5T8IA

Pi3kdelta in complex with the inhibitor gs-9901
Total Genus 240
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
240
sequence length
916
structure length
808
Chain Sequence
VKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNLWSLEQPFSIELIEGRKVNAMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVCPIAWANLMLFDYKDQLKTGERCLYMWPSVLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELLREILEYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Discovery of GS-9901: A Potent, Selective and Metabolically Stable Inhibitor of PI3Kd
rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
molecule keywords Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic sub
total genus 240
structure length 808
sequence length 916
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2016-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 5t8iA05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5t8iA01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 5t8iA03
3.10.20.760 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5t8iA02
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 5t8iA04
1E8YA 3CSTA 3ZVVA 4URKA 4EZLA 4XX5A 2WXGA 4F91B 4L1BA 2ZKMX 4NPJA 4ICWA 2Q3XA 2N1TE 4KZCA 4IQHA 5G55A 4UWKA 4L1LA 5EDSA 1RLWA 3W57A 1DJZA 2CJTA 3ML8A 1V27A 4WWNA 3R7QA 2ENJA 2K8MA 2KI6A 3L9BA 4LCVA 3KWUA 4QJ4B 4A55A 1W15A 4KITB 3GPEA 2K3HA 4F92B 3RDJA 4F1SA 3L17A 2DMHA 3JZYA 3QK0A 2FJUB 4NP9A 3ML9A 4ANUA 4EZKA 4FJZA 3L13A 3ZIMA 5JHAA 1QASA 2BWQA 3QR1A 3PYCA 2CHDA 4UWFA 3APCA 3QJZA 4TS6A 5CCHE 3S2AA 1E8ZA 4PS8A 1W16A 3L54A 3L08A 3IBEA 3F00A 3PFQA 5H4YA 2NSQA 4FHKA 3APFA 3APDA 1YRKA 5T8IA 3TWYA 2X6KA 2WXMA 4F93B 2X6JA 1DJIA 4OVVA 1E7VA 1RSYA 3T8MA 2V4LA 3IHYA 4BFRA 2D8KA 2ENPA 2DMGA 1BDYA 1DJGA 3L4CA 3DBSA 4OVUA 3OAWA 2RD0A 2WXHA 4FULA 2WXIA 4GNKB 1BYNA 4FLHA 1E8WA 4DK5A 3RPBA 4KZ0A 3R7RA 4FADA 4LT7A 4WWPA 4NS0A 4ANVA 4OYSA 1WFMA 4LDCA 3PRZA 4MJJA 3NZUA 2WXPA 1RH8A 2QZQA 3N5AA 4NPKA 2WXOA 5CCJA 3LJ3A 3OHMB 3NZSA 4PH4B 5ANLA 1DJXA 1TJMA 5JHBA 4UWGA 3QARA 3IM1A 2R83A 2NQ3A 2UZPA 2K4AA 5ENNA 3P2BA 3TJPA 4DNLA 1QATA 3B7YA 4HVBA 2X38A 4QJ3B 1DJHA 4FA6A 1UOVA 4BGDA 4FHJA 2Y3AA 2WXQA 2WXKA 2CHWA 2Q0ZX 1WFJA 3LS8A 1TJXA 3FDWA 5H4ZA 5CCGE 2JQZA 4GB9A 2A5UA 1DQVA 5G2NA 4V11A 2NCEA 4AOFA 4UWLA 4WAFA 3SD5A 4XZ4A 4PS3A 3ZW3A 4WEEA 1E90A 4TV3A 3MJWA 4PS7A 2WXLA 4L2YA 2YOAA 3PREA 2FK9A 2Z0UA 3DPDA 2CHXA 4AJWA 3FBKA 3F01A 2WXFA 4Y1TA 1UGKA 4J6IA 4XE0A 2B3RA 1CJYA 3HHMA 2A4ZA 3PS6A 2CHZA 2CJSA 2LHAA 3TL5A 3QR0A 1A25A 4Y1SA 5KJ7E 2WXRA 4EZJA 2X6FA 2QZ5A 2YRBA 2X6IA 4ICXA 3CSFA 3HN8A 2ISDA 3W56A 1DJWA 3L16A 2WXNA 4IHBA 4QAMB 4ANWA 4FJYA 1BCIA 4L23A 1UOWA 4TUUA 1CJAA 1E7UA 4JPSA 4WWOA 2CM5A 3F05A 2I9CA 2ENQA 2EP6A 1E8XA 2WXJA 3F04A 3NSJA 1HE8A 4ANXA 1DSYA 3M7FB 4QJ5B 3KWTA 3ENEA 1K5WA 2X6HA 1DJYA 2K45A 3QAQA 4UWHA 4HLEA 1GMIA 3HIZA 2CM6A 4G11A
chains in the Genus database with same CATH superfamily
1GYWA 1UGNA 2BVOB 1IU1A 3KCPB 1F0LA 3VXPB 4PY7B 1GSKA 5FYKD 3G6AA 4BYHA 1TQBB 1UM5H 5E0QA 1RZIA 3A47A 3QIWA 4Z7AA 2Z4TA 2H6IA 3QVAA 2KPWA 2FNBA 2OMUA 2K39A 5EIQA 3FT2A 2BSTA 5BQ7B 4YXLH 5HDBF 3TZVB 1OWRM 2IAMA 1RFAA 2AC0A 3L9BA 4WWNA 1N64L 2J88L 4OFKA 3DSSA 5HYIA 5BZXA 2MWCA 2W65A 5GJSH 5C92A 4AL8C 1J1PH 1IQWL 3MX3A 2XVBA 5B7FA 1NINA 4NGHH 4ZMTA 1AD0A 3RUGF 4P9HH 4D9RE 4P23B 5A6CA 2DTSA 1NC4D 2DJUA 4ALAC 2KDMA 4LNRB 3ZR6A 4UQ9A 3O4OB 4PJBE 2XPGB 5E2JA 3IBEA 4LDOB 3US1A 4EXPX 4FHKA 2XKNB 3E33A 3CCHA 4WNQB 4DKTA 1ZP0B 2DLEA 1AGFB 2WVTA 4G8LA 1EVTC 2X6VA 1QYGH 3J2PA 5TGBB 2AX5A 5DFVC 3D3VB 3UINC 3C12A 4OVUA 3T2LA 1BFTA 4BZ2L 2YXMA 2VMDA 3RO2A 2JK5A 4KJYA 4PRHA 4B27A 1MFDL 2IY1B 4OFQA 3ARFA 4NQCE 3SDCA 2J42A 3D87B 4ZQKA 3SE8L 4Z7OE 1YN3A 3RDTC 2XZAH 3RVTD 1AZRA 1NDGB 3JZ7A 5AW6B 1XFPA 2AXGB 3A23A 1JG9A 2YNQA 3VXPA 2R69L 5MEOB 2WNXA 4M7KL 1QPXA 1KJ3H 1D9KD 1K72A 4GSWA 4G5ZH 1V5TA 3VWKC 4AQAB 1XF2B 1ZSHA 1EEYB 3ESPA 3P9WB 4R0LA 5FUCC 5JDSA 2EYRA 3ZR5A 1EJFA 1PFOA 1U8HA 3K1KC 5BO1L 3RA7H 3TCLB 1PBYA 4K5LA 1QUNB 1N4QA 5CUSH 3BQUD 3VXQA 1KWGA 4X7CC 5H8DA 4XO3A 4CYEA 2J5LB 2W94A 4ODUA 4HS6B 3RPIA 1E5WA 1HG2A 3GSQA 5ISZD 4WIQA 4HPMB 3IXSA 3DK0A 1ZSDB 1IM3B 1JE6A 1HNFA 2JJTC 3OLGA 3U46A 4L2YA 1O7VA 3JVFC 3PL6D 4XN8A 3PPAA 4POYA 2CH8A 2JSFA 2EDFA 3PQYD 4PHZA 5IB4A 2ZWYA 4BV1A 2P43B 4PY7A 4PSRA 1ZK9A 1IUEA 5IQ9A 2KWVB 1BVLB 5JHLH 4WHDA 3MLXL 3DROA 1IKFH 3LY6A 1KGCE 5DCNA 4PRIA 1ZOXA 4ONOA 3WDIA 4IEFB 3AQXA 2MBQA 3QHFH 3ECBA 3VI4B 2RJMA 4J3UA 4PI0A 1QKZH 4HUNB 4F9LA 2FIKB 3SPGA 4XO8A 1W0VA 4N4YB 4JEHA 4F7EB 4YAQA 1FBIL 3H7LA 2FDBP 4XC3H 1I7UA 2PTTA 4YDZA 5DWUH 3RHWF 3T3PF 1AOZA 1Q2ZA 3AEAB 1R4NB 2WYHA 3QWOA 5JMOC 4EI5A 3EJUA 3WE6B 3DEOA 4NEHB 1UWFA 2HJLA 3RTQA 3F12A 2KKQA 4S1SL 4CN6A 4BY6A 4I6LB 1PZ2A 1M4VA 2L9BA 3K46A 2D11A 6FABL 4FG0A 3GPEA 4HRMB 4QHUB 3X13A 4ZQTA 2AEOA 2CIIA 3D6GA 4K3JL 4LSPH 4RDQF 5IESL 3SE9H 4P46B 3C5ZA 6CGTA 3I5PA 2P4AB 3U36A 2ZKWA 2WVIA 1QSFA 2PO6C 4NQTA 3S2AA 1BJ1H 1MCOH 4J3SA 4MNQB 4LK0M 1B4JL 2VAAA 3DX9A 3IBOA 1SEBD 4LEXH 2QQNH 4U8HA 3OKLA 2FB4L 2YPLE 1YMHE 3L3GB 2MTAA 4HJSA 3VD0A 2HJFB 3HG0A 3WMSA 4IMLA 1YJDL 1NAKL 4Y8AA 5MP6L 4FYQA 4JKPL 1HHGA 2EH7L 5I1GL 4DKFL 1CBJA 4BFIB 1KXVA 1RZPA 4MASA 2ONDA 3TWQA 3DUSA 1V9JA 1NSNL 3VA6A 3RVUC 1RZGB 3D48R 4G3XB 4NPYB 4JPVL 4ADIA 1IAIL 4WKZA 4YHZL 2BKKB 4A66A 2J6EH 4MJHA 5IG7A 3P40A 1JI1A 3E3QC 4XGZA 3UADA 2VSNA 3Q5MA 2VGXA 3E80A 3FYIB 3HN3A 4GPVA 4YFDB 4ZRPA 4R90H 4HG4K 4K5AB 2WU5B 4HVBA 4GAFB 2XG5A 3BN9C 1XGUA 4OD1L 2X05A 4YSCA 2Z0DB 4BGDA 3N42B 3APMA 1ZEAH 3HG1E 3O11A 5A16B 1ZW7A 3X0WA 3ELQA 4AK2A 2GEQA 1D5XB 1F90H 1RUPH 3OL2A 4LARL 5FS5A 3UTTD 2BCKA 3VM7A 5CFHA 4LNGA 3PXLA 3NUKA 3TV8A 3QWWA 1TT6A 5J6HA 1KCSL 5FF6A 1YJIA 1OP3H 5L0QC 2IWKA 3KZ8A 5J5EA 2JELL 3I02B 3RVVC 1ETJA 2BDNH 3CX5K 2NY0B 1F90L 3RNGC 3CU7A 3KL3A 2FCNA 4JE0A 3FU0A 4PG2A 2QQQA 1N26A 4W9JC 3IVKA 5AB2A 2FECI 4UDUB 5IEHA 3KDMB 3GKWL 1DBBH 2K6WA 4LCIL 4WNQA 1N54A 4IYKA 4FAAB 2BRRH 5I74B 5EUOF 2X6IA 1NENB 4K3GA 4QOKE 3CLFH 1JNNL 4NRXB 4HXDA 3PNLB 1DJWA 2JX5A 1Z9PA 1K2DB 2GCYA 3OXLA 1SZNA 1ZDSA 2DWEA 4L1TA 4YHZH 1J5OH 3T9KA 4J8RB 5AAPA 1MQSA 2VXTH 1QSVA 1D5ZB 4MX7A 2GIXA 2VZSA 5HYQB 4UTBL 1SOSA 2L6JA 4ZUVA 3IDNA 2N1VA 3V5KB 1TTNA 4U4IA 4JANB 1SXZA 3GS4A 3AQYA 4KHXH 5D7LD 3ROLB 5GRXG 1NCDH 3UPRA 1V49A 1HZLA 3G5XA 1F8TH 1S3SG 3WOVA 1G7JB 4BKSA 1VFBA 3E7JA 1WLHA 1X3DA 3TURA 1CLCA 2HJFA 1AN8A 3SZ7A 1XF2A 3VXNB 3TUOA 3CC5A 4NDMB 2SAKA 1U8HB 3KE0A 5DHMC 4MAZA 3ZE0F 3OKNA 1CK0L 2VDNB 3N43F 4R7DA 4KZDH 1JWBD 1HHKA 3L3OB 2GTZB 4HIIA 3LN4B 3QCTH 1NCWH 3LZRA 4NP9A 2LGDA 4LPVA 2HXAA 1U8KA 1Y18B 3VXUB 3Q7FA 2KLGA 3B3IA 2FAUA 2N01B 3TBVA 3HMXH 3WLWD 1Y07A 2WLHA 3UXGA 2YSSA 3FSOA 4PK1A 4XMZA 5D1XD 4J8SA 4JQVC 4MMYA 4P2OD 3MV7B 1YEIH 1NIEA 5HDLA 3N9GL 1FA4A 1J0YA 1T1YB 2PM7A 2YKLL 3IFPA 3VD3A 4U31A 3CBKB 3NAAL 4XRCB 1LP9F 5HDQH 1ZXHA 3ATBA 5IHUH 3P63A 2UWEE 2NY2C 3H3KA 4IMKC 4DETA 5CEXB 2HLEB 4U1GB 3CIQA 3Q2WA 3QC6X 3WIFA 3ISMC 1AHKA 4RMUA 4GUOA 4LNIA 2JKRM 3MJ7A 4N26A 1BM3L 1DJXA 1IBYA 2EIJE 2CGRH 2YA1A 5HHVH 5KVEL 3CVIH 2AYOB 2P1YA 2PPDA 5AQ0A 1OLLA 2A6JA 1A5FL 2DV6A 3PQYA 4JN2A 4LF3B 1HCFX 1HQ4A 2VTBA 15C8H 1ZT7B 3LPGA 4TNVF 5DRXA 3MBEA 2EH7H 2ADGB 5JORB 3S88H 4RLDA 5EE9A 1XT5A 1XIWA 1YJDH 4Y5XB 1CLYL 1NANH 1CC3A 2BNRD 2HKAA 2YPKB 4HH8A 2XTJE 5GRUH 2NZIA 3JWDC 3QI9A 4PRPE 2N1WA 2BSED 2FYYB 4R2GB 5FYJL 4NKDB 4ODTH 2J07A 2VDML 3ABKB 4B9KC 2F7OA 3NN8A 5IY5B 4M5SA 4Y4FD 1KIQB 3HDXA 1FG2A 3PP4L 2DIBA 5J6SA 1GCFA 2J2ZA 4KPHH 3O0RH 5DJ6B 5HSFA 5KAQF 2EQDA 4Y1TA 4P6VF 3WXVL 2GRIA 1AGBB 3W38A 3SFZA 2W1NA 3J7HA 1G6RA 4Y2DC 2OCCE 3CN2A 3F58L 1FFTB 3HA0A 3ZRSA 4M00A 3MCYA 1YC7A 4HKJB 1N7ML 4KI5D 1CBVL 4JFZH 5E1IA 3MCLL 1RULH 4K3DH 2ZNXA 5FXCH 3EBAA 1UOLA 2FEDC 3DVIA 5IUCA 3LN4A 4KRPD 2TRHA 5K59E 1JCKA 3GXTA 5D7IB 1V1OA 5B8CC 2X6HA 4JPQA 3QAQA 3D2UD 2Y22A 1BQHA 2GJ6E 2I07A 1HSBA 1K4CA 5BO0D 1C1EH 5IVZB 2H9GB 4ILGA 1NCWL 2BJMH 1MVUB 2LU4A 2W54A 4NPJA 4XBPA 4KJQD 2GRNB 3NPSB 1NFAA 2ILLA 4JM2D 3MUGA 4Y4FC 5JNYB 4IBWA 4JQWC 5E7BA 1F3JB 1AI1H 1UXSB 4UWKA 2NY5H 3A6CL 1P5VB 1IGJB 1SJHB 3N91A 4N39A 1YA0A 5HQ8A 2JTDA 4N5QA 2ODHA 3FRUB 4YNYA 1JWSD 1T2JA 5JO5B 1Q38A 1P4IL 3SE6A 3PGDB 1YCSB 3CZSA 1BZQK 3GRWA 1Q9LA 2PWEA 1RZKC 3KJ6H 3TBBA 4PRPB 4N86A 4FXKC 2VDQB 4Z7WB 1IKNA 4G8FB 4M1GL 4HEPG 2UY6B 3S48A 3OX8A 4NC0B 4ZRGA 4S0SD 1BD8A 5FM4A 1MNNA 4KO7A 4NUJA 4GEIA 2QADD 1UUNA 2YBGA 5FGRA 3UZEA 1EEYA 2J57A 5DRZB 4FL4C 1FV1A 2BSBA 5B3SE 2MH4A 4J8DA 2MSPA 5CO1A 5F7UA 1A5EA 4P3WA 5LUMA 4QTIL 3QRBA 4AEIL 1WZ0A 3E4BA 2R69H 5C07B 4TQPA 1IE5A 1B1ZA 3TBYA 2VO5A 2D3BA 5ID0B 5GGUA 1OXJA 4BESA 2FVNA 2LT9A 5MPOA 3ROOB 3MYJA 2XX0A 5LNGA 3ZT6A 1IUZA 3SHFA 2ZP0T 4UYQA 3MNZB 2CBQA 2ZOKB 2PCPB 3PWNB 3Q6GH 2VERN 3DYOA 4H8PA 1EAPA 5ELIA 1P2CA 4IWPA 2WPVA 2DWQA 3U9WA 4YDKL 1KNOB 3A4DA 4KPHL 5ABAA 1ZUD2 3STZA 1WFOA 1OGAA 5BCAA 2CRMA 3OLIA 5ITBH 1NAMA 2DL2A 4XO5A 1HHKB 2R0LL 3KDPB 3UABA 1LNUB 4R90L 1ZKHA 4A04A 4NENB 4WV1A 1QT9A 1D5MB 3EW3B 2MHJA 4ZRQA 2O30A 1RPKA 1E50A 2A6KB 3KPNB 4X6DE 1Z9SB 3VH8G 1JV2A 5ACMA 2UYLB 2VUKA 3QUYC 4OGXL 3ZKQD 1DYQA 3DBRB 3FBKA 4DX7D 1MAKA 1DLFH 3I9AA 4HPPA 5BV1A 5I1IL 1ZA3A 1C3TA 15C8L 1OSZA 1UYWL 2XT1B 5FWRA 5IJVA 1DVZA 3GS0A 5D2NE 3BRGC 7TAAA 1IGYA 4HK3J 1KLUA 3CPLA 4Q56A 3Q9NC 2DQDL 4UMSA 1CICC 4M7ZC 4R4BB 4QOKB 1P3QU 3ARGC 4FC8A 3H55A 1QP1A 3NH7L 2BJML 1J0KA 2BP0B 2WXJA 3BFOA 3HR5B 4J8FA 4OM1L 4XI5C 4GU5A 3F8UB 1HI6B 4KH9A 4E41E 3BKYH 3RVTC 1PZBA 5I8OL 4FXKB 43C9A 2OEWA 1IEHA 1CLZL 1HX8A 4WUKH 1N12A 2JXXA 2V3SA 1U8PB 3OX8B 4WI7A 5AVXB 1JGLH 3SYPA 3TT3H 1Q0XL 2TSBA 4JFHE 5CBEB 2A9CA 2JB6A 4LCUB 1XDTT 2Q3XA 4Q2ZB 4YE4H 3B9JA 4K73A 2HN7A 5DJAB 4X6EA 4X6CF 5KVGE 1T2QL 2BX5A 4AT6A 1TZIA 3FU8A 5IW6B 2LO6A 1OP5H 2LAHA 5AB1A 4PV9A 1KYFA 4IOIA 3S36L 1FNAA 1B3IA 1OCCE 2AXHA 4X4ZA 3WFDH 3IPEA 2D7MA 5I73B 3D9OA 2X2IA 1CE6A 3TJHD 3L13A 4NSKA 5KW9L 4U6YB 1EFXD 5HHOA 1WCQA 5ITZF 5B8CB 1PY1A 4NQEE 1UH6A 3GXDA 1A7OL 1HWGB 1OTSC 3KS0J 2XGOA 3E9SA 1AS6A 5JMRA 3S4SG 4NAJA 4XCNB 5B3JF 1ADQH 3BH4A 4WEBH 1NCTA 1MHHB 1JRUA 2AQNA 3BAXA 4A63B 1R17A 1OQQA 5CBNA 2J56A 2JZ3B 5E00A 3KPLA 5M94B 4GO8A 4GPMA 1NAML 1ZT1A 4Q58C 4WCYH 4XNBA 1AGEA 4JM4L 3H7PA 1MCPL 4MDRA 1BYNA 3IDXL 4PJ7A 5D5MB 2E59A 2EDYA 5ESAA 1FQ9C 1RD6A 4EAEA 3KPRE 3LRGA 5B39A 4LT7A 4P49A 3CKBA 3DQVA 4FYRA 3VD1A 5LXHA 4M6NL 2O6FA 3VM5A 5CCKL 4BVUC 1WWWX 1J5OL 4DN3H 2A9DA 3K8LA 3KYMA 3TG5A 3HI1B 4JO2L 3BPCB 5ADOL 5I8CB 1XGZA 2WSPA 5J11B 3HFMH 2XEHA 3U6XA 3LQAL 1KJVB 2VABA 3U30B 3MUUA 2ITEA 5E6YA 3S5YA 3IJHB 1S9YB 5HGHA 1YQ2A 3AT8A 4Z3IA 1A3LL 1BYPA 2ESVA 1U95A 1Q72L 1TJXA 4R97C 4UIKH 5K39A 2PTUA 3CZEA 3U48A 4F7CB 1STEA 3OVUB 4PBDA 1TIUA 2H6UA 3LD8B 4HKBA 5KYYA 4XVUD 3MLUH 3EO9H 1IPGA 1CG9B 1UCBH 2AGJH 4AEHH 2X4SA 3G7TA 4EUTA 4JFDD 2MHAB 1RUMH 2BKRB 4AM9A 1KEGL 3ZLQC 1J19A 1MZCA 3O41A 2PKOA 5DJYA 2LAIA 2CHXA 2UY6A 2CGZA 2OTWB 3H56A 4WWMA 3ARRA 2R1WA 3ARDA 3MEKA 3TWRA 3BP4B 4JRWA 2AEPL 2HJ1A 4NZDA 4HS2A 1UW4B 2WXRA 3BWZA 5DMGC 4W9GA 4EUPG 1CCZA 1TZAA 2KX3A 3U1PA 3P3UA 2DQEH 2M19A 4P2YA 2A6DB 1BCIA 2J6EL 3P02A 2WAHA 1HO8A 2VC2L 2E0IA 5L8LB 4MD0A 4OF6A 4UV7H 5AW3B 1PYWA 5SWZA 5ICYA 2DIEA 3AG4B 2IH3A 4IRZH 4NQED 5C0ND 2EEAA 4M1GH 4M7JH 3NCFB 3ARDD 4HLEA 5IW1A 4HDIB 5C07E 1DBKL 3DKHA 2DAFA 1OAYH 3JTTA 4JG0H 1C7SA 1UKTA 3EYQD 3K72A 3ORJA 1ZHKB 2VLRA 1TPXC 4B7LA 1X6LA 2BOLA 3PE9A 5DS8A 3UTSA 2ZUQB 1OE1A 4KUZH 3PVLA 5B4MC 5AW0B 1FYTE 1CGUA 3KPLB 1R5IB 2FHCA 3OJDB 4PJFE 4DW2H 1FNVA 4B95C 1FT2A 2MRIA 3KPRD 4QWWD 5EFIA 4XKBA 5DQJB 5F7LB 4KKLD 2FSDA 3RVUD 4KAQH 4H4NA 1F2XK 4NO0D 3PHWB 1QFWM 3GSVA 3HC4H 1RZQA 1I3VA 3GBDA 3MJ9A 3PYCA 4OY9A 4UWFA 2D07B 4JY4A 5C0AB 5FQ8A 1BMGA 3QXVA 2IQCA 5EN2B 5L8JB 4PS8A 2FQFA 5KSUA 2DQGH 5IVXF 2PR4L 2XKUA 2UY1A 4QWWC 5HY9B 1UWGH 4R5TA 4A7TA 4NKIL 4HIHB 4KO6A 2BSDA 3WEXB 1YUHA 4F9PC 1LWHA 5IQMA 3ZL4L 3D2UA 2DQTL 4DERA 2GAZB 5EBMA 3B7SA 3SPIA 5FFLA 5FLVA 4HJIA 3VFWB 4PDXA 1CXLA 3HNSH 1ZDQA 3EHNA 2ARJA 3R7RA 1N0XL 4L3EB 3F58H 2BIMA 5LVEA 4MGXA 2GITB 4WJ5A 1XGRB 3LJ3A 4FFYH 4JFTA 3VXTA 4XT1C 4NQKE 4K7PX 1W3BA 3D39E 4YUEH 4X6FA 2ZOTA 5L0QB 4G43A 3N9YC 3D25A 3CHOA 1FO0L 4C4BA 3ATFA 3JSVB 5CSGA 4KTGA 1IJ9A 3GO1L 3LB6C 2F15A 3OZ9H 4RGOS 4ETYA 2XTSA 3WEAA 1J9RA 2PNNA 2J4BA 2Y3AA 1AYOA 4HGWA 4ODTL 1W0YT 4HKJA 4XMKL 5DUJA 4PLJD 5GIRA 5IP4A 2OM5A 3EYSL 1TQCB 5CEDB 2R1YA 2D3GA 1VRSA 3MLZH 4JHZA 4ONHB 2RPVA 1SGHA 1VJSA 3OJ2C 3GXMA 3EIQC 3QDAA 4JFFB 5C0CD 2IDFA 4DFHA 1EDHA 4OLYL 5JHMA 3HG2A 3K0WA 4XP1L 4XMLH 4BUQA 1MCRA 3IDYB 4FNLH 1D7DA 1KXQE 3EBHA 3MHZA 5FO7B 2XICA 2NZ1A 4S17A 4H8HA 1KLXA 5D94A 2OI9B 4APQA 3QFJE 2CJSA 2X5PA 1TNUA 2J09A 2NY3B 3ZDXE 5KJ7E 5T33L 5DQ9A 4ZMXA 4MLSA 3CZFB 3NCWA 3UUXA 2WVVB 3GBML 4NWTH 1K5NB 4H25A 3C0RB 1OUVA 1CIUA 1G0YR 2VR7A 4LSDA 4YDIL 4Z7OB 2KVZA 2B0SL 1K4DB 4HS3A 4QYOB 3R4RA 5T3ZE 3F6JA 4F58L 3BKJH 2YD9A 4X99A 2GT9A 2ZUUA 4JO1L 3SE8H 1NBQA 4FMKA 2BPSA 3QIBC 1C8PA 5DHXB 3ZHFA 3NRZA 4PRPA 1L6ZA 5EUKB 4BZ2H 3IDMB 1F4AA 3T0AA 4KXAA 5D1QE 1GH7A 4YFEA 5A2BA 1LE9B 4P46C 4AQEB 5C9KA 2APTA 2F1AA 4KDTA 1U3YA 4NO0A 4GSDH 1II4E 5INCA 3UZVB 3TGXA 3FFCA 1KZPA 2Z34A 3GDBA 5IB5B 3ZYZA 3QEGL 4K7PH 4N59A 1JGVL 1WBYA 1XF4B 5SX4I 2KTFA 1JWFA 3QXAB 1X5KA 1AKJA 3NFNB 3OXRA 4Z95H 4YDJB 4B7IA 4U07A 1FPTH 3PHQB 4ZPVA 1T03H 3MLVH 1WD8A 3ZTCA 4JG1H 1VFAA 4JG0L 4TS6A 4GTTA 2KTRA 1Z32X 2LNIA 3TONA 4F7KA 4UM9B 4NHCH 5AKVA 4KQ3L 2WJ5A 4MB4A 2QDVA 5TDPB 4KV2A 5K9QI 3INOA 4OAWB 3TBWB 1EBPA 4QO1B 4KTEH 2GSGA 3V6OC 2IY0C 4WFHE 1WX7A 4X9BA 3WAOA 1OW0C 3L4ZA 4V1DB 4GA0A 4BAXA 4YWGL 4ELME 2CU1A 4LLAA 2MOQA 3UKUG 3ARXA 1M05A 2X3MA 4N9OB 1ZE3C 4G59C 1K3IA 1OD7A 5I6OA 3NSFA 5KYNA 1PYWB 3QNKA 1LP9B 4P2RB 5SWZB 4DF9A 1WY8A 4A1GA 5E8OA 4PGEA 5I75C 1ROEA 3SGEH 4QHPA 2E9BA 5AW8B 2EECA 2OP4L 2JRIB 4ZMPA 1B9ZA 1S3KL 3FFLA 5B1AB 4X9FA 1XCQA 2J5LC 4GSRA 2BH0A 2WZ6A 3K6DA 3V5DB 3AY4C 3HVDA 5LBSA 2DLFH 2YN3A 3SCMB 3ZRCC 5IROA 3JWNH 2VZ3A 3HAEB 1SPDA 2CRIA 4R97B 3QQ3A 3MO1B 3MRIB 3EJCA 4I6PA 2Z8WC 3ARQA 1RZ7H 1RUPL 1Q72H 3F6QA 2X70A 3WJJA 4P2QB 3WD5H 5J11C 4RFNB 1BA9A 3NY5A 4WO4C 1C4CA 5DFTA 2PW2B 1JZHA 5CMAA 1IBBA 1WM3A 5B4MD 5DC2A 1B88A 1NGXA 3OHXB 3ZT5A 5IWLA 2PABA 3I9PA 4NQEB 4QT5B 3GJEA 2EDHA 4UNIA 4XTRC 3K6IA 1I1FB 3NCMA 5D4JA 5FA4A 1R1CA 5E5RB 3EHBD 1DQDL 5BZZA 4D3CH 3AECB 3ZRFA 2KC7A 1T7ZA 5J06A 1XTLA 4LLVB 2L0FA 3UJIH 3L16A 4EKXA 2JXMB 4FEIA 1TJIL 1ZVHA 2NX5D 4L9PA 2ZPNA 5DJ0B 5FR3A 2PCFA 4OZ4B 4J5VA 3D9HA 2UXVA 3DTXB 2LEKA 1J7CA 2UXGA 2VSMB 1BD2E 1DDHB 1ETZB 1OQYA 3RY5A 3VRAB 5T3ZL 1F86A 4CSPA 2VLJD 3D05A 2XPGA 3BKCL 4XCNA 2F9BT 4WW1A 3NG5A 3WY2A 3S35H 1N5YH 3L8QA 3NSDA 4FC3E 2IQ9L 4E9WA 2APBA 4ZX5A 5EO9A 4DQOC 1XSIA 3PY9A 5AZEL 4KGTA 2VC2B 2QL1A 5ACLA 1B9KA 1OAQH 1BF8A 2ZJSH 4R6UA 4YH6A 4B0EA 5EZJA 2C9WB 3DXAD 4BT9A 4O2FB 5ERWA 3GXUB 4E74A 3IMTA 4AYID 1SF3A 2DZEA 3AT0A 4KUCF 3JYBA 3O9WC 2K3UA 4IM2A 4L0ZA 3M3JA 1KBWA 3VXRE 4PLNC 2EUXA 5TPWH 1ODUA 4BBWA 1MLCA 1QBBA 4PRID 3T1FB 4I2XA 1WAAF 4KROC 4WUUB 4YDLB 3S34L 4B3VA 3DHUA 3QEHB 4P5RA 3ILQC 1GB1A 3ARGB 4XNMA 1N59A 5T33H 2KLRA 2B08A 1A6TA 1E9QA 2NXZC 3HC3L 4QRPB 5L7XH 4OZAA 5EA0L 5F6HJ 4M03A 3ZGZA 5D4IA 1F4HA 3MLSH 2P5WB 4W6YB 3U83A 1MCFA 2GJ6B 4ZNEE 2O5NA 2J1ZA 1NGWB 1E28B 1D9KC 1HL8A 2A38A 4N28A 4Q94A 3AXIA 3WHE0 5KG9A 2OJZL 4M8RA 4YBLC 2PLPA 3N44B 2E7CA 3VDBA 4HFUH 4XPFH 2IO2B 1NCNA 4FQIH 1HU3A 2K5PA 4HALA 1U8MB 5CINH 2XQYG 5E6ZA 2YAEA 1WBZB 3X2QB 3NS8A 4L1SA 4HIJB 5IFJA 2J1WA 1YMMD 1AG0A 3CGTA 4MB5A 3SFYA 4P9ML 2IOMA 2IGLA 3GO1H 1IE4A 2IADB 4MXWL 1HA5A 3KQ4A 1VACB 5BRZE 2OLDA 4KMTH 2IWGA 2FYVA 2BRQA 4LLUB 4K71B 3H3PL 4U0RB 2L3BA 4G1TA 4ZS6D 4FG4A 3U0PB 4C55A 1LQSR 5C8JB 3ULVH 3B9VA 5FZSA 1DQTA 1R3LB 1MCIA 4JPKH 1UWEL 4JKWA 1FYTD 1NOLA 1KLGD 4YQXH 3FU6A 5HYFA 4GW5A 1QNFA 2F7IA 2GGFA 4AXWA 3CQQA 5JW3H 3AMZA 3ZE0E 5DVLA 1Q90A 3MRNA 4RMRA 3TFKC 3TVMC 3UOAB 3T3PB 4DJMA 1RPUA 1WISA 4KV5E 2P80A 2NY6D 1KXTA 1ASOA 3VI3A 2KQ7A 2VSXE 3ZGIA 3WEBA 4CDNA 1RPQA 5EIIB 4IS6B 5CEYA 1OAQL 4DQAA 1CI5A 5JIMA 4RG6A 3BKML 3FQXA 3H9ZA 5GRVL 2WWNA 1G6JA 5ANMB 5CSZB 1LXMA 2WZ0A 3MNVA 3LSOA 1JUQA 2AK1H 5EN2A 5B1CA 1AYRA 4LASH 3HRAA 3FCUB 4M1DH 3EYVB 1S9XB 2NW3A 4TNEA 5IQ7L 5HJGA 4WSKA 5IOKA 3UTTB 2X44D 1HYSC 2A5EA 3DO4A 4J4PC 4HHAA 1RCYA 4XIFA 1A7RH 5DD1H 2L52A 1SQMA 3BZ4B 1OP3K 5I1CH 3ZKMC 1ZGLB 2Y9RT 1FLTX 4AV0A 3JV6B 3X17A 2YQ8A 4QKTA 5KBNC 3KW5B 3EO0B 4BETA 4N0FB 1ET7A 1KJ2L 3DURA 5CGBA 4XO9A 1TVHB 1DN0A 2GBAA 3D3VD 5KOVC 4P5MB 3ULUD 1ADQA 1ZXQA 5I16A 3P4QB 4BCXA 3WN6A 3WLWC 3CE1A 4HHGA 2FT6A 3LRMA 2WBWB 2AERT 5DPRA 3F5WA 2F8IA 4YXDB 3KGSA 1RUQL 2FATL 1LM8B 3EFOB 3RNFC 3ZTCC 2UUDH 4LNRA 2TSAA 5JXED 3BKMH 1N18A 2X87A 1KGXA 4RIRB 2Q5WD 5K59F 3UAJD 1SYVB 5AB9A 4MBGA 2YPVA 3JWOL 4G8IA 5DMYA 4II2B 1OP5K 3D9KA 4AJVA 3DO3A 2WY3B 1D3CA 4HU8A 2IADA 3W11C 3FQ2A 3FUNA 4O1OA 1FCHA 3VWKA 2ZUYA 2UVFA 1RAMA 4W81A 3CVPA 4ZAKD 3N3EA 3WBDA 1KB5L 1FNHA 4LESA 4XI9A 3EJSA 1H6KA 5HYQA 5IFAL 1JOIA 1D9SA 4OZGB 2OMNA 3DTXA 1BT0A 2BVCA 4NJAH 2FBNA 3D0LA 5CHFA 1XGWA 1TQUA 4OLWH 2X4OA 4AIEA 3QUZC 1FO4A 1TIFA 2DM4A 3C3RA 2HH0L 2OA9A 3CQPA 3MLUL 4CRPA 3LRHA 1AGCA 3EHMA 2OP4H 5GGTL 5IK3B 3WO4C 1ES0A 3L3DA 3KSQA 2XWRA 5FOBA 5BPPA 4FS0A 4OV5A 1OXYA 2RAMA 1T4WA 4PWEA 4P06A 4E2OA 1U92B 7PCYA 4R0LB 3SSGA 5JDSB 2LGNA 3S7JA 5HJBA 3B2XA 3B3BA 4GDLB 1LD9A 3C5XA 3C6LC 3GZOA 5T1DL 1FM0D 2DQUH 3SOBL 2NCEA 4XWGL 3P54A 1DE4A 4XP4L 1Y18A 3VXUA 3N3KB 4Y4HB 4PGJA 4CC1A 2FT8A 5ALCH 3CLWA 3ZK0A 1LQBA 5KWDA 1GZPA 2EINB 3MX0A 4KWUA 2PPFA 4EN3A 1WFTA 2ICEA 4ATGA 5BYQA 3FB5B 3H4FA 4TNWK 3H9SA 1AXIB 3E6FB 4Y1SA 3UMTA 3KYNB 2ALWA 4K9EL 4N8CH 1SIJA 1LEKB 1FNSH 3E34A 2E2EA 2X4PA 2VN5A 4DK6A 3RTQC 2CUAA 2ZW1A 5KSAB 2A1WL 4KKAD 1JP5A 2Y5TB 4IWOA 4J3XA 1DEEB 1FO0H 3NMEA 4GAYA 3MYVA 5JQ6L 3W39A 4EN3D 2ZXWB 4WI3A 1INZA 3HBPA 2BXZA 1WA0X 2FX8H 4WFHD 3UC2A 1QF6A 1OT2A 3ZYMA 4GW4A 5EUOA 3HIZA 3BUTA 3LDZE 1T0OA 3NEXA 4L4TD 1UQSA 3SDXB 2V7NA 3F85A 1A6WL 4OIAA 4R26L 2RDHA 3BVNB 5D6CB 1XVSA 3IFPB 4EIUA 2FX8L 1XGUB 3W82A 5FUCE 2HAZA 4LBEA 5LCWJ 2DAVA 2IQ9H 2Z59B 1NIFA 3D39A 4JFQA 2YOCA 3GW4A 3SJVD 4CNIA 3Q6BA 1G7LB 4PJHB 1A70A 1KB5A 4Y4KC 4W9CC 5BUGA 4DP2X 2JIXA 3ESMA 1YNLH 4B9GA 5IOPB 4Z8FL 2ZCHL 5E99L 1IEAB 3OF6D 2VITA 1XGYH 2HYZA 3O9WD 4YXHH 2BWQA 4C4UA 2WYZA 4U7KA 4XMWA 2ZP8A 2MYOA 4HK0B 3MV3B 1WAAE 5D96C 5C70A 3BGMB 1D5ZC 2WP3T 4NUMA 3BVUA 2HFEA 1HEZA 3SCMA 1UURA 4PJ8B 3E6FA 3L3DB 2J0KA 3MJ8A 3QZOA 1WFYA 4EIZC 3MRIA 2WUBH 1UA3A 3IMRA 3BRFA 2UY7A 5I74C 4LSQH 3D85D 4A3TA 5FYKE 5FW8A 3PEVB 4YBHA 4FABL 2QMTA 5I17B 3M17A 3C72A 3RTLA 3ZO0A 5I6LA 1MFNA 2WMPB 1H8SA 1ZT4A 4V3IA 4RAUA 1BU9A 2X9WA 1GGCH 3BEWB 4OCSL 4PTTA 4NT6A 1HL4A 2I07B 1MRDH 4H8WH 3Q1SL 4WU5A 1FYTA 3PU7A 2YSTA 1GW0A 5ILTH 4CC4A 1GIGL 1I4GA 2E27H 1RZ7L 5SWQB 1JWUB 1IV8A 1X7QB 5KSBA 2F8YA 5CF3A 3H9SB 3OBAA 5ADPH 2OSWA 1OD9A 2DQEL 2H45A 4KX9A 5CFAA 4ODWA 1UD7A 3AQDA 3EHBC 3P4PB 4P7IA 3AACA 2MQGA 4UQXA 3K6SA 1UKQA 3P2TA 1QR1A 3U7ZA 1UWYA 4EVNA 2YMXH 3UL4A 2FR4B 2XI9A 3FT1A 1MQKH 2IF7A 3MA9H 4FFZH 1GTFA 4YHPB 4EOWL 3VTVA 5DRNA 4MDKE 5I0ZA 4NQ0A 2YD7A 4JPKL 4L9DA 5GGQH 4AEIH 2LAGB 2OL3A 3G6DL 2LJIA 1UB6A 4LNUD 4YWGH 2PXYB 5LGJB 3C19A 1J9SA 1F13A 1U21A 2Z65C 1SNRA 4IRSA 5LJYH 2CPUA 3FKYA 4AV5A 5L4IA 3DPBA 5TD4A 4ICXA 3VFKA 3F7PC 1C08B 4GBXC 3SJVE 1NGPL 1F6AA 1FH2A 1MVFA 4GRWH 5F7FA 4MDIA 1ZTXH 2BSRB 2CUMA 3QWNA 4IU3A 4FG6C 5JO5A 4K94C 4JHRA 1MUJA 2FCSA 4GUPA 1DGJA 1EGJA 3QP3A 5E4EC 3PJLA 2PO6B 3KBFA 2JFCA 4XNXL 3MJ7B 5EC2A 3RWHB 1T04B 4YS4A 4OCXH 5F96L 1RAXA 2HPOA 5AQAA 4XX5A 1TENA 2YUXA 5EPMB 3BIID 2GEEA 3IGAA 3LDBC 3Q3GA 5FCUL 4X5XA 1RP9A 3GSNB 5DMJB 4GQ9H 4Y2NA 4A7QA 3RGHA 2V1YA 2AQ3A 3MACL 1LDSA 2DPKA 2K6YA 3X2QE 2K8MA 2EE6A 3C6SA 4LVHB 5CSBA 1I8KB 4JB8P 1BJ1J 4LVOB 1HQRD 3ATEA 2DZIA 3RUGE 1SYSB 3W0WA 1I1AA 4DUWA 3OAUH 1F2RC 2R9HC 3S8GB 3NJFA 3NCJH 4JEUA 3BX7C 3BVGA 2XPZA 3C3OA 1JUFA 1PG7W 3DVGB 1SJVA 2JLPA 2FGZA 1AACA 2OL3B 4PJEF 1GY2A 1YZZA 1C8QA 1W6WA 5D6DA 4AIZA 4JRXE 3GZSA 4AQ7A 3SODB 3UAJC 5BVPL 1JHTA 3C08L 2PP8A 3MCKB 4S2SB 1KEGH 5JYMA 3HE7B 1FXTB 4J6RL 3MFGB 2EIDA 3MBEC 1MW0A 4BZ1A 4KY1H 3PIQB 2CRZA 3T3PE 1CF8L 4NS0A 3TT3L 2VDMH 5DI8A 3AWGA 2O5ZH 4XP1H 1C5BH 5TDNA 5I18H 5MENB 2B14A 1V3LA 3J5QB 4KXDA 5GJTH 3KCWA 4GZDA 1TY0A 1AC0A 4A38A 4B9KA 4UT9L 4WUYA 3MRRB 2NRDA 3V9EA 2VSYA 3SY2A 1J86A 1QLEB 3IFNL 4AZ8B 3O6FA 3MRNB 3OMAB 4P5TC 3ZXSA 2C9RA 5AW1B 3DDFA 1H3GA 1T7XA 2BNQA 3EJRA 2EDJA 4U1KB 1JYNA 2WXKA 3L48A 2BFGA 2DQDH 5F7EL 3ZSTA 4AVHA 4DQOL 2VGLM 1KPSB 1BM3H 2CMRH 1VPOL 4Y2OB 4D3CL 3ABZA 4HEMA 3GSQB 1J8RA 4RWYH 5I0DA 5HHOB 4OHJA 4MA1C 3HOGA 3V61A 4YDMA 1FWXA 4V2CB 2J8UA 5DD3H 3I6KB 1LEGB 5CWSB 3RX7A 3A1QA 1AWCB 1KFGA 4LVNB 5EIBE 3DSXA 3NRQA 2BP3A 4OZIB 3A4RA 1O5PA 3CN4A 3MCKA 5GZNA 3TL5A 4LLDA 3SYAA 1OFFA 2X6FA 2RDGA 3UINB 4UI9J 4AY5A 2HN7B 2WCSA 3PV7A 5CP7A 5DJAA 2E4TA 4JPWH 4KKNA 1G7IA 1UFGA 4UQEA 4X4XB 3IDJB 1TVHA 5JJ7A 1R3KA 4EBQL 3ZKMD 1LO2H 3T3ME 1O7DE 4DTGL 4RFOL 5FO8B 1MFEH 1T0NB 4DX1A 2CDGB 3EH1A 3SZ6A 4KK5D 5FM8A 4P23C 3B3IB 4FKHA 3ROOA 4HMCA 4YSSA 3GP7A 4URKA 1OHQA 1TS3A 4QNPE 2VDPB 4J1UB 5E56A 1L9RA 2APVA 2UV3A 1JTOA 3QDHA 1XEEA 1VLXA 4HUWA 3C8HA 3RPKA 2HTHA 1BSIA 5FK9B 3AQZA 3HE7A 3RZCA 4KTEL 4JHUA 4PP2A 4E41D 4LHUG 2WJ7A 1HS6A 3MV8D 1N64H 2J88H 3II3A 4P0DA 5HBBA 1AG6A 4L2LA 1CG9A 2ZX9A 3PWJB 3RGVD 1U2VG 3T65A 3TBTA 3ETBJ 3QK0A 2CG2A 1Y1DA 3Q4AB 4MZ3A 3EYOA 1SY6A 4CN4A 3LNEA 3APCA 1E40A 2Q20A 4KDLB 3GRBA 1JV2B 4JRLA 4N20A 1V8HA 1YVLA 2BO0A 3KBHE 4L4VB 3FOLA 5FKAA 2ZD0A 4KJWC 3ILQD 4KVCL 3VRJB 3VU2A 5IIEA 1DANT 4OVVA 4FTVE 3WFCL 1UD2A 2VJ8A 3MMEA 4OF7A 4JG9A 1S2EA 2LU3A 2YD4A 4M61B 4A6YB 4QLRA 5J13C 1VGKB 3N1QC 4I18B 2H2SD 4K15A 4IBQA 4LASL 2BEDA 2FH6A 1PS3A 2MQ3A 4GKSA 4IOFC 3IKCA 4JUTA 3ZHDA 1EAOA 3HNVL 1DQQA 2K1FA 3ARDC 4FADA 2NSXA 4QTFA 2NTSP 4WI0B 3FTYA 1FIEA 1BD2A 1HI6A 2MOGA 5FHAH 3ZJTA 1SOXA 4N0YH 5LGHL 5KVFL 3AE4B 2GMIC 5ARFA 3IMSA 1DJSA 1LK3L 4PWFA 3Q9PA 2WQHA 3VX1A 2PPCA 4Z7NE 2ID5A 3SKMA 2BNUB 1EJ8A 1MWAL 2YZ1A 3VNYA 5A6MA 5L9DL 1BXUA 2NR6C 2YPVH 5MHSD 3ZTNH 1T0SC 3ISRA 5HHMB 4KH2A 5DXWA 4EKJA 1TKYA 2ZYRA 4E9SA 3AG1E 4N2LA 4N3BA 4XWOD 5CP7B 2IPTH 2RFMA 1J11A 3OAYK 3OQ3B 4IBTA 4LO9A 5GRWA 3W11D 1R0AL 1GGUA 1JAEA 1JXDA 1CDUA 2QTVA 2VIRB 1KN4L 3VSVA 3EUB2 2BSEA 1D5IL 2RQEA 1INQB 4R96A 4UAOB 1LGVA 4WWKD 1L6XA 4PG9B 4Y9FA 2BNRE 5C3JB 2FO7A 4PS7A 5EC1B 3U9UB 2X0WA 3HUJF 5TE6L 3T3MF 3FQRB 1MCSA 1BQHG 2VLKA 2YN5A 4A6QA 4I88A 1R5WA 2XJLA 2L7UA 4P4KC 1IQDB 2RMMA 2QZ5A 4AUJA 4NQLB 3L0WB 4HLLA 2Y0SA 4P5TD 1LO3L 2YHGA 3CVYA 1IGJA 3CSPA 3VVVA 4AUQC 4CVWA 3Q8CA 1EUVB 1XBDA 1OGTA 3B0AA 2K0PA 1P6AB 1S5HA 1AVAA 4MD4B 2E7MA 3IEAA 4E9QA 2B0OE 1A0QL 1PAQA 2HDEA 5IBLD 4XEIG 2QIEB 2W0FA 4XN7A 1AXTL 3LY8A 1KTRL 3PWVB 5TK2A 4QEGA 3C08H 3HNSL 1H2TC 3PQYE 1L0PA 4QRQB 1FCCA 2WSDA 4PJAB 3TV3H 4K8RC 5T1LB 1XF5A 1LO0L 4JDZA 3WFHA 4AGLA 5K9JL 5B39G 4LSRL 5AAWA 4GI8A 2E7BA 3HPJA 2FWOA 3V5HB 1WM2A 4UI9K 1Z9MA 3BPLB 4HLZH 4Q0XH 4ZW6A 1W0WA 3N85H 4ZW3A 3JVGA 5EO1B 5BZWB 4B97A 3AZUA 3ETTA 5GGUB 3DIDA 4PRBB 2ZCLH 4S11A 1WMHB 4KK8C 4YL8A 3VXWA 1Q10A 3NA9H 4ZO9A 4HS8L 4XHQA 4PP1C 5FPIA 4OBRA 1HTOA 1NGQH 5KSBB 4IUMB 1CXIA 4UOQA 3IHVA 4I6GA 1J0GA 5G4NA 2QJLA 1IKFL 4Y4KA 2AQRA 4DW2L 3LKNA 4PGBB 3H9HB 2ED8A 3MRLA 3S6CA 1EXHA 4FLBA 4JZNB 4TQ8A 3KPSE 1AQDA 4XMUA 4E3CA 4PGCB 3RNQB 3WHXA 2Y7QB 3QQNA 4PG2C 3NIGB 1ORQB 4LVNC 4A37A 2DQHL 2G5BA 4H26A 4U33A 4MJIB 1VDYA 4YHKH 4D7BA 2LVQA 2QCZA 4YSXB 5AW5B 2Z8RA 2ZIRA 1GUAB 1RJLA 1QBLH 3FCTB 3LH2H 4EFOA 2N0KA 1J5CA 3PWVA 4XN2A 2BPBA 1BQRA 3BDYH 3VRIB 3US0A 4L1HA 5AVZB 1A6UL 4KXZH 4B41A 3UROR 4B94A 2O5YL 3P0VL 2IPTL 4XAKD 4P23D 4JFDE 3LS8A 4XCFH 5BXUA 3DV4A 5LXVA 5KZCD 3LHPH 3KWWA 1SBSL 3L5HA 3QDGE 3VXMA 3TIXA 2LUEA 2VERA 4XNUL 4ZOBA 4UNTA 2FO1A 3IDNB 3ILEA 1L5JA 1FFQA 2BNRA 3DUHA 4MZIA 3SGDH 4I85A 3ZMNA 1JYVA 3C5RA 1AY1H 1WS7A 2QKSA 1DTUA 3E9UA 3QOUA 1CF1A 2J9QA 1QFUL 4PJ9B 1A1OA 1YQBA 1NFIB 1KIRB 1WDYA 3FC8A 2DQGL 2B3RA 3BPOB 4K23H 1AFVH 3ASOE 2ZXQA 4PJXE 3GEWB 3M1CA 4HWZA 5JUEH 1YY8A 4G8GA 2P8PA 2JF5A 5IR1A 2OEDA 4HPOL 5D55A 1BVKB 1MG4A 3O8XD 1NL4A 4UM8A 3QUMH 5AKRA 2OJEB 1Q5WB 3D9NA 4RMAA 2HG5A 1SEBA 4N2GA 1EPFA 1CDYA 4AXHA 5I1HH 3TF7C 1ZWIB 1X9QA 1I8LA 2MCMA 3BRDA 5GRYA 2H2PD 5CJXC 4MD0B 3NFNA 2BHUA 3OXRB 5E08H 3AREB 4EQFA 1UT9A 4MJ6A 2BQQA 4G83A 2K8QA 3MRDB 5BS0B 1UGJA 2M8SA 3BJ91 5AD0B 1OIOA 4TMPA 3VFTB 4KHXL 3L7FB 1PW3A 1MQ8A 1Z5HA 3KW8A 1VA9A 3BQUB 1QOBA 5DJDB 4IMKA 4NFCA 2KWCA 5EEWA 3F6IA 3FFCD 1XGPA 5DO2D 4YXLL 5T3ZD 4YOKA 5CZRA 4C58B 3D51A 5DJZB 4MCMA 2NY7L 4ELMB 2R05A 1IM3D 4F9PA 4HXBL 1GG3A 1UT2A 3R4DA 1W8OA 4RAVA 1CFBA 1J8HE 4BK8A 2YXVA 3AE1B 3SO3C 5D1ZI 4BD4A 3WUZA 1NUFA 4CGWA 1T1XB 3MU3A 1MWAA 1UB5A 1CE1L 1PL3A 3FYEB 3VFOA 5AG9A 2X6KA 3QQ4B 5LXGH 1KJVA 3SIKA 4G8KA 1A6WH 4IOSA 5CIPH 3VB8A 1C12B 2FWUA 3UQBA 4WF7A 1WF9A 4RFBA 4JM2C 4MSMB 4FERA 4ELMF 4RISL 1GOZA 1OOAA 2L1AA 2KCVA 4NZJA 2Z93B 1MRFH 3DX0A 4GRLB 1JPTH 5C07A 2AEIT 1OTTC 4WNEA 4PY8I 4U3SA 3CHQA 4JO1H 3NACL 3O4ZA 4R84A 3PRZA 5IVXE 2XDHA 1HKFA 1EDYA 4LRNL 4KRPC 5EU4A 4DWHA 5HHNB 5T1JA 1WZ3A 2GQHA 4HUVB 3LHPL 1HAUA 4NJ9H 3FB8B 3LPOA 1D7CA 4ZMLA 3QARA 1S0PA 4MXQD 2OTWA 2QBWA 2HT4C 2PCPA 4LSTL 1J05A 3KVQA 5D1XE 1EAPB 1L9PA 4LG6A 1DEDA 3BVDB 1IM9B 1W2KT 3GSXB 3QZWG 2Y6SC 4C56A 4RWYL 3BVTA 4R7NB 4JHWL 4HF5H 3R0MA 4UM8B 3FH5A 1GL4B 4PJDE 4CMHC 2KDGA 4CVXA 5H4ZA 5KAQG 3FRPB 2P9LG 3GUTA 2A9NH 2JJWA 3MUJA 4IU2A 4K3BA 1OK0A 3LKSB 4FG6D 4L37B 4W4OC 4ODBD 2A74B 1WZAA 2R02A 4EIBA 2IDCA 1CDIA 3AFLA 1BAFH 3EOBA 3FFOA 5KJKA 2C0LA 3ZYQA 2CKBH 5ALBL 1AR1D 1N10A 3AG1B 2BUGA 4LHUA 4BJLA 3VFOB 4KK8D 3VFSB 4OUUA 5I0YA 1JFQH 1GJUA 5FO7A 4FCHA 2WOYA 3AU1A 3B34A 2AJSL 4MSWB 3KVFB 3D9PA 1DQLH 4KIKA 2C5DC 1I8IB 1PX4A 5J1AA 3HVEB 1F3DH 4NYLB 1FIQA 3RA7L 2UUDK 5D2NB 4YDYA 2KXJA 4F7AA 3OQRA 3Q2AC 4IULA 4UUJA 1CJAA 1E7UA 3GYZA 4FYTA 1V55B 3N1GC 2HJ8A 4PJ8C 3RB7A 3ZNHB 3PGDA 3AGWA 3LRKA 3I2CL 1T2QH 4JGUA 2NNFA 3TNMA 5BV7B 3SYQA 1P5UB 4MQ7A 1L0YA 3V0VB 3ZTDC 4IK7A 1SBBA 4YHNB 5DGRA 4B93B 1U8IA 1FSKC 2CR6A 5DUMH 4GI6A 3EIFA 1ID5I 2IALB 4XN5A 1HDMB 3DC0A 4E9XA 5C6TL 1PZUB 2FUG1 4JB9L 1IM9A 3GSXA 4ICWA 3RVXC 1IAII 2L04A 2XG4A 2VSDA 4UZGA 3ZOAA 5I5MA 4EKUA 1CGSL 3U7WH 3W57A 5H2BA 3FFDB 5FHBH 2ADFH 4NX0A 4YK4B 2G2PA 1R34A 4WK4B 1ITCA 2IAND 2VDNH 1E4KA 3URYA 4Z5RA 3T5XA 4P57A 3FSZA 4F1SA 3NEOA 4K2UH 5HHOE 1QI5A 4ZTOH 4YN3A 5I6XC 2KO3A 4Y9GA 4ONFL 2BNRB 1JGDA 3PHQA 5KSBF 4L9LB 1MIML 2Q7AA 3U7YH 4PJ9A 1JGUH 1Q0YH 3CFJB 3ARBB 3T08A 1H4RA 1WXAA 3D85A 3IS0X 3KPQB 5GJSL 3QT2A 3O2WH 4TNFA 2LGXA 4DLOA 4KKCC 5TGBA 4C56B 3A6CH 3VU1A 1BOGB 3PXJA 3RP1A 2XPYA 3WNPA 2GFBB 5CEYB 1KT1A 3W9EA 3L1OL 4TUJB 3GMPB 3F62A 2XXGA 3TJEL 4MMXA 1E65A 2WB1A 2FSEB 2AVPA 3KYOA 3VJ6A 2C5LC 3WKMH 1FD6A 1GC6A 2WXPA 4FQXC 1HH9A 2XXMB 5GXGB 5CHVC 4M1CC 4Y4HC 4N2IA 4Z3JA 2R4RL 2IFFL 1I1AD 3QORD 2K4AA 1GZHA 1MFBL 5KVDE 3L6FB 5GSRB 4GYYA 2OMWA 4RFEB 4F8OA 5FV1L 3RCZA 1NBFC 1TKWA 3CK8A 4W6WB 5KYWB 3D39D 3INUH 1FFNA 4P5KA 4GYOA 1QRNE 4H25B 5E2WH 2ZG2A 3QPXL 1Q4NX 5CMYA 4I4WB 1UWGL 2HT3D 3BP6A 3O13A 4WNJA 3RWJA 3BDXA 5KBDA 3LN5B 2B39A 3QUZB 4LLQB 3O3EA 2O6EA 5C1ZA 4H8WL 1CL7H 3WTUA 4L8SC 2LI5A 3NFPA 1U2YA 3VA2C 3Q69A 3RE0A 2XRAL 2FE0A 3D8MA 5FYJH 1LM8V 1MFCL 3BT2L 3GEFA 3TAXA 3QIJA 3EH4B 3T09A 4RA0C 1BFVH 1LO4L 3BW9B 1YMHB 2YPLB 5J08A 4APQD 4I1RA 4IRUA 4XNDA 2Y25A 5T1LA 4CW1A 4PJCE 1UWXA 4KJPC 2YD2A 3LVQE 3ZUNC 5D0QD 4LU5L 3F7LA 3CVHA 4N0FA 4J3OH 3L5IA 4J39A 1CFMA 1M57B 3GRWL 3CVIL 2NZ9C 4P57B 4YDJA 2DCPA 3AAZA 5M95B 5KG9B 4NBXB 4ZPVB 4ZTOL 3I6SA 4ATWA 1QWUA 3RBGA 1TQTA 3FB6B 2XQ0A 4HWEH 3MV11 5I19L 3BIBX 3W5UB 1P7KA 3D3MA 4ORZC 1ES0B 1RURL 5E1AB 3WJMA 1EEQA 2IZVB 1T4KB 1NBZB 4Z8FH 4AITA 4OV5B 2DWTA 3AXHA 3IXTA 4R3SB 3MDJA 4ZO6A 4IQHA 2WZAA 4KTDH 2CO6B 1BF5A 3ARGD 5KJ4A 4ZSOB 2I5YL 1TVBA 1B2YA 2W60A 4LQ1A 3HBQA 3Q8EA 3BP6B 3U66A 4BKTC 4HRSA 1NFDE 3AWFA 1KGYE 1A6VL 1IYGA 4XPBH 2IVFC 3P9MB 1MFEL 1HJBC 2PL2A 1GHFL 1OCWH 3ZYKA 4AIOA 5L2KE 5D7JB 2DM3A 1D9KA 1Z6JT 4L1DA 3GJFB 3QDJE 3DUUB 2R5SA 2YGOA 4M93B 3PWUA 1A6VH 2I9TA 4YIQA 5JQ6H 4WJKB 4GAGH 4YE4L 2F54E 3AU1B 2WQXA 4KIKB 5JIPA 5CBOA 4G7VH 1P84K 3DO7A 3D3VE 4QLWA 3MTRA 2W81C 4R4ND 3W9FA 1CFTB 1UA6L 4OT1L 2EICA 3ZDWA 2AW6A 3DHPA 2KZTA 1WP6A 2Y5TA 2DTMH 4NQSA 4F5CA 4FTDA 4CU8A 5D1XA 3QDNA 1ZS8A 2NNAA 1CU4L 2WKOA 3UBXG 1M53A 3MOAL 4IIZA 3UYRH 3MV8A 3DMMC 3S37L 3H8HA 1VCBC 3M8OL 1VIWA 3ZYLA 1IAKB 1JNLL 3LV3B 4OLYH 4XWGH 3CCHB 3VXSD 3JUIA 3EGDB 3U8ZA 1IGFL 1U6AH 2VLRD 4NZ8A 4HHAB 3UYRL 3WKYA 3U4EA 2C7NB 4D9QD 3B9AA 2DWZA 4YXKL 2HMID 2JQZA 5ARGA 4LSVH 5G5DB 4DFIA 1QWNA 2IDTA 2NY4B 5C08B 3ECBB 1PG7X 2FUTA 4UT6H 4AUYA 2R2HA 4K3EL 2BS3B 4M48H 5DJ2A 3MKRA 4G7VL 2X4QB 3MXVH 2P8MA 4FLQA 2YOAA 1UTDA 3GLEA 1ZCRA 2AXUA 3KHOA 5BMHA 2P9KG 5FZRA 4FNUA 1IVLA 4WGVB 1GGTA 2WQWA 4O2EB 2LFIA 5BYSA 3D85B 2PM6A 4BX9A 2BT6A 3PJSB 4Z23A 2F8XC 1SJMA 2HT2D 3FTGA 3TWUA 1NM4A 2NXZB 4G24A 3DVNV 1O5MA 3STLA 1CE1H 1MLBB 3CXFA 2NTTA 3LB8C 4NUPA 1K6QH 2AJUH 1X5AA 4MKMA 3CGHA 1OANA 2O6VA 1UG9A 1RW2A 2KMWA 1JHKH 3R0NA 4LCYB 1JGLL 5GZOD 3BKCH 3CQGB 3ULUH 3WTXA 1TZHA 1U8QA 2DWXA 2FD6H 5LDUA 1ESOA 3B9KA 4Z7NB 4J28A 1TF4A 3ZTDA 1BV8A 4NN7B 2X4OB 4OZHF 3TA3D 4DHLA 1IQWH 1NC4A 3ZKND 2R2BB 2DBAA 3T1FA 3BN9D 5HVGB 2W0LA 3JWNG 3ASNE 1XB8A 3PPEA 3QNYB 3VFRA 3VTXA 5JHDA 1RU9L 2E5EA 3WUWG 1KCRL 5JPNA 2C34A 4PVBA 3WUWB 3MRCB 3ZDMC 1BBDL 4FQQA 2XA8H 4X8CA 1DJZA 4ZFOB 2NY1C 1RK1B 2QPDB 3H3BC 2DM2A 1QR1B 4HZLB 1UYWH 4HB5A 4O2CA 4FN2A 2NYYD 2C9VA 1XF3A 3RKDD 2QHOA 1X9LA 4KK9D 1XEDA 2YLKA 2UX7A 3CUPB 4JS7A 2FIKA 3N1YC 2WU2B 1OSPL 4CVZA 1KCWA 4UOW0 4XPHL 2X4QA 1A7QL 3W9CB 3OMNB 3EFOA 1PU0A 4LQFH 4B89A 5I76B 1JHKL 2TRYA 2C9XA 4PW3A 1KB3A 3ZL1A 4D8PA 2ADIB 2WLYA 1J05B 4YL4A 5I1HL 5FZQA 1G5GA 5C0BB 1E4WL 3RT3B 1KGWA 4W6XB 2OMZA 2W80C 4HI8A 3T8MA 1NM9A 4GAJL 5FYKU 1IO4C 1BD2D 3QDMD 3RWEA 3A9KB 3UBHA 4JFDA 3FZUC 1LO2L 2G9HA 2FX7H 2X4NB 4MCZB 4M0WA 1YNTA 1AS8A 1CXKA 3UACA 4Q9RH 1A6ZB 2DLFL 3IDGA 4GIVA 2YD8A 2NNXA 3GZQA 3VG9C 1UD8A 1NWPA 5JDJA 2HZHA 5J6HB 3GK8H 3GS7A 4G7YH 4HD9A 1KOTA 4FQXA 3C2AL 2HJKA 1A64A 1NCAH 1SBSH 2KLTA 4JFYA 4Y4HD 5EC2B 2APXA 3RWHA 4QRSA 4NERA 4AW4A 4QRRD 1XB6A 3ULAB 3ZFWA 5EDXA 1SA5A 2VGYA 3JXIA 2R4RH 2XCBA 4AXWB 3WKQA 2M4NA 1KFAH 3NJMA 3OKLB 2A6JB 4JN2B 2UXTA 3CZFA 3OC8A 2J12B 3E8VA 1FVCA 1E2WA 3DETC 3URZA 4QDGA 3P4NA 1FORL 1YDPA 3B6SA 1F6AB 1XV8A 2LTQB 5IW3A 2WV3A 4K5OA 3SBRA 4NI3A 1E5ZA 3VWJD 4IS6A 2GRMA 4KDTC 1BQLH 1YSOA 2VZ1A 3EJPA 4PWJA 4W93A 5C09A 4PFEA 3ZDYB 5I75B 1U3CA 1J0ZA 4E85A 4G6MH 1NEZA 2IBBA 3ZN6A 2ETCA 3BIKA 1F11A 5SWSA 2RALA 4GRLC 3CG8A 4DVRL 2E7LC 3K5SA 4BFEA 1RLFA 2A9MH 3BN3B 3C8DA 4XTRD 1H6OA 3GSUB 2LGYA 3DYPA 4G3YL 4QPEA 4XDDA 3PFUA 3AEFB 3VRLE 1XR9A 5BXFB 1XO8A 2BTEA 2ARWA 3SFXA 4OKDA 1OY3B 2RG8A 2LASA 3ZGHA 3L3OA 3NK3A 4WEBL 2ZCLL 3PHOA 4NWUH 2C60A 5FYLH 3QHZL 2VGEA 2EYSA 4MJSA 2QELA 2ZXWE 5C2YA 2CBOA 2IV8A 4I77L 4NT6B 1J7BA 2E46A 5MEQB 2FLRT 2IWFA 3FCGA 4F91B 1VZIA 2LXAA 3DBXB 1EJOL 1WTLA 5AUKA 3WN5B 2OMZB 5DZJA 1I85C 1T22B 4ZFZB 4GGQA 3BP5B 2C2LA 3HM6X 4K3CA 2W07A 2CO3A 1VEMA 3RWEB 3GM0A 4LVEA 4BZ1L 2FI7A 1JXGA 1X5IA 3IRZA 4I8DA 4I2XE 2ZX7A 4TUJA 3KXFE 5CHNA 5D7LA 4U7SA 5AAMA 2JCCE 1G7QB 2VXUL 3O6FC 4UV4L 1OTTD 5LBSH 4L29A 1AJ7L 1N94A 1Z9NA 2ZCKH 3G2TA 1VEOA 2KM4A 2R17C 3H0TB 2A9ML 3NIDB 3OAYH 4GH7B 3KWLA 4CHKA 4JHVA 4XHJD 2KHWB 2XTLA 3GIVB 4JL2A 3CR3A 4L8CB 4HK0A 4XKCA 5H4YA 2N1KA 3QIBB 4LCDE 4I9CA 5D1ZB 2J44A 3CSGA 2WTRB 3NK4A 2VJ0A 3VI4E 4ZUWA 4LNNA 2BSSA 3JWNE 1K8IB 2EZ0D 2LWPA 4PR5A 3CDYA 4ECNA 4M7JL 4BRVA 1BM7A 1ET6A 1MHQA 4M5TA 3BPOC 2M2DA 4Z77B 3OLMD 4X57B 2H88B 3FTSA 4JHWH 2C4FU 1R4XA 2XWCA 1BG9A 2H1PL 2YEZA 2WMPA 3IDYC 3R1GH 4PJ9C 5EU6A 1JJUA 3QISA 3KPTA 1KZOA 2ZUSA 2JI2A 2JT4B 3N32A 1DZBA 4TKNA 2J53A 2DN7A 3G6DH 1CDJA 4XP5L 5EEXA 1TQSA 5EZOH 5DJ6A 4EN2A 5DO2C 3BIKB 2DX5B 4J3WA 1P1ZB 1AGFA 2XG5B 5C09D 1QVOB 4H2AA 3PWNA 2I1JA 2WDTB 3DBRI 4GG6E 2XENA 3QRLA 1NCGA 2BMKB 1O6SB 3FH8A 2W88A 2JXMA 4FFYA 1NCJA 2VXVL 4B0MM 4KHTH 2CS4A 2GUOA 3WGUB 2NXZD 2BCKB 3KG5A 4XRCA 1MWAH 4IW4C 4OCRL 1MRFL 4ELDA 1PDXA 3OG5A 3TBTB 2KYIA 2FCQA 3SDCB 4JIOU 4ELKB 4WAFA 2P49B 3B2VL 1M42A 3SO5A 4D9LL 3GF8A 5INDB 4I9WD 4HUUA 2Y06H 2FUQA 4C83A 4KVMA 3TGOA 5EE1A 3QIBA 2Z8SA 4NM4H 4IN3B 4Z78A 1WYJA 3GSRB 1VZ6A 1MCQA 5I1AB 1R4MB 1T21A 5CKAA 5D7LE 4YFLI 5AUMB 4LBEB 3W56A 2MBBB 1KYOJ 1TETL 1I9IH 2H0EA 2KUTA 1XL6A 2F54B 1AO7B 4E71A 2AJZB 2BVPB 3IU3A 3E2HC 3U2SC 5TFSL 3T65B 3R9MA 4G50A 4OIIL 4L3EE 2AJYL 1KUMA 2GYSA 2J21A 3AADB 4PI2A 4JL1A 3NJVA 3FAHA 1U3ZA 3HAEG 4WNFA 3NIFF 4JANA 1DJYA 3ESLA 3B9KC 3MNWB 3QCVH 4PLJC 4J7WA 3ROLA 3C09C 3DI2B 3EKCA 2P24A 2X1XR 3LCYA 2HTLD 1XXGA 5EE3A 1UUPA 1KLVA 1PGRB 4USAA 1UZ6E 3CSYB 4JRYE 4Z95L 1IBGH 5E99H 4AWJC 1RUAH 3RAJL 1F42A 1I31A 1UA7A 4NZTH 5CU5A 4LSUL 1AZCA 3E1ZA 4FCAA 2VXSH 5EWIH 5G04C 3QHTC 4ZUSA 5CEZD 1TPXB 5IROD 3IAM1 5EILA 4I3SL 1QLFA 4GG6B 3SEBA 2AQPA 4M7CA 4ERSH 3UX4A 1IAMA 5C0RL 1PSKH 1CE6B 3IDIB 2Q9OA 5GS0H 3TBVB 1J9CT 1RUML 2AI0H 4G6AC 5B8CA 3T0VA 2C9PA 2BP8B 4H0IA 3G2SA 4HCGA 2HVBA 4KVNH 4H7XA 1CDGA 4B0MA 2WNWA 4OAUC 4FNRA 3LS4L 3N85L 3UERA 3T0EA 2H6FA 2X6AA 3P0GB 2FCMA 1E7VA 3P9LA 4B60A 2N59A 1CXHA 3O45B 2ALAA 3WENA 2W59A 1UXSA 4NO5B 2MHKA 1SVBA 2DIJA 2UXFA 2X4TB 5TF0A 2WXHA 4OJCA 1A8JH 1RFDL 4QHUA 1RSFA 3X13B 5JLZA 2BS4B 2GBNA 2L8JA 5C0FA 1SHWA 4K7FA 3MRQB 3SDXE 3D2TA 1U3JA 4AVJA 4DVBB 3SQVA 1G9HA 3D0LB 4FMFA 2QEJC 1IGFH 3SDAA 2IANA 4LLGM 2F8OA 4GY4A 1MJJB 3ZXAC 2AXGA 4Z7WA 3RBSA 3HXEA 1XH1A 4KJWD 2EDWA 3BPCA 4OLUH 1YG9A 5A23A 5FWQA 2E7HA 2P5WE 2YAQA 4JGJA 4M43L 4MZRA 4OI7A 1BZ9A 2GBVA 3OGOE 4P4RA 4AZ8A 1NMCC 3UQ3A 1IQDA 2DYSB 3FTGB 3PQYB 4LF3A 4POUB 5EOCH 3UGEA 4YSQA 1EANA 1NIBA 1JZ5A 4OQ1A 4HOQA 2R9HD 2OW7A 1SVXA 2VLJA 2YD1A 4XB7A 4KMLB 4N5CA 3VI3B 4F8PA 4KQ0A 4BFIA 3VXQB 4PP2B 4HLZG 1JZFA 4XAWH 3ZRFC 4BK4A 4J8RA 4P3DB 1AO7A 1MPAL 2X9YA 5KBMA 3S3JA 1L0VB 4UTBA 3EUUA 1F58H 1O0VA 2QYJA 1OY3D 5GHWL 2J0MA 4XCYA 2WX0A 4P99A 3CV0A 3UG5A 1KIQA 2P58C 2AKRB 2DWDA 5LG6A 4J3VA 4FE9A 5IV2B 4CO7A 5DQDL 1LK2B 1KPVB 3BQOA 4G6FD 3GE3C 4MLPA 3X3FL 5IB4B 4LSPL 4DWFA 3RK6A 2N7AA 3TEYA 3TF4A 2R1WB 3IPBA 2ROXA 4H5SA 3TA3C 3NRFA 5B1BE 1N0LA 5IIEB 2RB8A 1K8DB 4BHUI 4FRWA 1TYEB 1L6VA 1P2CB 2O1AA 1W91A 4LAQL 2VL5B 5HI4C 3INUL 5D7KD 3DVNU 5AW4B 4EIGB 3OKDA 3AS4A 4AEEA 2A6IA 1SYSA 3W0WB 4B6ZA 3CUPA 2BOBA 2BB6A 3C60A 2L76A 4MKTA 2R27A 1NGYA 3RX5A 1QBQA 2Z9TA 4G71B 3SDYL 2EIMB 4A90A 4GRMB 5ACZA 3CFIC 1AXTH 4NN5B 5F3FA 1QKZL 1ZAGA 4H40A 4ZXBA 3PNWB 3HZYB 4J1UA 5L2JA 3X11B 2YFNA 2DI7A 3KR3L 1C5DA 1IGYB 1V80A 3HRPA 1P1AA 1FL5B 1CL7I 1A3ZA 4J3OG 2DZKA 3X1BA 2ATPA 1NKOA 3R7QA 3MC8A 4IKGA 1J48A 2Y5EA 4MH0E 4N6RA 4YNYB 4ODSL 2DYSE 1IC4L 2H0FA 3NIDF 2OZ4H 3B2UC 3P30H 1YEWA 4PEEA 5ESAB 1H2UA 3KW7A 4BH8A 1PVHA 3NA4A 1ENFA 2GOWA 1MY7A 5J6GA 1LWRA 4QRUB 2YIHA 2OZ4A 2YQ3A 2ETAA 4FXGA 4WH4A 1ZV2A 2G5RA 5I8KL 1KLGA 4XBEL 3OLDA 1BAGA 2JWYA 1MW2A 3CC5B 2HLFC 4JR9H 2OJEA 4XXCA 3VNZA 3MRMB 4EDXA 5J3HD 4IW0A 2B59A 5ICXB 3DRAA 3SF4A 3BINA 2JQAA 3LEXA 4N2DA 4YPGA 3V62A 5I23A 1RFKA 3NBNB 3V6CB 2WAQA 1KYUA 5D8JH 1DLHA 3EJQA 2F53B 3UJTL 5IREA 3Q7AA 3MOBH 1MH5B 4P2RE 4NRHB 1I1CA 2YSSB 2VQ4A 3MR9B 2CO2A 3TO4B 2WIIB 1FH5H 3FUKA 2W0FB 2P24B 1X7QA 1UVQB 4NXKA 1YHPA 3CHXA 4FFTA 5I71B 5KBKA 1ZLEA 4F5CE 4U8YD 5A16A 4YTPB 2DL9A 3FMGL 3V4PH 5DEJA 4N0UA 4X4XA 4DPCX 1M6OA 3C5SA 3DGGA 4NQXB 1AE6L 3DK2A 4P5TB 3PDGA 4JRXD 3O6KL 1N0QA 3G5YB 4OF3A 1NAMB 1NLBH 4AVKA 1QHOA 4FQ2L 4CDRA 5GHWH 5GZOC 1JPFB 1BYOA 3BSZH 4HU2A 2ERJB 1R7SA 3H7SA 2J4WH 4M6MH 4YHKL 3V0HA 3T8KA 1MVKA 4MNHB 3QSKB 4GIOA 4HBCL 4YSPA 3NJNA 3DPDA 4Q97A 1T1WA 5GISL 4JQXC 1OSZB 2MEKA 5EOCL 1PZSA 2OJZH 3V05A 4M6NH 3MBEB 3GBEA 5D7IE 4HOWA 1A22B 1Q8MA 4OKVB 5FK9A 4RGNC 3GPSA 2YRPA 3UZQB 1K2DA 2DWEB 2GCYB 3H9HA 3D9JA 4NKQB 3RNCC 5HVWA 3OXFA 2VOTA 4LKXB 1K8RB 3LAFA 5IQNA 1LEIA 4MX7B 1HE8A 3QC1A 1FPTL 3C8YA 1CFSB 1QG3A 2GIMA 1NICA 4GKZB 3JWDH 3P73B 3RQ3A 3N1XC 1MWOA 1XCTB 1YAZA 1JHLH 2HCZX 4C00A 4WWID 4G6JH 1TR7A 1WXQA 1OGSA 2PTVA 4H88H 1UVQA 3BYYA 3SE9L 4ENED 4LVOC 2FUHB 4F33A 5KW9H 2HFFA 2JE8A 1A4JA 5CD3B 3QCAA 1B4LA 5FM5M 2BIOA 1Z9OA 4GSDL 4MD5B 3UTQA 2J1KA 4AWJA 3GRGA 5I9QC 1XF5B 3TPUB 1E96B 1K3ZD 2JCCB 3HMXL 4XMVA 4F37F 4LOEA 3NPSC 1INEL 1TSRA 3WIHH 4FXLA 2YXFA 3D4ZA 3V7AG 2BWFA 5CLYA 1U8KB 3IWUA 3V0WH 4BZYA 2V3PA 1GOHA 3VCLB 2AITA 2AQ2A 5F44A 4NM8L 4IYPA 2F1BA 2MPVA 1FBIH 1VFAB 4NZTL 5A40E 1KPVA 4FNTA 2H9GA 3IWVA 4IOIE 3D52A 4B3EA 1OCRB 3UQAA 1IBZA 4PTUB 1IFGA 3RRMB 4X8GA 1FNSL 4WO0A 3RY6A 3OPUA 3K80A 1BHGA 4UQZA 3O65B 2Q3ZA 3DJZA 1UZGA 2QYUA 2B8OT 5DEZA 2VH2A 3VYNA 5IMKB 2FR4A 1H8NA 4KX6B 4WWPA 2ZWNA 4IG7B 1P5UA 4MQ7B 4XI0A 3Q78A 2OFQA 1T66C 1M7UA 3ZZSA 3GMOA 3VFVA 1JK9A 5GS1A 3DECA 4OGXH 4F2FA 5L4MA 5EC1A 1UNSA 1DLFL 3M6DA 1OCOB 3C5ZC 3SFEB 2KZBA 2PMZA 2FT7A 4L8BA 1R33A 1O9VA 1QI4A 5LP0A 2IAMC 4U6XB 3ZHNA 4W9LC 1DR9A 3NZ8A 2ESVB 2FWSA 5FGBA 4ZJ9A 3V4VA 1Z5SB 3GZNB 4NKOB 1L5GA 1AE6H 3AS5A 2YA0A 3DIVA 3HRZC 4TLTA 3WLBA 4RRPG 3RFZA 2X40A 3N9GH 1B6UA 4TVSa 3ULUC 1DUYB 1B2WH 1AGDA 5F1NA 4E68A 5KS9F 5ETUA 4OGYH 1IT9H 5T3XL 1RKRA 3LH9A 3IE4A 4C4KO 5EOTB 3SD5A 1KCVL 1WTGT 3D9AH 3IF1B 3OD3A 3QIUA 2H7WA 1QWHA 2UZIL 1I7RA 1ELKA 1FVDA 4JRYA 2JKSA 5DR5H 1HESA 2Y24A 5DJYB 4ITKA 3TXAA 1E67A 5JPMA 1HYSD 1OSYA 5E4IA 3MGBA 3TVMA 2ICWA 1CK0H 1FFPB 4Y5VA 4K5PA 3MBWB 4W9IC 4R3DA 4KKLC 2GIYA 3UP1A 5INCB 2IAAC 2AQ3B 1JWGA 2IGGA 4JFPA 4Y19E 2A6DA 3CIRB 5GIRB 1WH0A 3QUXB 5H8YE 1WBYB 1XF4A 3D0VB 2JSVX 1MNUL 4U4BA 4RM9A 5D2LA 1KRHA 3IETB 3GSOA 1YEKH 1I1AB 3PH0C 3CDGB 1OARH 3UBGA 5JZEB 1U3NA 1XZ0A 4GS7B 4HPLB 5D96B 3KNBA 1MRDL 1JERA 1X5FA 2KCLA 3KJ4C 1A3RH 4JMXA 2D5GA 3WIIH 1THCA 2YRLA 2DQ6A 3MRJB 2REXA 1S7VA 4PJXF 5C1DA 2V7HA 4N6EB 5DDHB 1LP9E 4OCXL 2GLSA 4N0CD 5MI0B 5GGVY 2EDLA 1ED3B 1XB3A 2L7JA 2QGCA 3BE1L 2X2YA 3CLEL 3DTDA 3EUDA 3DOSB 1J1PL 4WK2B 4Y4KB 1IEBA 4YHLH 5L4JA 5T1MB 2NMSA 3MRLB 2WVVA 4UAHA 4DGYL 4LLYA 3LKNB 4I1OB 5DD5L 4MRUA 1RUKL 5G4MA 2NBWB 5JW5A 4DX5D 1Q9WA 2AJXL 2KC2A 2WYTA 2Q76B 5C86A 5ENWA 1I4FA 4FXCA 2XRAH 3LZLA 5L95C 2WWKT 1V3MA 4U7EB 1NDTA 3A24A 3S7FA 2MEJB 1KULA 4M02A 4Z3EA 1OE3A 4OUUB 4M6OL 3HZVB 2K25A 3AU5A 5KSAD 4Y5VB 3JTSA 5E24E 4M56A 2WLIA 5CIPA 1QSZA 2JZPA 4U04A 1XSJA 2X6CA 3HBGA 2ROYA 2EJ1A 2MQ0A 3L7EB 4KRNA 3TZVA 4QGYA 2HMIC 4PJDA 3WSQL 4UQIM 2O61A 3DEPA 1XNFA 1YECH 1UWXK 4HWBL 1S46A 3WJLC 2CBMA 1IQRA 4F2ME 1OM9A 5AL0A 4PJEB 2GJ6A 5F1NB 4PQXA 5AARA 5HI7A 1H15A 1UWEH 2HLFD 2IPKA 2WGNB 1XGRA 3PRPB 1THAA 3Q5TA 1HZ4A 4NLAA 4G6KL 4IRJB 4US9A 2OQJB 4X6FB 4LK4A 2IOLA 2OSXA 2Z91B 3RNKB 3GWJA 4U63A 2XN9D 3BZEA 4OZGE 3HFFA 2WWMC 4ZFHA 2UWEF 5FFGA 5GGRY 4P9MH 3VXMD 4N3UA 1JDAA 4X6DB 4AQ8C 3FDWA 2JCCA 2DB8A 4N68A 3QWQB 3QFJB 4V11A 2EADA 4PG9A 3ILPA 3OLEA 4UIMA 4GRWF 5HHQB 3U1SH 4D0DA 4WWKC 4GDKB 4UTAH 1TFPA 4JDEB 1Q9KA 4HF5L 4I17A 1S7VB 4DI4A 2EE0A 3ARPA 1A14L 4GKNB 4K3JH 2MA9B 5CMWA 4GN1A 4PGDA 4BKTA 3CXHJ 1DVTA 1MRCL 1AQ8A 1AXSA 3IJHA 5HGHB 2Q2LA 2XTJD 3B5TA 4R7VA 5JXAL 1FL5A 1VFMA 2QVFB 3K74B 3WXXA 3CBJB 3EFFA 1XAKA 4ZFFB 4MACA 4Y89A 3T2NL 1J1XL 3O2DA 5IJKA 3LEYH 5TPWL 4D0BB 4L23A 1G7HA 2NXYB 4JFFD 4LDEB 5C0CB 2KCKA 4PVNA 3WU1A 4LCCB 3CVDA 4RX4A 3GK8L 4HZAA 1I3GL 3E0GA 4TVPH 4GAGL 1B9RA 3DWGC 3U1QA 5F6IB 4KFMA 4TQHA 4Q9RL 4YVOA 1SQ2N 2AJ3A 3D34A 3QHZH 4G5AA 2RA1A 1L4ZB 2EDRA 4LGSB 4D2KA 3U82B 2NY3D 5SWSE 2VLME 1CQVA 4XPBL 2JJVA 3UTTA 2AXFB 2NY4D 1SJEB 3PCYA 1L9NA 1DUZB 2JYTA 4I18A 4PLKD 4ABQA 2B16A 1CFTA 4OLEA 3WS6C 3REWA 1IHGA 4Y2DA 2QC9A 4UTAA 4C56D 4DT2A 2J1XA 5HJDA 4JUSA 4PT5A 3AKJA 3UPVA 2D3JA 1ZGUB 3TH2T 4AVIA 2PCFB 2X1PA 4OZ4A 5DU7A 4CC0A 5I30L 1HKLL 3QWVA 4WJ5B 1BVNP 4AMXA 2DVWA 1E9PB 4FLOA 3NH7H 5AVRB 1OAYL 2DHZA 3V2OA 1BQLL 2BWES 3BVWA 2WVSA 3HKFA 4HOUA 1WHOA 5CUSL 2WXMA 5LWYL 1FO0B 4OJDH 1V7MH 4MA3B 3GMLB 5F7AA 4XNQB 3QUMA 4P5TA 3TVMB 2DYPD 2CR3A 1ZVNA 4PIBA 3GMPA 2RACA 3BWAB 3HB3C 3QCUH 1LXDA 2J25A 2R0LH 1JD9A 4P46A 3QORC 1YEHH 4IIQC 1A66A 1DHKA 2VT0A 5GS1C 1CUOA 4D0DB 2DIWA 3BO8A 3P3SA 3QUZD 1T0MA 4OCYH 4UWGA 5JJ6A 4U0RC 2VQ1A 2R29H 3RJVA 4J4PD 2GY5A 3UI2A 2AK4B 3VRIA 3ZPDA 3QYNA 1TJGH 3ASHA 4H0HB 4MBRA 1X5MA 1KCSH 3C3QA 5D9SB 3ULYA 1MKFA 1C5CL 1FH5L 4YNDA 1RK1A 5FGBC 3STLB 4HX1A 1E4WH 3SBSA 1NI2A 4DI3A 1WT5A 2V17H 3KLLA 5IEKA 5EKQD 4K3EH 3R2IA 1F9JA 3ZDXB 3VRBB 1QX1A 4GA2A 1BREA 2ZQKA 4PRNA 2A9BA 4HRLA 2NX5E 4RAHA 1FXIA 2F5AH 5ANHA 1LTXA 1MI0A 1PJWA 3QDMA 1BXXA 2E86A 2UX6A 4RGTA 1N2RB 3PNRB 4PUBL 1RK7A 1D9KB 2D0GA 5D70L 2XEVA 3QH3A 4JM0A 4LLMB 3EGXB 4JN1H 3WL9A 4UT9A 1G0DA 1U6AL 4NO0B 3VD2A 5CCKH 5AWNL 1RZJC 5CKGA 3BZ4A 4NACA 2H8PB 4Y1AA 4PRDA 5EU3B 5MEND 2EVIA 1IKOP 2FWOB 2BHZA 3V5HA 2DQCL 2YBRA 3T4YB 1NC2D 1IB5A 5CRUA 4QR7A 3HUJE 1CYWA 3O4OC 5DJXB 5LAPA 1T83A 1A21A 1BXAA 4JREC 1RZKH 1WQVT 1NMBL 3BO8B 4PB9L 2N7JA 3IK2A 4ODSH 2DEYX 5ECJE 1S7TB 2ZUXA 3MGOA 1E5BA 2WGSA 3NABH 3SQBB 3S3PA 3SGKA 4WW1B 1BQKA 1M7DA 3KGTA 4DP5X 2OEVA 5HKPA 3T4AC 2V2XB 1AJ7H 4N1HB 4DXAB 3QJHB 3TNNA 4X0NA 3HG4A 1A65A 3KVDD 2NT1A 1DL7H 3GMQA 5DUBB 3MCXA 3PL6B 4A55A 1ZVSA 4GP4B 1KB5B 2VZVA 1YY9D 2KK8A 1QW8A 4U8VD 1AZVA 3FO1A 4LRIC 4UOJA 3EDEA 4C0EA 3K2MC 1HCYA 4NN5C 4TUOB 2F6AA 4A2LA 3ML9A 3BLKA 1MYOA 3L4WA 4MLIA 2OCFD 3NZHH 3GMMA 4OZGA 3VFVB 3BFQG 1X5XA 1KXQA 3FT4A 1R3IH 2EDDA 3JV5A 3WNOA 1TITA 4PB0H 3HVZA 4EXKA 5KJLA 2BVUA 2NSQA 2BYEA 3KCPA 1O1SA 4N5ED 2EACA 4NWTL 4U6VL 5FYLL 2V2TB 2RGFA 2YO3A 5ENTD 3IPFA 5E23A 2DENB 2EDKA 4KVGB 1QOAA 3KBPA 1F