The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
240
|
sequence length |
916
|
structure length |
808
|
Chain Sequence |
b'VKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNLWSLEQPFSIELIEGRKVNAMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVCPIAWANLMLFDYKDQLKTGERCLYMWPSVLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELLREILEYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALR'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The Discovery of GS-9901: A Potent, Selective and Metabolically Stable Inhibitor of PI3Kd
rcsb |
| molecule keywords |
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic sub
|
| source organism |
Mus musculus
|
| molecule tags |
Transferase/transferase inhibitor
|
| total genus |
240
|
| structure length |
808
|
| sequence length |
916
|
| ec nomenclature |
ec
2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase. |
| pdb deposition date | 2016-09-07 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00454 | PI3_PI4_kinase | Phosphatidylinositol 3- and 4-kinase |
| A | PF00613 | PI3Ka | Phosphoinositide 3-kinase family, accessory domain (PIK domain) |
| A | PF00792 | PI3K_C2 | Phosphoinositide 3-kinase C2 |
| A | PF00794 | PI3K_rbd | PI3-kinase family, ras-binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 | Phosphatidylinositol 3-/4-kinase, catalytic domain | ||
| Mainly Alpha | Alpha Horseshoe | Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat | Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat | ||
| Mainly Beta | Sandwich | Immunoglobulin-like | C2 domain | ||
| Alpha Beta | Roll | Ubiquitin-like (UB roll) | Ubiquitin-like (UB roll) | ||
| Alpha Beta | 2-Layer Sandwich | Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 | Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 |
