 4NPKA 2FK9A 3RDJA 4BFRA 4FA6A 2WXQA 2K45A 2ZKMX 1HE8A 2X6JA 4WAFA 2WXGA 3DPDA 4TV3A 1QATA 1RH8A 2K4AA 1CJAA 4L1LA 4AOFA
chains in the Genus database with same CATH superfamily
1S7TB 2C9PA 4XGZB 5KYYA 3VD5A 4OGAD 2FULA 4C56B 4Y19D 2GBRA 4QUOA 3WAJA 1MFCL 3L95A 3TOPA 1YEWA 3EJCA 1Z6TA 3F83A 3U48A 3ONKA 5IVXF 2DH3A 2NLJB 3HXDA 4WFGD 5BZDA 4J5VA 3TIXA 4J27A 3QRGL 4HUVA 1ZCRA 1OY3B 1DFBH 3LYYA 5IFJA 2EINE 4ISVA 4HK3J 4YHNA 2EXWD 4X4KA 2P26A 2D9CA 3OD3A 4DKDC 2KWUB 4WJOA 2OFQA 2P58C 1C16B 2GBVA 3VD1A 5DI8A 3MCG1 2R7EA 2AW6A 3IFLH 4YFLI 1Z5LA 1DO6A 1MYOA 3SKJL 3JVFC 3UP1A 3Q75A 3IDJB 4JPKL 1OOAA 2WUBL 3VMOA 3RVTC 1ZGLA 3WL9A 2LUEA 4H1LB 2AABH 4IDIA 3EYOA 1EEZA 3SDDD 1YMPA 2J5LC 2YMOA 3Q8BA 1TNMA 1CYWA 4XI9A 1T6BX 3L2NA 3DVNA 3L3JA 4FC3E 2RSUA 4ELME 5GZNA 1KB9K 2VM9A 5BRZB 4MEMA 4AYID 4WCYH 2PL2A 3W11C 3CDCA 1HZ4A 2E27L 2C9XA 2Y5EA 3IB4A 1IARB 4KC3B 4NM4H 4E9QA 1OXJA 3OJ3A 3A6CH 3PS6A 4R7DA 1I9IL 3Q43A 2KLSA 2XWCA 4G72B 4PS8A 3M88A 2XXFA 2FWSA 4QYAA 2Q8AH 12E8L 3GJEA 3DETC 4Y5XC 2A6IA 4ODVL 1KELH 4L1HA 4GUQA 1AD0A 1FXIA 4UTAL 3RCZA 1H5BA 1MQKL 2BJML 3T3PB 4C4VA 3CNKA 4Z0XB 3B8SA 5EX3A 2GJJA 4UWLA 1IM3D 3QUMB 4OW6A 1RK7A 4QHKI 1AWCB 3QNXA 1JZJA 3LCYA 4W9LA 3HNTH 3CDGB 2LGIA 1P69B 3BQUB 3GSRB 2EYRB 2Z93A 4MSQB 4OZHE 3NP4A 1CR9H 3RNAC 2RCSH 1UQSA 5FGCE 3OJMB 3C08H 5D7KE 5IBLC 2GTZB 3JXJA 4IM8A 1R5WB 3ESLA 4CDMA 3C60C 5DMKA 3WENA 3L17A 5EILA 4P2QD 4UNUA 3ZU8A 1MWAH 3MV7B 1TYRA 3FONA 4X6DF 4XPTH 5HBBA 5BRZA 1QSED 2DYBA 5L8LB 2ARJA 2DPKA 4KHXH 4YSPA 4NAWB 2P9SG 3LEWA 2B9BA 2BDNL 1LXDA 5SWSD 3GUTB 4FTVA 3HOGA 1AXTL 3U9UB 3EC8A 3UM2A 1HEHC 1TKYA 3AEAB 2Y3AA 4LE8A 4XN2A 1O1RA 5EE9A 3FTGA 2ICEC 4HJEA 1WR6E 5D0QD 5E94B 1G43A 3HS9A 2C1PB 2DQTL 2R8SL 4HJKA 2W3SA 3H6JA 4N2EA 3OHXC 3PEUB 1N5AB 4KJPC 4XR8C 2XPGB 4TV3A 2AJUL 4PTUB 4XRCB 3ESKA 1ZB1A 4X50A 3BN9C 4NO2A 1YQBA 2D10A 3IAPA 4S1DD 1ZTXL 2FQGA 4OLYH 5IB3A 2JJUA 4EMZA 4G8IB 3M1CA 4LOFA 3RWHA 3ABMB 5CBAB 2CR5A 2DS4A 1X5AA 3ZNHB 4UWHA 2GPZA 2LU5A 4H4NA 3AS1A 2BFVL 1MRDL 3KCWA 1K3ZA 3OJDA 5HGHB 5FUOL 5I75B 1B2YA 5IMOB 1SQMA 3QXDA 5DS8A 1HILA 3KLAB 3PCYA 3OGCB 5A40E 2IDSA 3LHPH 1TIFA 4PGCB 3ZDXB 3FAXA 5DT1L 5I1LA 3I9V1 3FB7B 2OKMA 2AXGB 3CN0A 3IKKA 2FSEB 4DP8X 5DMGD 2A0LC 2BNUA 4BFFA 5A6CA 2CD0A 2PWGA 2BY3A 4FABL 1T0MB 3PSEB 2H32B 1S64A 4KI1A 4BKSC 3D34A 7TAAA 4HCFA 2WLJA 1NCHA 4ELDA 4DZBA 4GRLC 3STBA 1RLWA 3MRDA 3NIDF 4U7EB 2F15A 3K5RA 2C9UA 3GMQB 5CN2A 3CK7A 3RVXC 1IGCL 3WGUB 1UZ6E 2I25N 2JKNA 3MRJB 4XC3L 3TNNA 3O6LL 3QJVB 5FV2A 4U8VD 2CKBL 4K0OA 4RBPK 3JWNE 3MGTB 5J12C 2GC7C 1HOEA 4I18B 4C56E 4YDLB 3DMMB 3L3GB 3D25B 3RBSA 3OPZH 1TCMA 2A74A 3WTTA 4N9GA 4LLGM 5EZLB 3ARQA 4UZSA 3VNYA 1Q0XL 1C5CL 3O6KH 5EYPF 2RAMA 5DUPL 1NVID 2BBCA 4YUEH 1QA9A 1JAEA 3P73A 4ZX3A 1WCQA 3GBDA 5JYLA 2NW3B 3O3DA 5DYFA 1G1OA 4MZRA 5CR8A 1WZLA 4HIHA 1MPAL 2O6EA 2I9CA 1G7IA 4N0RA 4NLAA 4OTXL 2ZYSA 4F7PA 4ZYKA 2X2UA 2BHYA 1JCVA 1SXNA 4ILIA 3K1DA 3O3AB 4L8CA 1HAWA 1VDVA 2EIDA 3KXFE 1JZ4A 5AZ2L 3TA3A 1NDMA 3F5WA 3SPHA 2V5TA 4X9FA 3S5LB 1PGRB 1U2HA 3FQ4A 4WHCA 1DR9A 1XNFA 3OGOE 3TAXA 5GGVY 1AN8A 4TXVB 4YAQB 4M5YL 5B38G 2WKLA 4AEHL 3L82A 4N0YH 2H2PD 1WT5A 4XP5H 5JTWA 4U49A 2XCBA 1HHGA 1JHKH 1A4CA 3EUB2 3PWVA 4E41A 4XPAH 5DJCA 2ZT9C 1IGMH 3V05A 5AUKA 2R29A 4ZHPA 3L3GA 1N0LA 1SMDA 3MYJA 2IPKB 1ZE3C 1ZLDA 2ICWI 4PTTB 5L8KB 5TK4A 1L4DB 2OMWA 3BN3B 4KRMB 3P1VA 4Y89A 4XP5L 1VZGA 1J1PH 3AS2A 2OV8A 3HG4A 1AIFA 4LSSH 1W72H 3S7FA 4R90L 4YHKL 3D9PA 1WZKA 1FZOB 1H4RA 4H8QA 5ICYA 1QYGL 5HDLA 1RUQL 2WD0A 3G08A 4PJ7F 4W6YB 2PTUA 5JORB 2O26U 4XXCA 5F9JB 1SXBA 3FC4A 4M56A 1X7QB 5F7DA 1EM7A 1E6OL 2E6QA 2JKWA 2OZ4L 4QHMB 3K2UH 4NO0A 3QEUB 5SV4A 5E7BA 4UI9J 4JKKA 2KO3A 5F1KC 4BKLB 3L4VA 4II2B 3D8MA 2H6PB 1TS2A 2QGBA 3P11L 1JPLA 5K93A 4HOMA 2WYZA 3MO1A 5DO2D 1X9RA 1N5XA 1ZXIA 5DC0A 2LGSA 3LNHA 2PR4L 1BUIC 1CE1L 2DWDA 5FOJA 4BZ2A 2HTKD 5T1LD 5FFLA 2P9LG 5K69A 1GGTA 3QEHB 2R69A 3FRUA 1FNVA 3T0DA 4QXGL 1NGZB 5ISZE 1E4XH 1A7OL 3UZEA 1C1EL 3K9IA 2Z8RA 1U3JA 2ZF9A 2WANA 1M6OA 4BEIA 3K6OA 3OPZL 2CIIB 1WFOA 4GINA 5FDWB 3QB2A 1R7SA 1F4YL 1WCBA 3NBNA 1M6UA 3HC3H 1QQDA 2B3RA 3DVGA 1SEQH 4WQMA 1KULA 1U0QA 1YNLL 3F7PC 3KW7A 4X98A 1N4QA 3VXRE 5L8JB 1TYEB 1SBSH 4U6HB 5C0CB 4A38A 3KYDD 3MZLB 2OJ1A 3BAIA 5DD1H 1E9QA 2G4DB 3QUYB 1AIFB 3IDXH 1QP1A 2HDEA 5D1ZA 1P4LB 3HJ0A 4XN8A 3WEOA 2JZPA 4P59L 5ABAA 1SEBA 2DYPA 2X3CA 4NENA 2Y1AA 2K6DB 4QHUB 4YDJA 5FHAH 4A7VA 2CJOA 1QWUA 2G4EA 4QHMA 4UDTA 3CR3A 4QCIA 2QIEB 3FUKA 1JTOA 1RJCA 3RWJB 1E2ZA 3U2SB 5T3XD 2I85A 2NOYA 4PJFA 4I6EA 4PP2B 2CLVB 2HG0A 3O41A 4NS0A 1D9KA 2CUHA 3PDOB 4X6DB 1YYMH 4LEXL 1UVQA 1ZDVA 4HOWA 3GXMA 4ZUUA 1DSYA 4HWUA 5FTPA 1BD2A 4N2MA 3FILB 1FRGH 3MRCB 4IBZA 3UC2A 2ARJB 4CN4A 1H6EA 5G04J 3D2UB 3B4NA 4KZEH 4YDOA 1X6LA 1I1FA 3GIZL 4O4YH 3LZFH 3OX8A 3OF6A 2BYVE 3VRBB 2DHZA 4GSWA 3HG1D 1ZE3H 1I8MB 3K2KA 3CCHA 1QAWA 4NZTL 3SYOA 1AGBA 4LLVB 5GJTL 2MJEA 1J10A 1G4RA 1AP7A 2W0KA 3GXFA 2EIJB 2EEFA 4LCWD 3CXHJ 1TUPA 3V0JA 4DK3A 2XC8A 2A9DA 4MLSA 1CD9B 2W54A 4K71B 1JF5A 1G7QB 5FYKH 1N0XL 3D33A 4AMXA 4KDWA 2X9ZA 1I85C 4ZPTB 2MCNB 1KCLA 1CXKA 1YNTE 3SCMD 3R3MA 1MCWM 3WANA 4F7MB 1DQQB 2R0LL 3UTZB 5IB5A 1RUKH 4LCDE 3ECVA 1NFKA 2BDNH 1H0AA 2Y5TB 3DRQB 1BZ9A 2ADJA 3H9HA 1P7QA 3EHBB 2WNKA 2ICIA 4R3SB 4UBDC 4S17A 1HL5A 1HX0A 1L6PA 3NCCB 2X0VA 2DQHL 2YZ8A 1BMZA 3MNWA 4LRZA 2B16A 2OMZA 2ARWA 5F7KC 4ZAKD 1HCFX 2DBYA 5TDOA 2Z4TA 3Q13A 3L45A 1BAGA 1XSIA 3MN8A 5CCKL 4LLMB 1RAMA 4L5FE 2BSCA 3S7JA 3RNKA 2JB6B 2NUPB 3ZU7B 4U63A 4MLIA 5IQ9B 1HYSC 3TWQA 3CQQA 1FXAA 5H92C 2AWIA 1T4KB 5EF3A 3AU0A 3L7FB 1A3RH 2VW7A 3M46A 3CCHB 3IU3A 2O5YH 4C00A 3F7YA 4D3CH 5E8NA 4M4RB 4OBRA 1DVPA 3W0WD 5AIJA 1U8PA 3TFBA 1CFNA 1K8IB 2H6GA 5FF6B 4QKTA 1F8TL 1S7RA 3WJMB 3NAWA 3PZ7A 2IBBA 2PPHA 3HMWL 4Z8FH 3ZL1A 4DKTA 2JUOA 3QDGE 3P4QB 4PV1C 2NZ9D 3LS5H 4LVOB 1RZPA 2VJ0A 4HFWA 4PP1D 3W0WB 3GXDA 3BUQA 4N2SA 5AB1A 4Z7QB 3QQ4B 2K0RA 2GITB 1HNGA 2W60A 4WCYL 2EDEA 3N9GL 4XVTH 2CBMA 3BFOA 4N8CL 3WL9B 1HZKA 2ZXEB 4RZCB 4TNVF 3PVLA 3HUJA 1C9FA 1M7IA 3CDZA 4XOAA 1WDAA 4PJXB 4OH2A 3AM8C 1TO4A 4J3OF 4JDZA 3H9SD 2LW3A 2NUPA 2J1WA 2W95A 5D1XB 4JANA 4BH8B 2DYSB 3QORD 4J3TA 3SKJH 3VQ2C 3T1WA 1UBQA 3NJJA 4ZZKA 2N9KA 5G4MA 4OIFA 2GRIA 4JPIA 4H2CA 4MS8C 2K4WA 3NH7H 4QRBA 5BRZE 3PLYA 4PHXA 4PCTA 1KJMB 3RVTD 3VWJD 5GRUL 1FHNA 3GNMH 3SBWC 1DVTA 4GKNA 4A3VA 2E9GA 2KLRA 2B3IA 1C9SA 3VXSB 3KJ6L 4N3UA 2VLKA 1SXZA 2ICWJ 3CMOL 3LPOA 3OKLA 3UMVA 4I1RA 4I85A 4I3SH 2GAZA 4GTTA 1WGDA 3TVMA 2EYRA 2ZQKA 5EEVA 1P6FA 4L0ZA 4HRNA 4FEIA 5AJDA 1SDAB 1G6RH 1N62A 2AXWA 2CUAA 1E8YA 2YA1A 5DVKA 1KJ2B 1AQDA 5EU6E 5FUZL 3IJEB 4KTDL 3WUWA 2CK0H 5BMFH 1OAKH 1XH3B 4Q6IB 2VT0A 1FZJB 1YLBB 5IROC 4YXHL 1TY2A 2VLKD 5C9KA 3OM3B 3VD4A 3AM8A 2P45B 2K4AA 3HZYB 1OZTG 3K5SA 4L37A 3KYOA 1LP9E 2CPCA 3OZKA 4OGXL 3UABA 2ZP0T 5T1LA 3LPPA 4IWOA 2XUWA 3GUTA 4YBQC 3LOWA 4RISH 5DHVA 4JPWL 4AQ7A 2IAMC 4QTIH 4ZXBA 4XTRD 1NEPA 3RP1A 3EHVA 3MUY1 4HEPA 4MJID 4Y16C 4HS2A 2K6YA 2VZUA 3ASNB 1JRHI 2YLKA 1IM3A 1QPKA 1MHPH 1P9MC 5J0BA 4TMAB 3N55A 3BXNB 2DWDB 3NCJL 3Q2VA 2Z64C 4M61B 4Y9GA 2WLIA 1MRCL 2XJKA 4ZRKA 3C5SA 5DLMH 3DHHC 3TF4A 3NABH 4Q6YA 1E4KC 4LKCA 3IGAB 3MX3A 4X57B 3RFZC 3VI3A 4MA7L 2FGWL 3GMNB 1T0PB 2VXVL 4MNHB 3BKYL 5CEYB 4N2NA 5HY9A 3W9CB 3BVGA 4PJDB 4RAVB 4APQB 1AH1A 3MRMA 4X7TB 4FQXB 5I1JL 2IMNA 4Y5YA 3FKUS 2JX5A 1GW0A 1V10A 1UEMA 4OLWH 2F0CA 1AG6A 5EB9A 1TN8A 5JMOC 4XPFL 3MLPA 5DRXB 1TBEA 3SDLC 3DBHB 3NPZB 4HIEA 2YQBA 4HJ1A 3TU6A 1VFAA 5LAPA 1KCUH 4MA3B 3TFKD 1ZIBA 3C9NA 5H94B 4OZ4A 1GCYA 5B1AB 5E1AB 1OTUD 1RZKC 1A6AB 2KS0A 2XZAL 3H0TB 1W9XA 5E4EB 4BE5A 4LLDA 2X4PA 4TUMA 1NIEA 3NCWA 1ACZA 3A1QB 3CSBA 3E34A 1TNNA 5EN2B 4Y2OA 3TO4A 4AGNA 2ASQA 5CGMA 2OVFA 4HFUH 1CXHA 3AEBB 1AKPA 3BVNA 2EXYC 3T6XA 3V9FA 4JQXA 5T4YA 2DMCA 1PZSA 4KPHL 5HI7A 4G6FB 4F7ZA 2WN2A 4N5QA 1I9JH 1R3IL 1CDGA 1BD2B 2HTLD 4M29A 2BX5A 3KXFA 1OO2A 2R2HB 1GHFH 3QUHA 4PFEA 5F6IB 2FCBA 2BVPB 3GMNA 1RW2A 1DNPA 4JEUA 2GW5A 1U3HB 4P3DB 2O5ZL 3FQ2A 3V31A 3HNSH 5IVXB 2D3JA 3BG0B 1IMHC 3L7EB 3KPRD 1QPPA 4LNOA 5HVGB 1CLVA 1BQHA 2CHWA 3G5XB 4E68A 3F01A 3P4OB 2DQFA 2JNZA 5JIPA 1OM3H 2BKRB 1B9ZA 2PYEB 3PRPB 2VLLB 4HK2A 1G7QA 2DI7A 2VDNH 1FF5A 3MLVL 4GO8A 3LTVA 2HLEB 2FGZA 2B4CC 1WD8A 1U8LB 1N19A 3A1QA 5D7LD 4UQEA 3VACA 4FNUA 3DBRB 15C8L 1U91B 2VITA 2UY7A 1GHFL 3LRMA 3HUIA 2LOEA 1P7QB 1I31A 2RALA 4AUUA 2WXQA 4OV5A 2X6JA 3LDBC 3SE6A 4HGMA 1RH8A 1TMQA 3MVSA 1TJXA 1JHTA 4X6FB 2JH2A 2PM6A 1XGPB 2QVTA 4OJEH 3SGJA 3KXFB 3VVWB 2ZKYA 4MNQA 3K4AA 5E6UB 1QI5A 2OZNA 4NRZA 4NRYB 3UGEA 3UTOA 2CLZB 1HNYA 5E03A 4PWJA 2J8UB 3OKOA 3EDTB 1VENA 2EYSA 2MOVA 1AYRA 2X7LA 1FYHB 3FYEB 1HI6A 3GBNH 4J6RH 3WIFA 5JW4R 4KX8A 4AK1A 1TZIB 2IOOA 1T7ZA 2UY1B 4LHQB 5E6ID 2RDGA 1JPEA 1V5JA 1XL4A 3VGBA 4PWHA 2EJ1A 4I77H 4ANUA 1ZT7B 2EUVA 2NNCA 4WGKA 4NKMA 2JQAA 3Q15A 1CL7L 4G9FD 5CEXA 3LN4B 4BQ9A 1FDLL 2A83A 2ZJSL 3H6NA 3HZVA 2KDBA 3EF4A 5F9JA 5ESAA 3D4YA 2I24N 3VXRA 3F12B 5GQBA 3EIQC 2FGWH 4LCTA 3HS0C 4PU2A 1G9NC 3L3OC 3QWNA 4JRXE 4TQEH 1LJMA 5GS3A 4LKXB 3FUMA 5GIRB 1CK1A 2L6JA 4IIQB 5EE3A 1KMGA 1YY8B 3Q8CA 1R47A 4IJTA 5DLML 1SVZA 3E2HC 2EH8H 3BAYA 4PY7B 3HZMB 2DJSA 3RZCD 4YDZA 1NTDA 4AQ1C 3T3MB 4DEPC 5AW9B 3G9AB 1Y56A 1OARH 4XO3A 3CVVA 1KC5H 4HCRH 4R26L 3SGJC 2EDDA 2H8PB 3I75A 4UIKL 5CIPB 5EH1A 3VTTA 1GZQB 2LVPA 5IG7A 5EOQL 5FWRA 4OCRL 3HB3B 4PSPA 2DZKA 1TJHH 1HH6B 1JV2A 2OI9B 4U6XB 4TSBL 4D0CB 2UY1A 3ZKXB 1VKXB 1NZRA 5HDQL 1VRAB 3U9PL 1T83C 2CO6B 2J55A 3KW8A 1HHKA 4MB3A 2D3GA 4J0UA 4PI0A 4QRRB 1KJMA 4OGYL 4J12A 2FWUA 4NYLA 4TUKL 2DI8A 1CTNA 2PVGC 4BA8A 1XF2B 4NOBA 3B56A 5ADOH 4AM0Q 3TWYA 3GHPA 3JV4B 3HZVB 2X4UB 5LBGA 5FM5O 5TF1L 4C47A 3VXRB 3DV6B 1YJDH 3AI5A 5DHMC 4W9GA 3MAWA 1JIBA 4OFYA 2X12A 3GJFK 2MCPL 4J8RB 3EU9A 4IRSD 4JB9H 3O45B 2X6VA 2KCVA 2ETAA 5BNWA 2JVCA 2DQUH 4Y16A 3WLWD 5HGGS 1VJKA 3NFPA 2KQNA 2DIEA 3HFML 3HRZB 4WLCA 3IT4B 5E6YA 4DUIA 2YBRA 1I9RH 2FH8A 1I9EA 2W94A 5GRWA 1HQRD 3MV7D 4GUCA 5HQ8A 3QG7L 1FG2A 1JPSH 4JRFA 4NZFA 1MFAH 5EF1A 3WA0A 1OP5H 4PB0L 2AKRA 4RIRA 5EUOE 4XPFH 2GY7B 3GSNB 3KEAA 3UTSB 2A6KB 4GFTB 1NC4A 2JCCA 4BZ1A 4PD4K 4UI2A 1N54A 4NNXA 1F3JB 4RX4A 3OMAB 3WD5L 1HF8A 5JA9A 4KK5D 3QI9A 4ELKB 3PUJA 3EFDH 2VXVH 3FULA 5TDNA 1TTBA 3B2UD 3L4PA 5BMIA 1JFHA 4U7KA 3ZXAC 4M93C 4ZW3A 2PE6B 3EDJA 1B9KA 4IMLB 3VQ1C 3OXLA 1P0RA 4G7QB 2AEPL 3HRAA 1Q72H 5I30H 4K9JA 3BUPA 5C07D 5I8CB 3LS5L 3PIQB 4G6JL 3S35H 5IBUG 2UYZB 5E6IC 3RG1C 5DIZA 2IBGA 4Z8FL 1FNEA 3WDIA 4RNRB 5K1NA 1OAJA 1J1OL 3BP6A 2C9RA 4FMFA 4GW1B 4N2GA 3WS3B 5BS0D 5GZOA 2Z1PA 3UX4A 3CVLA 4ZK8A 4KNQA 2D7NA 4O02L 1EO6A 4CKVX 4D3CL 3MLWH 3DSNB 4ZUTB 4FQHB 2HH0H 1CFMA 3BZDB 1KIUA 1O5DT 5KZCD 4YDVA 3E3QC 5GS0C 2LO6A 1OAUL 1LLAA 3JWDC 2PCFA 2LUHA 4JFUA 3RL2B 4OCXL 4XMLL 1RZQA 1NC4B 2B7DT 5HDWA 4GB9A 2RJMA 2KFJA 1E6JL 5E8NB 4LCCB 2X3BA 4UT6A 1PKQA 2FO8A 2NDFA 2G2RA 3L3IB 1Y6MR 5CINL 1RLFA 2VJ8A 3SDAB 1OCRB 2MCG1 4HC1L 1P6WA 3QWRA 1A1MA 3CQFA 4LL1A 4BHUA 1LDPL 4FFWD 5DVNA 1J19A 3IVKA 3RKVA 1OIOA 4HPYH 2M1MA 4AIOA 2R5SA 3RDTC 2AXJA 1JHLL 4N3CA 2VDLB 1NLBH 3A4AA 3RX7A 1ZRUA 5J1AB 4BWUA 1AD9B 1FFPB 4NPJA 4Q7DA 4HPOL 1IBBA 4QYOA 4X83A 4D8PA 4LMQE 3W57A 4G0NB 5HDOA 2YRPA 5JW4N 3WUWG 3TIEB 4XMXA 3L95B 3ATDA 2YLMA 4I1PA 3A47A 3LMJL 3TC9A 1KENH 1NFDA 1PX4A 3LKPA 2IDTA 1U8NB 5F7LB 1Q1PA 5I71B 1FH5H 1U8JB 5ADPH 4MTMA 4LNRB 3HC4H 1YZZA 1RZJL 5FO9A 2AQQA 3V4LA 5TE4L 5CM1A 5D1XA 2J57A 2IANA 3TZVD 3RWGA 2C9WB 3LKNB 4PJ8A 4NNYB 1EIBA 4PGDB 4FULA 3BGFC 4G11A 3TV3L 3PE4A 5IV2A 4KZEL 3IMVA 5FT9A 2KMWA 5TQ2L 3PZ4A 4NZDA 4GT0A 3RT3B 2XQYA 4PVMA 4BBNC 4TOYL 2FQDA 4A1GA 1A4KB 2X1WL 3TFKC 3EHRA 4LSVH 2FJHB 2Z7YA 3HE7C 3NS1A 4NRZB 3VUXA 4Y2DB 3MGBA 5CSZB 1TT6A 3TA3D 1W72A 5HGDB 4EN3D 5LQBH 2VE6A 2EYSB 5DEGB 5DS1A 2G5RA 3NN8B 2GAZB 4UB0L 1S7UB 2HE7A 2KI6A 2ZCHH 1I42A 5FHAL 5DMYA 3BW9B 4LZKA 4UV4L 4X4ZA 3ARFB 3NOIA 4Y0GA 5C6TL 5JPNA 5KVEL 2X1XR 2IGGA 1WE6A 3GB1A 4AJYV 1QFWI 3TCXA 1WX7A 3GSNH 3DVNV 2DLEA 1L9OA 1I7UA 4YDKH 1PYWA 1H5BB 1TTCA 2PLTA 3HG2A 1FZJA 4KI5E 3F2LA 4X2UA 1DVYA 2DDQH 3LKSB 4OQTL 3I9PA 1DE4A 3VX0A 3OXFA 2KD0A 2WJ7A 1FYTB 3PWUA 3L4XA 5T3XL 1E5CA 1UUNA 3UTTB 4RLDA 4MMXB 1CF8L 5EO0B 5AVRB 2EELA 3NPSC 3FT0A 1NEKB 1HHJA 2D7QA 3BQUA 4Y5XB 4IRZH 4LPYA 3U4BH 3UC0L 2Z0BA 1WTLA 3MEKA 4H1LH 3BSZH 5FYJL 2OK0H 3T1FB 2Q86A 4GCNA 3RPKA 4PT5A 1UQSB 3L9RA 3DWTA 1N6QL 2QPSA 1KY7A 1UWEL 3TO4D 4F8QA 1RUKL 4FXKC 5KVFE 3QXVA 4LVHC 5IW3A 1GZPA 2Y24A 4UT9A 4YIQA 3NA4A 3VD0A 1YN5A 5TF0A 4HOQA 4AKQA 5MEOB 3QE5A 2IOIA 1Q9OB 3OR7B 5DGRA 2R2BA 2FHBA 3L22A 3L5WB 3RQ3A 4S1SL 3QORB 3QWOA 5CJBA 4APQA 3BZEB 3DO3A 5D1XD 2G9HD 4CQNA 1JPTH 2EIKB 2AMGA 3HI6H 4MB5A 1G9NL 1N12A 5CZXD 1OQOA 1IGIL 1CQKA 2IBIB 2YKLH 3T3OA 3N0PB 1A1OA 3H1ZA 1D5BA 4J3OH 1J7CA 1E7PB 1X4XA 3VWJB 3X0WA 1NCNA 4EUPG 1D5MA 2HX9A 1DN0B 3BLPX 2MH7A 3U0WL 2ZSWB 4GO9A 3C19A 1ZA6A 4JY6B 2WAQA 3LD8B 2JRIB 5I23A 2X4PB 1QEWA 5IB3B 1GZHC 1MAKA 4ZS7H 2W0FA 3HG0A 5EU4B 5I1IH 1UG9A 1C5DB 3FU0A 1WICA 3OHXB 2IWFA 3FQRB 4CBZA 2VDLH 2F5BL 3D39D 2WKGA 4JJ5B 1ZGLP 2F53D 4IHBA 3O0RL 4X9BA 3H9SB 4NGHL 2V33A 4JFEE 4OCWH 4K3CA 1JTTA 1QFWH 5ILTH 1GZPB 3HN5A 3IPEA 4ONHA 2V3NA 3WAPA 1DVUA 4TQHA 3FB7A 2J72A 1TJIL 4HDQA 2YMXL 4U0RC 4WKXA 4QQIA 2N9EB 4N58A 4NRHB 2A4ZA 4L3EB 3VD3A 4GMTL 3FN9A 4D94A 4Z7WE 4GRWB 4XMKH 5B39G 2V2WB 4GG6A 1QFWM 3P4MA 4LCYA 4FFYA 4E9XA 5B1JA 3EJUA 1GPXA 1N6ZA 4ZW7A 4Z7OF 4MNGE 4NNXB 1BFOB 4GKOA 4AEIL 1E50A 5BZDB 5C92A 2VUOA 3CN1A 5FGCB 3G6JE 1MCRA 1F5WA 2V2XA 3BEWA 4YUEL 4K5CA 4BH7B 3Q2NA 4E42A 1KYUA 1DN0A 1NCIA 3MJ8A 5F7FA 4JFVA 3CXDH 4BGDA 1FE8H 2WO3B 3IF1A 4KUZH 3H4FA 2OMTB 1XF5A 1LWRA 3H7LA 5ICXA 2CRZA 5C0AA 1BD8A 2V5FA 4ZOHC 3LPGA 5EZLA 1LWJA 3A6BL 3QO0B 1WGKA 2WQAA 1I1YA 1HG5A 1IGCH 4PRIA 1AYOA 1JV5A 2YQGA 3P11H 4HCGA 4D9QD 4WJG3 1LK2B 3MI6A 4KVNH 2G9HB 2WXPA 4IEFA 4FG0A 3FUDA 1B2WL 1HDMB 1SHMA 3BP5A 3E6FB 5IT2H 2IH3A 2P44B 3X14B 3MBXL 1BQSA 4D9RD 2PNNA 2FJGB 1DN2A 3S3SA 1EXUA 3OKMA 4HETA 4X6CE 2O6DA 1J9CT 2J3SA 3JWNH 2EADA 2WM0A 2Z8VC 2YO3A 4ILDA 1XT9B 4LNFA 4JPQA 1S2EA 4LCWE 3WIFB 3CX5K 4GMJA 2EO7A 4BK5A 1UZXB 2X41A 3QDJD 4CT4A 4RA0C 1FNHA 1IGJB 1KACB 1DQLH 4XDDA 4PLKC 5DJAB 2QJLA 3NACH 1QSZA 4M6ML 1KGCE 2OYMA 3QAZB 3OAZH 1LXMA 3O4LD 5GS1C 3A33B 1KXQA 1KLVA 1PY9A 1AI1H 4GQ9L 3HVDA 1BMGA 5CXPA 1MRDH 2F53B 1ICTA 3E4BA 2A3TA 2C8NA 5F9OL 3GI9L 2LHEA 3AWGA 4WO4A 1M94A 1RI8A 3E37A 4L7TA 1WRFA 4H0IA 1J0KA 3C3OA 4K7PL 3E33A 2QFPA 3N85L 1MI5B 2P5EB 1WZ3A 1YMHE 4PYZA 4GIAA 5D8JL 1XZ0A 1NCGA 4JW3A 3VQLA 2YQ2A 1OEZW 4NN7C 3ASWA 1KLXA 4HOTA 4PLJD 1FZOA 3DCGA 3T0ED 2WPVA 1ZDXA 1ZUD2 3I57A 2V5RA 3FONB 3X14A 1W0VA 4L8SC 2XV6B 4APXB 1V5TA 4WNFA 5FWQA 3IM1A 3RU8L 3S5ZA 3UXFA 2N7AA 1YJ1A 5CBOA 4X99A 3VYPA 1IQDB 4X7SH 2KC7A 2KZKA 1YEEL 2UUDH 4LSRL 3RI7C 4B89A 4FFVD 3L6AA 4KY1L 2WWKT 4UU9B 5AKSA 4J8SA 2VSXE 3TXAA 1Q0XH 4GRWE 3FF8A 3WXVH 2H9GB 3Q05A 2LXLA 2ZXBA 3QUZB 3RIFK 4JZOB 4LOEA 3SY2A 5DPSA 4Y19E 4WWMA 1ZVNA 1FORH 1SW6A 1AP2B 4KJWD 3UBFA 2FSDA 4MMZC 1T1ZA 2NY6D 2YC1B 1YUHA 2EE9A 2JCWA 4LGPB 1ZGLM 4BTBA 3D08A 2GB2A 2BEDA 4IGBB 4CDNA 3L81A 2FQFA 3MRRB 4TULL 4OZCA 3DIVA 3E1ZA 3CQCB 2XIDA 3O0LA 2TAAA 1XGQA 3X13B 4ATWA 5DTFA 3PABA 3HBZA 1LE5B 1C4AA 2LAHA 3HE7D 3C09C 1CFTA 1P53A 1AE6H 3IK2A 3QG6A 4MKTA 3FL7A 3DXAA 5ABDE 1SA4A 5G5GA 2MEJB 3S3JA 3GTNA 2X1QA 1JWSD 1UM5L 4XO9A 1DJWA 3DUSA 5DT1H 1BLIA 5FW6A 4DK6A 1XO3A 2D9QB 4RGMC 2O30A 1T83A 4H88H 1E4XI 4H88L 4HS8L 5LGYA 3L3HA 2DZIA 1MCSA 1NGQH 1WAAE 4UU9A 3PPAA 4DO4A 1MVUA 4I2WA 1BVLB 4M1DH 4BXVA 1D7DA 3FB5A 2JFCA 4RSVA 3ZGIA 1UVQB 1J0HA 4MXQD 4UILL 1P98A 3AY4C 1TXKA 2Q6WB 4YIQB 1B0GB 5KZCB 2EAEA 4MDKE 4LSUH 1KXTA 1RQ5A 4IS6A 4ZMTA 5CMYA 3FTSA 3GS2A 3QZOA 3AUWB 1JZHA 3BKCL 3OX8B 4B0EA 1GC6A 1RFDL 4UI9K 4UT7L 4LCUA 2X4NB 3ETBJ 2VN3A 4GH7B 5T5FH 2EUWA 2MBQA 3EYVB 3Q6BA 2J2ZA 4N2CA 1N8ZB 4LK4A 5IMKB 3TURA 3DJ9A 2WXKA 2QPDB 3ETSA 4HD9A 1QSEA 1JPFA 2Z92A 1TKWA 4IOIB 1KTKA 1WSST 1ROWA 4GDLB 5C08B 1CUOA 5EDXA 3TM6A 4NUGL 1ECZA 4AYGA 1E90A 3OKDB 5C0GA 1S9WA 4NBYB 4IBQA 4Q8BA 5SWZB 2H32H 5ICZA 1ZTXE 2VKXA 5D2LA 3FQXA 1QEWB 4W81A 4WW2B 2XWTA 2FTAA 1CGSL 3L5IA 3GM0A 3V4PA 3A9JB 4K7FA 2V0AA 5C7ZA 3JUEA 1ADQH 2IDFA 4NJ9H 2OJZH 1NCWH 1XHHA 4TN9A 4KITB 1GC1H 2HFGL 1CR9L 5F93C 5IZ7A 1S8DB 5D96C 5BZWB 4UT7H 3KPLB 2ATPB 3B2FA 4TQPA 5KAQG 3BO8A 3OTNA 4XMZA 1NI2A 1OW0C 1SXTA 5KSAA 5KYWB 1ELRA 2ZG3A 4QGTA 4XGAB 4HU2A 1N8OE 4L4VD 3CVHB 2J7LA 3TBWA 4LBEA 1C77A 1KEML 3H3BC 3LZRA 3FO9B 2XWXA 3OC8A 3K74B 1MDTA 5JOPD 4OLVH 3S7BA 2MNUA 5DFTA 1NFDF 1G6RB 3JYSA 2KLTA 5DJCB 1ZLWK 1D6VH 2GJPA 4TSAL 4OCYH 4ODVH 4UQ9A 2EYTA 3VMPA 2GHWB 2OJEA 5HHPA 1VZIA 1K6QL 3TIEA 2VISA 1P4BH 5LXVA 3DRAA 4HMEA 2CFUA 1AI1L 1WM3A 3Q0HA 5GGQL 1MAML 2BNQB 4JHKA 1GOFA 3BWUF 4PJHA 2KTRA 4ALAC 3ARGC 3VFWB 3MRHA 3MKGA 4QXUH 5A2BA 3VE0B 1E0OB 3FFDB 4PYUA 3RFZA 2XENA 1KPUB 2IJ0C 4WSKA 5D7SL 5J1TC 1OTSC 4YHOH 2N56A 3NSXA 4JLRB 1JNLL 1MDAA 5I2IB 3GBMH 3UIYA 3U0PA 4F53A 2WBJD 1EAJA 2F54B 3PPSA 3GW4A 1AE6L 3KGTA 3LV3A 3SJVB 4B53A 1KEMH 2F8VA 2XK5B 5AW1B 1MWAB 3P02A 4O1PA 4OZGB 4TULH 1A4KA 3TPKA 1SQ2N 2BZ7A 2FB4L 3GHEL 4CU7A 5AAPA 3DBLB 3AUVA 3E9TA 1PLGL 2TSBA 3G6JF 4FN0A 2K9FB 1F90L 4FNQA 1S7XB 4PJFE 4UWQB 1MNNA 1MJ7L 4GXVH 3I9AA 3MNVB 2V5YA 4NZ8A 1H8LA 3VTXA 4H2AA 5LB1A 4BA0A 1EWHA 3ARBA 2LLNA 1D5RA 3ASOB 3D85D 3MBED 3U79A 1PC2A 1KF9B 1HQRB 4US8A 3UO8B 4HWEH 1X7TA 2C4FU 2Y2TA 3QP3A 5C0BA 5BUAA 2WXLA 4XE0A 1E9QB 1MJUL 1QKZH 2H1PH 3NQPA 3KYAA 1FNSL 3PQYB 4MMYA 4NZUH 5D1XC 1E3XA 5ACLA 1W15A 1P84K 4GW5B 1WF9A 5L4FA 4A67A 5EF2A 3QC5X 2XS1A 4YFLF 5L6YH 3ETRA 1DVSA 5E9DB 4RFNC 5EA0L 4JFZL 4WNGA 3UINC 4OJAA 1HAUA 3WNNA 3AH7A 1VADA 1DVFA 1SJMA 3MV9A 1N9AA 3OB0K 3WFHB 2YEPB 4H8WL 2E3VA 2XZDG 2Z8WC 4U4BA 1PNCA 2BWQA 4EVNA 3BKCH 4QLRA 4IRJC 4KKLD 4OF8A 2I27N 3EGDB 3QIWC 5GGTH 5MEND 1WGRA 4K7WA 3FMGH 4ANWA 1BVKB 5CLZA 4LSPH 2Y2WA 1D6EB 4NN6B 4P5KA 4OHJA 1L6UA 3S88L 1VZ7A 3MRCA 3D07A 1QYMA 4GQ9H 5KSBB 1PZDA 3I6SA 5IBLD 3QIJA 3QORA 1HCYA 1IBHA 2BM3A 3QWOB 4N2DA 3X1EA 5F0MB 4ANKA 4BYHA 1Q9KB 2X4QB 3JUZA 3T6ZA 1DC2A 4ZMAT 3QFGA 2ZIRA 2E9BA 4UTBH 3U0WH 3O3BA 3VFTB 2HAZA 5JLZB 2IMMA 3DVGY 3RZCB 4EFOA 5CZRA 2MQJA 3T9KA 5IHLB 2ZG2A 2XWZA 1EGJH 4M61A 5KSUA 3TBLD 3ZVVA 1RMFL 4M9PA 5D7LB 2GQHA 1XT5A 1KOAA 2NYYD 1AP2A 4YFDB 5KWDA 4KNSA 1S0PA 1G9NH 3OXSA 3BVDB 4WEMB 3EDEA 2YPKB 2FO1E 2CRIA 1A70A 4DOHB 4XHQA 1CCZA 5IB5B 3CSGA 2V7NA 4I5BA 2ENQA 5IB2A 1XGQB 4N9GB 4NQSA 3PABB 3T08A 1UB5A 3G6JA 2AP2A 4YTPB 1Q1JH 3VB8A 4OD2A 1JGVH 4N5UA 1TCRA 4JG5A 3ILPA 2J73A 4O58L 2WIIB 4MAUH 3D7PA 5C2BL 1MZZA 3ATBA 1SGHA 3WG7E 3MQIA 3TBVA 1LO3L 4APQC 5BVJB 1J05B 2OVBA 4GQZA 4WWID 1IC0A 3VWKD 1RIHL 4N1HB 3GT6A 1ZOYB 1YCSB 3TYGL 2DICA 4TMPA 3Q9NC 3KH0A 3NCBB 4Y4KB 5HI5D 3H7PA 3GSVB 4ZTEA 1CXEA 2KX0A 3SR6A 1I1AC 4L4TE 1G5AA 1PSKL 2APWA 4EIZC 2ZCLH 1BPVA 1MREH 4GLRH 3KLQA 5C0DA 3QQXA 4KX9A 4PJHF 1T1XA 2AXHA 1K8KG 2P9RA 5FK9A 2R17C 3N43F 3PV6A 3CVBA 3RY5A 3MUGB 3QJQB 5EU5A 3ONLA 3I5JC 2Z31B 3PDNA 4Z3HA 1UASA 3VDAA 4W9EA 3CAFA 4UV4H 4FFWC 3CFNA 2GTWA 1U8MA 4NQ0A 3LVTA 1OP3H 2WO4A 4H44C 5HI5C 1Z5SC 1IFHH 2IDYA 3C6SB 3RI5F 2R83A 3DV4B 4NGHH 2EIBA 1PQSA 2DCPA 4U1JB 1IAOB 4L29B 1IP9A 2QDFA 3WNMA 1M2VA 2NNRA 4K81A 3PNTB 3GD1C 2IJGX 2M4NA 1AGFA 3BD4A 3ZGHA 4APQD 3GLEA 1WX8A 3LSOB 4HPMB 3S2AA 1IBFA 5HYSA 4L9PA 3LY9A 1R5VA 3CBRA 3BP5B 3E6FA 2XEVA 3OMZA 4ADIA 3KPRB 5LUMA 3UJIH 4IBVA 4W9JA 3L10B 1IIIA 5B7MA 3BISA 4ZBJA 4QRTA 3QX1A 1Q0EA 4DGVL 2JI3A 5A7BA 1S5HA 1L3NA 2WINB 2NBWB 1XXFC 1UN9A 4BRVA 2UUDK 5I6XB 1T89A 1UOWA 4KUCF 1T5WB 2YS4A 4WF7A 5HJGA 3M1BB 1VB9A 1Z9SA 2NYYC 3ARDB 3MRPA 4XBMA 1SOKA 2EIJE 3IFWB 2BW5A 5CHVC 5JXVA 3TO4C 3CVHA 4NRYA 3V4VH 4RFEB 4RF0A 2XCCA 2VLKB 2G3MA 4HOSA 2E7LC 4N2OA 4ITKA 2C4XA 4GZCA 4NT6A 5FW7A 3M6DA 1IQWH 1QQDB 1EU3A 1UUSA 1TZIA 2GG1A 5CD3A 4HPYL 5LWYH 4YN3A 2NXZB 5IHHA 1GMEA 3TN0C 5CEDB 5FHBH 4WHTA 1AVAA 5JOFA 2ZUYA 4HBDA 4QRPB 1L0YB 4ME2A 1JS4A 1BDYA 1ND0B 4FFYL 3SPIA 2KCLA 3HC0A 4BK5C 2ZX5A 5B8CC 4GO6B 4PR5B 1OQYA 2VMCA 3BWZA 4JM2D 4DSYA 4XMLH 2IAMD 2VZSA 2IOSA 2JIXA 3V7MA 3W2DL 1RZGB 3S34L 3T2OA 3AG1E 3WLWC 2EDLA 2BVCA 2HH0L 2E86A 3AE6B 2N0MA 1TJIH 2LSVA 2J25A 1HINH 3GSXA 3C6LA 1O5PA 4NP4L 1NGXB 1A0QH 4W4OC 4KO9A 1KRHA 4OT1L 4DKFL 1JERA 1UJ3A 8CGTA 4N9F4 4WJNA 2JQZA 5DJXB 3IGAA 1MJJA 4A6YH 3L3OB 1KDIA 3QXAA 5ENSD 1FA4A 3LQAL 1KF6B 3PHQB 4ZRQA 1BG9A 4ALAL 2BNRA 5I30L 5HHXH 3Q44A 1NEUA 4LIQL 3JTSA 3P9MA 2VDKL 2ZYRA 4OYSA 3GJFH 3T77A 3SZ6A 5TQ2H 5KN5A 1RZJC 1U8IB 5C0BB 4ICVA 3HS8A 4BZAA 4BQ8A 1OCWL 4B41A 3RNGC 3V62A 4Z3TA 4ESKA 4NYLB 5D72L 2IVFC 2L00B 4HIEB 4AGLA 1IIKA 2EILE 2NXYC 5ECJE 1DCEA 1LO2H 1XCWA 4P2AA 4LK0M 4L5FH 5HPMA 2XT1B 1OAYH 4LEBA 1KPVA 1EJ6A 1RZGA 1D8EA 3S37L 4S1SH 1UXSB 3R06A 4ZFZB 4CC1A 5KYXA 1JPSL 1QFPA 2NNXA 2YAPA 4GTVA 3EGDA 5E2JA 3HHRB 4XO4A 5IMLB 4IOIE 4G2VA 4QNPE 4W6WB 1BVLA 4AJVA 5EC1B 3U4EA 1MCLA 3JTBA 4JEGB 1RFKA 1I1AD 4TLUA 4ZYNA 3VFRB 5HFYA 4WFHE 3GXUB 1MCPL 1NINA 1YEGL 4JAMB 4J8FA 2WXHA 2ODHA 2RA1A 3DI2B 2IF7A 4MQSB 3B2GA 2HT4D 1UWEH 1HE7A 3HFFA 4XX1G 4AL8H 4P5TC 2X6KA 4JFQA 4JB9L 4HJIA 1J8HB 4XVJL 5IEKA 4IS6B 1MX6A 1I8KA 1DANT 1IYFA 4P2QA 3QEQA 2BOCA 2R02A 1YECH 3BAXA 5LGJA 2VZVA 3ATFA 3RY4A 1AANA 1ACXA 3T4AA 1YC8A 1AR1C 3QIUA 2DDQL 4OQTH 4P2RA 4LL4A 3SJVD 4ADJA 1OD9A 3ILEA 3EYSH 2V6HA 2CJUH 3MCLL 1LEIA 4PJ9C 3KPOA 4JFDB 3I5PA 5EIDA 1J87A 2EXSA 2OS7A 3ESPA 3AECB 2I1JA 5KJRH 4F7AA 2X44D 4Y6CA 1A6ZA 1PW3A 1CICB 4A63B 2NTSP 3VI4B 2BNQD 4L9DA 3C5ZC 3NFNA 2SEBB 4UIKH 3VRAB 4LERA 4TUJA 4PRBA 3DSUA 3RSEG 3VXPA 4M93B 5EC1A 1DLFL 1MFBL 1OLLA 4AIZB 4LSVL 4LUNU 1MFEH 2K70A 5E08L 4XB7A 3UERA 2ZYIA 4IOFC 5DUBA 2NVUI 1SJHA 1FT1A 1VJSA 5IB4A 2IADA 1NC2B 4DGIH 1N68A 3AMKA 4ZMZA 1HJBC 3PWJB 2N1WA 3NT0A 3ZHLA 4MWFA 2AXUA 2ALAA 3QDME 3QH3B 4X9YA 7FABH 1GJWA 3P0YH 3CFBB 3D06A 1NBQA 4CILA 1I8KB 4TQEL 3FO9A 4AK2A 2FNWA 5HI4C 1PZ5B 5I6KA 1D9SA 1ZHBA 3HUJF 4WUKH 5CHNB 1I4PA 3ZYYX 3WDJA 4WJKB 1JPST 2CHDA 2V4LA 2DKUA 1EEQA 2L76A 2J49A 3AS4A 1E4JA 2OJEB 3SE8H 1N4RA 1HXMB 1RZJH 2AJVL 3ZQXA 1CL7H 4QRSA 1H8OA 4P2RB 3NY5A 1OQRA 5C0DB 4XNYL 3QYCA 4KMQA 3PE9A 4NKMB 2RDHA 1LF8A 3FJTA 4D2KA 1E8WA 4B8AA 5ETUB 4UOZA 4M43H 3WTXA 3MRFA 4IMKA 4IOSD 1CFSA 2R59A 5DA0B 2EE6A 2MFNA 1FSKC 4IRSC 4BSWA 2QFCA 1JRHH 1IC5H 4MH8A 3IJSA 3OKLB 3ATAA 2IPTH 4JGJA 4PJ5D 5DHVH 4NWTL 2FEDD 3EH4B 3ZUNC 4MRCA 4Z7AA 1QBLH 2BSSB 3M7FB 2F74A 2D7TH 5C0FB 2IY1B 2DOCA 1MH5B 1K3IA 1RIUH 2ZNXA 5F8QC 5T3XE 2K8HA 4A2DA 4F8LA 2BKGA 4XP1L 4L4TA 1W3BA 1AKJA 4MNGB 3QNFA 3DOSA 3RWIA 4YHYC 2BCKB 1XR8A 3VXNB 2NY5L 1UM6H 3GMMA 4L8BB 5F89A 4U1GC 2EVIA 5DRZA 4GDKB 1E6EB 5EZOL 4KVGB 1E7VA 3ZE0B 4DGYL 5DJYA 4ORGA 5EEWA 4OF7A 5FW8A 2QV4A 4F7EB 3MLVH 2G60H 4F7CB 3C2SA 1A1NB 2FWOA 4H5SA 1KM7A 1UH4A 4EBAG 2R9HD 4ODXB 4II3B 2CG2A 2ITDB 1PGAA 2P3YA 4KJWC 5DRWB 4Z0XA 3UO1H 2OYPA 4WIPA 5F1NB 4Z7UB 4WU7A 2K39A 2DAVA 3L9YA 4QO1B 3VH4B 1RSFA 4L0PB 5I16A 4D9QE 3JV6A 5KBLA 2YEZA 5CMAA 5IF0A 2LV4A 2WUCL 3CDGA 3GWJA 2CDFB 5DEGA 3MV2B 1QBQA 1FZKB 2QVMA 4IDLA 4N2IA 5HY9B 2WBXA 5AUMA 3BDBA 5IJKA 2AQTA 3IDIA 1TVBA 3BFQG 3DX7A 5A7DB 3BIBX 3DX0A 4FERA 5C09E 3ORJA 4JY4A 1N0RA 5D7LE 3ZUVB 5H35B 4AY0A 1KTCA 2E9WA 3V2OA 1BVKA 2EINB 3QJSB 2Z91B 1KLGB 5E23A 4RRPM 3VRIB 2YJQA 4YBQD 3N42F 5E99L 1BM3L 1EHLL 1X5BA 3UMTA 3RWIB 5D71H 2D2CC 2ZG1A 3X12A 3NCMA 3ARBD 2KZRA 4Q74A 1AFVL 4Q0XL 4ADGA 5E8DL 2XLLA 4HZLA 3J2PA 4TYUA 3VCLA 2KN5A 4KV2A 4G71B 2CG3A 1WE7A 4LO9A 1WE5A 3S9DB 4JFFA 4PJFF 3ZMNA 1A7NH 3CH1A 2ZCCA 5IWLC 3ULUE 1S7VA 3VHTC 1XGRA 4PJ5A 1XEUA 4JGHB 5TPWL 1ID5I 2ZKMX 4ODXA 3SDXF 4AYMC 1P4UA 5TDNB 4BSVB 5KSUB 3NZ3A 5I26A 1YYLH 2OSYA 4LCWB 1BPLB 3DOHA 2IC2A 2WB1A 1CDBA 4MBOA 3FU5A 5CJ5A 4AS1A 3QFJD 3TYFA 1JZ6A 1ET7A 5E4OA 2YUXA 2H5UA 4DLQA 4JKLA 5IOPA 5DVOA 1IEAA 2LGXA 2NTTA 1JZGA 4O2EA 2DYRB 4F3VA 4PJEB 5G5DB 5TQ0L 3VYNA 2FX7H 1U21A 5F9WC 3CKBA 2VUYA 4PRDA 5D70L 3IMBA 3T3PE 3B7YA 3M95A 3CVNA 4GI8A 3FQWA 2GYSA 1U30A 3E0GA 3RKPA 3ISWA 2VMFA 4KJQD 1KLUB 4NKOA 3VXMB 5I1LB 2QGCA 1BMLC 1U36A 1NI3A 2XWDA 3UQ3A 3W1SA 2CJTA 4LAJH 5JZEB 4DBGA 4HZLB 1GY1A 1P3QU 1PGBA 2VDOL 1A7PH 1VACA 2EC9U 4X4MA 3UCRA 2MQ3A 3L1EA 2DWTA 2YSSA 2J71A 3HMXA 4L4VA 2IONA 2MOGA 2QY7A 1B89A 2A77H 4XO8A 1UJKA 4AYFA 4DZBB 4OF0A 3BY4B 3D0VB 4GUPB 5ID1B 3AU4A 2ZWNA 1HNFA 4FL4B 1XXDC 5KUMA 3I50H 2EQXA 3Q7FA 3CU7A 3JWOC 4WY7L 3DPBA 4PJ7A 1R3LA 1G6RL 3V0EA 1WFJA 3L1GA 2JKLA 3L4YA 5FKAC 3QA8A 4XMPH 2YRLA 1FNWA 5L83A 3UTTE 4J3VA 4HH8A 2D3BA 2Y7OA 3ABGA 3MJ7A 4PV9B 4NQLB 1GAQB 2WWMC 4R8WL 2UXTA 4PMFA 1HXYA 3LXCA 1N9PA 5C09B 3N5AA 1AD0B 4C4VB 4WGWB 3JUIA 2X53A 5CEXB 4WAAA 5JHBA 2JJVA 3ZFWA 1L9MA 4K3EH 5DD0L 4EOYA 4JFXA 1TPXB 2X4SB 3PWLB 4KKBD 2XTSA 4PJ8B 3GBNL 4CGTA 3IJ7A 1TNBA 4F1SA 2LD9A 1V54B 3MNDA 4BKGA 3RX5A 4JFPA 3GB7B 2JVUA 1LK2A 2GSMB 1T66C 4MZ2A 3X2QB 1CQVA 2EEBA 1Y6KR 1XH0A 3OF6D 4JQXC 5DUBB 2OL3L 2A9MH 1EDQA 1V55E 2H6HA 4N3AA 1PTZA 3I74A 4HYTB 2XN9B 2PW1B 5CJQH 2AJXL 2N1TE 5H37A 4GYYA 2A6DB 1ZKHA 4U4IA 1MHCB 3ECUA 5CZXC 2BF8B 2WSKA 2Y0BG 2VERN 4ZMXA 5JUEH 3KUDB 4PIRF 4ZUWB 3FOLA 2BQQA 1CLYH 3IE4A 5I9QB 2OCCE 3MODH 3N1GC 3V6OE 3TBSA 3EO0A 5KBMA 4MX7B 2GK2A 1JCSA 4MSWB 1F8TH 2NY3B 1WIOA 4PJEE 1PAQA 1T66D 3RU0A 1BIIB 5GXGB 2B6CA 4XI5D 4UINH 1XGTB 2BSRB 2UXFA 4OCSL 4GGQA 1N52A 2XXGA 4TNGA 4AXHA 1ND0A 4P46C 1B6DA 5ICYB 2J0KA 1WFNA 1JF6A 1PD1A 3O9WB 4NHUA 3Q9UC 3GJFB 4GG8A 4YXHH 2H3KA 4UQ2A 4R7NB 1T0OA 2BTEA 1SYSB 4M8NA 4YSQA 2MP2B 1OAKL 3NOCD 3QAZC 4BRJA 5JPMA 3ULVL 1NCJA 4BE6A 4M7KL 2BB6A 5DEJA 1JPGA 4GLSC 2XFXA 2XVBA 4E9YA 1UWGH 4U33A 1I8UA 1KCWA 1PUTA 2C9AA 4TKWA 4LL9A 1OGWA 2XZQH 1R3IH 3SPCA 1CXFA 2BVUA 2JELH 4PBDA 2Q7NA 3FSVA 3JUYA 4KPHH 3II2A 4HNAD 4NN5B 5DZVA 5MEOA 3MTNB 5KG9A 4JFHE 2AHIA 4OVUA 3P2DA 3QXAB 5B3SE 1REIA 4HOUA 5FO7A 4FJZA 4ZRJA 4M5ZH 2BNRB 2H88B 3KPSA 5AAOA 3BUBA 4HXBH 3WKNA 4BKTC 4JS7A 3ESNA 4REZA 3B34A 3EO0B 1WRDB 4KDIC 1DQMH 1MQ8A 4PJDE 5C23A 2X2IA 4U2ZA 3OXGA 1D5BB 3DETD 2YGQA 5FYKU 2X9WA 4LNGA 1KJ3L 5AZGA 1U4EA 3CFKB 3DYMA 1KGJA 5HGAB 1DSFH 3V8CA 5BS0E 4HD5A 4Q94A 4H8HA 3QUZC 1WGHA 5JPMB 4QCIB 1W0WB 4RX4D 2K9UA 1U3ZA 3IDIB 1WUZA 3Q3FA 4GKSA 3ZKQD 3HNVH 1TETH 4J23A 3AMZA 1CFTB 4MMZB 5ERWA 1D9KB 4U1MB 4AM0B 1MCEA 3DX8B 4IJ3B 1WS8A 4UTCA 1HG2A 2RACA 4UM8A 2Y1VA 2X6MA 1A6UL 3QRBA 3UZQB 4QOKA 4FQLH 5TH2B 1OB1B 1E27A 1JK8A 3M1OA 1YMHB 1EGJA 3B9AA 3MC9A 4W9IA 4JPWH 4LHUD 4AYSA 2G2PA 5M95B 2FDBP 3K91A 4B9GA 4P5MA 4WDIA 2OEWA 3DBHI 4LLYA 4LLVA 2NYZA 1I7TA 3WEAA 2OTUB 2HFEB 2YMTA 4IKLA 1BF8A 2EIZB 4PJAE 1LD7A 1Q0YH 3RWCB 3PP4H 4RGMB 5LXGL 3SCMA 1GJUA 3L48A 7CGTA 3TZVB 4P46D 1J7AA 3DX9B 4PG2A 2HKHH 1LTXA 2KDGA 2KACA 1NMBL 3SDYH 3UKRG 2C34A 2L4OA 4I3SL 4DGWC 3HJEA 2Z9TA 5IESL 3RWDB 3AVEA 4PRAA 1SYVA 2L7EA 4JPVH 3UXGA 3KJ6H 5JW3H 5GGTA 2RG8A 4G26A 1A7OH 1A21A 2PW2A 1QSEB 2Z92B 3K72A 5IW1B 3NF1A 2D7MA 4NAJA 2P80D 5HDBF 1TT5B 2R0LH 2JLBA 1L5GA 4XNDA 3NCXA 3P40A 5EOTB 3NQKA 4D9LL 4ZMLA 4E3CA 2IADB 1A6VH 3BE1L 3IT8D 2FLRT 5E56A 3KS0H 4K3JL 4LSTH 3SDXE 5TH2A 4C56D 5ICUA 4I87A 3AQYA 5FYKL 1FFUA 3ZRFA 4TQIA 5ESQA 5ICZB 2BYEA 2WWKO 4JN1L 1C79A 4QRAA 1HKLL 1YEJL 1A6WL 2ZXDA 4MA8H 4K9EH 3VI4F 3N1YC 4NZJA 3DX2A 2VN4A 4ZZFA 4XNZB 3TS8A 4PJ9A 2CK2A 2JTDA 5AW4B 2O2VA 1F1AA 5BT1A 2DLHA 3OKNA 4KKBC 1KT1A 4FFZH 2HRPL 2QKIC 5CP3A 5EX0A 3LZFL 3QDHA 1WGGA 2VCOA 3SQVA 2XNAB 3TZVA 1HC1A 3TBWB 1KY6A 4I0PB 4C0MA 4DLOA 4DN4H 2CIIA 4BFBD 2LHAA 4QXWA 4OKVA 5J11C 4FXCA 4LCIL 5D96B 3RD2A 3WXXA 4TVPD 2SODB 9CGTA 3IRZA 5D66A 1JHKL 4L9LB 3WCQA 3Q8EA 2NY4B 2DQ6A 2NZIA 5CSBA 3B2VH 1NGPH 4JY5L 4Z7QE 2R1XB 3GE3C 2D31B 3UT8A 1R3JA 4KKAC 1OQQA 3RYMA 1CFVL 3PRMB 1S3RA 1YJIA 1Y1UA 3GMRA 5IFJB 1URZA 4JDZB 2Q3XA 1BMWA 3NB2A 5F0LB 3QOUA 5A3IC 2VDQL 3DTUB 4PPTA 5DPTA 3BUYB 4WWKB 3VFUA 5I19H 3CSFA 3QPQC 3SYAA 1LD8A 2P80A 3QUKA 1BAFL 2CKNA 1DEDA 4ZRGA 5IJCC 3B3IA 4W9KA 3ROLB 4ECNA 3VTWA 1CB4A 3CV5A 1MWOA 1NA8A 1GPOL 1SBSL 2IU1A 3ARGB 3HW7A 4JZNA 4NFBA 4YZFF 5DPRA 3BJ91 1BFSA 3PEVB 5F0PB 4OR1A 3L4UA 1AGDA 3VXUD 4H13C 4X8XA 4OF6A 3EGSA 3HG1E 4GTPA 1XMWA 5SWSA 2B77A 2FO4B 3SGKC 5CF3A 3V6ZA 2MQ0A 1NAMA 2Q3ZA 4QRQB 2FI7A 5DO2C 1S6NA 3CDYA 3NCYP 2OMUB 1Y8RC 1OV8A 1BLNB 3T09A 3FQNA 1P1VA 4OZIB 3EOTH 3FN0H 2LNIA 2CDFA 1MFWA 2PR4H 1YSOA 4B0ZA 4Y5VA 3ARBB 2E6JA 1I1AA 4OVZA 4WU5A 4XC3H 1YN4A 2EEDA 2XHNA 1YO4A 1LO0L 4PUBH 1JI2A 3TG4A 3EDFA 4X8QA 5HJBA 1BAFH 1NBYB 4I7ZC 1KBPA 2H2SD 1V3LA 3K6DA 2DLFL 5GS0L 2LRUA 1TSRA 1QW8A 2EZ0D 2VDQH 1E6OH 3BPLC 5LKNA 3B9KD 5DQDL 1MCFA 4P1BC 1UZGA 3EA6A 3DUSB 4N2BA 4ZPTA 4UQ2B 3NAAL 2Y5BB 4E2OA 3WAOA 4KZCA 3SQOL 4EVNB 2D7PA 4Z7QF 3AU1A 4LSSL 3F7LA 1IAMA 2XZZA 2XFXB 3DRQA 3RURA 1YA5A 3LJ3A 2GROB 3VFGH 3R9AB 1HK6A 2EDQA 3I6LE 4ODWB 5FYLH 2IOMA 4LCIH 3ZLQC 1VRSA 4EBQH 5IW6A 2FNJB 1A8JH 2C9VA 2AEIT 4QJ3B 3FHQA 1T6VN 1U3YA 4FE9A 1YEIL 3V5KA 3QIWB 3LDZE 2ZUWA 3GKWH 4G8FB 4MDIA 5DHXB 4L4VE 4G8GA 2LAGB 2BVOA 4AEHH 4TVSa 1OPOA 4YEEA 3U9UA 3Q1SH 5DJ0B 2WB2A 1C76A 2LHDA 1NM9A 1ETA1 2TSAA 4NRXB 2RDBC 3IS1X 3P77B 3C6LD 4JG0H 3NEOA 3PWPD 4P59H 5HS0A 1BT0A 1GGBL 2C1PA 2AMUA 5H37G 2ARJQ 1G1KA 3KQ4A 1H8SA 4OLUH 2I32A 3TWCH 1E9PA 3W11D 5C97A 4DX6D 4TVPE 1WTGT 2DYRE 4E85A 3X11A 5IJDC 1A6VL 3GYZA 3T2QA 5JHDA 1UWFA 1V8CA 3NZUA 2X4OA 3AM9A 3R2IA 4AMWA 4A3PA 6TAAA 2IFFH 3QJXA 4KK9D 4K7FB 5CP7B 4F7KA 1E7UA 1SNRA 3FRPA 3WELA 3LZQA 3RVUC 1IKFL 3CFEA 4FG4A 2YA0A 2LFEA 2KC2A 3RVXD 2P8PB 4MDRA 3H7BA 1N3NA 3TVMC 5I0YA 2VC2B 3Q5OA 1MAJA 3URYA 4UM9D 1ITBB 1I4FB 1MJ8L 2NY3D 3O2DH 2O93L 2NCEA 5EKQD 4JVSA 3QS2A 1XH1A 3U0TB 4G8FA 4MDIB 1TTUA 2YHGA 4OLUL 1VLBA 2R1WB 3CX5J 4JXTA 3QUXA 1GGBH 4G5ZH 2OMVB 4CYMD 2CKBA 4JK0D 2XN9D 4JPIB 4HEA1 1DQJB 3EZJB 3MV8E 4E9RA 5J3HC 4FABH 3BH8B 3HAEA 3MFGB 3DHUA 4PJHB 1IUEA 1R5IA 5A3ID 3SCMB 5I0WA 4ACFA 3GKWL 5A2JH 4F3FB 4HVBA 3MRJA 3LPWA 1WH0A 4YXLL 1K1AA 3LN5A 3CMMB 1VGEH 4XPHH 2WLLB 5DD6B 1RURH 4I89A 2PMVA 4WUUE 3GSWB 3IAM1 4EBQL 1DBJH 3DHPA 2MCMA 4JM2C 4FXLA 3G6DH 3CIQA 2VGXA 1U8CB 4KNUA 5CN1A 3Q3JA 3CKCA 1UENA 4TVPL 4YSDA 5FZSA 1IEHA 1SXCA 3EYOB 2DNFA 1EANA 2PWHA 3GGWA 5L2KD 4GN1A 2UU7A 4FTVD 1S9KC 4RGNC 5CEAA 3ATEA 4M5YH 1V7NH 1K4CB 2VQ2A 2G45B 4MXWL 1NDDA 2LAIA 2IFGA 4L8CB 1FPTH 1QSFB 2ZKHH 1HX8A 4GSUA 1BQRA 1QTSA 4G9DB 2CIKA 1ORSA 3PDDA 2FBWB 3CFJB 1E3ZA 2CA4A 2DQTH 2XACC 2WZ6A 4DO6A 2BIIA 4HZAA 2V9QA 1EEYB 4Q2ZA 3V0IA 3EHQA 5DR5H 2QADB 1JG9A 1X5JA 3PQYA 1DFBL 1T5KA 1QFUH 2VAJA 1GW6A 3FU7B 1NDGB 4M5ZL 4NX0A 5A1AA 3KL3A 3EYUL 3B1UA 4PRHA 5HGBA 1W8NA 1CLOL 3HA0A 2HWZL 1U2CA 5I6MA 2X6IA 3ONSA 3BC9A 3CZUB 3BGMA 3C6LC 5F70A 5E9DA 3PHWB 2X09A 2AAAA 2QHRH 4TRQA 5D2MC 1DVFB 4GA1A 1I53A 1JUFB 3MV9B 1NZNA 1FAKT 1JZFA 1L0XA 2UZIH 3M7OA 3SDXA 3P9WB 2DAJA 1IGCA 3MV3B 3LKOA 5I74B 2CKBH 5CD3B 5IFHL 5IA7A 4RDQG 1RRBA 1LK3L 4TPRL 3L9BA 2AZUA 3D9AL 3X17A 2HKFL 1CLZL 4CGUB 1B88A 2DM4A 1AZZC 3K2MC 1UT9A 4TNVK 5BS0A 4AGOA 4M5SA 3FTYA 3AJIA 1AGEB 1ZLUK 2QR0A 5KOVC 4M6NL 1PLAA 5JXED 2FBOJ 5KVGE 3KCPA 3WDHA 5BV7H 3L4TA 3H0TA 5ISZA 4F1ZA 3NRZA 1ORSB 1MQKH 2BJMH 5LFAA 2F8IA 3OLIA 1KTJA 4KK6D 1Q9KA 2Q8AL 1OWPA 3B2VL 1SY6H 4JY5H 4P46A 5E94A 2BZDA 2EZ0C 3DVGX 2UVFA 4Q97A 5C2UB 1XXGA 4EXKA 1XTLA 2NXYD 2WVTA 5BPPA 3MOAL 2XPGA 5DBKA 1EAPA 2D03L 4N2FA 2BFVH 5K9OA 5MEQB 5ITFB 3NEEA 4NO2B 4WJ5A 4Q4IA 1KCRL 2OMXB 3WAKA 2PKOA 3EJSA 4RMVA 3ZKJC 3AKJA 1ZTXH 1XF1A 1FCLA 3T2PA 2CSPA 2AK1L 1TQTA 2CXKA 2YD9A 1ET5A 3ZNID 1X4YA 3CVCA 1FFQA 3ZTJH 4CDHA 2Z3FA 3D4CA 5HGHA 2C4FT 3QUYA 4JFOA 4FYRA 3D69A 4IM3A 4NQED 3VFPA 2OL3A 5AB9A 1ZWIA 3G5VA 2FYVA 4QFVA 5DJDA 1OCZE 4NKDB 3HVEA 4LASH 2KATA 5HDBB 2F6AA 5DPWA 1A3ZA 4MCMA 1E27B 4S1QH 3HK0A 1FG2B 2HYMA 3ALBA 1TNOA 2WZPD 4JA7A 3ZT5A 3AS8A 3QZWA 5CU9A 2HTLC 2GOWA 5B4MC 1NOAA 4QF1A 5T1JA 4GT7A 4A9AA 2E75C 3HHSA 4PP1C 4RWYH 4KRPC 3ZYMA 3TBTB 3QUML 2HFEA 1MUJB 1MWAL 3EJYD 1U92B 3BVZA 4IN3B 1MOEA 1XD0A 4TLTA 3L3DA 1YN7A 4DK5A 1F4AA 4G6AC 1MCBA 3O6FC 4TM9A 4ZT1A 3N42B 3D2UA 1JGIA 4WUYA 2M19A 3W39A 3ULVH 2FCNA 3PP4L 3D39E 3S96B 1Q0YL 2WYTA 3A4DA 4QJ5B 3C6SA 3NJGA 5KEZA 5DVPA 2CZNA 5DD3H 1PKQE 1WWCA 2VW6A 5FM8A 1NYQA 1X5YA 4UTAA 3BPNC 3ZRCA 3DVIA 1PX3A 2GIYA 5ENQD 2X5PA 2ZYHA 3BWSA 3D69B 5DMIH 3Q69A 1MG8A 3NGBB 4JW1A 3FRPG 5HYSB 1NBZA 4GIPD 2ED6A 1EF5A 4IRJD 3T2NL 3DSNA 3ZE1E 2PKDA 5AD0A 5ESAB 3HMXL 3A6OA 5EZIL 1RZ7L 5EBWB 5J9PA 2X4OB 1ED3B 2DTSA 1RIVH 2P5WE 1SY6A 1NBCA 1NDMB 3F5WB 5FCUL 1PY0A 3ESVF 5JIKA 2J0JA 3IDJA 1KXVA 4H0LC 3AXHA 4JDEA 3ZEFA 5F7HA 2CR6A 4PJ9B 4GMSH 3SE3A 4DH2A 2X38A 2FJFA 1OE1A 1Y6NR 4E5XA 4KIKB 3GLDA 5D1XE 2J08A 3IV0A 4K3HA 5JOEA 4S11A 4MWFB 4LLWA 1HN1A 3FPXA 2CGZA 2YUVA 5CHEE 3HLAB 4GA2A 3QCTH 4HLJA 4M7LH 1WWWX 5HHOE 4GXUM 5DD0H 5K1JA 3SI5A 2NX5B 5IKCB 3CHOA 1A7NL 2YARA 3N04A 1TNYA 4QRPA 3FYIB 4AI7A 5C86A 4DP5X 1KFAH 4X4XA 1FCHA 1HSBB 4GSQA 4I9EA 1JXGA 2IWGA 1HXKA 5AD0B 1J9RA 1MZCA 1E43A 4RFBA 4IUMB 2WBJC 3RL1A 1TQUA 1IAIM 3T9WA 1QBMH 1CK0H 3SE4A 3ZSSA 1HEZB 4ZODA 4WI0A 5A2IH 2APXA 2XTJE 5AVZB 4JFDD 3IGLA 3OLMD 4KQ3H 1NUNB 3WEXA 3IDUA 3NVVA 4MS8D 4HGWB 5FGBC 4CVUA 1T3QA 4GG6E 3W9GA 1I7ZA 4E5XB 4ZHOA 2KWCA 2X4RB 2WUCH 4ZOCA 3L9EA 3ULUD 2WGNB 3EBGA 5SWSB 1EZVY 1UJ3B 4WAFA 3C5RA 2K7QA 2NNAB 4JRYA 2YBRB 4HAGA 3VXNA 2KTFA 2DN7A 5IM7A 2QYJA 3MTXA 2HA1A 2KDYA 3VXQA 3ECIA 5BW8C 4G9DA 4NJ6A 5HYJA 3KAEA 2E76C 3QGVA 4ORGB 2J6WA 3UTSA 1VZHA 2DD8L 5C6PB 4F92B 2DYOA 4MAZA 2NTFA 2O6VD 4HUUA 5KVMC 4CMMA 5KSVA 2IALB 1P7FA 5B1CA 2IDCA 4H5SB 3Q78A 1CLYL 1NDGA 4EI5C 1CPUA 4M5TA 1SRDA 2VH5H 2WZPA 5B3SB 1HCZA 2I26N 3QZBA 3KD4A 2HTKC 1UM6L 2VLRB 5DJ6A 4GAYB 4XBPA 2GRPB 3JSVB 1BIHA 5DHEA 1H3GA 1N59A 1OALA 3BAJA 3BT2H 3D3VE 4I18C 5E6SB 2I2YA 5IF0B 1HHJB 1HEZA 5F7UA 4F33B 2EH7H 5EOCJ 2A1WH 3F6QA 2R05A 2R23B 5HYEA 1UCBH 2VTFA 5FM4A 3S37X 4ZD3H 4MRUA 3CJJA 3I3DA 3PDOA 4X6DA 2E0IA 1KCSL 2DIBA 3MA9L 1U42A 4P3WA 4UQYA 5HYFA 1JGUH 3P63A 3VUYA 3HPJB 3A67H 1GS6X 3R4RA 1TJFA 4G1MA 3THML 3VXOB 3IMUA 2HLFD 3KYOB 3SZKC 3SZ7A 2AXGA 3OAZK 4AVXA 2BIQA 4ARIA 1R4MB 4NC1C 1BWMA 1OKEA 1FO0L 4IU2A 4ZJ9A 4NQDE 3JXIA 5F71A 3MUHL 5JJ7A 4WSJA 4GEIA 1OUVA 2Z7UA 3OLEA 2LTQC 4NUJA 2ZOTA 3H85A 4S10A 1I75A 3LDZA 4YDNA 4DXAB 3BQOA 3GZSA 4NIYE 3PNLB 3UI2A 4ZFOL 4URKA 1SN2A 2ORBH 3F7KA 4ZQKB 1FIGL 3RWEA 3TYFB 2BHZA 1J0JA 2Q7AA 4HWZA 4ONGH 3S3DB 3G5YB 1IEAB 2CAKA 2IGFL 5J1AA 3SGDH 1GGIL 5C09D 3MRKB 3VI4A 3NFNB 3F6LA 3O81A 1I3VA 3MBEC 4WO0A 5LBSH 4RNAA 3WFCL 1TLMA 1LM8B 3FRPB 2JEKA 2OCJA 1S9YB 2XG5A 3VG9C 3ZSTA 4DF9A 4KZDL 3A23A 1DYZA 1N3NB 2YD5A 1GC7A 2OL3B 1OTTD 3UACA 1I4FA 4XB8A 2X6AA 4NKDA 4OI8A 3JTTA 2DWEA 2IEJA 1WA1X 2WJ5A 3P54A 1NCDL 4EECA 2F9BT 4JM4L 1NUFA 3LQZB 4NNYA 2ENJA 3QZWB 4ICWA 4PGDA 5FO8B 4X8JA 25C8L 1LEKB 2B2XL 1NCCH 3S5LA 1P2CB 5D70H 5AB2A 2J53A 2KERA 2N1KA 4B3VA 3OV6A 3KEHA 1Z9LA 4UF7C 1MUJA 4K0RA 3NJMA 1ZSDB 4J8DA 2GJZB 4WI8A 5EV7A 3WUZA 2P9NG 2BCMA 4AY5A 3W9EA 1C5BL 4NC2B 1G1CA 2BVPA 2PXYA 1YYLL 1T2JA 4E41B 4ZNEA 3O4OC 1BW8A 3NESA 5EWIL 2BSDA 3TBYB 3ZDXE 5LGHL 5K5YA 4MGYE 3BFWA 3UTQB 5TPWH 5AAWC 2VTBA 1I1RA 2W8CA 3EJQA 2DYSE 5IOIA 5HXMA 3L7EA 1XCTA 1LMKA 5I1KL 8FABA 4U0QB 4EAEA 4YLQT 2VXTL 4Y1SA 1E2WA 1A22B 3UAFA 4EDWL 3FT2A 4GPKA 2PR9A 3H53A 5I6OA 4YHLL 1CO1A 1AMYA 5EE0A 2IH3B 2MA9B 4YGAB 3ZRHA 4US9A 3ZL4L 4I48B 3JWNC 4C56C 5BMHA 3N6YA 3TIDB 2AQ2A 2ZVOA 2CIKB 3Q6FB 1WXAA 3D05A 5I1GH 3VYOA 2VITB 4U3SA 4JFEB 1E42A 3EUVA 1TLKA 1CFBA 2L05A 2XX1A 1JP5A 1L9NA 3PFUA 3ASOE 5CECB 4NKIH 1LFDA 4I17A 3M8OH 4Q96A 1IFGA 4N8VB 1MFUA 1TPXC 4JHUA 3ERXA 2QGEA 3QEGH 4PLKD 5HGBB 2WBKA 3VVWA 1QSEE 4I0CC 4ZFGL 4L1TA 4YHML 2HJFA 2XXCB 4Y4KD 3B7UX 4LDEB 3VXSA 3N3KB 4JG1L 2MTPA 3PHQA 4GMLA 1C7SA 3EJTA 5PAZA 4HDIB 3NIDB 4ZRIA 2X9XA 3SDXB 1NYRA 3NBNB 1WCBB 1ESOA 3K46A 2GIMA 1UADC 2VO5A 1RV6X 2VXUH 5HHNB 3ZDZB 3RGVD 4QKXB 1KJ2A 5IMOA 1NSNL 1D5XA 2RFXA 5E1GA 1G5GA 3X23A 1EMTH 1ZE3D 3LY7A 3HCVB 3MA7A 3PAZA 5C0IA 2LR4A 4K71C 2VZKD 2GBTA 4HHWA 1CD0A 3BCFA 1FCGA 2ADIA 4PG2C 1CBVH 5B1BE 3AREA 4PGCA 4Q14A 4EN3A 2BS3B 3U7AA 2CCLA 4I48A 2C0LA 1F6AA 4MXQC 2L83A 5INDA 4FFZA 1IKNA 2QKSA 1RU9H 5J6SA 1H2TC 1GS8A 3AY4A 2AQ2B 2CDGB 2K8CA 3FK3A 3FSWA 4UDTB 1UOVA 2E8YA 1X7SA 2H2PC 3AITA 3O6FA 4H7VA 3Q49B 1C5DA 1QQEA 1OVZA 3OHXA 3HPLA 4WVRA 5SWQA 1I82A 3N0AA 1A4JA 5JDJA 5D6JB 1BZ7A 1V3JA 3ZE2F 5DJZA 3ZOAA 2AEWA 4YHLH 5C8JA 3RMKC 4MJ6A 5JHLL 4GZ6A 4KBQA 1J18A 3QUZD 4OU3A 5IGXH 3SGEI 5D3DA 4P5TD 4B0MM 5EUOB 3K71B 1FFRA 3I75B 5H4ZA 1Q9LA 1V54E 4GJTB 1WPCA 4HSAC 2J4WL 3KHOA 4KU1A 4R96B 3RDJA 5IGXL 3S37H 4HK0B 1SJHD 3KGRA 4USAA 4XNYH 5EWIH 4AZ8A 3RNQA 3D25A 5FUCE 1CE6A 1AXSB 5EEZA 4X5WB 3IXEA 1IBGH 2ZCKH 4JZJC 3NFSL 1TEZA 5I1DB 2RFXB 4PJ7E 4JFOB 1KTRL 1PLCA 1U9KA 2YJLA 3PWPE 3CHSA 4ZHBA 1LVEA 3W9FA 3CZKA 4M7JL 5F96L 2HTHA 1A25A 1H6OA 3JYCA 3N44F 3NK4A 1RJYA 4R7LA 5HHXL 4LVOC 2L32A 3N40P 4JQIL 1WK0A 2CBOA 3N32A 3KH3A 3MJ9H 1R19A 5CZKA 3F6JA 1NANI 3B7RL 5ARFA 1FO0B 3P4NA 4P2RD 3QO0A 5LO7A 4YTNB 4XNAA 4HQQL 1A4JB 4X0KB 1UATA 1NCOA 3BZ5A 4U1MA 4AM0A 2PF6A 3WHXB 1TVHA 4MJ6B 2KT7A 3K8KA 4UM8B 3LY6A 1Z9MA 1LO4H 3GRBA 3AT8A 2GGFA 1RLBA 2QTVA 1NCBH 1VEPA 2VDMB 1QO3A 3QZWG 4OIIL 3DBXB 4NC1E 2DQEH 2I7SA 5IQ9A 1TS3A 2F08A 1WAAA 1GGIH 1WFTA 5FM5M 1J5CA 2MHAA 3S97C 5EMYA 3VXUA 2O61A 5IVXA 4DUVA 2WTRA 5IHWA 4U7SA 2E6PA 2J2ZB 3N50A 3CSTA 2WVSA 1TF4A 2P4AB 2KXPC 2B4CH 2EIZA 2DW5A 3CFIC 2JXMA 2DQFB 5I1GL 1RUMH 4Z1PA 4PJ8D 3MC8A 2WGSA 1WYGA 2VLLA 4I6PA 1JZ5A 2WNWA 1S7RB 2ZWKA 3WJMA 3ZXVA 3NOBA 4W9ZA 3MXVH 3GP7A 5SWZA 5CILL 4A2HA 3AG2B 3O11A 2YR3A 3AROA 2V4HC 4NO0B 5KANI 1JGVL 1YMMA 3I2CL 1BU9A 3OAYH 3F7VA 3LEVL 5AZHA 3H2QA 4IU3A 4GSRA 5L2JA 3S0PA 4PLNC 4OW0A 3OBAA 3WNKA 3KVDD 1KLFB 5D2LF 3RUGE 4QRFA 1OAYL 3EJRA 2GK0B 1O9ZA 4ACKA 1XO8A 5IB1A 5ALCH 1XR8B 3O3EB 4LSQH 4WENB 3VR9B 1WBZA 3BZDA 3C5ZD 1V8HA 3HAEG 3SDCC 1GRWA 4UQAA 4DN3L 4F58L 4HV8A 4ZFOA 2AQRA 2PXYC 3ECQA 3WNJA 2EECA 4X8JB 1MHHB 3HVNA 2DEXX 4QGYA 4FU3A 2WWMD 4BFGA 3CWIA 5H4YA 5HHPB 3UJIL 3AE3B 4GBXA 1ZLVK 2YOCA 3SHQA 1FH2A 1UM4L 2B8OT 2KQ7A 4ALAH 5BXFA 2QQKL 3A4EA 4X4XB 4DI4A 2OP4H 2ZAIA 3EADA 3FWVA 2XNAA 4U1KA 2P8MA 1A1MB 5BYQA 4PDXA 1OT2A 1QACA 2DY2A 5IBTH 1COBA 4JFWA 1AC0A 4MCZB 4NFCA 4GG6F 1KLUD 1FNGA 2YEZB 2TRYA 1TFHA 4ES9A 4PS3A 1MHEB 5AZFA 5B4MD 3P0VH 5AUMB 3X13A 5CBNA 4J7WA 3KS0J 4NJAL 4IU3B 3KD7A 5DD5H 3SOTA 1KN2H 2HD5B 3WKYA 1KLGA 3CLEL 2KM4A 1KTLA 3OKKA 2ESVD 4ZPVB 4PVBA 5DZJA 4M6AA 4LNRA 3PREA 5I1EL 4OZGE 2GEQA 3QWWA 3T4YB 1DJYA 1WT5C 2H8PA 3QHZH 1WBZB 4FNLH 1SVBA 5L6YL 3S96A 4W70A 2B1HH 2NY4C 2WXOA 4LDCA 4P23D 2XTJB 3RB7A 4HV8B 4KJQC 4MGXA 2JY6A 5JNYB 4JRWA 3UPRA 3QUKB 4LAQH 3KEZA 1JGLH 1QKZL 3NSDA 4BFNA 3KM1A 3ARGA 2QZ5A 1VKXA 4NCC2 4WO4D 1CBJA 2V9RA 4O2FB 1U6AL 5I6LA 3D18B 2X2JA 1N61A 4XMVA 3SBQA 3U2IA 3N3EA 4ZS6C 2AXFA 3QIBB 2HG5B 1A64A 3W81A 3V4VL 1WGYA 1PCXA 1YEHH 2OX5B 1HESA 2TSSA 4PUCA 2FAZA 1K