5T8IA

Pi3kdelta in complex with the inhibitor gs-9901
Total Genus 240
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
240
sequence length
916
structure length
808
Chain Sequence
b'VKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNLWSLEQPFSIELIEGRKVNAMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVCPIAWANLMLFDYKDQLKTGERCLYMWPSVLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELLREILEYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic sub
publication title The Discovery of GS-9901: A Potent, Selective and Metabolically Stable Inhibitor of PI3Kd
rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 240
structure length 808
sequence length 916
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2016-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 5t8iA05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5t8iA01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 5t8iA03
3.10.20.760 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5t8iA02
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 5t8iA04
4XE0A 3F04A 5H4YA 1DJHA 4EZLA 2X6KA 4LCVA 2R83A 3GPEA 3W56A 4WAFA 4OVVA 4PS3A 2NQ3A 3PYCA 1E7UA 1UOWA 3FBKA 3T8MA 4UWHA 3QAQA 1DSYA 3HN8A 2DMGA 4ICXA 5G2NA 1DJYA 1QATA 4LT7A 1CJAA 3DPDA 4ICWA 2WXRA 4UWGA 4URKA 4FADA 2I9CA 4WWOA 3L17A 5ANLA 4F93B 4UWFA 2K45A 3OHMB 5CCHE 5CCGE 3QK0A 2CM5A 5EDSA 2FJUB 3R7QA 4KITB 3L16A 4NS0A 2WXPA 4FJYA 3S2AA 4KZ0A 1BCIA 1DJWA 2WXHA 2A5UA 4L1BA 1DJZA 1W15A 2YOAA 4TUUA 2ZKMX 4QJ4B 4TS6A 2WXNA 3W57A 2YRBA 1RLWA 3P2BA 3PS6A 3CSFA 2NCEA 5KJ7E 4QAMB 4HLEA 1QASA 4TV3A 3F01A 3NZSA 3HHMA 3NSJA 4FJZA 2WXMA 4UWKA 3TWYA 4QJ5B 3IBEA 4PS7A 1CJYA 1E8WA 3L54A 1WFJA 2ENQA 3TL5A 1A25A 1K5WA 2WXJA 1DQVA 1E90A 1WFMA 3ZVVA 4OYSA 2Y3AA 1DJXA 2WXGA 2CJTA 3CSTA 4NP9A 2D8KA 3RPBA 4WWNA 4F92B 1YRKA 4OVUA 4BFRA 4JPSA 2B3RA 4XZ4A 4XX5A 3B7YA 3HIZA 4FHJA 3SD5A 2QZ5A 5JHAA 3M7FB 2WXOA 4ANUA 4MJJA 2X6JA 2BWQA 3ML9A 1E7VA 1E8ZA 3R7RA 5ENNA 3TJPA 1BDYA 3LJ3A 4Y1SA 4EZKA 3ZW3A 1W16A 2WXIA 3PFQA 4WEEA 4BGDA 4FLHA 3ENEA 2CHDA 4AJWA 2A4ZA 5H4ZA 2CJSA 4AOFA 3APDA 3L9BA 2UZPA 2KI6A 2WXKA 3DBSA 4J6IA 4FHKA 2WXQA 3LS8A 4WWPA 2X6HA 3QJZA 3L08A 4ANXA 3N5AA 4GNKB 2K4AA 3QARA 2ENJA 1E8YA 4LDCA 4NPJA 1DJIA 2DMHA 1DJGA 2ISDA 2X6IA 4KZCA 3KWUA 4DK5A 3MJWA 3L13A 1UOVA 2EP6A 4UWLA 3F05A 3IHYA 4G11A 4FULA 4HVBA 2CHWA 1V27A 2X38A 2CHZA 3ML8A 2WXLA 4ANVA 1UGKA 3QR0A 4QJ3B 4PH4B 3JZYA 1TJXA 4L1LA 4Y1TA 2ENPA 3RDJA 3PRZA 2CM6A 2Z0UA 1BYNA 1HE8A 4F91B 5G55A 4F1SA 4DNLA 3KWTA 2FK9A 4EZJA 2LHAA 2NSQA 4IHBA 2CHXA 3APCA 1GMIA 1TJMA 2WXFA 4L23A 4ANWA 3FDWA 5CCJA 3QR1A 3PREA 4GB9A 1RH8A 2K8MA 4V11A 5T8IA 3L4CA 1E8XA 2N1TE 3IM1A 2RD0A 2QZQA 2X6FA 3NZUA 3OAWA 3ZIMA 2Q0ZX 3F00A 4IQHA 4PS8A 2JQZA 1RSYA 2Q3XA 4L2YA 5JHBA 2K3HA 2V4LA 4FA6A 4NPKA 4A55A 3APFA
chains in the Genus database with same CATH superfamily
2QMJA 5JW5A 1P6FA 4LCYB 4NSKB 5HI5D 4IRSC 1IAIH 4U0UA 3U4BL 2B2XL 2PABA 4ODVL 1AR1D 2YLMA 2NCMA 3FQXA 2YAOA 4GYOA 3QPQD 4KMTL 5HHPA 4Q2JA 3N30A 1M1SA 4ICXA 1M2VB 4KKCC 3O65B 4V2BA 3HBPA 1LO5D 1X5HA 2G60H 3ZK0A 5K1VA 5FYJU 1N60A 4P59H 2OHFA 3A5VA 3BGMB 4GH7B 4PJFB 4UIKL 5E5LA 4DCQB 4UWFA 5A2AA 5IW1A 1XBRA 4OF7A 3EJSA 4BFGA 4I7ZC 1IAMA 4DJAA 3EDDA 4IKGA 1S78D 2D2CC 2VDML 4IW4C 5F8QC 3CKBA 5F9OL 2BKKB 2A6KA 5DZVA 3S3CB 3X3GL 1E9QB 3A21A 3SEPA 3TO4D 4Z7UF 4HUVA 1E65A 1UZ8B 2NCEA 4R96A 4UT9L 2DY2A 3PNLB 5JMOC 2M56B 1U2YA 4G8GD 4FTVD 5DHYA 4YXHL 4ZS6D 1FNVA 3KDMA 5HHMB 2H3KA 1DDHA 2X0VA 4JA7A 4P4RB 3FRUB 4JM2D 5L6YL 3I57A 3S48A 1QABA 4HH8A 1R19A 1J9TA 4NQKE 3CZFB 1J7BA 4F7EB 5BJTA 2AP2A 4MA3A 3HPJA 4MD0B 1YHPA 2B3RA 1FL3A 1HH8A 1C1EL 1KGCE 1GJZA 4Z77A 5LGYA 2G9HA 3OHXA 1H8LA 4KKBD 3LZOA 3UINB 2AQ2B 1WE5A 3QYCA 3GBNH 4JKLA 1J87A 4OD1L 4NUGH 4GKOA 4X4XA 3X1BA 5ACLA 5HDQL 2HKHH 3ARFA 2F53D 3SGHA 4DEPC 1JPGB 5E1AB 1Y07A 3SODB 5IFAH 5HYIA 2AJSH 2A6KB 3RU8H 3IG3A 1P2CA 4K9EC 3B2VL 2IFFH 3MOAH 2OCFD 4I3SL 2UY6A 1CFBA 3U64A 4LLUA 5AYWD 1LLAA 3AM8C 2GUYA 5DHYB 1OE1A 4N5UA 2YXWA 1SHXA 1EEZB 1L9PA 3CMMB 3KDMB 4MBGA 1UUSA 4U1KB 4AXHA 4UT6L 5D7JD 3VD2A 3DVNB 4ODWA 2JJTA 1OV8A 3NMEA 1MQSA 1V7NH 3U1QA 1U95A 4YHMH 4TVPL 4MA3B 2EDHA 3FT3B 3HBGA 3WIHL 3ZYJA 2DLEA 1TKWB 2CXGA 4XYCA 1QFWI 3PL6A 4PJ5D 3QNYA 3U6XA 3LVRE 3Q2CA 4PS8A 3Q2NA 5C6PB 4CQNA 4ZUWA 1SFHA 4NHCH 3BAWA 3GP7A 2M4NA 4H2CA 4ZYKA 2OS7A 2EVGA 2P3YA 2O5YH 2OVFA 1CLYL 4NGHL 3CVQA 4ODXA 2F7PA 5D7HA 5H37A 2L83A 3GZNI 4LSDA 1TMQA 1HXYD 2F7OA 4EI5A 2NSZA 4XCFH 1GYVA 4BUGA 4HPHA 2P8PB 1U58A 3NJGA 2Z8VC 4M8RA 4PJ5E 5BPPA 5FV1L 5ADPL 3UCRA 2VJXA 4X9FA 1BXAA 5HGAA 2ZUQB 3CDYA 1UN9A 5D71H 2VZKD 2Q3AA 3L3GA 4ODWB 2CQVA 2JQRB 3HNSH 4KRPB 1ZD6A 4AY5A 1O7SA 1TO4A 3HZVB 3LQAL 1NENB 3LRSB 1A7OL 3B2UD 1RFDH 1BVKA 1FN4B 1U95B 2Z91B 3MGAA 2H6OA 3URZA 1GAFL 2VZUA 4WEMB 2NOYA 2WQWA 5DHVB 1TKEA 4NO0D 3BWAA 3NFNB 3Q7AA 2D4FA 3QXDB 2PP8A 3QNYB 5F1NA 3G2UA 2VGXB 1NBVH 3CFJA 4B96A 1TJCA 1BFVL 2W81C 1BQ5A 5KHOA 3UERA 1ZLEA 4ZW3A 3SBRA 4RGOL 4U6HB 3B37A 2Y3AA 2H45A 1WR6E 2CJUH 3SEBA 1RMFH 4KU1A 4TQPA 4WUKL 4D0BA 2ZXGA 3V52H 5IREA 3BP6A 2WBJB 1LO4H 2XS8A 1WTGT 3AJ7A 4JG9A 4G7QB 4JE3B 5B8CB 5EF2A 3I2CL 1ZKHA 1HZHH 1HZLA 2ICWB 4TNGA 3EJZD 4C4KO 3QIUA 1CICD 5D2MB 2F1AA 4J7RA 1KCVL 2MWSB 2TRHA 3ZUCA 1A6UH 1KYAA 1J8SA 3WEMA 1MFAL 4TNWF 5GGVL 4XI5C 3HEIB 3L3GB 3HR6A 2CIIB 3ZQXA 1IUEA 3SKOA 5I66B 2HB0A 1I1FA 4FLOA 5D96B 1AG0A 1F4XL 3V5DB 1UD8A 1EFQA 3VXMB 2K4AA 1FNWA 4YK4B 3MBEC 1I9JH 1N54A 5AVQB 3ASNE 4J7WA 3L5XL 5BYSA 3EJPA 3PGFH 2AVFA 1AZRA 5EZLB 1Z0NA 3UM1A 2ATKB 3BLKA 3WN6A 3ZTDA 1PDKA 1YPZF 4GSQA 4KVNL 4OH2A 2XTSA 2AK4E 3VI3E 2VXQL 1CTOA 3WDJA 4BQCA 4DO4A 1WA2X 5ITFB 1CMOA 5AB1A 2GJJA 2NY5L 2VDPH 1YNLH 3F7PC 3SGEI 4AC4A 1QQDA 1CD9B 4ODSL 1JP5A 3B9AA 5A6MA 4RMTA 3LYYA 4HCRH 5EPMA 2NPLX 3B34A 2DTML 1BW8A 5F0MB 1RZJH 1KXQA 3QCVL 3ZY7A 1Z0MA 3ZO0A 1D5RA 4TVPD 2CFZA 2B9AA 5F0PB 3L4WA 1F90H 2WX0A 1YEEH 3TEWA 4PJCE 4CO7A 4WUUD 3B9KD 4L3CA 4EPZA 1RQ5A 1OP4A 2VW7A 3FTZA 3HA0A 3OZ9H 3S3DB 2G45B 2OZ4H 3GIZH 1EVUA 5T3XH 2WN2A 2EZ0D 3N9GH 3MFGB 5K69A 4PGCA 3CBRA 3IXSA 3FB8A 3T8KA 1TIFA 1UASA 4OGAD 3AKJA 4DWHA 3ZZSA 1S7XB 1WX8A 3QISA 1QYGH 4JKPL 1I8AA 4AV7A 1PDKB 2DI8A 1Q1PA 3ABGA 2LTQC 3PLUA 3EFFB 4FX5A 3H1ZA 3DHGC 1N19A 1Z2KA 3IU3A 1N10A 2ED8A 3QAZC 4FXGB 1BVOA 1LWHA 5ID1A 1WXSA 5CN2A 2KT7A 1XO8A 2NR6A 2YC1B 2CA4A 5BO1L 3UM2A 4HCPB 4K07A 1QASA 1X4XA 2XPZA 3HG0A 4P23A 3NZSA 1A0QH 3AWGA 5TFSH 1AXTH 2KDGA 1I1YA 2P8MA 3KWVA 1XLNA 1ETZA 3OV6A 1DQQA 3MDJA 4B9CA 2IQ9L 5EIVA 2ITDA 4QOKA 1NC2A 1F58L 1BHGA 4NQEB 1IGCL 1J0GA 4Z0BH 3TL5A 5D1XA 4U31A 3F5WA 4JANB 3BMWA 1OTTC 5DD6B 3VD3A 1WY8A 3BCFA 1GC1L 2WWKT 1BQSA 3T1WA 3IF1A 1DLHB 2NXZB 2I2YA 3Q06A 3C60A 3BP4A 2MHKA 4TSSA 1A6PA 3VDZA 4X7FC 1IX2A 1MWAH 2ZUTA 2LGIA 1ZIAA 4DUVA 4JHBA 1OAUH 6TAAA 4GRWB 3I9V1 5CHEE 3PV6B 3TESA 1CXLA 4ANUA 4WDIA 2ZOTA 2V7HA 4CA4A 3QIJA 4I2ZA 3EOAB 4OFIA 1IGYB 1UD2A 2A83A 4B9IA 2RPQA 1QFWM 4F3FA 4YZFF 4M0WA 4AVXA 2CPCA 1OTUD 1QMUA 2JKLA 4U1JB 1MCJA 2X3MA 1OSZB 1UXLA 2SEBA 4OZFH 1N64L 4OZ4A 5FUOH 5BS0B 3COOA 2P9PG 4PW4A 4F2ME 1UA3A 3L08A 2PW2A 4MNHB 1EDHA 4Y1AA 1TETL 4LDCA 2Z0EB 1DBKH 1XF3B 3EO9H 1T7XA 4P23B 3HJ0A 3G5XA 4XGZB 4PJDF 4UWLA 4M3HA 1NPNA 5AKVA 1GS8A 1ZCRA 2P8MB 3BESR 2X4OB 4X98B 5D7LA 2MNJB 2QPUA 5GGTL 3R19A 2Y1ZA 4FQ1H 3P54A 3BKCH 1NC2B 3VMOA 4LNUD 1I7RA 2CM6A 3LY8A 1FV1B 4AUYA 3RIFK 1ADWA 3E2HC 4KGSA 3N9YC 2MBOA 4JVWA 3SGDH 3BJ91 1WGVA 4MJSA 1HHIA 3C60B 4KDLB 1V5TA 3L2LA 4HWBH 4GB9A 3DWTA 1OGAD 1V97A 4W9LC 5IJVA 5CHWA 1Q1JH 1WISA 3VXSA 3X23A 2B1AH 2CLVA 1HHGB 3QQDA 2FR4A 5C7ZA 1TQBB 1UCBL 1KT2A 2OL3L 3FNKA 1F77A 4NC2B 5IB5A 4LNIA 4Z3JA 3F2LA 3VI4A 3BVZA 3ARGD 3WTSA 4Y9FA 2JKWA 4OZIF 3OAUH 4F7TA 3EFDL 4M8NA 1Z3RA 5GSVA 4XNZC 4AG4L 4IOIB 1QRND 4PD4K 3EHBC 2P9NG 4ICWA 4PRBA 3R06A 3S7DA 4Y1AB 5ENWB 2HVBA 3L17A 1ZE3C 4FMKA 5DLML 3GEFA 1ZOYB 4MNGB 1BREA 2H0JA 4TL5A 3V62A 1DEEB 5D7LB 2E76C 1TVHA 2E5EA 3TP4A 4KKAD 5C0CB 4HZ1A 1TYGB 4BZ1H 3P1MA 2NYYD 1KTJA 1QILA 2BOBA 2N7SA 1F3DJ 3EG9B 2BVQA 4X8GA 5HHVL 3WNIA 4DGIH 1C4CA 2FUHB 1DYZA 2DKSA 1OXYA 3V2OA 1W72B 2FIKB 4HH9B 3ZXRA 3ZTNH 1GJUA 4N8VA 2JH2A 3ARDD 2ADIA 4C8XA 3ZNHB 2QGDA 1OFFA 3W1YA 1OEYA 4ILDA 1AC6A 4LCCB 3L4TA 4PS7A 4MD4B 5HVWA 1KMGA 3GSUA 3MNVB 3GRBA 1V5OA 4KVCL 1FORL 1IT9L 4HJGE 4K94H 1U3DA 1BF8A 4HF5H 4JZYA 2HX7A 4H8WL 5KYYB 3FO1B 3VI4B 3O11A 3O2DA 4MJ2A 2V2TB 2LVQA 1IRAY 3Q78A 5IHWA 1MCRA 5AOJA 5HBBA 5EIIG 2MCNB 4IBVA 2RDHA 4RWYL 5DMKA 2AZAA 1ZS8A 4OFYA 4B9PA 1UD5A 4ELKB 1JWSB 2VL4A 2BPBA 1DBJH 5KBKA 1U3ZA 2KC0A 5HJBA 1FIGL 4QO1B 5ABDE 3U4KA 4M1GH 5I6NA 4YDKH 1CDGA 4X5RA 1TVHB 3DXAA 1KACB 4OCXH 3RZCA 1NEUA 4X6CE 4ZQKA 2JI1A 1MAKA 4XVOA 5JORB 5E9DD 2V9UA 3FQ4A 1JDDA 3ARPA 2LV4A 1COBA 1PX8A 2YQ3A 5IG7A 4JX0A 1PLGH 1E2WA 3S5LG 5DEJA 4N8VB 1FVFA 1SVXA 3H56A 4FC8A 5FECB 4P5TB 2NDFA 4HVBA 3U30B 2EH7L 1F6FB 5AZHA 3O13A 4Y4FC 2YAQA 5A7DB 4O9HH 1OWMA 1L9MA 3NCMA 2IPTH 1FIQA 4M01A 4I1RA 1B1ZA 3V4UL 5D2LE 4KK5D 4PUBH 3QJRB 4HKQA 4MHHG 5BV0A 4X7DC 3GSVA 5CCJA 1L7IL 3OJMB 4BWUA 2XBTA 4EBAA 4Y2LA 1Q72H 3GZKA 4HXAL 5E9DE 3WS3B 1LP9F 1MNUL 1ZS8B 2BM3A 3ZRCA 3L4YA 3N04A 1EU3A 2Z7WA 3ZE0F 2JY6A 1NCBH 4Y5XA 2R4SH 1FG9C 4AJYB 1QP1A 1MXGA 1RI8A 3PZ8A 1UCTA 2BEDA 4B7IA 4AV5A 1QKZA 3ES6B 4HKZE 4QRPB 3JV0A 4MMZC 3Q48A 3LHAA 1WGGA 4LMQI 4JG0H 2CGYA 3RZCB 4FQXA 5KOMC 5K1NA 3OAZK 4IRJD 4DW2H 4WI8A 3DPBA 4RFNB 5EU6D 4G50A 2VAJA 2O61A 5GZOD 3LNHA 4X5LA 3U7YL 1B0RB 3HAEG 4XO9A 1N5YH 1NTDA 1PKQE 2QKSA 2FEDD 2X3CA 3OKNA 2VSDA 2G4SA 3QK0A 3WKMH 2DV6A 2PXYD 4HWEL 2YAHA 1BGXL 5EEVA 4ZHBA 2Z93B 4ESKA 4KTEL 5AWNL 1DJWA 4RGNC 4ZT1A 4Y0GA 1AH1A 2XHEA 3I4RB 2R5SA 4KUCD 3SBSA 1JSYA 1T0OA 4PJAE 4EECA 2DJMA 2WBXA 2GITA 4W6XB 4KT6B 4YO0A 5ECJE 4DHJB 1K5NA 3GSVB 3FHEA 1TTFA 1M6OA 4AUQC 4M7KL 4MMYB 4ODHL 4F53A 3F64A 5EU4A 1S5IL 4CMHB 2LGDA 1WD8A 1J1XL 4V1DD 2QSQA 2RJMA 3DKHA 4HAGA 2LU4A 4XTRC 1NFIA 2WYTA 5F6HJ 1EM7A 4F9PC 4AP2A 3NSDA 2Z4TA 1YEKH 3W9GA 3HI1B 4WFGD 2V5RA 3UTSD 3NQIA 5F9DC 1XF5B 3L9TA 1VAHA 2V2WB 4FLBA 5IMLA 1NPJA 3KH4A 3KYOA 1I82A 2I5YL 4F7PA 2R2OA 4Y16A 4XDDA 1DVUA 2X3AA 3U82B 1IBDA 2O61B 2QZ5A 3N71A 43CAA 4LRIC 4BOSC 2R15A 3OKNB 1OHZA 5KVDH 4XDCA 1QZ2A 3FO9B 4V1DE 5CM1A 3VDBA 3RL2B 2P44B 2IAND 5EOCL 1Y1UA 2XBZA 2ZOLB 1TG8A 1A5RA 1ID5I 4LCIH 3ZE1E 5MERA 3CK9A 3X11A 3UTSE 2XG4B 3DX8B 2QVMA 2DL9A 4XIFA 2ESVA 2X2JA 3IFOB 2E8YA 3FCTB 4NKDB 4YO0B 1SXTA 3CU7A 1JCKA 2ZNXA 3GMLA 3HE6D 1MFBH 4KQ0A 4ZDHA 4NB7A 4HSCX 4PLJC 4FULA 1JZ8A 2APTA 2CHWA 1DBMH 1RZ7L 1INDH 3QZPA 4FQLL 4IJTA 5JZEB 1NFIB 3TBTA 1KB5B 1S7WA 4AIEA 5DHVH 2GRNB 4A3OA 4P5KB 4G2VA 2C4FT 2IANE 1YDPB 4MMXB 2ZUYA 4GLRI 2N3JA 2OYMA 1G94A 2ZP0T 5G4MA 4IHOA 2I32A 3G6AA 4X57B 3MXWL 1MHEA 4EN3A 3D32A 2ZF9A 2DB8A 3L4UA 4P2RA 1MF2H 1TIUA 2N7EA 2QJDA 5DD1H 5GZND 3PZ4A 1OCOE 4KO6A 4HIXL 4FA6A 5L2KD 1DANU 2ZX8A 2JX5A 3LY9A 1LD9B 4HIIB 4I2XA 5K33A 5H37H 5CGMA 3CHRA 4U7EB 2XICA 1LEIA 1HCFX 3II1A 3OX8B 5CF3A 1WR1A 2H3NA 2Y7MA 1OTSC 3DIDA 3HI5H 5HHOE 3CK7A 3O6KL 2EIEA 3GB7B 5FM8A 2D5GA 2J52A 4XE5B 2YPLE 3MI6A 5KANG 1SMAA 3SO8A 1ZTXE 3ZQ9A 1MDAA 2YJLA 5MHSE 1JCKB 2VAAB 5AYUL 1W8OA 1FYTD 3KAAA 4ZDHB 1T0MB 2VDRB 3LN5B 3Q5MA 3ULVH 2EKSA 2X4UA 2JCCB 5DEGB 1DL7L 3TV8A 4NM8L 3E3QE 3HG3A 5C2TB 2EYTA 1I4RA 5E03A 3BZ4A 2ZYIA 4CU7A 3QHZH 2LW3A 2C34A 2OR7A 4I48A 5LNDA 5ACMA 2NDGA 2ORBL 1BD2A 2J12B 4NZRH 1VR9A 2QPEB 3D5OF 4S11A 5C2BL 4GA1A 2VLJB 4YAQA 1E4WL 4JNXA 4C4VB 3NA4A 2MCAA 3I3DA 1JGVH 2BVTA 4EN3B 3BQUA 3NVZA 3LN4B 3RKPA 4IKLA 4N6QA 1FQ9C 1LQBC 5CJOL 5C0AA 4H0GA 4U6YA 4UQ9A 1OLLA 4YBLB 2LI5A 1EBAA 3VRAB 4G82A 4Y9BA 4NQVA 2E9WA 1Y6MR 1JZDC 2XPYA 3MRCA 4EUPA 3QUXB 5HVGB 3MA5A 2RH0A 4BA8A 4JFOB 1T0RC 3W11C 4H20L 4BFRA 3HUJA 2AANA 4EF3A 3V05A 3L81A 4GZDA 1FVDA 5JLZA 4M7CA 2DDQH 2B1HL 3PNRB 3SCMC 2I60H 3X12A 4GKSB 1XGTA 5AW8B 5BRZB 5C0JA 2MJ3A 2VN3A 2CMRH 1V1PA 1JGLL 2I27N 2Y72A 4EAEA 2FNWA 3RQ3A 3TGOA 2XTJE 1S7VB 4BQBA 5T3ZE 5KVFL 1WM5A 3H9DA 4ZAKC 5I1KL 2RKKA 4GT7A 4KY1L 2BTEA 2XZAH 4PLKD 4DN4L 5FCUL 3F7QA 1MHXA 2FX9L 3BZ4B 2BS71 5CEDB 4N2NA 2DWEB 3OL2A 4ONFH 3HXFA 4GUCA 4I48B 4X7CC 3GMQB 3SGJA 2KQ7A 1NI1A 4N8CL 1FL5A 1KXTA 1FO4A 4APXB 1ETB1 3ULVF 4TLSA 1ZVSB 3HK0A 2E4FA 3BQUB 1KLVA 3G04A 1FH5L 4K5NA 1MFEH 1O5PA 4ANVA 4M62H 1G6RA 4PJ9A 3TOPA 4U6YB 2BB6A 2NLJA 3IYLW 3S36X 3U79A 1BYNA 5E7FA 5D7IE 2OR9H 1PQZA 1NCCH 4WW1A 5HJ3A 4K3EH 1N62A 3HUIA 3QCAA 3RUGE 4NQVB 2CNZA 1OAZH 1YJDH 5AKTA 5F44A 4L0PB 3RBGA 3NGBC 4YDEA 5FDWA 3MA9L 5T33H 4OAWB 4L4VB 1R3HB 4Y2DD 1X5GA 4CT4A 3HUJB 4XVUC 2P52A 4L37B 4JQWC 1TR4A 5BMHA 1JGIA 1I1AD 4DX5D 1NCWL 1XGTB 5C0JB 1TT5B 2FAZA 4P4KD 5K39B 5A6CA 4L8SC 1M05A 3PIQA 2GEEA 1H6PA 2FEJA 3DSWA 2V7NA 4GRWH 1E7UA 3FBKA 2QVIA 4QRBA 4X99B 3VQ2C 4DEPB 3P2TA 5E6IA 4K5PA 4YDLB 1FL5B 1HHJA 1KXTB 2L4OA 4GXVL 2JTDA 4Q4EA 5FQ6A 1WIPA 2J0JA 2KUTA 1E4JA 2WW8A 1AKPA 5GPRA 3FCSA 2JUOA 2R17C 2UVEA 2Y7QA 5GGRY 3I63C 3GMOB 5CP3A 1OF0A 4N6RB 4S2SA 1PQZB 3VW3L 3HRZC 3NG0A 3ZNGC 1XF1A 3QUML 4B50A 3LD8C 1CK1A 1AAJA 4K5MA 3RRMB 1OSYA 1MHQA 5F9WB 1HJCA 2W0FA 5K1JA 2K22A 4RNRA 2NXYB 1PZSA 1TS4A 4S0SD 1EHNA 2YGNA 3VG0H 2Z1PA 1OAKH 4B97A 3PABA 5D8JH 5J9PA 5CZVL 2C7MB 5E6OA 5D70L 1MVYA 5EZIL 1J5IA 1DQVA 1N94A 1U8CB 4JD2G 4YE4L 5CMAA 4WEBH 3DVNV 5IVXA 1A4KA 1NI3A 3PZ7A 4JA9A 1JERA 1T5WB 3J27A 2IQCA 1U33A 2V7NB 2XA8H 5IGXH 2Z92B 1RUKL 3LS4H 4BZ2L 1MCNA 1FLRH 5I24A 5I6XC 5I8CA 3EADA 3PJNA 3O41B 2EKJA 4GEIA 2QELA 4M6AA 5KJNA 3NIFE 5EHFA 3VD5A 4FFYA 4EBQH 5KYXB 4HCNB 4DLQA 4GQ9L 4K7FA 3FY4A 1DFBH 3N1QC 4Z1PA 5FYKH 4AEIL 1AGDA 1P53A 4LOVA 2Y7QB 4B3VA 1SHSA 4JO4L 3IDGA 4ZOHC 4ARCA 5D3IB 1OP5K 2MCMA 1MHHA 3ARBC 3IPFA 4S2SB 4UQEA 5LBSA 4DQAA 1GOHA 4NNXA 4YSEA 4OVZA 4YDMA 3PE4A 3LTVA 1KLGA 3D34A 4PB0H 4M7LL 2W0FB 4RNRB 3AQZA 3GSNA 2P5WD 1Q9WA 4D7PA 3DX1A 2J53A 1XNFA 3EYOA 2JELH 4O51A 3ML8A 2ILRA 2X10A 4RX4A 5J9PB 2W59A 1W72H 4JRYB 3ULSA 1ZHKB 3MTXA 3N32A 4G3YH 2VSNA 5IVXB 1S7QA 3QJHA 5C07A 3FONB 3QUGA 4A7QA 4Z7NF 1AE6L 1XB3A 3KGUA 2YQBA 5BW7C 4ATZD 4N0YL 2G2RA 4UM9B 5AJLA 2EXTA 3MUY1 4YC2C 5AZEH 2WGNB 2AW6A 1XH1A 4HFUL 4JR9H 4OTXL 3I02B 5EBLA 2P9LG 2IXQA 2X7LA 4H1LA 3ETTA 2R69L 5KVFE 1F6LL 3SDXB 4BM7A 4D94A 4ZTOL 1QT9A 1KFAH 4YDIH 4K7FB 4NN5B 3MV7D 4K9EL 3TIXA 4JB9L 3ZHKA 4WSKA 4TSAH 4OIBA 3CXDH 2Y6TE 4LLVB 2F8OA 3WHE1 2F8IA 3GS7A 4GFXA 4KQ4H 1AGDB 2J6EH 1KRHA 4Y4HC 3U7ZA 1JPEA 2EE9A 2HLAA 1EZVY 1UM5H 2UV3A 3IDYB 3IEAA 1MHHB 3V6OA 4YSSA 5EU7E 1A9VA 2DD8L 4B5EA 2QC9A 2DJUA 4UIMB 3OC5A 2P42B 5AVVB 5F6IC 2DVWA 4E41D 5E99L 2PYED 3P3TA 1KC5L 1RLBA 5EU3A 3U7AA 1XR8B 1MJ7L 1SMOA 3FU8A 3KE0A 3KXFB 1QF6A 4PGDA 5C08A 3MODL 2HJKB 3O6ML 1AKJB 5MENB 1O6SB 3D9JA 1DVFA 1GGYA 2F15A 3U2SA 4NWTL 2KC1A 1CU4L 1JN6A 3BAEL 3UAFA 5KSBE 3EDKA 3QXUA 1WIAA 3QJHB 2OEWA 3DI2B 2JXXA 3PP4H 1G9HA 1JRHI 3I6LD 4CVZA 4NAJA 1TU2A 4MA8H 2G2RB 5GGSA 3FO0L 2DQUL 5CP7A 2EXYC 3VH8G 1BOGA 2W9DL 2CSPA 2WIMA 4WO4C 4AM0B 25C8L 4B8AA 2FQDA 2XWJA 4KXBA 5EBLB 1BEYL 2BOLA 2CIKA 4TNEA 1LILA 3C72A 1MHCA 4H1LB 5EA0H 1AQDA 5INCA 5L4JA 1Z5LA 1MAJA 2G75B 3L9EA 4OU3A 5DYOB 3TA3D 3UTTE 4CYEA 4MS8C 3N50A 2BP0A 2OJZL 5IMOA 5B39A 1GNUA 2HRLA 3CIAA 1E5BA 2XU9A 3BAIA 2Y1AA 3L7EB 5EIIA 3MLZH 3G5ZA 5I5MA 2VYIA 2AEHA 2W92A 4IRSD 1WRIA 1QBML 3VI4F 5JHLA 2V3PA 4CU8A 3DOSB 5F6HI 1PMYA 2WDQB 4M7JH 1UM6L 1J12A 5FUZH 3H2WA 5DMGC 5SWSB 1H3XA 5ESVA 5B4MC 3F6IA 2H6FA 4Q6IA 2NY3B 3ZGHA 4FLHA 4PGDB 4JQIL 1TJFA 3RTQB 3UYRH 3IT6B 3BPCA 4FQJL 1CGTA 3RNKB 3EFUA 3DGCR 2BWIA 5ECGA 2UZPA 2W60B 1DVFB 5IJKC 3E8VA 1X3DA 2ZD0A 1L3WA 5AEAA 1JN6B 1ZLSH 3LS8A 1FVEA 4KQ3H 3S5LA 3UBGA 4GO8A 4GU5A 4O2EA 2KCKA 1E96B 1KLUB 1LM8V 4JGUA 5GGSB 1OWPA 5CP7B 3QW9A 1J9QA 1JI2A 4MH8A 5HPMA 4G11A 1W3BA 3Q9PA 4WNQA 1RULH 3C8YA 4QJ3B 3MLXL 4PWIA 5AVSB 3CZNA 2A38A 1IBYA 3WEAA 1AD9A 1L5JA 1BU9A 1BM7A 1TVDA 3L4ZA 1SZAA 3CLFL 4QXWA 3JXAA 3DA0A 4UV4H 1Y0LB 1S9VA 5B39B 1MYOA 2O5NA 1BAFH 2KX3A 2KXJA 5K9OA 2DZNA 1MVFA 2IEJA 5ITZF 2DBJA 1FRGL 3KLKA 3G5ZB 1QLRB 4PJGA 4DUWA 5CCLA 1BLNA 4RMAA 3HS8A 3NFSH 1ZPSA 1OGTA 1QOKA 4BYHA 2DQ6A 1PKOA 4AH2A 5DJXA 2ZOWA 3AMKA 1J19A 1F4YH 1EVTC 5FF6A 2V4LA 5INDA 1UB6B 4R7DB 3RVUC 4L3AA 3GW4A 5H4YA 5FB8A 4ONHB 3CV5A 3TWVA 3TJHD 3BPCB 4JO2H 4Y4KA 4WAFA 4PWEA 1XQQA 1IAKA 5CEXB 2UZIH 2RDGA 2FCQA 2LQRA 4ETQB 5AUIA 3ETBF 4O2EB 2DW5A 2WDTB 2DQEH 5JPMC 4NQDB 1SPDA 4HMEA 5T1KD 1GJWA 2APVA 2BS2B 1P98A 5HPMB 4C58B 2O6FA 2PMVA 1BQUA 4WNQB 3TT1L 1HYRC 4S0HA 3E33A 2GG1A 1UWXK 1BZEA 4ABUA 1N2RA 1T83C 1A6TA 1EDUA 5JQIB 2JEKA 5BVPL 15C8L 3KJ6L 4NQCD 1R4MB 4CJ0A 1LEGB 1GGTA 3MJ9L 1I9RL 3IDMA 2OMUB 4PS4H 4JM4H 4A6QA 4MRUA 2BPSA 1T7YA 2FTAA 1KB5H 5D4IA 4NAWB 3CJJA 1TEZA 1I85A 1H3UA 1JPTH 4HBQA 5I75B 4UWKA 2A0LC 4A7SA 4OJAA 2XVLA 5DJXB 2R8SL 1SJHA 3L54A 1G1CA 1ZANH 2WUBL 4N22A 3ECIA 2Y4SA 5INDB 3O3EA 4FXCA 4WTQA 4HORA 3BEEA 3C8KB 2WN3A 5CLWA 3FTUA 2JJWA 2VSOE 1VJSA 1IAKB 1ZVHA 4L8DB 3IWUA 1LMIA 1WAAF 2IBZX 3BO8A 4PWJA 1C9FA 1XGRA 4KXZI 5FHAH 4X80L 5G4OA 5BUPA 2G30A 4R26H 5F7AA 5JW3H 5FO2A 3BVWA 4WY7L 2E0IA 2PNNA 3T3MB 5EUOA 1QEWA 3MP9A 3SD2A 2WP3O 4WU7A 5E2VH 1BF2A 4PCYA 1LE9A 1GPOL 2ZE0A 3IMUA 4FI8A 3DBLB 1CLZL 1KZPA 1GIGL 2J07A 1G7QA 1VZ6A 2E27H 4LCDE 1A6TB 1MZZA 4LSVL 4J3UA 1NGQL 3OBAA 4B60A 1A17A 3M1BA 2AQQA 2VDRH 3JZ7A 1AIFA 3AT8A 3IDMB 2ODIA 1NCDL 3KW7A 3RX7A 3T3PE 4ZX6A 2BRQA 1WZ3A 3A6BL 5GJTL 3BT2H 3MROA 3JT2A 4DKAA 4YVNA 3ONKA 1O1TA 5JW4Q 3VAEA 2ICEC 4JFQA 3REVA 3LKOB 3FOLA 2ICCA 4FQQB 4XNUL 4UQBA 1MG4A 2AMUA 3T0EC 3QHTC 1HTOA 1A7RL 1WBZB 3NA9L 4X7TB 5AW5B 3WTXA 4G83A 1F1DA 4YXKH 3CVYA 2AGJL 3NEEA 4MNQE 5CAYB 2JWUA 1QLEB 4FXLA 5GRZA 3VA6A 3SY6A 2IGLA 4WQMA 2MBHA 3BO8B 5AVZB 2WZ5A 4ELMA 4EEWA 5ENOD 2JIXD 2YPVH 4XP1H 1IL1A 3MV8D 43C9A 2QSDA 3UMNA 3ZEFA 1CYGA 4UV7L 4ZPVB 5EUOB 1QEWB 3AACA 2KJHB 1YMMD 3RVWC 5EUKB 3ASHA 1EF5A 2LSUA 1QSFD 1I3GH 4UMGA 1RJLB 2CKNA 1MCQA 4YNYB 4KXDA 3UJIL 1N9AA 3E6FB 5F7LB 1KXHA 5C09A 4ZX4A 1XR9A 1DJYA 1QATA 3M1BB 4FF9A 1DOIA 4XI5D 3Q5TA 4GTVA 1IM3A 4AT6A 3FH5A 2EE3A 4WNGA 1MAML 3D50A 1BT0A 4EIZC 4P2QA 2CM5A 5DMIH 3MROB 3N42B 3QDME 1G9EA 1W0YT 3FQTA 3MV8E 1MLBB 3V6FA 1BM3L 2ZXWE 4GEJA 4JFQB 3W2DH 4K94C 1UA7A 3U1SH 1NUDA 4B0MA 3VRLE 3LH2L 3LEXA 2EDDA 2F68X 2LMCA 2VE6A 4BSWA 3P3YA 4JDZB 4LB8A 3B6SA 3FILB 4F9LA 5E6ZA 3PQYD 4HJSA 1PY4A 1WD9A 1TCMA 3BDYH 4JGHB 1NCIA 1XGPA 3APNA 4YHLL 5L7XH 4A1RA 3TN0B 1HSBA 2LSVA 2XKNA 3BEVA 4YPGB 5I74C 2PTTA 3Q73A 2ONQA 4JUTA 1E3ZA 3MFFA 2P46B 2OXHB 4H8VA 1ZGLM 3VE0A 2H2SC 2DAFA 4HLLA 5C0EA 3CQQA 2AXWA 3GFUA 3QQ3A 5ERWB 2JKXA 5C09B 4NNYB 1XR9B 1KY7A 4MJ5A 2A9NL 2OM5A 2YZ8A 1OY3D 2PTVA 1YNTB 2ZWSA 5C8JA 4HEA1 2ZCKL 2CDFB 3PQYE 2K9FB 4M5ZL 4OV5B 1R0AL 1WX7A 3QO1A 4CAGA 4OT1H 1QFUL 3QWWA 3DX3A 1NANH 4AJYV 4LVHB 4OD2A 2LJIA 4U8HA 3HZYB 5IM7A 4NZJA 4KZDH 1NM4A 2WLLA 2BYFA 5CEZL 2HJLB 1UATA 2KZ1B 1IFHH 1U91A 4XP4H 1S3SG 2VE6B 5DD0H 3I9IA 4J1UA 5BYRA 1BMWA 1SXNA 2GCYB 1YN6A 4GFTB 4MWFB 4IWQA 3DTXB 2Z31B 4AITA 4PJ8A 4N2AA 4ZUUB 3DWGC 3RPIB 2ZJSL 1FFOB 1SLVA 3FUMA 1SOQA 1ZPUA 1YVLA 3H7PA 5AIJA 3L4XA 4I6EA 3T04D 2PTTB 2C7NB 1TZIA 4ZPTB 4ZS7L 3G6JE 3OXGA 4OGQC 3C6LB 1R5VA 4HWZA 1AVAA 4UUJA 1NUNB 4WTXA 2I24N 1OTTD 1NGWB 4YLBA 5E6UB 3V0FA 3MNMA 3WS6C 3MLVH 3TEUA 5DS8A 3I6GB 2ZXBA 5JHDA 4GI6A 2I6HA 5CLTA 5C8JB 3Q13A 3WIFB 2AEPH 2XYCA 4I0PB 3HUJF 1SEBB 3RYTA 1ET9A 5TF1L 4JY5H 4MXVE 2F54B 4G71B 2XN9B 4OD2B 3SKUD 4PIRF 1C5DA 2YHGA 2WANA 3HG1D 2ZX7A 4LSTL 4Q96A 5IM7B 3JBG7 3SE8H 5D1ZA 1UFGA 4UU9B 3Q15A 5I1AA 5CZXC 2OEVA 3D07A 3QUYA 2M2DA 4XWTA 5E6JA 1E3XA 3UBXI 2E7BA 2WQVA 1HG2A 3VTMA 3FCBA 4RH4A 4NXKA 2PO6D 1WFUA 3E7JA 3VXQB 3VGAB 4BSVB 1YO4A 5HVFB 2R23B 4NNPH 4WJOA 5AG9A 4OB5H 5CP3H 2WVSA 4IIQA 4PJ8B 4HEMA 5IHUH 1W0VA 5GS0H 1JNNL 3WO3B 2VUYA 2BMKB 2WNWA 1QNZL 2ATPB 3AU1B 4FERA 2KL6A 3FU3A 2V17L 2W38A 2YHCA 1XTMA 2ZCLH 2O4EA 4NCC2 5SWZD 3OR7B 1WRFA 3PNTB 4JFYA 2Z65C 2VXSL 5IQOA 4ZX3A 3T08A 4AYDC 1F86A 1U3NA 3QUHA 4MCMA 3T0WA 4UUJB 2LE9A 4YHIB 4K5CA 4DVRH 3OHXC 3GB1A 2QFCA 1NFDA 1HXKA 3UO1L 1A1MB 1HQRB 5DS8B 3FB7B 5JHDB 2N0SB 1TTAA 4HV8A 4OQTH 5ANMB 2L7QA 3UC0L 3HXBA 1IGFH 1ZA3B 5F88A 1BZ7B 3BK2A 2MKLC 3WYRA 3WFCL 1JUFB 4IK6A 5B7FA 5F1OB 2WAHA 3G2SA 3A23A 3LXBA 2R0LH 3MLSL 2FCSA 4ZFFA 3UJTL 4JLCA 1YEFH 4RQQB 2UXTA 1U9KA 5FO8A 3UPAA 2LXMA 1HK6A 3JWNG 2ZUQC 1Z9MA 1UZXB 5DVOA 3L2MA 4CVWA 5EN2A 1E67A 4JLRA 4OFDA 3EHBD 4B95A 3FB5A 1L9QA 1TDQA 5CIPB 3CVPA 3BD4A 4IIQB 5LBSH 5B21A 3EYUL 3TCLA 4W9ZA 1IYFA 1N3NA 4QD2E 1YEHL 1ZE3D 4BELD 4AOFA 2VR9A 4R90L 4L1TA 3TM6A 2VYRE 2WM0A 5F7EH 2VQTA 4NRYA 3VX0A 3PL6C 1JGUH 3ZZQA 1IVLA 1A3RL 2AXJA 2EADA 1QWNA 2ENJA 3FZUD 2YNQA 3MOBL 1NFDB 1RPUA 4DK5A 4XBMA 5IUSA 1CFNA 1K3IA 3X3FL 1HFUA 5I15L 3Q6GL 4KGRA 4O2CA 1EPFA 2FHBA 5F9AC 3FOMA 3M86A 5CEZD 4HUNB 4BCZA 4ZOEA 3L8QA 5F88B 3ZDXE 4F6RD 2IOSA 3RNGC 4Y7MA 2WBJC 4JG1L 1HEZE 3K46A 3V6CB 2KKQA 5LDSA 1CK0H 5B8CC 2H6HA 2OYKA 4EI5C 1L6UA 4AZUA 5LXIB 2FO4A 2YPKB 4AYFA 4H1LH 5D2MC 4N20A 3K5RA 1A9EA 5LGJA 5IVXF 3U9PL 3AG4E 1AGCA 1OE2A 3ESPA 3GBML 5C70A 4TUKL 1IC4L 4JPKH 4FYSA 4PT5A 1FAKT 3DNKA 4NFBA 5I1DA 5EN2B 5JPNA 3WY4A 4J3OD 3FB5B 5IUCA 3N1XC 3ULVC 3TWWA 4Z7VE 1P4BL 4KJYB 4PTTB 3INUH 3SDXF 3TCLB 1BA9A 5KVEH 2HYMA 1F4AA 4YK4C 5C2UB 2AK4A 1ZHBA 3GO1H 4ZTPH 3VI3A 3US0A 2YXFA 2MBEA 2X09A 5AENA 3GDBA 3JXIA 4NRYB 4YHKH 3DSNB 2L8AA 1SF5A 1RCYA 3TA4D 3GZNB 2EIZA 4QRSA 4QAYA 3QFJA 1K3ZD 1CF8H 1P4IH 1WCQA 3D05A 5DC2A 4FNUA 3K6NA 1DUZA 4U95D 2ERJB 1RZFL 2WSDA 3KWLA 2ETCA 2P9SG 4QXTA 4ANKA 2XRYA 4NRHB 4XPAL 2B4CH 2D0FA 3FTYA 3GRGA 4NKOA 2WXNA 3KWWA 1SY6A 2JMRA 3D30A 1JDAA 3A9JA 1CPUA 2NY4D 2DBLH 2UXFA 2J7QB 5ESQA 3FDHA 2BIOA 4MAUL 1EGJH 2AXUA 4PJCA 3CWIA 3NAWA 2EECA 3S4SG 1GC7A 3GLEA 1JYNA 3SZKC 1G87A 4ZBJA 4DN3L 3VACA 3TXMA 1K6QL 1Q0EA 1ZU2A 1CBJA 1ROWA 5J6HB 1A25A 4MJ4A 4PI0A 1U92B 3FH7A 4CT0A 2E6XA 5F7YC 1DCLA 3KPMA 3NCCB 5LLIC 2CBTA 2XV2A 5LBVA 4JFFE 2Z35A 1E4KA 2CO6A 4Z0XA 2MQ3A 2UY7A 4Z7WB 4UZSA 1ZLVK 1WGDA 1RPQA 1YAIA 3GLAA 4XXWA 2AJ3B 2GFBA 2OX5B 5H7PA 2DPKA 2J8UE 4KHTH 3ZTDC 2FX8L 3Q44A 2C9XA 3PXJA 3LIUA 1C08A 2AW2A 2EIZB 2OSXA 2Y5PA 3QXWA 3QFJB 3K6SB 4FXGC 1W9XA 5IEHB 4JEUA 1HZ6A 2PUQT 2I9TA 2Z1KA 2DLBA 1MCSA 5DZOA 1B4LA 2PKOA 4U6XB 1YJDC 2NZ9C 3AW5A 3IXAA 3HFMH 5HFYA 1ZHLA 3BZEA 4TUJB 2R29L 4LCWD 2DH2A 1GHFH 3ESLA 1ODUA 1BVLA 5T5NF 3Q3OC 1H3TA 1NC4B 1A5FL 3BKYH 5ISZE 1QVOB 1TN6A 2GRPB 2J21A 5A2CA 3AE7B 1KLXA 1JWMA 4UB0L 1FZJA 2NXZC 4WU5B 3SNXA 4UWQB 3O3AA 4BWTA 3DUSB 5LNK1 3CBKB 3WJLC 5KYWA 4XTRD 1NYQA 4JO1L 5J1SC 1PDXA 1H8NA 1T2QH 2WZPD 1B4RA 1H2VC 4DH2A 2INDC 2CO6B 4Z0XB 2BO0A 3OPZH 2UY7B 5C6TH 2ZGDA 4ENEC 4CN1A 4Z3TA 3KUCB 2CK0H 2LUHA 2HFFB 4RGNE 1SYSA 4C4UA 4CSTA 1WIUA 1I4FA 2PVGC 4JGMA 4AQ8A 1YAZA 2W0PA 3GSXA 3HFFA 1NBYA 4LCWE 3MBXH 3HR5A 4O02L 2VN6A 4RETB 4BFNA 1RD6A 5JXED 2GI0A 3N0PB 3BPNB 4XCNA 3UT4A 1ES0B 2NR6C 3HCVB 3LIZL 4HPPA 1YN7B 1Z5YD 3EBAA 3FU9A 4US9A 4YSYB 4P23C 5IMMA 2NX5D 2E59A 3CXHK 3MJ8B 4YGVA 4KI5F 2FL5A 3SO3B 2F7IA 3WHXA 1WE6A 2D2QA 3LKNA 2OMWB 4RZKA 1UVQA 5D1XC 3ZHEB 1ORQA 1BVLB 2FSEA 3AU0A 4RZCA 5DJAA 2K6YA 2I9LB 1JV5B 2DQHH 4KZ0A 1KH0A 2HTHA 3C60C 2MRIA 3K9IA 3O3AB 3STZB 2IPKB 4JL2A 4UOW0 1KZYA 1TFHA 4JFHD 4NBXB 4OIFA 3WLBA 2P8LA 1OTRB 2OMZA 1QX1A 4DPAX 1PZ5B 1RZGA 3D85B 3SJVB 1XCTA 5C0IA 3CVUA 1TQBC 2YGOA 1MIEH 3UPCA 5AAMA 3MKKA 4TNWK 1KGIA 5FA3A 1TNUA 5E8PA 4PP1D 4PJIA 3OKMA 4OW6A 5IROA 1SYSB 2MCPH 4GP4B 2N7BA 2CFUA 4O6FA 1ANUA 4PD4J 1A5EA 4Q9CA 2XWTA 5I4DA 3SFDB 5GRUL 1QLEH 1NJ9A 4AIOA 3RRNB 2VXQA 4FGMA 3ZRFA 4JVUA 4Y8AA 2GC4C 5I1EH 1HCVA 1WS8A 1ACYL 2WSKA 2YD8A 4PRPD 3FQNB 3V6ZB 3GE3C 1WUZA 1CB4A 4FN0A 2X5PA 2AV1A 4YGVB 4EJ1C 1OTSD 4MX7A 4N39A 1BZDA 3BZDB 1XAUA 3LKNB 2IONA 4IKIA 3GHPA 1UVQB 2LFGA 4WGWB 3ZW3A 4AC2A 2FSEB 4XR8C 5CJQH 1A9BA 1HHKB 4HJGA 4UQ3A 1MIMH 1E3FA 3BI9X 3BE1H 3ZYOA 7CGTA 2P8LB 1GYUA 3FUNA 4LCCC 4U1IB 3FQUB 2X6HA 4GNKB 2HPTA 1QSVA 1I8IA 3UDWC 4DVBA 2C5DC 5E7BA 2BY2A 4MBOA 1DJIA 5C0IB 4N24A 2KANA 4W9EA 4MCZB 2EDQA 3TWUA 3ZYQA 5FA3B 4JN2A 4PJIB 3OKMB 1G6VK 4B53A 2OMXA 1ZT7A 2Y6SC 5A40E 2VXUL 4MJ6A 5IFAL 2AJSL 4ZSOB 3RU8L 3WAPA 2O93L 4OD3L 1IKNA 1GZPA 5KWDA 4KO5A 4PHZA 4NX0A 1F3RB 3OAYH 5CILH 1AZBA 2UY1B 2WQXA 4C54A 4EIBA 4X6CA 1UD4A 4R7NB 4X7SL 5DPRA 4S17A 5TQ2L 4DSYA 4KXKB 4R7XA 3SFXA 4L48A 5I26A 1HKLL 1Z66A 5KW9L 4BERA 4P5RA 4MX7B 3W11D 3GTNA 1E4HA 1ZVYA 4BXVA 2KJ6A 3EW3B 3QIWD 2G5RA 3VFUA 5L88L 5FO9A 4HIPA 5IEKB 4ZUTB 3SCMD 2BVCA 2F19H 4GN1A 1QHQA 1IGCA 1NMCC 3VXRB 3TONA 5DQJB 2WOYA 5EUOF 4HUUB 5J12B 1G0YR 4W81A 4HOXA 1J0IA 4TULH 3N1MC 4ZAKD 4DIXA 2IZVB 1UJ3A 2CXKA 4RM9A 1KCLA 3EXJA 5KNGA 4X9IA 2E7MA 1HDMA 1CE1H 5D2LA 2BP3A 5SWSD 4DVBB 1WXQA 3ZDMC 1Z2MA 1RK0B 4NHCL 2VB5A 4XCYA 3HS9A 5EZOH 1OQYA 2PLTA 4XP6L 5C7XH 1AQHA 3T71A 2L7RA 4CN6A 3MV9A 4Y8DC 3LY7A 5IK3A 4DJMA 1MSPA 2XK5A 1Z3GH 3NHEB 5FIEA 4QTIL 1E4XH 4HKZA 3LV3A 4LVEA 4XCFL 1ZOXA 4X8CA 3AGWA 2DNFA 4D10C 1GSKA 5JA9A 2IY1B 2WAQA 2O30A 3HVZA 2CUMA 3H9SE 3LYAA 1N26A 2ZP8A 3P9LA 1QOGA 3KLDA 1CJYA 2CGZA 4JFXA 4P7IA 3RZCC 1PKQA 3HNSL 5IY5E 4XVUD 4OLEA 3VFUB 2EEXA 3R9MA 4APQA 4ELMF 4RFNC 1D5MB 3W3BA 5D4JA 5EORH 5DHMC 1R3LA 3S88H 5KSUB 3VGFA 1BJ8A 2XFGB 2CO1A 5K9QI 1I4HA 5A6IA 2V1YA 3SD5A 4PJAA 3QDAA 2FNJB 5DFAA 1NBVL 3QQNA 4R0LB 5J57B 5KS9B 5M94B 3LRLA 3BUYA 1FC2D 2ZZPB 3DC0A 1CR9H 4Q52A 3P02A 1UKQA 4D9RE 3QQ8B 2CJUL 3D39D 4NKIL 5IB5B 3P4NA 5I1DB 3APDA 1CE6B 3PF2A 4P46A 3V52L 3VUXA 3MV9B 3BY4B 3W9CB 2ZCCA 1LO4L 2XG5A 4G3XB 4JFTA 3AJIA 2Q86A 4JDEB 3LPOA 4I18B 4BTAA 4O5LL 5EE9A 3LV3B 1BXXA 1VKXA 1VZ8A 3RIBA 4QRTB 3UABA 5E1HB 4Y7OC 3FUEA 4CGTA 1PYWB 2GABA 4GG6B 1V27A 1HH6B 1RU9L 2W80C 3DSVA 4PJEA 3BVXA 4FDWA 3ARSA 1MJ8H 4FQXC 2C2LA 5FGCE 3RVXC 2PYFA 4XN5A 1JRPA 1E5AA 2GBVA 1Q0YL 3JV6B 1G0DA 3ZOAA 3P73A 1J7AA 1KELH 3TTYA 5B38G 4K7SA 1N4SA 1I9JL 3HNTH 2FO1E 2VJ0A 4ZXBA 3BSGA 3MMEA 4NO5A 1VD2A 4Z7QE 4M93B 4WI7A 1KIPB 2WWNA 1S7TA 5E00A 1I4QA 1FNEA 2P5EB 1IPGA 4OAVB 1SM3H 3B0AA 1I35A 1FE8H 1E40A 2JVCA 4OGYL 1LDPL 3MA7A 2H9GA 1KCUL 3MRJB 5KOVC 4WI0A 2BNQD 5GRVK 4OAUC 1DVSA 2DN7A 4UNUA 3RZWA 4P46B 2VDPL 3TBWB 3VMPA 1NCNA 2WM9A 4ZFGH 1CZ8H 5CIPH 5KJMA 4IKNA 3PG2A 2DLIA 2Q86B 3UG4A 2JT4B 1HS6A 2BCKA 3L9RA 4KRNA 5DI8A 1EO8H 3ARBD 2QQKL 4HCRL 3ZKSD 2A9AA 4ATGA 3OKKA 1ZDVA 2JKJA 2X1OA 2ZSVA 4A6YA 1YEEL 4PJEB 2C9QA 1NFKA 1N4RA 3HE6A 5BVJB 5HJDA 2MQGA 3DMMB 5F7FA 1EWHA 4DGYL 3NBNA 3OKOA 4PRHD 4F8PA 5JQHC 4OKVB 1WLHA 2OZ4L 1J0HA 1KTBA 2UX6A 1T21A 3MZTA 4WNJA 3O8XD 5J6SA 1BPOA 3JYCA 3K4ZA 3NRZA 12E8L 3GS4A 3FQWB 5HHOA 1SQ2N 5E1IA 4KJQD 5CU9A 4ZRGA 1S7TB 2YPLA 2OI9C 2QC8A 4I2WA 3HHSB 4P48A 2V5TA 3D2UB 4N4YB 3U0PB 3PGDA 1BBJA 4KZEH 3X1GA 1I31A 5GZNA 2C3VB 2C3GA 3Q5YA 4GYBA 1MCDA 4K3JH 4C47A 5HI3C 4NO2A 3TZVB 2NY7L 3N85H 4UOJA 4M6NL 1AXTL 3QWNA 5DRXB 3CVHL 2BHZA 3QJXA 3S37L 1QFWH 4HUWB 4GUPB 1UXWB 4Y4HD 2N9XA 2FGWH 4M48L 3AS1A 3L9RB 3UH8A 1IAOA 4LVNB 5ID0B 2VITA 3AN1A 4Z0BL 3L45A 3IN2A 3OKKB 5JDJA 4XNQA 3HC2A 5CCKH 4LPVA 2P48B 1UKSA 4YX2H 2ZSVB 1J05A 2H2PC 1FH2A 1M3IA 1ZEAL 1EBPA 4AMKH 2D4DA 2L3BA 2WIIA 4EN3C 4LP5A 5C9JB 3VXUE 1TCRB 4UT7H 3PZ3A 3MRGB 1OAUL 1ZV2A 5E8NA 3JSVA 4WEUD 3ARVA 4M61A 1OK8A 1T21B 4XNMB 4YBLC 3T8XA 1RZ8B 2NBVB 2YK1H 1J9CT 2BIHA 5E8OB 5FKAA 4YHNB 1NFDF 2X4SB 1D9SA 1YPZE 2EXYD 4QKXB 3SYCA 3QUXC 4IYKA 4WO4D 5DJDA 3IJ8A 3IFLH 5IV2A 4IOSD 2Q2EB 5G55A 3PDNA 2EINB 3PGDB 4YSAA 4Z3GA 3S35H 1R33A 3K6OA 1G9NH 1K4DA 1RIVL 1IBGL 3C6SA 4HZLB 4MS8D 4LVOB 1JF1B 2H6PA 2Q6WB 3PREA 1EA9C 1DBKL 3B13A 4NO2B 2Q8AH 4HPMB 3U0TA 2CRYA 4MD5A 2N1TE 1J1OL 1LD8A 3VXWA 4H8QA 3TCAA 1M7UA 1EK3A 1JF6A 3QJFA 1I42A 1F97A 1T66C 4H44C 4FQ1L 5CFHA 2AK1L 2XKSA 5HXMA 3GS0A 2MP2B 4G8EA 3PLYA 4UDUA 3FW6A 5KTEL 1ACZA 5DDHB 4ZRJA 3PWJB 5LX8A 3TSSA 5DMGD 2GT9B 5CJ8A 3GHEH 4QKTA 3OWRA 1NKRA 2X1XR 3RWGB 2K39A 4XPGH 5B4MD 1YA0A 3GJEA 4D3CH 5EIBE 2EVJA 4F15B 4HWBL 2Z7UA 3SOBH 5D7IA 3BQUC 3CN1A 1UWYA 2BYVE 35C8H 4LPXA 2B1AL 2NNAB 2EYSA 3RUGA 3CC5A 4M61B 1AIZA 1C77A 2LFEA 2FBNA 4FXTA 3T8XB 2BZCA 3RZFA 3JTTB 4UI9C 3LEWA 5DO8A 2HJ1A 2MRPA 4IW0A 2XQYK 1ZGLP 1SRDA 3MYZA 4M7ZB 5DJDB 3TCTA 2QJLA 3F65A 1N59B 3A4SC 2X89D 2XWZA 3E8UH 2PPDA 3H85A 1WGKA 2K6QA 1X9LA 5LP0A 5DUJA 4L0YA 3T6XA 1RUPH 3T2NH 1C4PA 4N6EB 2LLLA 1P7QD 3ASDA 2H6PB 3NVVA 4JEHA 3S4SA 2IDTA 5CBEB 5B1KA 3DRQA 3MRIA 5KUKA 3B1LX 3L5HA 3ATFA 4AEHL 1R5IB 3QJFB 3AAAC 3CDGA 1ASPA 2V8SE 4BZ1L 3FKUS 1ZSDB 3H42H 3HNVH 3H4HA 3B8YA 4UDUB 4OCSL 4Q8BA 1XXDC 3W1SA 4GINA 1YCSB 4YPJA 3QORA 2JKTM 3UM3A 2AJVL 2NTFA 3T77B 2MFNA 3SGJC 1KTLA 2CRIA 2EDXA 3CLEH 4P3CL 4X4KA 4BAXA 3RVUD 5AVWB 4XMLL 4WI6A 2Q3ZA 1IARB 3L3OA 2RCSH 5I76B 4BQ9A 3SGEH 2OQJB 1X5AA 5JHAA 2VTBB 3Q8EA 1SOSA 5DJCA 5E5RB 1OF2A 3VI3F 4FA7B 1MDTA 3QPXH 4K94L 5HYJE 3W37A 3WTUA 3UTQA 3EGSB 3L3KB 2DRUA 2O2VA 5C0RH 5B1CA 4P6VF 3MZLB 4MAYA 4HI9A 3EUVA 4YZFE 5JIHA 5FGBC 3NOBA 2LGSA 2DAJA 4U49A 1MVUA 5CS7A 2I2OA 5IBLC 3S7GA 3VFGL 1FCHA 2IAMB 4I3RL 1CDCA 2NXYC 5T3XE 1VCBA 3A67H 3O9WD 4KDWA 4JPWL 2P47B 3CUPA 5BQ7B 1QUNB 5T1MB 3BVTA 1BQLL 4NUQA 2IJGX 1UACH 3WENA 4RG9A 2R05A 1CBVH 5CGTA 3G3LA 1PUTA 1MX4A 3ZYKA 4L1SA 3JQ1A 3B7BA 1RUMH 1S64A 5I0XA 1KEGH 1QSED 1SJED 4PJCF 5JR1H 3CDGB 2D3LA 2CR3A 1IHGA 1BYPA 3IXEA 1XVSA 2ILLA 3BP7B 2XC8A 2A0LD 1KGYE 3NSFA 4R4ND 5HTSA 5IB2B 2FCMA 1NEPA 2NW3B 1CI5A 4KSLC 4LPUA 5HGBA 2NTFB 5IAAC 4FCAA 5E6IC 3Q9UC 3AUVA 4UTAH 2NT1A 3JTSB 4B6WA 2GK2A 1AGBB 1OW0A 2I1KA 3E4BA 1OPOA 3FK3A 3LVTA 1EUTA 4U1NA 4FNRA 2R2BB 4IBZA 4OGZA 5T1JA 3CFEA 3KEHA 2O2VB 2YEZB 3I75A 1P0SE 3TVMA 2NT0A 1QPXA 4O58H 5GS0C 4PUBL 1MRCH 2EDMA 3DHPA 4N0UE 5C3LD 3KLAB 4L3ED 1GTFA 1MVUB 1A1OB 2ZKHH 3TPUA 4XPBH 1LK3H 4BSXA 5IA7A 2IQAA 3FU0A 2GJZB 1AZUA 3LNDA 4EFOA 4FBJB 3NEOA 1I7ZB 5ICXB 1NCBL 2R4SL 4LIQL 3U1PA 3B4NA 3DXMG 1GB1A 1VESA 3RWFA 1EHLL 2FJUB 5EBWA 1YECH 2WCSA 3KBHE 1DQJA 3NZ3A 4IUMB 4JZJB 5EO9B 4JG0L 4LP4A 1ONQA 3KPRB 3NOIA 3QOUA 3ZYLA 1KPUB 5KYUA 1UUPA 1N0XL 4HP5A 2KFJA 5IOIA 1JXFA 4TNFA 4BXSV 3KPPB 4L3EE 4W9CC 2H32B 1JMZA 1JHTA 2XCMC 4GW5B 3ZYZA 3J5PA 4NN5C 1K2DB 1TNYA 3WKML 5E08L 1KB3A 1MELA 2F5BH 4UNVA 4FQHB 4ZFOA 3PGCB 1U8QA 4NJ9L 3CFEB 4WH4A 3IDYC 2FULA 4A7GA 1HNGA 2OULB 3IETB 2CGRL 1Q94B 2Y2YA 4KBQA 2CDEA 4LHUB 1OCWH 4Y2OA 1NIBA 3WXVH 1MFUA 3DXKG 1GH7A 2K9UA 4WHTB 2UZYA 3KPSD 1MX2A 3SQBA 3RVWD 2DX5B 2LRWA 1OK0A 1U8HB 2EDJA 5TF0A 3ILEA 5KSBA 3ESNA 4XWGL 2FNBA 4D7BA 5LN4A 3UG5A 3T0EE 3X1NA 1VADA 1NVID 4FJ6A 3CK0H 3CG8A 1NDGB 4PGEB 3RWFB 3VXPB 2JB5H 1WSST 4OM0H 4Z95H 3Q1EA 2XJKA 3BP5A 2BWDA 1M71A 1EUVB 4XN9A 2CJSA 2GSMB 2P24A 4AM0Q 4MQSB 4Q2ZB 3NIGE 2BNRE 3UTTA 3TV3H 4E9LA 3GS2A 5KYUB 1PTZA 3RKVA 1AYFA 2FYYB 4KTGA 1S46A 4IC7B 1G3NB 4FQIH 4TQEH 1TUPA 1IXVA 2RDBC 2XQBH 2OXGA 3AREA 3RE0A 3BG1B 4N2OA 2ADFH 3VNZA 1KBGL 2WUCH 2QV2A 1S6NA 3QHFH 3L82A 4KKPA 3EJQA 2ITCA 4OUUA 5DZLA 4ZFOB 4KAQL 3SN6N 3UGEA 3H6NA 2ZVNA 3RY6C 4LRZA 3EOYG 4NQQA 4PJIF 2VMEA 3UZEA 1IKFH 1SXAA 2RFAA 3AS0A 3TWCH 2CDGA 1VFMA 2WQ7A 3V6OC 5I30L 5KSAA 1A6ZA 2AJUH 2XVBA 4MGXA 3VQMA 3QB7C 2YD2A 3C5ZB 1KIUA 2AQ1A 4GQQA 3TA3A 2K8QA 4J2QA 1JNHB 1S7SB 3Q9QA 1MFBL 4LXFA 2ZCBA 2QZQA 2H2SD 2NY3C 1BECA 3NFPB 4N0CC 3ZE0E 3RTQC 1RM6C 1TQUA 3ZL1A 4H8UA 5ANHA 4IRSA 1DVFC 3U2SC 3DX6A 5BZWB 5DRNA 4EPSA 3BP5B 4BQ6A 1U3HD 3GE8C 1M71B 5ADOH 5ICZB 3AC0A 1FDLH 1YZZA 5FV2A 4US8A 1B0IA 3D2TA 4FD0A 4X0KA 2B4CC 1PG7L 3SZ7A 2ZXQA 1MF2L 1LWRA 4LT7A 1U4AA 2A6DA 3K2MC 3ZHNA 4LNFA 4FTDA 4NQLB 5HHMD 3EFOA 4GLSC 4LGRB 2HKFH 2QFRA 1SN5A 3GXNA 5E9NA 2OXGB 2D3AA 3AAZA 4E68A 2IEPA 1QFOA 1PFOA 4PJFE 1S9XB 4WHCA 1EJ8A 3CZUB 3D51A 3RGVB 3S3PA 2VLKB 1R47A 3B2GA 3MACH 2GBUA 3QZLA 4GKNB 3V8OA 3W5NA 1ZPLA 3HI5L 3QC8B 3B3BA 1THCA 2HAZA 3DVIA 4Y9GA 4N2FA 3MRBA 4NKMA 5CWSA 4NACA 5T5FA 5JMRA 2VW4A 2EIKB 1KIUB 1KJMA 1MG2C 3AQYA 5BUZA 2Y1YA 4WHYH 1VGEL 4RNAA 4Q89A 3IJYB 3IBEA 3ULVL 3O3BB 1MZYA 2IBBA 4X6CF 1B89A 2D10A 1WWBX 1NINA 5HHME 4KI5C 2EDLA 4ZUVA 5ACZB 5CUSH 5I6OA 4JY6A 3P4RB 5CHVC 5G05C 3DX6B 5DCNA 1I8KA 2QGEA 5CD3A 5DRNB 1E6OH 2NW2B 2VN7A 1FJ1B 2F7QA 5SX5H 2BWFA 1V54B 3Q2WA 4OI7A 2D73A 4X0KB 5KBMA 3PXHA 1QR1B 4HXBH 2WP3T 3FTGB 1OCCB 5ARFA 1EZUA 4ACPA 4R2GB 5CZXD 1N5WA 5CGBA 4G0NB 4DLOA 5EC2B 3ROLB 4KNQA 1F0ZA 3RPKA 3PHSA 1ILUA 1IBHA 2B9BA 3HB3C 3CFIC 5D2LF 5CBAA 2MTPA 5ILTH 3AAZB 4NQSA 1W6LA 3UADA 1IE5A 1L4ZB 1XSIA 3HMWH 2EVHA 4LZKA 4XPHH 3T0BA 5KS9F 5IFJB 1NGZA 1SF0A 2KM4A 4YOKA 1I1CA 1UH3A 1DYQA 4YL9A 3MHSD 2FJHA 1F1AA 2OJEB 4PTUB 2ED7A 3IFPA 3AM8A 5I75C 1OSEA 2DDQL 4FEIA 2I60L 3MRBB 3K91A 5HHQB 3TO2A 1MFDL 3TNNA 3H0TA 4N9GA 2CMRL 3FFDB 4KOCA 2RPVA 2GK0B 4JHUA 2EELA 2G9HD 2GRQB 2VZ3A 1G5GA 1NLDL 1R5WB 3C87A 4RG6A 3V95A 4ZMPA 1HJBC 2XZAL 3HZMA 2RG8A 3RIKA 4GG6F 4JPIB 3CFDA 2Y7OA 3VRIB 1WT5A 4JY6B 3ZYIA 2C1PB 4ONFL 3ARFD 4NPYB 4WHDA 1I8KB 3A1QA 1ZGLB 2V0GA 2BNUA 4AEEA 5B38A 2D3BA 3G5WA 4LK4A 3MRPB 2V6HA 1EF1A 3QFDB 4EVNA 4U3XA 4FNPA 4GTQA 1DEDA 1KCKA 2G3ZA 3PAYA 5EIDA 3FXIC 4HPLB 3D69A 1MFEL 1TZHB 4E71A 2HT3C 2H0FA 2AF2A 2H7WA 3PDOB 3NCWA 2H41A 3APFA 3FJTA 4XE0A 2VQ1A 2FIFA 5CX3A 4XODA 5BOZG 1KN2H 3A4RA 1OAZL 1YJDL 4FZEL 5FYJL 4BWWA 2ZPYA 2K7PA 4OVVA 1NGZB 3DUUB 1NA0A 1S5HB 2XRAH 4GAYB 2QQLL 4UWHA 3DO7A 2FJHB 2E7LC 1L9RA 1G4RA 3IFPB 4OY9A 1PLBA 4X6FB 1TQSA 1RAXA 5KVDE 4UMSA 4UAOC 4MNQA 3PL6D 1PIFA 4G8FA 3BIKB 2W9EL 3VD4A 3LNEA 1WEJH 2EIBA 4WJG3 3MRLA 2RFXB 4MDJA 1KLFA 4K23H 1AMXA 1A7QH 1R3KA 3HZMB 3C2AH 4G42A 3WL9B 3CFDB 5BZXA 4AVJA 1A8ZA 4TS6A 2ETBA 1MI0A 4PJEF 3A1QB 4G6AD 2F1BA 3TCXA 4J8RA 3CVXA 3GBDA 3Q3JA 4IU2B 2M0XA 4H88L 1SXCA 3B5TA 4KNSA 5FGSA 1L2NA 3HE7B 4EI5D 1USZA 1WZAA 1QPPA 5BZDA 2N1WA 3SGKC 5K59E 3N20C 1XCWA 1HKFA 3EHMA 2OV0A 4DPCX 3KZ8A 2W91A 4N3BA 3GMNB 2FE8A 3SDCA 1R1CA 3MO1B 2NCNA 3QDMA 4FKHA 4GLRH 1S3KH 2B5IB 1M7DA 4U1MA 5I23A 1UGJA 5LCWC 3WJMB 4ZX5A 4B41A 4FQ2L 3ULVD 3CH8A 1EH9A 3VXMD 5EOQH 1GB4A 4CHKA 3KR3H 4KHXH 5D8JL 3GZSA 1RZKH 4XNBA 3O3UN 2A9DA 3QEHA 5DZ9A 3VR8B 1A02N 2ZGGA 1G5AA 2BWQA 4XRCA 3VYNA 3GYRA 3PE3A 1WFOA 2M26A 4XOEA 2AQ1B 4WEBL 2LAHA 4QRUB 4X6BB 3AKKA 4FEMA 1KLFB 4XMTA 1N0LA 2XA8L 4NZLB 3KM2A 5IGXL 4K2UH 4ILIA 2C3XA 2V9QA 1FLRL 2BB5A 1JOIA 4RRPM 5DC0A 3MBEA 4XO5A 1D5BA 2VR4A 4WWID 5GS2H 3R4RA 1TTBA 3ABZA 2WHVA 3KG5A 1AO7B 3ULVE 4Z6AT 3TN0C 4FLSA 3VXME 4HGWB 1DFBL 4JDTL 2KTRA 2Y25A 3PHWB 3QIUD 5EEYA 1KT0A 2YIHA 2B7DT 1PZBA 3GMRB 1O7DC 3W0WA 2EC9U 4BKLB 1U2CA 3MRMA 3SDCB 1M56B 2XXFA 3PWPB 1MQ8A 2JE8A 3BDBA 4F7CA 5B7EA 2LGXA 4WJ5A 5E2TL 4G7YH 4UNIA 3JVZX 5H2BB 1U6AH 4NCDA 3OM3B 2Q10A 1IQDA 4JGJA 2VN4A 4HJIA 2OMNA 2KC2A 1X4ZA 4LVHC 1IGDA 3HM6X 2L9BA 3IBOA 2G4EA 1CLOL 1X5KA 3QEHB 3ZDZB 5K9KB 2Q1EA 3QZBA 3BGAA 4NLHA 1TZGH 1ZA6B 2LAIA 3QEQB 5DF0A 3VWJB 1ILSA 3KEZA 4F58H 4LNRB 3QUKA 1N0LB 2PCFA 1KY6A 1MCWW 1NZRA 4F9LC 1HL8A 1KXVA 5DMJB 1AMYA 5EF1A 3FAXA 4S1SH 3TWSA 3G6JA 2L8JA 3AXLA 4WI4A 2I9CA 1V5JA 5AEKB 1XZWA 2D0HA 2VXTH 1KFAL 2K45A 2ZW1A 2VOTA 1DLFL 3VFWB 2PPCA 1UJTA 4KMLB 5FYJD 5IB4B 1J10A 2KTRB 2A6JA 2CALA 2Y07L 3D25A 3VFOB 3GKZA 4JPVH 1N11A 3C6LC 4MB3A 4TTDD 5D6DC 4PGBA 3W0WB 1UM5L 4PJBB 3WHE0 4XBPA 1SQMA 1L5GA 4CADA 2BJMH 3CQCB 2NXZD 1F6AA 1UXSB 5KJ7E 2QKIA 5LAXB 4AUUA 1W2KT 2VDKB 4OIIH 3IGAB 5FFOA 3K1DA 5CMWA 3IK2A 4I0PC 1FZMA 4LQFL 3ZKXB 4K1RB 1HWWA 3V5HA 4ENED 5LXGH 2JPHA 4BDVA 1WMHB 1ZW7A 2AEQL 1JI1A 2KQ4X 5JH5C 3QJVB 3ARUA 1H0DA 3MYVA 2Q9OA 3K71B 4NQEE 3GF8A 3PP4L 2PCFB 1YQBA 1SOXA 3VGAC 1MCLA 3SDAB 3PUCA 4XBEH 1FLTX 2X42A 1AY1H 4KOBA 4FFWC 4G7SB 2NR6D 2B08A 3CV0A 1MFCH 4PJ8C 2QDVA 1TJGH 5EA0L 3CFMA 3O2DL 3HG0D 4DQOH 4P23D 5IESL 3Q6FB 3RHWF 1MCPL 3FMGH 2Y4TA 5D7IF 4FABH 3QQXA 4GRWE 4F2EA 1CDBA 2FEEL 3RUGF 2IWKA 1EU4A 1NC2D 3IJSB 4XNYH 5JUEH 5D1XD 3LHPL 3ZTCA 5J18A 2XQ0A 4IBUA 5KAQF 1KFYB 4XBPB 1L5GB 3NVWA 2F6AA 2V3NA 1WY6A 3SPJA 2BSSB 4WWPA 1T1ZA 3RBSA 5BS0E 4M56A 4UM8A 2NZIA 3C60D 4M7JL 4PJ7A 4PP2A 4G7VL 2KFKA 1H3VA 3RI5K 3EGDA 3U6RA 1D9KA 1NZNA 1TSHA 3D6GA 3MLWL 5DR5L 1GOZA 3UYRL 2AJZA 3GRWA 2B3AA 5E1QA 4BDVB 1PSKL 2H32H 4RAHA 4BE5A 4LLDB 2RGFA 2YARA 1OAQH 2KMCA 2FK9A 1ZLSL 4P2OA 1T4WA 1T7ZA 2SEBD 5G5GA 3FDWA 3IVKB 2KDEB 3T4AA 4W9LA 3QR1A 3FUIA 4QRFA 3TMPB 1G7HA 2FO7A 3GLDA 1MCHA 4OBSA 4IIQC 4Y1AD 1J7CA 4GDLA 2R51A 1NCAH 2YEVB 3GSOB 4FJVB 4PG2A 3MLTA 2QPDB 4XC3H 1F3DH 2LABA 2OCCB 1BG9A 5D7LD 4LEOB 5JO5B 5C0CD 1BAFL 2FX7H 1ZJAA 4XMWA 4CDGC 5I6MA 5AG8A 4UANA 3FFCA 3GSWA 4X8JB 1UOWA 5E8DH 3REWA 2AABH 3RILA 5F7HA 1XLPA 1WZKA 5KVGL 1QKZL 2A1WH 4YHOL 4A2LA 2E2EA 2VQUA 2GSGA 4PJ7B 3LZFL 4IOIE 2PCYA 1HI6A 5D2NA 4WFHE 3MGOB 5FYKE 2YSSA 3TT3H 3VXSD 1E2VA 2DI9A 4QWWD 3UBXB 2DM7A 2V3FA 2CRMA 1CL7L 4Y1AE 4YDJA 1QYMA 5EYPF 1A7PL 3MX0B 2G4DB 2AJZB 4JO2L 4NN7B 4X5PA 3RURA 2WO2B 4MNGE 2CO7B 3VGBA 2AXFA 5D7LE 3BK1A 3QR2A 2VDNL 2Y6SD 5C0CE 2APXA 3Q3MC 3CFKB 4Z7VA 1V55B 4P2OB 4ZMTA 4BKTA 5PAZA 3K6IA 5GHWH 3AEDB 4NUMA 1PVHA 3P0GB 4MYPA 4D0CA 3MEKA 1E27A 3VGDA 4IIZA 4B95C 5CERB 5BOPA 5D1QB 3MNWB 3PV1A 4WUYA 2JXMA 4GDLB 3DSFH 3NSYA 1HT6A 3OG4B 1N5XA 1DHKA 1BX2B 4O00A 4X0NA 2WO4A 5LHDA 1JWAD 3VFTA 3MLTB 2R4RL 4HS8L 1AQMA 4R4FH 4ZODA 2W55A 1DQMH 1XHHA 3U9WA 4GZ5A 4A9AA 1R24A 3KCPA 3CGTA 2D8KA 3FFCB 3GSWB 1RJYA 3VI4E 1AR1B 1V05A 5E51A 4HYTB 4HHWA 1UB5A 2A7BA 5HHXL 5TTRA 3WNKA 1FC1A 1LO5B 5IOPA 3B9EA 2ERJC 3CPLB 4XVTH 4I9CA 3D0LA 4MFHA 4XMVA 4XHQA 3RSEG 5ENNA 1OT1A 5D2NB 4JXTA 3SPVB 4DXGA 4UI9K 5IKCM 3TNMB 2OFQA 4YDJB 4UDTA 3RA7H 4FFVC 3QWRA 2FBOJ 3P4MA 4UTCA 4YHZH 4XAKE 3FTSA 5TGBA 4CDRA 3RWHA 1QOAA 4WW2B 4NN6B 3ZU8A 1FBIL 1H3WM 1G9NC 2AQSA 4P9ML 5E2UL 5AYTA 4JFFA 4ZFZB 1NBZB 3P1VA 3TO4B 5I17B 4NPNA 1ZWIB 4R26L 5AZ2H 2INPE 1ADQH 4C4BA 2JFCA 4XVSL 4W93A 5AAPA 5JPNC 4OFYD 1E27B 1MN4A 2J71A 3PHQB 4FTVB 4G8GB 1EMTL 4Y4FA 3RNFC 3UJJH 3D0AA 5E2VL 5DRZA 4Z7OB 3P4OB 4AJ0A 2LU5A 1F18A 1TJXA 1WWWX 2AEOA 2J8UA 3ARZA 2E27L 5CN3A 4GDKB 3QZOA 4A1SA 1MCWM 3OMAB 2W82A 1KNOA 3DXAD 3HMXA 3RZCD 4YFEA 1FNSH 1JRHH 1BI8B 2P49B 3D4GA 1YEDB 2PZIA 3HS0A 1RJYB 3QCTH 4ABWA 5JTWA 4HK2A 4MCYB 4PVNA 1J18A 2YXMA 4GAJH 4IQHA 3HPLA 3QDHA 2P1YA 2F74B 3LZPA 4U33A 2ADYA 3TBSB 5CMYA 4FG2A 4B5ZA 4KTYA 4JL0A 1FNUA 2Z0BA 1FFVA 1EFXB 1DQDL 4GZ3A 2YKLH 4IEFA 5ISZA 1DBBL 4WTZG 4N5QA 1WTLA 2VC2L 3P4MB 4MLSA 2F53B 4OGXH 4YXKL 1GGIH 1S9YB 3RWJB 2KN5A 4QRPE 5CINL 2FUQA 4BQ8A 2X70A 3OXSA 3GQFA 1EEYA 2YPVL 4XP1L 5I16B 2I69A 2KDBA 1AP7A 3SQRA 1II4E 1S70B 5A3IC 4PRDB 2HFEB 1VFUA 4NIKB 3QNFA 1OAXL 4JE4B 2KQNA 3L16A 4LF3A 2O1AA 2WXPA 4RGNA 5DRZB 4I0CC 1E4KC 1I3GL 5D7JB 1RZIB 3EZ8A 4HKBA 2WVVA 4IYPA 3QZWG 1KSRA 2ZKMX 4Q0XH 4XMPH 3GI8H 3TU6A 3SY0A 2DIBA 3TBVB 1IBXA 2B59A 2ITEA 3T2QA 1MG3C 4FQXD 1EPUA 4GYYA 3RVXD 1MJUH 3NK4A 3CMOL 2R1WB 3ZXAC 1AFVL 4ITKA 4XPFH 2QSCL 1A7NL 4GTPA 3HPLB 4BFKA 1AQKH 4KGTA 3Q1SH 4O4YH 3N1FC 2E3TA 2L0TA 4EDXA 1CLCA 1CT8B 4M6ML 3VUWA 4HLZH 5JIKA 5JOPD 4PJHB 2D7TH 1OZUA 3P3SA 3ASFA 3SO3C 4GQPH 4OZFG 1BXTA 3FHQA 1O0VA 3SOTA 4PLNC 1U8KB 2JCWA 1WAAE 3DETC 3LQZB 4B6ZA 4YH6A 5F7BA 1EJOH 2H89B 5ABZA 1CFQA 4JK0D 3U66A 1AGEA 1QA9A 2KH2B 1ROEA 4HJTA 4AGQA 3NPSB 1HXYB 3PHOA 4ODUB 3RWIA 4PYGA 3EYQC 4R6UA 4N3CA 2OMTB 4LPCA 3AULA 5CN1A 4HC1H 2Y24A 1OB1A 3ARQA 4DX2A 3AU4A 2CKBA 3HLKA 4AW4A 4M8VA 1QTSA 1FYHB 3CN0A 3KYMA 4BX8A 1KEMH 1YMPA 3ZRSA 4AS1A 1FZKB 1VGKA 2VZKB 4HKBB 1PAZA 3QULA 4WK4B 2XZCL 3RLSA 3BUIA 4ILHB 2EYRB 1E7PB 4GPVA 1FVHA 3BVDB 3CSGA 2B59B 3G5YB 3HC0A 2W95A 1MCKA 3TBBA 4YHPB 2DQIL 2X0UA 2H8PB 3FQ2A 4J3WA 2R0WH 3VVWA 2YAEA 4OT1L 2D0GA 1FPTH 5D93B 3KYNB 1L6ZA 1KPVA 2V8MA 1LXDA 3O4ZA 4NO0B 4OFQA 4QCIA 2OMBA 1SF3A 2VDMB 3PTFC 3FYIB 5E8EA 3F83A 2FATL 3ZKJA 3SE6A 3CHSA 3HVEA 3ARXA 4JS7A 4QTFA 4W9GC 1NFIE 5IVNA 1YJJA 1IFHL 2DQFB 2ZOOA 3NN8A 4XP4L 4BUQA 1GMIA 5DO2C 1UD7A 5DD0L 4GRLA 1G6RL 2KMAA 3TIDA 5ALCH 2K8MA 3ZKNC 3MXVL 1B6UA 3QO0A 5BZZA 1QA9B 2PTLA 1F02I 3FU7B 5IW3A 5HI3D 2Z34A 3LKRA 4RGTA 1JQ4A 3RWIB 2DYBA 1CGUA 3MRKA 1T03L 1CICB 3VFSA 2R0ZL 1YJIA 1TTRA 2C9SA 2RQ8A 2TSBA 2N9KA 2G9KA 2B77A 4LCVA 3OSKA 3AMZA 1WZMA 2QR0A 1IGMH 1VGKB 3LH8A 3NCJH 1OOAA 3SDLC 4WI3A 3GJFA 3RWEB 2Y5BB 2B15A 2H2PD 2QY7A 5FK9A 2HTME 2VLJD 3T9KA 4KXZH 3HC0B 5G4NA 3MJ7A 2AEPL 5KNHD 4XO4A 4ALAH 4TRQA 4EN3D 5D6JB 5TK2A 4P2RD 4JZOA 3V4VA 2UUDH 5HYSG 3SPGA 4ADJA 3CC1A 2AL3A 2M0AA 2ODHA 4QHNA 5E8EB 3GSRB 3BQOA 3VXNA 5ALBH 3ZRFC 3KSQA 5JJ7A 3FO2A 2JCCE 4PV9A 3SBTB 1BQHB 4MQXC 5H35B 2D9CA 5AW4B 3SKMA 2QVTA 3NCYP 2R2EA 3QUXD 1T1WB 4K5AB 4A63B 3B8SA 2L04A 1F41A 1K85A 5LOZA 3TIDB 3V2AR 3NCYS 1ODAA 2VUKA 5D7KD 3TWYA 1ZK9A 2VLJE 4X5XB 2YWZA 2PWDA 2OBGA 5GS0L 4ODTH 2VXVL 3WNNA 5LWYL 1XO3A 1VZGA 3LSOA 3MRKB 2IU1A 4M7LT 5J12C 3PAVA 4QXVA 1X5ZA 4MBRA 2J1ZA 3F7YB 1EAPA 3S34H 3IXTA 1I3RA 1ND0A 1PY1A 4K4KA 2HVKB 3EUB2 2MH4A 3WSQL 3LVEA 5FW6A 3LPPA 5AKRA 3ZN6A 3GYZA 3FN0H 3QG7L 4Q9RL 3GJFB 3L1EA 4WUUB 4JQXA 4FA8A 3RMKC 4A7VA 3U46A 3D18B 5DWUH 5FFLA 3BQUD 1MJDA 5D7KE 2EQXA 1P6AB 3PFQA 3RL1A 3H9SA 4UTBH 5BRZE 5I1GH 3V60A 1ZLWH 5C0AD 2R0LL 3MRNB 4QHNB 5FA4B 4YSUA 1JNLL 4J6RH 4PG9A 2OYPA 1X1MA 1PJWA 2VDLB 4FFYL 1MCOL 4H8HA 2NY2B 4OLXL 4NM4H 3N55A 3FAWA 3VXTB 5JDSA 4NQTA 1NLBH 2QHRH 4KY2A 3WOVA 4E9WA 3FF8A 4DI3A 5FO7B 5I0ZA 4BFIB 1JALA 5ESAA 5TPWH 1RFKA 3GMMA 5LBSL 3V0WH 4AQAA 5CGYC 3P11L 2XQYG 3ZNID 3U4EA 4LNGA 1E43A 4HQQH 2VDKH 4NI6A 1HOCA 5KJRL 1MFMA 2CRZA 5F7EL 3AE9B 1EAPB 3PWNB 3Q2LA 5FZRA 4Q9QH 4LSRL 3RI7C 4R0LC 1JXGA 4JHRA 3RKDC 2C7FA 4QY8B 4HKJA 1RIUL 1JYXA 2NVUI 1RSYA 4LLWA 2QGCA 4L4VE 3HUJE 5CJ5A 4A67A 1H6KA 3VRLF 1Q4NX 3OKEA 4L5FH 4ORGA 4ZYNA 1ED3B 1Y18A 4PJ9D 3ZDZF 3NTCH 4I18C 5D0QD 7PAZA 5KG9B 5AZUA 3DJ9A 1FWXA 2WWMC 4PR5A 5GSRA 3EU9A 3TF7C 4H7XA 5IBLD 4EIUA 3MUZ1 5DRWB 4W9HA 4Y5VA 1MJJB 2NXYD 1VACA