5TARA

Crystal structure of farnesylated and methylated kras4b in complex with pde-delta (crystal form ii - with ordered hypervariable region)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
184
structure length
184
Chain Sequence
GTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of recognition of farnesylated and methylated KRAS4b by PDE delta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein
molecule keywords GTPase KRas
total genus 69
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2016-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5tarA00
2OCYC 1HEIA 1N5LA 2GJAA 2J5XA 2WVJA 3IUYA 4E03A 5KSZA 4BLOA 3CZQA 1W5SA 4YXWA 2AL7A 1S96A 3D3QA 3P1JA 4JBYA 5EUQB 4B74A 2QRNA 4D4JA 4TZ0A 4HLUA 3IDQA 4V0NA 3THXA 3CRW1 4MDEA 4WXRA 4C2TA 3WMGA 5JSZB 2CK3D 3E5HA 2QGZA 1JI0A 5B2ZA 4JSTA 3GJ4A 2YZ2A 3DM5A 4PQYA 4B6EA 3L8ZA 2WSSD 3CNLA 4HLUC 3EZ2A 2WPDA 3QXHA 3L82B 5FFMA 3LBNA 5HTKA 1KO5A 3EZ7A 5C4GB 1XTKA 2BBWA 4TLCA 4TLAA 2HCBA 2DHRA 2ZRBA 4XWAA 5AJXA 3SN6A 3QKRA 1PJRA 4QGHA 4V0LA 1CRQA 2ERXA 5FTLA 1DAFA 2FJUA 4MA4A 2V4ZA 5AUPB 3A36A 3FOZA 3BC1A 1E2NA 3C5CA 1N0WA 3WYGA 1NP6A 5FL3A 2F9LA 3ICEA 3VKWA 4WIAA 2WAXA 3LFUA 5JSZA 5B57C 5F9HA 2QT0A 1H8ED 4DJTA 2IXGA 3LH5A 3C16C 1Z3IX 3GLFA 2ZJ5A 1XJQA 2ZRJA 1XP8A 2A3RA 2VF8A 1T91A 1WXQA 2QSZA 2XOKA 2R8RA 4GP7A 2X2FA 4BFTA 2QG6A 1NL3A 1M1YE 3QENA 4LOAA 3MJRA 1ZNWA 4WZAE 5DN6A 1E69A 3GP8A 2O0HA 3AVOA 3CBQA 5D3MA 5LD2B 4ASUA 2B8WA 2BVNA 2NO6A 2NOAA 2R9VA 4P0TA 5KDOA 3U44B 1VCMA 1TUEA 1Z6YA 1FX0A 2REBA 5EE9A 4FWTA 1OH8A 3RS3A 3LX8A 1J99A 3TH5A 3IEVA 3ZQ6A 1DS6A 2YOFA 3NH9A 3BWDD 2R65A 3OHMA 1IN6A 5DISB 2ORVA 4MGIR 1KOFA 521PA 4PXAA 5JHHB 3QF4A 1JXOA 1IXSB 3SQXA 1IJFA 2RGDA 3QPVA 1GRNA 3H86A 3K0FB 4PHGA 5DSZA 1W0JA 1ZCBA 3GEHA 3K09A 1QHHB 3EC2A 3TAUA 4URYR 2FA9A 2IUTA 4XTCS 3T34A 821PA 2WZQA 1I2DA 2YJTD 3RDPA 3RS2A 3DZ8A 3LY5A 4LK2A 4NCJA 3KQKA 2DWPA 2H18A 1J70A 1ZAKA 2GVDC 4KJZA 1P72A 1QHGA 1Q57A 4YDHB 2IHYA 2P6RA 2AHOA 4Q1FA 4Z8YA 3QXJA 2GZAA 2AFHE 4P31A 2QTHA 1YKSA 4Q48A 5B64A 2C2HA 1XEXA 3B8HA 1G64A 2J0VA 5L3SA 4B32A 3V9PA 4LRWA 1U98A 5FL7D 4HDCA 1I4DD 1TF2A 2O52A 1SXJE 4A36A 4N0DA 2BMJA 2IWRA 4HZUA 1P62B 1ZM7A 3ZYCA 4QRHA 4U7DA 3JZAA 4L9SA 4M22A 4PQFA 1IHUA 4DRZA 2WOJA 2W2XA 3RC8A 3EPHA 2L0XA 4AYWA 1M6NA 1QF9A 1YE8A 1GNPA 3WMEA 4WOPA 4FW9A 3IHWA 1LW7A 2ZI6A 3Q5EA 2Q3FA 1F48A 4XVRA 4F4IA 1S1MA 2E87A 3OIYA 4PZLA 1P9WA 1DG3A 5J40A 1H8HD 1MH1A 2P6UA 2XITA 2RGEA 5FOXA 4B76A 5JJLA 4V0ME 1VMAA 4OK6A 1N6NA 1KK1A 4IKEA 1LF0A 2O8DA 1ZNZA 2VHJA 3AVTA 2WPDD 1W2GA 2WWIA 2VHTA 2YWHA 2RGGA 3FMPB 3I8XA 5HKKA 5DGXA 3W3AA 5L3QA 4A0GA 3QXSA 1RW4A 3AP3A 2O0KA 4DSNA 5FTKA 3AQ4A 2ZRKA 1WE2A 2N46A 3EARA 4M9ZA 3AH8A 3AUXA 2RH5A 1U99A 1K5DA 2O8BA 3SYLA 2OCAA 4BFUA 1VTKA 4QKQA 1RJ9B 4IOMA 2A5YB 1ZYUA 2YHSA 3KJEA 3P20A 1NKTA 4F92B 5EE1A 4MUAA 4QHSA 5K8LA 4CYMA 2AX4A 4PPQA 2Q21A 3BXZA 4GZMA 1NVUQ 1G9XA 2QROA 4BLSA 4W5HA 2BBOA 3WY9A 4LWZA 1CKEA 3UPUA 2EYQA 2CBZA 2WJVA 3RANA 2OZEA 1W1WA 2F9MA 4EQ6A 3I3SR 3KQHA 1F60A 1IY2A 1JALA 3B2EA 2X2EA 1KSFX 1QHHA 4HZIA 3ZS9A 1G5RA 3Q7PA 4WW0A 3C4JA 2VA8A 2VP4A 1YR6A 3QKTA 2YC4C 3QVVA 4UXIA 5KU1A 1OIVA 4RVCA 4LJ4A 3GEEA 5BYJA 2BIFA 4OYHA 1N5KA 1XPUA 3FMOB 1WDTA 3UWKA 2DFTA 4M1MA 5JI2E 721PA 4MRPA 2IYUA 3KXKA 4URXR 1G5PA 1HURA 4FI3C 1ZUIA 3HU3A 3LO5A 5E7JA 3P4XA 3OEHA 4DZZA 3JZMA 4AIIA 5JI3E 5L3VA 1TU3A 1ZW6A 2REXB 4LJ5A 4ASUD 3EZ9A 1AM4D 2A5GA 3AKDA 1E79D 3B9QA 1Z6TA 2QBYA 2F6RA 5JCPA 4ZCIA 1DARA 1WF3A 5DHAA 1N0UA 4PO9A 1G1MA 1VIYA 1JNYA 4O0MA 3ADDA 1ELOA 1GKUB 3BAFA 3TMKA 3PFIA 3IO5A 1GNRA 2HV8A 3ZQJA 2EYUA 3DMDA 4DCTA 4Q03A 1Z2CA 2GEDA 4DEYA 2ZRAA 1YJ5A 1K6MA 1AS3A 4RZ3A 1W44A 5FOTA 3B6EA 3O8CA 2Z6VA 4QOSA 4PPGA 1TF7A 1R0YA 4CT4B 4BZXA 2GCOB 2QTFA 2KE5A 4C0SA 4DCNA 4GOJA 2D62A 2GXUA 2JIZA 3DZDA 5DO9A 3L2OB 4URWR 2Z83A 3A37A 4QG7A 4B3DA 2ZYVX 3RS7A 4A8JA 2ZVQX 5FOWA 2F43A 1Z5ZA 2CNWA 5FBQB 1UKZA 3Q8XB 1L4UA 3CRMA 2IYTA 3ECCA 1TADA 5KPJA 1ZUNB 1KTVA 4UKDA 3K0AA 5JLJA 1YR8A 4V0KA 4PAOA 2H5EA 5GVSA 2QENA 3MG9A 4JVNA 3ZLJA 3CPJB 2FPMA 3TUIC 1RYFA 3SYKA 1DAGA 3HPQA 3LW8A 2FDCA 1OSNA 2GBLC 2IYWA 1G8PA 1DO2A 2X1VA 1UDWA 2IYRA 2JDID 3PEUA 1IN5A 1Z28A 2V55B 1Q1QA 2YV5A 2GBLA 4BE7B 2EVWX 2H1LA 2KWIA 2AWNA 4LBVA 1G7CA 4Z1MA 1NRJB 5AUOB 3BH7A 3DHWC 2OXCA 4I99A 5D3QA 2OCPA 4ITRC 1P9RA 1TL7C 4LJ7A 1FPMA 4BFZA 1GVNB 2VQSA 3ND8A 2ZREA 3SR0A 4DB2A 3PUYA 4JYCA 4PC7A 5J4VA 1T9HA 1D8TA 3SJCA 5FUXA 3R20A 3CF6R 2V7QD 1MT0A 1OB5A 1OB2A 1GAJA 4NYJR 3CPHA 4GZLA 4DLYA 1UBGA 1GG2A 1ZMXA 4KITB 2CVHA 2O8BB 4IDOA 1E2PA 1NMZA 2NPIA 4MKHA 4JLKA 4XJXA 4IOKA 3T61A 3LRPA 2P3SA 3THYA 4NCHA 4A9AA 3AVXA 4H1UA 3NDBB 3K9HA 1XMIA 3GFTA 3KJHA 2ZR7A 1CJMA 3I1FA 1U9IA 4EAQA 1T8TA 5FBVB 1Z29A 4HI0E 3WYAA 2DY1A 3QPWA 4IXMA 2E1RA 4O25A 1S3GA 3B60A 3A58B 3CWQA 3EA5A 2GEVA 4KAXA 4ZDJA 4ZCMA 3IHLA 2F1IA 1Z63A 1RVDA 2IW3A 1FNMA 3EIEA 1S9HA 4HDOB 2WWHA 4HDQB 5JZVA 3PCRB 3GLFE 4TMKA 2F1HA 4M4SA 1W4CA 4I1SA 5F3WB 4G5SA 2DYKA 2GAAA 3VX4A 1KZ7B 4LHYA 1SQ5A 3UANA 2JJ8A 1W4RA 3LX5A 1AKYA 2IYYA 1SGWA 3LBIA 2IWHA 4TYNA 2D74A 2O8DB 3BH0A 3GLGA 3LXRA 1ESMA 2R62A 2ZYUX 4IEIA 1Z0IA 1TF5A 4NPHA 5EP1A 5G53C 1FTSA 2VP5A 2QE7A 4BLTA 3DL0A 2GILA 4Q7MB 1IQPA 2AD5A 3CRRA 1CJKC 4GSYA 4DDUA 5CIWA 1S3SA 2GESA 5CLQA 3O8RA 5SZKB 3CX8A 2IC5A 3Q5DA 1E2LA 3EC1A 5BWMA 2A2ZA 3VU9B 2NO0A 4A0FA 3GLIE 1ZC4A 2GRJA 4KYIB 3TBKA 3PEVA 4IFBA 4A6XA 4N3NA 2PJRA 4DKXA 4RFSA 4KLNA 1RPZA 4ZI3A 8OHMA 4O2RA 1H65A 1EX7A 4OHWA 2UVQA 3D6TB 3TSOA 1NIJA 4CEIA 4KFSA 2QT1A 3U6BA 4URVR 4Z51A 4JVMA 4LBWA 4BUJA 1NN1A 2W2VA 3JVVA 4EQ6B 2CE7A 2F55A 1IN4A 1T3HA 4FMDB 1KYIA 1D2EA 1S1CA 5KHOC 2GCOA 3C14C 4PHHA 1B23P 1L4YA 5FOVA 1XBTA 5C2JB 4Q21A 5IDVA 4DLUA 4TMZA 2V1XA 4BFVA 3FHOA 1KI1A 2WAYA 1KAOA 2GXAA 2W0SA 2GXSA 1T0HB 2Q3MA 1ANKA 1WBBA 1AGPA 3FE2A 4HEJA 1ONBA 4OL0A 2DWQA 2EFDB 2FV8A 1XD2A 5CK5A 1KJWA 2ZROA 2VSOA 3NVAA 1QHYA 2YKGA 5IK2A 4JKYA 4Q4AA 3CPEA 2KI5A 4BGDA 4M1KA 2HXSA 5K8TA 2C9OA 3AF1A 4HB0A 1K5GA 1XNJA 4TLDA 2XB4A 1CJTC 2NO7A 4YONB 2DCUA 4P4TA 5JJKA 1E9EA 2IF2A 3MFYA 1SVIA 4U5XA 3LLMA 3RLFA 3ZVLA 4NHOA 2JLUA 4LYJA 1KI4A 1OYYA 1EG7A 3EWSA 4LJ9A 4DDVA 4Q4LA 4DDWA 1N5IA 4US1R 1A1VA 4C2UA 1KI2A 3L0IB 1E9DA 1F3OA 1HE1C 4LJAA 2ZYWX 2BCJQ 1G5TA 4WBSA 2V9PA 2G83A 1X6VA 4CRWB 1J2JA 1I2MA 3VR1A 1H8HA 4LPKA 4B34A 4B71A 3THWA 3FHTA 4TZ6A 4Q1EA 2V1UA 2QU8A 5JJIA 3SNHA 1X1SA 3PITA 1OFUX 2QL6A 4JT2A 3IQXA 5KDDA 1E1QD 5F2EA 1ODFA 2QZ4A 4YMSA 4MYTA 4B3CA 3SOPA 1JJVA 1F2TB 1G8HA 1SZPA 2IUSA 5CK4A 5FBLB 5TXGA 3SFZA 1KDRA 4Q02A 4BFWA 3QVUA 4S35A 4BZPA 3U3KA 1P4SA 2QMUA 3T06B 1UKYA 3V4FA 1VYUA 1OXTA 2QI9C 5J4KA 5TDHA 2ORIA 1A2BA 2QNRA 2B7CA 2OBMA 5A5GA 4JJKA 4Q7LA 1QRAA 4TL8A 2GK7A 4RD3A 3S1AB 4DUGD 2RCNA 4BRUA 4UXHA 3O8DA 2FFBA 4BEJA 5FOSA 2IXFA 1O87A 1PV4A 1HE8B 4NCNA 6Q21A 1U0LA 4B48A 4LC0A 1NSTA 1JB1A 1D2NA 2J3EA 4QFMA 1N6OA 1BMFD 3BD9A 1E0AA 4LHVA 2JLQA 3MGCA 5C18A 1SVOA 3SYNA 4TLEA 3DO6A 3WRYC 3C7KA 3UIEA 3FPAA 3TQCA 2ONKA 2OFXA 3R9WA 2G1KA 1E2FA 1M8PA 2DBYA 5EXSA 3ZZTA 1OV4A 4WZBE 4FMCF 5CDFE 2CVFA 4JLDA 1G7RA 4Q9IA 1N6HA 4ZPXA 3RRZA 3UG6A 3PEYA 1D2MA 3RHFA 3RRYA 1E0JA 5IRCD 1P2TA 2PMKA 1FUUA 4EDHA 1P5ZB 4NONA 2FEMA 3NC1C 4RD0A 1E9SA 1US8B 1PVOA 2SHKA 5F9FA 1W48A 4K46A 5SZHB 2IYXA 4QGGA 3FMFA 3WBKA 4DLWA 1FL9A 1Z0AA 2D7DA 4DB4A 2ZRLA 3GJ6A 1LVGA 2QQEA 4ABYA 3ZS8A 1OXVA 1NVWQ 4OK3A 1JXMA 4Q7JB 2GJ9A 4JSYA 4ZKDA 1M7BA 2J9RA 5GJBA 2J0SA 1OT3A 3LXXA 4DVGA 1W0KA 2UKDA 2FNAA 2VP6A 1II0A 3NBZC 3I61A 3G0HA 5CYOA 2PEZA 4XVUA 1UPTA 3BGWA 3B1YA 2JASA 2OLKA 1SKQA 2BKUA 1FMLA 4JJZA 2NMVA 3QKUA 3TK1A 3CO5A 4XTRA 4UXJA 2OBLA 4KBGA 2GETA 2VO1A 2ODWA 4FCWA 4D0LB 4KFTA 3NXSA 1QHXA 1OF1A 5FPYA 4BLPA 1G17A 4OBEA 5BN4A 2JEOA 4FXPA 1FP7A 4FCTA 1ZRHA 2E9SA 4C0AC 1CIPA 2XX3A 2ZUBA 1XF9A 3LQRA 4DCVA 1DELA 5AK0A 3U61B 4Q4HB 2GXQA 2OAP1 5EJEA 3LWNA 3KQNA 1AS2A 4Q00A 2VHUA 3E2IA 4PANA 2QAGC 4PX9A 3OEEA 4A2QA 2VSXA 3CW2A 4WZ6A 1AKEA 1ZNYA 4PR0A 1XCPA 4AYTA 1SXJA 1EFUA 1KKMA 2FG5A 2GCPA 2XEXA 1S2MA 3NBYC 1CU1A 2D7CA 1GUAA 3LA6A 3GLHA 2QP9X 2BKEA 2ZRGA 2QAGA 2B8TA 1G291 2P65A 1TAGA 1AK2A 3TKLA 2BMEA 1R0WA 3AB3A 3E70C 1LTQA 1UEJA 4Q1BA 3W9YA 1E2GA 3HWSA 4US0R 4ZDKA 3A1WA 3PQCA 5EP4A 3W90A 2ZIAA 1GKYA 4ZV4A 5JEEA 5E7MA 5GJCA 5JHGB 2XAUA 2ZPTX 4QM6A 2IS2A 5DI9A 3MAAC 3N70A 1EXMA 1TUIA 4JS0A 1G3RA 3WP0A 3KQUA 2DFNA 1OIWA 4LYFA 2IS4A 2RGNC 5A0FA 2OXRA 4FINA 3RSOA 1N0VC 4DT1B 1TQDA 2PX0A 4PSAA 2W6JD 5HR5A 5DN6D 2J41A 2FMXA 2VBCA 1U2RA 3TAHA 1SVSA 2AN9A 1G21E 3GLHB 5DNYB 4M9QA 1Z08A 2XJ4A 1OKKA 1LS6A 2GDJA 3X1XA 1A5TA 4P4SA 2R44A 1KI6B 3FTQA 3MWLA 2QMHA 1QBKC 2YWEA 2VPPA 2FSHA 3ZVMA 4CEJA 5FBWB 1XZQA 3L0PA 2PCLA 1HV8A 2N1BA 2AXPA 4HUTA 3SJBA 3K0FA 2QP4A 4E22A 1VKJA 5AUQA 1L8QA 3HR7A 1UF9A 2HJVA 3O47A 4CT5A 3TNFA 2ZS8A 1NMXA 3HP1A 3A6PC 2PBRA 2WV9A 1Q20A 3AVUA 3RYTC 4CEIB 4N0EA 2C03A 3ZVNA 1RRCA 3UK6A 4C0QC 3KTAA 2O8EA 2EU8A 5SZJA 4G3XA 3CR8A 3GJ5A 3ETLA 2QM8A 3NC0C 4JLNA 2WJHA 2CCJA 4MGZR 2C9YA 4AY2A 4BQSA 3U2QA 2QY9A 1KO4A 4QNMA 1G3UA 4PSVA 3T12A 1KHTA 4FIDA 2QRZA 1NN5A 2DB3A 1NMYA 3GJ0A 4GPTA 2A9KA 2IK8A 3Q85A 4HAXA 5FL7A 1NBMD 3K53A 4ZKEA 2HYDA 3B13B 1UAAA 1IAQA 2MSCB 3U3MA 4URZR 1P73A 1W0KD 1Z22A 2C8VA 1FZQA 2UZIR 2OESA 4PPFA 1G6OA 5EE0A 2FSIA 4B75A 4LV8B 4QJ3A 1FW6A 1C4OA 4Q4AB 2NZ8A 3QNUA 4BWYA 1TQ2A 2J45A 4ZDWA 2EWVA 2YC2C 2ZJ8A 2BBSA 3ZD6A 4IHQA 5HCNA 1W2HA 2JGNA 2QUZA 3JVUA 4MUBA 4GRAA 1EFRD 2ZYTX 4RZXA 3KJIA 1QZXA 4LY6A 5BN3A 3Q7QA 4HUQA 1X86B 3TIFA 3UATA 2OT3B 4B33A 4NCKA 3K70D 4EFMA 3ZIAA 4K81B 2WBLC 3P4YA 4C9BA 1KK2A 3AKEA 1VG0B 2VP0A 4LYAA 1QG4A 3H84A 5FR2A 2RHMA 1D6JA 1S0UA 2V54A 2BMDA 2DWOA 4LX0A 1JQLB 1GILA 1NJFA 3O8BA 4G5GA 2ZVPX 4BRWA 4NBSA 4TTRA 5CM8B 3W3ZB 3SJZA 1SXJB 1UKVY 5DLQC 1TQ4A 2WKQA 3A1SA 1PUJA 2DPXA 1LNZA 1E96A 2K5UA 5DIFA 1IN7A 2FH5B 2QM7A 3BBPA 3M1IA 4P4SB 4AG6A 1Y3AA 1ZD1A 1SVMA 5FI0B 1EESA 1S8FA 4A92A 5IK2D 1G41A 2R6AA 1JPJA 2RGBA 4W7SA 1XEXB 2ATXA 2ZRCA 2PZFA 3MRSA 4AKIA 2ZR0A 4CEHA 2J7KA 1GM5A 4MRSA 3ZZ0A 1KDOA 2JAQA 4HB4A 2AKAB 2MSEB 3B1VA 1A4RA 3AKYA 4EPTA 2QEQA 4C30A 3VU9A 1AQUA 3H0KA 4M8NE 5DE3A 1JPNA 1VCNA 3GMTA 3P26A 1GFIA 4TQUS 5CDFA 1ZBDA 1SVWA 4PHFA 4P3YA 2VYFA 2JLRA 4NYIR 4RCYA 1IY0A 3TJZA 3UWOA 1GRRA 1Z6AA 3B5JA 2Q9AA 2C98A 3BH6A 2BV3A 3K9GA 4UNQA 5AUNB 2YOHA 4NH0A 3NIBA 3QF4B 3K70B 3HYRA 4ESHA 2GTPA 5J4YA 3FKSA 5KNBA 1OW3B 4LJ6A 1OH7A 3BERA 1Z6XA 1E32A 5J47A 2JJ2D 1E94E 4TYPA 2Z4SA 4ZCLA 1M2OB 2XZLA 1C1YA 4YQFA 2QBYB 2XZOA 4ARZB 1GDDA 4BEBA 2A5DA 4BASA 2YWGA 1I4TD 4B43A 1W7AA 1YZNA 2FF7A 3PV0A 1E2KA 4Q7KA 1W49A 2OM2A 3AM1A 4GFDA 4GNKA 2ZQ5A 4JBXA 3GLIA 1NLFA 5IHPA 2KJQA 1OH5A 3AV0B 4JYBA 4M0LA 4P32A 1G4UR 3TVDA 4EPXA 1N25A 3MD0A 3I32A 1F2UA 1II8B 2GHIA 2H8KA 2W58A 3H4MA 3KDSE 2ZAOA 2ZRFA 5CJ2A 2RB4A 3NH6A 1FQJA 1Q21A 1XMJA 3KKQA 2C99A 1G3IA 3FWYA 2NTYC 2FWRA 2QGNA 121PA 2D06A 1QVRA 2R6GA 1Q22A 3KKNA 2C5LA 2CCKA 2BEKA 2RMKA 3KXIA 4LHWA 4DLSA 2AR7A 4Q9HA 1YQTA 4JLPA 1T6NA 2FZ4A 1F5NA 1X8JA 2BDTA 2YWFA 2CCGA 5EP2A 4D81A 3PUZA 1LB1B 3VR6A 1R2QA 5TB5A 2J7PA 4TQ9A 4ACAA 2WICA 2V6IA 3X1DA 4EPVA 2QTVB 2O8FA 1QHSA 2A5JA 5AJZA 1EFRA 1TEVA 4HLDA 5EUMA 3HU2A 4M2LA 1KI6A 4EKDA 4A2PA 1Q1ZA 1FOEB 3OESA 4W5JA 2PLRA 3IO3A 1KMHA 2ZI7A 2VHCA 5L3QB 3HR8A 5ELXA 2FSFA 3FFBA 4XH9B 4CF7A 4IW3B 1UJ2A 2GEUA 5GVRA 4H1VA 2XTNA 1KI8A 2OE2A 4PZZA 4DCSA 3ZVRA 2CK3A 3SS8A 3NHAA 1KY3A 1D5CA 4KU4A 3WHKA 1R8QA 4EJSA 3ZJYA 2P2LA 4DWJA 4ZDIA 2RKOA 4HB3A 1SULA 5FUVA 4PZYA 3BS4A 1XB2A 1Z0FA 1OFTA 1E2IA 4D6PA 4TT3A 1AGRA 3ASZA 3ZH9B 1KDTA 3MSXA 2PMDA 1SVLA 1R4AA 1P60A 4OI2A 1BMFA 4TYQA 4FMDF 4O3MA 2PX3A 4OQFA 1IONA 2XNSA 3X1YA 2PT7A 4IVPA 4G5RA 1TTTA 3GCGA 2ZJAA 4GL2A 2O5VA 4JT4A 3D31A 1VG1A 3IEUA 2KB0A 2RHDA 4C7OB 1DAIA 4J0QA 4H9GA 4OHVA 3GPLA 3AUYA 4AWXA 2H7VA 5TV2A 2V8OA 3VR5A 1F2UB 4D0NA 2GF9A 1M34E 2ZJYA 4B3FX 3AP2A 3T5GA 3ADBA 2WJIA 2C95A 1I4LD 3LW7A 2P6NA 4ZI2A 2XXAA 1HYQA 3W6OA 4EPYA 1YZKA 3TW4A 5C1BA 1HQCA 2IS1A 5H8WA 3QSYA 4UNNA 3KXLA 4AD8A 1OJLA 3F8TA 1IOZA 1ZM9A 1XCGB 3OAAA 4U02A 5DYGA 5GADl 1R8SA 2NQ2C 2OHFA 4TMWA 1P75A 1FX0B 1M7GA 1NLZA 3B7GA 1XFAA 5CITA 4NTZA 1FQKA 4US2R 1Q3HA 2ODEA 3VKGA 5L3RA 3L43A 5GJVC 4I1OA 1J8MF 1NI3A 1TQ6A 1G8YA 4QBHA 4JVSB 2H92A 3QE0A 4L4UA 4NDZA 3T15A 3KKOA 2PJZA 1Z0KA 3H1TA 1P2SA 3LD9A 3T1OA 1NKSA 4IOJA 5CLLA 2IYVA 2Z43A 3ASYA 4M53A 621PA 2FFAA 4PC3A 2WTUA 4UJ5A 3EZFA 1GWNA 5KSPA 2FE4A 1E1RA 4EUNA 1OHHA 4ON9A 2GF0A 3NG1A 1ESNA 3T1TA 3NHBA 4UNSA 4KFUA 1XZPA 2BEJA 2GKSA 4I81A 1DADA 1T3LA 2P5SA 1KI3A 3A8TA 5JEDA 4TL9A 2Y8EA 3UKDA 2IS6A 2IA5A 3QJYA 4RD6A 1UEIA 4AKGA 1SXJD 1VHTA 2FX3A 4MYHA 1XCMA 2ZE8A 2PEYA 2RAPA 4C0HA 1G3QA 3BIFA 4UQOA 2FPKA 3QG5A 2ZRHA 2OAQ1 2J0UB 4OJKA 1DO0A 1NJGA 4D25A 4V0MA 1R6BX 1WP9A 4KBFA 1JR6A 5FH9A 1Z0JA 2R6FA 4XD7D 4QGAA 4NYMR 4TLBA 1GNQA 3D8BA 3FB4A 4IVQA 4IOLA 1G16A 1Z8FA 2IYSA 2PL3A 1FFHA 3AGPA 4EIWA 4QXAA 1TX4B 4RFSB 4TYWA 4KFRA 3DDCA 1RFLA 2G9NA 4AKEA 5JCZA 2ZE7A 4YMVA 3B1ZA 4XSGA 2JLZA 4X8MA 2C04A 4CDGA 3KB2A 1GOTA 2OO7A 1GITA 4IDPA 5K8IA 3W5IA 1E99A 1N6IA 1YZGA 2YYZA 4UNRA 1KO7A 2WWFA 5J4LA 2FGKA 2IYQA 4MDFA 3MWJA 3M0EA 3CF0A 4Q5IA 2ONJA 1KY2A 4IEEA 4DDTA 4PFSA 1P2VA 4CGZA 2D4HA 1KAGA 3K0CA 2W00A 2BM0A 4XWKA 1E2JA 1OE0A 2ZJBA 3VNVA 2ERYA 4HAWA 2VL7A 4JKIA 4C4PA 4NCIA 1AQYA 2C77A 1CR2A 3K0CC 4JLVA 4Q01A 421PA 2JLYA 1RJ9A 3K70C 2CDNA 2ZRMA 3AF4A 2J59A 4NZYA 4B3XA 1GSIA 1YZTA 4R7ZA 2O8FB 3I5XA 3WXMA 2CXXA 3K8YA 4U00A 1VECA 2B92A 2IL1A 3THYB 1TMKA 4TMTA 1GKIA 4JLAA 1G4AE 4KO8A 4WAUA 3EW9A 4D26A 3GQBA 2ATVA 3QPUA 1W36B 3U3JA 3IILA 3MWKA 3QIAA 3B85A 5HE9A 1T5LA 1ZD8A 3EIQA 4DIEA 2OLJA 3QG1A 1W4AA 1TEXA 3FYHA 3TR5A 1XJ0A 2LWIA 3VAAA 4GDFA 4IDQA 5M04A 2FOLA 5LB2A 5L8VA 2Q9CA 4KLZA 1YVDA 2FEOA 3KZ1E 4HYYA 4KXFB 3R8CA 4MYUA 2BC9A 2XZPA 4G01B 5DH9A 3W8NA 2ZI4A 2J46A 4TTQA 4NMMA 1QG2A 2VHQA 1U8YA 2HLDA 1KJZA 1KNXA 3F5FA 2F3RA 1R7RA 3Q9LA 1KSGA 4CZ2A 1R5NA 4D80A 1Z0DA 4LBZA 5ANRB 1AZTA 3ICQB 2FPLA 2XSZA 3HPRA 4JLMA 3THWB 2GWHA 1W0JD 1NF3A 4R2HA 4PC1A 5J5CA 1JR3A 5JRZA 1VCOA 2JJ2A 3CX7A 3FDIA 3AEZA 3GJ7A 3RS4A 1GIAA 2XTZA 3U4QA 1HT1E 3Q3JB 3WRXC 2EFGA 1Q1BA 2WM9B 3BJIC 3WNCA 1DOAA 1V5WA 3X1WA 3IKJA 1Y63A 3TW8B 2I4IA 1GRQA 5EXXA 3R9IA 4MH0R 4YMWA 1VG8A 4JLBA 1Q1EA 2VEDA 2ZSEA 1OYWA 2G6BA 2OCBA 3CRVA 1PLKA 3FKSD 5AJWA 3GD7A 4PC6A 4LV5B 4WA7A 2G0NA 1GP2A 1UFQA 3EPKA 1S4QA 3BFVA 2MMGA 4Q1AA 1VPLA 1ZU5A 3LBHA 3VX3A 4C7OA 2QP3A 4HAZA 2J1LA 3I5YA 2D2FA 4GMDA 4FCVA 3UMFA 2NIPA 1KSHA 2GK6A 1XMVA 3QI2A 5E3HA 1OFIA 4OQNA 2VRWA 3PJRA 4LI0A 1AJEA 3SDZA 3CR7A 3IIKA 1GZSA 1TNDA 1VCIA 3R7WA 2OSBA 2JDIA 4P4UA 2XXAB 5BW8A 4FMBB 3KUCA 5JWOA 3QKRB 4C0LA 4B2LA 4FD2A 4RD2A 3A1TA 1NNEA 3FHCB 1ZINA 2JLWA 5DI3B 4IFEA 3IGFA 1EK0A 5HKKD 1DVRA 1COWD 5A4JA 3KJGA 2KBFA 4QBGB 2GA8A 4KSBA 5UKDA 5CB6A 1XXHE 1L2TA 3B82A 2AFIE 3BOSA 2ZI3A 4B3GA 3LV8A 4KVGA 5KUTA 1Z47A 3GJXC 3RNLA 5EP3A 1ZVQA 3CF2A 4Z54A 2QA5A 1MO4A 1FNNA 5AR1A 2CLCX 4DCUA 3PR1A 3X1ZA 4AYXA 4GOXA 4LSGA 1RRGA 1KK0A 4QC2A 3K0SA 4D4MA 2P5TB 5EZ6B 4ERNA 1X8LA 3S1AA 1E2HA 1JEDA 1KJYA 1ZM2A 3DPUA 1XD9A 2I3BA 2QE7D 4OK5A 2IUUA 1P9NA 4M1OA 1M7HA 3OZXA 3KL4A 3SQWA 4HB2A 3GFOA 2KSQA 2CLSA 4OHYA 3AVVA 2CHVA 3W34A 2WWGA 4IJMA 4YMTA 2JJ1D 2BJVA 1R0XA 4Q9LA 3QXXA 1JR3E 4RJLA 2IHBA 1GL7A 3ND9A 3L0SA 4PO1A 3LAWA 4D4KA 4GBMA 2HF9A 2PH1A 1KK3A 1CJVC 1X3SA 2VTKA 2FN4A 5HCIA 4CVNA 4DIDA 1MOZA 1N6LA 4L9WA 4EPWA 2GNOA 3OEHD 1KI7A 4BFSA 2WHXA 2NZJA 2QSYA 2XB2A 1CF4A 5JBQA 3C15C 3ZGXA 2ZSAA 3Q72A 5IT5A 2F3TA 5LB4A 3SBDA 3GLGB 1EWQA 2JATA 2XNDD 4BFXA 1W36D 4CIDA 2AK3A 1UADA 5BXQC 3ZDQA 1SKYB 4L15A 4R9UC 4TWZA 1HY3A 1R0ZA 2WWYA 1KMQA 3WNDA 4MKIA 3K09C 4HLCA 1HTWA 4OHZA 1TPZA 4D82A 4W9MC 3REFA 2PLFA 4G0NA 3GLHE 5LDDC 3QKSB 2A5FA 2EWWA 2ODNA 4RD4A 2XTMA 2IEZA 3TR0A 3WMFA 4ARZA 4C0BA 4DT1A 1KKLA 2REOA 2XSZD 4NE2A 1CR4A 1YZQA 4GI7A 4V0OA 3BFKA 1MR3F 1JR3D 2HEIA 4F4JA 5FPTA 2YNMA 2BM1A 1PLLA 2BWJA 5G40A 3U3RA 1GTVA 2HJGA 4E5UA 2CHGA 3ADCA 4F7WA 3OAAD 3HU1A 1P6XA 3EWAA 3KUDA 2ZS7A 2WIAA 4KODA 3IIMA 4OQLA 2G3YA 1N6RA 3I72A 4A82A 4PPNA 1E1RD 4M1YA 2WSMA 3W8RA 1WB9A 2GJKA 1E9FA 1UBCA 3CNNA 5KTYA 1KNQA 4HUQB 2WOOA 2HT1A 4Q1DA 3PG5A 2QMOA 4QNRA 3MWYW 2RGCA 4LUCA 2DFKB 1ZD9A 1DEKA 3RS5A 1OXUA 3U5ZB 4QGFA 5JS8A 1BO6A 1DAEA 2CNWD 4I4LA 4YMUA 1G8FA 1VIAA 2BHRA 4RZUA 5TVKA 4TSFA 5BN5A 4RSGA 1MO3A 1EWRA 1COWA 1N6PA 1N6KA 4HAUA 1CEEA 3W6NA 2BMFA 2V6JA 1SXJC 3DMNA 3T1QA 2JLXA 1YRAA 2HT6A 5B58C 3TUZC 1XRJA 2DFLA 2FGJA 4KI0A 1HH4A 2AK2A 3KQLA 1MRSA 5H68A 2V7QA 3IBYA 3VR2A 2WSSA 5KNDA 3BRWD 1U94A 3U4QB 1II9A 4DUGA 4X8HA 1RZ3A 2H57A 4LCBA 4A2WA 4Z1MD 1LF5A 4NKRA 3UXMA 5E4FA 2C9CA 4MGYR 1CR0A 2X8AA 4UJ3A 2ANCA 3LNCA 1Q12A 3PEWA 5AWFC 4BPBA 1E2EA 4MKGA 4LC1A 4F4CA 4DLRA 2F1JA 1L7VC 3RWOA 2W6ID 3C41J 2JLVA 3CX6A 2QN6A 1NVVR 2ECKA 2JJ1A 4YC7A 3VR3A 1WA5A 1G3MA 4LHXA 1BOFA 4HZUB 1OIXA 2WMOB 3LQQA 2IF0A 3A4NA 2W2TA 1AS0A 5H1YA 4G5QA 5JRJA 1W46A 1G7TA 2WJGA 1CP2A 1RRFA 1RYHA 3OF5A 1FMJA 1Z07A 5JECA 3BORA 5LBIA 1U8AA 4A0RA 1J7KA 2OV2A 5KSYA 3TVTA 3IBGA 4HAYA 2ZITA 3KFVA 3OIUA 3EPJA 5EXTA 3IPYA 1XPOA 2HF8A 2Q0HA 5G3ZA 2QPOA 2GAOA 1IY1A 3ADKA 4Y0AA 1Z2AA 1Z83A 2DR3A 3BK7A 4X8OA 5DI3A 4KSCA 4DXAA 4F93B 1LFDB 1QHIA 4AI6A 5KDLA 4TMXA 2ZSDA 1D9ZA 4CEHB 3SJAA 4QBFA 3CM0A 3G5UA 4L5BA 5JWHA 3I73A 2A78A 1ZC3A 2N42A 2OFWA 4MYCA 4EFNA 1EFTA 5EE3A 1MO6A 2AD1A 4EPRA 2WMNB 3M4YA 1DBSA 4GP6A 3NBXX 3A4LA 1SHZA 1MV5A 1KGDA 2ZUCA 1DAMA 4W5WA 1JBKA 5TMPA 2NO1A 3QUSA 5FBRB 1QHNA 1D9XA 4AC9A 4D0GA 5J4HA 3NWJA 3I62A 2MSDB 3PUXA 1XTQA 4A8JC 1ZIOA 3VTKA 2H16A 2QAGB 2ZRNA 3CONA 1E9RA 5CIQA 1W5TA 2IEYA 2WJJA 3CH5A 3EXAA 4LV6A 3SU8A 2ZXUA 1JQJC 2YOGA 4F38A 4ZIRB 3CIOA 3AF2A 3OFNA 1YRBA 4MITA 3OEED 2CJWB 3VQTA 1KZGB 4M1SA 1XXHA 3FVQA 4DSUA 4TSFD 4TMVA 3WNBA 3J81k 3EPLA 1Z6GA 1IXZA 4A4DA 3UMSA 5HZHA 3FFAA 1ETUA 5BQ5A 3SHWA 4JMPA 4OJQA 2ANBA 2EFEB 3RVBA 2GZHA 1UDXA 1E2DA 1YU9A 2ZRIA 4LPSA 3OIVA 3QKSA 4RZ2A 4TT3D 1LS1A 4JLJA 1WQ1R 2QMEA 3QY0A 4KV9A 5KO2A 2WKPA 1MABB 4JL5A 4ZIRA 4A1FA 4LJ8A 1KI9A 1BYUA 3BB1A 2ORWA 1RC8A 3TGPA 3B1XA 4NYIQ 3SHFA 2ZETA 2O0JA 1XD2B 3LDAA 1T5IA 1UM8A 1XMSA 4M21A 3R7WB 4UNPA 1CLUA 4ESVA 1CTQA 2WIBA 3VMFA 2ZAMA 1P2UA 3MJHA 4BZQA 1MKYA 1NN0A 5FUYA 1KO8A 2ZRPA 1E1QA 3A1UA 2F1RA 4CW7A 1G8GA 1YZLA 3AVYA 1U9IC 4URUR 4DHEA 3BB4A 2RGXA 4ACBA 4YDSA 3R9XA 4DLZA 2W6JA 4Q4JB 3LVRE 1NLYA 4TN1A 1HUQA 2Z5FA 2C78A 1E9AA 1NSFA 2ZJOA 2F43B 3P27A 3SZRA 3U6KA 4NYJQ 1CULC 2ZU0C 2Z4RA 1ZIPA 5JFGA 1AA9A 1OKKD 4L16A 3RWMB 2ZE6A 5CYPA 3RAPR 3VKHA 2ZJ2A 3P32A 5FOUA 3DM9B 3K0EA 4OKSA 3KB1A 3LLUA 2W6IA 2V3CC 2ZSBA 1XU4A 1U8ZA 2B7BA 4M9SA 4EJSB 2CMKA 2ZTSA 3E1SA 1QDEA 4G5OA 4NU0A 4A8JB 3OE7D 3F3YA 2PCJA 2IT1A 3H2YA 1VYTA 4RY2A 3WBJA 3B78A 1AZSC 3K9NA 1T3SA 3DKVA 2WWXA 1G18A 3SI7A 4AG5A 5FUWA 5JWRA 1O3YA 4OQXA 2CE2X 2ZE5A 5CM9C 2QORA 4TQAA 2CHQA 2NGRA 3QBVA 1US8A 4AKHA 5FTJA 1NG1A 2AWOA 3NTUA 5DHFA 3AF0A 2Q6TA 1XTRA 2XJ9A 4V02A 1GL9B 1T0JB 2ZSFA 4XVQA 1K8RA 3GJ8A 2IBMA 1G20E 1PUIA 4AURA 4DLTA 1OHHD 4E07A 3VNUA 2ZU6A 1GL6A 2LKCA 1XEWY 2A30A 4MGKR 2XGJA 3UMRA 2VIIA 2H17A 4PAMA 1OFHA 2AXNA 4P33A 2IYLD 3F0TA 1Q3TA 2XNDA 4GT1A 3QXCA 4E09A 4Y0VA 4B35A 3BE4A 5EZ5A 3TE6A 2A7QA 4RKFA 4Q9JA 2HCJB 4Z8XA 5BYKA 3HJNA 3GEIA 1E3MA 1XEWX 1SKYE 4AK9A 1W36C 4R98A 1KMHB 221PA 3AF3A 5C4MA 3AVPA 5IF9A 1II8A 5FTMA 4YXWD 3OFND 2EFHB 1P61B 2J0UA 4B47A 3UG7A 2ZI9A 2FZLA 3TQFA 2FSGA 1CXZA 1XEFA 5HZKA 3TUJC 3K0AB 2GCNA 2OEPA 3EG5A 1Q44A 1ZM4A 1N2CE 4HATA 4RFVA 3RRMA 2ZR9A 1G19A 1SHKA 2AKYA 4IXNA 1H8EA 4LBYA 1XXHB 1JEEA 3N5CA 2VP2A 2G77B 4B44A 1E9BA 4BLRA 5AJYA 3ZIAD 3CH4B 3EAQA 4M1TA 4C3ZA 3EIHA 4XIGS 1N3BA 1E2MA 3N2EA 4HLQB 3CLVA 4EJSC 2D3WA 3U60B 4TYYA 3AP1A 4MRNA 3K9LA 4DEXA 5DYIA 2HDNB 4BLQA 1Q0UA 1M74A 2ODBA 4FN5A 4DSTA 1NVVQ 3IQWA 4OI0A 3FMIA 1BKDR 1F6BA 1HA3A 5FPKA 3GLFB 5KPDA 3D7MA 3CWZA 4DLVA 2BOVA 2OFOA 5KSOA 4R2IA 2ZUDA 1QVAA 1T8UA 2BJWA 1DE0A 1RIFA 4X8LA 1A2KC 2TMKA 4QBIA 1OXXK 3I8SA 5TY0A 2NO9A 2XOKD 1N5JA 2P67A 5AJVB 5FR1A 4A6PA 5HPYB 4K8OA 1YR9A 3IIJA 4HAVA 1OH6A 4C0KA 2G0TA 3CNOA 2CLDX 1J8YF 4PAQA 5LD2C 1VG9B 2RGAA 4PSKA 1U90A 2VLIA 3GLIB 2PT5A 3U7GA 2VP9A 1XJCA 5CB8A 2EW1A 4QL3A 4Q4JA 2NG1A 2PZEA 3DEFA 2VF7A 4DLXA 2CJWA 1FTNA 1NG9A 5EE5B 2W0MA 2R6CA 2WWWA 1XTJA 1XD8A 3FKQA 3IPXA 4D4LA 1U0JA 3PVSA 5E7IA 5B30A 3PUWA 5FTNA 2WKRA 3T5DA 3WP1B 4MKFA 3T35A 3U3OA 4PO8A 3L8YA 3SEAA 3M6AA 2R2AA 1VDZA 4FWIB 1R5OA 4JLOA 3SFVA 4M9XA 1XDBA 2ZM5A 1E4VA 1CRPA 4V03A 2R6DA 1A7JA 4MRRA 4TL7A 5FPHA 2HLDD 4JBWA 1WMSA 1U0HC 1U81A 2Q9BA 3EASA 4QHTA 1PLJA 2F7SA 2YVUA 4KCGA 4C0JA 4QM7A 1C9KA 2ZANA 3CRQA 4WXPA 3OE7A 1BS1A 4XSHA 1KO1A 1B0UA 3THOA 2ZI5A 4I1VA 4Q1CA 3W6PA 1E2QA 1S9DA 1HQYE 5TARA 2CL7X 1RRPA 3LVQE 3THXB 4TL6A 4Q47A 4II7A 3V00A 3KX2A 5EQTA 4LDJA 1DG1G 1MO5A 4B2PA 5JS7A 4Q9KA 2ZJZA 3KFXA 1LV7A 4M1WA 1DTSA 1EFCA 3B1WA 2VH5R 3AKCA 1CBUA 1J90A 3MCAA 3TLXA 1W47A 1LY1A 2HYIC 1MRNA 3SBEA 1OPXA 1P7CA 3RS0A 1UBFA 5C46F 3U7FB 5H70A 3N2IA 2NPFA 3QF7A 3ZD7A 4B3BA 2GJSA 3B9PA 1OLOA 2PZGA 3A4MA 1R5BA 1YZUA 3RRNA 1X8KA 5KNCA 3KKPA 3NDPA 4D2IA 1ZCAA 4LHZA 5GJWC 1HT2E 4FMCB 1E79A 1WBDA 5KOYA 2EFCB 4IDNA 2P0EA 4PQRA 2BBTA 3V4RA 1E9CA 5L3SB 1E0SA 1R10A 2ZEJA 1F2TA 4NP6A 1DPFA 4HSEA 3WHLA 2MMCA 1ZNXA 1YHNA 2D2EA 3PENA 1WCV1 1E4YA 4LGMA 4YLGA 1NBMA 3DKPA 4MRVA 4OI4A 4LZZA 3TSWA 4GMXA 4KYUA 2FFHA 3SC3A 3EX7C 3G82C 3PXGA 4Q66C 1AN0A 1JAHA 1E0KA 1MABA 1KIMA 1ZUHA 3MUFA 4JL6A 3RABA 2B21A 4XWOA 4JVLA 4PHTA 3R8FA 1SVKA 1EFHA 4ILEA 3L0OA 2C96A 4B73A 3DVLA 3VR4A 4MQBA 4O2LA 1EGAA 1VHLA 4XOIA 1UKEA 2ZRDA 4R71A 1ZJ6A 3BFXA 4G1UC 4F91B 5F98A 1IXRC 2BCGY 3U7EB 3WYFA 1RKBA 3DOEA 2ASEA 4GOKA 5FPSA 2QQ0A 1E98A 2IX3A 3CB4A 2HUPA 3AGQA 4Q19A 3GLGE 4Q18A 1BIFA 3MMPA 3AVWA 1BH2A 2G88A 1PZNA 5SZIA 1G6HA 4POAA 3RSLA 4A15A 3CZPA 2O8CA 2KBEA 2ZS9A 3AVQA 3CKLA 3W5JA 3VHXA 1NVXQ 1TU4A 2OILA 1W4BA 2I1QA 1AIPA 2IYZA 4LYHA 4OHXA 4ZO4A 2X77A 5E95A 3X2SA 4IVRA 2JLSA 2OBNA 2IXEA 5CJPA 4L8GA 2W83A 1ZU4A 2RGNA 1KSJA 3I92A 4KHZA 3QOFA 1DAKA 1YR7A 2QAJA 5P21A 3PIRA 1CJUC 4B6FA 1XX6A 3EA0A 4QJ4A 2Q3HA 4BECA 3RC3A 5HE8A 1NY5A 1IBRA 3U44A 4IDHA 2JIZD 1T4GA 1IN8A 4N1AA 3SE0A 3VFDA 3C5HA 1V43A 2LCFA 1DAHA 4EFLA 3T1VA 4DSOA 1XWIA 2O8CB 1P3JA 1ZM3A 2I1VB 1A82A 3PUVA 1CR1A 4RKEA 1ZP6A 4TTPA 4QHYA 4S2EA 4RCZA 1Z06A 1VYVA 1FP6A 1FUKA 2YINC 1UBEA 3QEJA 2JA1A 4LJYA 4JZKA 1X1RA 5JMTA 2X19A 3QBTA 2JCSA 1CS4C 3NEYA 1XPRA 3NKVA 4CEJB 5G3YA 3ZZUA 4JL8A 2G1JA 2EQBA 1OXSC 2GVZC 2FU5C 5EXPA 3K1JA 4Q4HA 2CL6X 2GJ8A 4RD1A 4DBLC 2QPTA 3ONWA 2B6HA 3EZ6A 2UZ3A 5D3MB 4DC9A 1JECA 4NYMQ 1EX6A 3TSZA 2VSFA 3C8UA 4IRUB 3KTAB 2O8EB 4XD7A 1JJ7A 2CEAA 2Z0MA 4OQMA 1E6CA 5LPNA 3DOFA 4BFYA 5KYKA 3HYTA 2LKDA 3QEOA 3BB3A 3U7HB 1XTSA 4A0HA 2OUKA 5G41A 1JAIA 4I1UA 5FI1B 1NIPA 2QPAA 3FGNA 4NL4H 1IM2A 3VHLB 3CUEF 1NY6A 4JIMA 1KDPA 1XTIA 2J7PD 3NEJA 4PC2A 3REGA 1RE0A 2CL0X 3GFPA 2WJYA 3I4LA 3KKMA 3TRFA 2J87A 2FFQA 2J0QA 1NBME 3GJ3A 4QJ5A 3NBFA 2OG2A 3OIWA 4WVFA 1NN3A 1WRBA 5K8UA 3A1VA 3MLEA 4B2IA 4PTLA 4KVAA 1G7SA 2GZDA 2HXYA 1BYIA 3QQ5A 4OI1A 1IJEA 3HDTA
chains in the Genus database with same CATH superfamily
1OV6A 3U4GA 4TXNA 4JXZA 2QRJA 4YYZA 2DOKA 2GJAA 2J5XA 3BGIA 4MKXA 2GERA 3WDSA 4E03A 1DQYA 2X0EA 1HFKA 1R0BA 1VB5A 2VAVA 3P1JA 1I2CA 2Y77A 1L5SA 5EN4A 3X2EA 5FHQA 4D4JA 5DM0A 3O03A 3HY4A 3C3MA 2G9ZA 3S2GA 4UEWA 3D0QA 3H2BA 4QTTB 3T8YA 4KWEA 3WMGA 4C2TA 2P5UA 3L1IA 3DMFA 5KC9A 3AFNA 3NT4A 4K5QA 1X38A 5B2ZA 3D2CA 1R9JA 3GJ4A 3VA7A 5KNCH 3QEAZ 2HCRA 2G63A 1T36B 2G06A 2WPDA 5D51S 1VPDA 2HSZA 3O4GA 3DONA 5DRYA 5FFMA 5HTKA 2ZBDA 4B82A 4HNUA 1DKQA 1E5TA 4QYSA 2BBWA 4BJ6A 4YJ3B 2CHUA 3QLJA 2HCBA 2DHRA 3KTFA 4J0DA 1ODSA 5AJXA 2FWBA 5J63A 2C3MA 4QFCA 5JY1A 5C1IA 1X9HA 1R4MA 1EUCA 4I19A 4QPDA 1Z45A 4TKUB 2ERXA 2QWXA 1DAFA 3KOOA 4MA4A 3FOZA 1E5QA 5AUPB 2WF7A 3SXUA 3QTTA 3C5CA 2HHLA 4IQGA 4P08A 3F90A 5TX7A 1NP6A 4PLCA 1SB8A 1P80A 4KNVA 3ZWAA 2PE5A 4R2XA 1L8OA 4KN5A 5TVGA 4C4SA 1B0ZA 1QP8A 2W6QA 5IVKA 1HK7A 4EJ6A 4DJTA 4HO1X 2FPGB 5C7YA 1M72A 2I4NA 3ZDDA 4P7GA 4MDEA 3RVSA 3LKBA 2JHGA 1JG1A 2O0MA 3MEQA 1Z5NA 2RONA 4MWBA 1RC0A 2Q1YA 1UWCA 4WESB 1WXWA 2ZRJA 5ALOA 1JHXA 3W9UA 1KEWA 2CMHA 2XOKA 1V9LA 3CT4A 1A3CA 2V6FA 4YMHA 3ENVA 4D99A 3KVRA 8LDHA 2X2FA 4CTKA 1U7UA 4F6LA 1U4SA 3P2IA 3GUZA 4NBNA 5DULA 1M1YE 3QENA 4WZAE 2WVHA 1ZNWA 3MJRA 4OQQA 5DN6A 1U3GA 3D2LA 3GK3A 2IGBA 3CBQA 1R16A 4INAA 5D3MA 3UGKA 2YXBA 2BVNA 2W48A 4P0TA 3Q7IA 5FFFA 1VCMA 1TUEA 1X9IA 1Z6YA 2REBA 3GMSA 5EE9A 2VDJA 4HGZA 1IZ8A 2PUJA 3DE4X 1EFDN 2DLNA 3TH5A 3ZGZA 4LHSA 4OGGA 4OGFA 5HQ3A 4ISCA 4WLUA 2D2VA 4XEUA 5DISB 4NULA 3WV4A 1NBIA 4CETA 1I3KA 5JYEA 5JJCA 1Z13A 5F5LA 2I6FA 3LRXA 3OCYA 1PTJC 5JHHB 2R1ZA 3PS9A 4CM4A 1Z4KA 3QF4A 3PIIA 2IOYA 3T0FA 1KP9A 5EMKA 1WO8A 4P81A 4G81A 3QPVA 3WLHA 3H86A 5DSZA 3K09A 4AF6A 4IIXA 3RIXA 3ZDEA 1LFAA 1EIWA 4YXFA 3I01A 4ER0A 4XTCS 2H51A 3K94A 3KYBA 3PDIB 2JG3A 3WQBA 5AJHA 2Y0PA 3RJ5A 3ENWA 2PX6A 1QFSA 1PZEA 2WJ3A 3ANYB 2DWPA 2Y1CA 3U31A 5KREA 3KQKA 2EKBA 1J70A 1ZAKA 2GVDC 4IXWA 4X90A 2EXXA 1UINA 1PEKE 3DA8A 2VXCA 1PJSA 4O3FA 4WHMA 4ZICA 1Q57A 3A27A 3MPOA 1K2WA 5ALMA 2IHYA 2H1CA 4Z8YA 5BNTA 3D5QA 5KVSA 2GZAA 2YJNA 3TTVA 2DSNA 4O6VA 5IT9A 4WN9A 2IHTA 1PR3A 1YKSA 2CVPA 1PR0A 3PUKA 3P2JA 2J31A 1XA4A 5I4BA 1YQXA 4NH4A 4WZBB 1SIBE 3O8OA 2CDAA 4UREA 2L18A 2Q27A 3I6ZA 3V9PA 4DAOA 1U98A 2NNLD 4UHCA 1I4DD 3QQPA 3EGEA 1WSWA 3I05A 2GBFA 3W6UA 1RI1A 3GZNB 3R4VA 1ZM7A 2Q8NA 3HB5X 2OXIA 1OGIA 1N4DA 2WF9A 1H9AA 3TQTA 2GHQA 2C3PA 2XWBF 3PPIA 3WK6A 4B80A 4PQFA 1S8OA 2H2GA 4BQQA 3EPHA 2L0XA 5BSRA 5D01A 1B8VA 3QLTA 3BGVA 3F98A 4FZRA 1KFEB 3ZY6A 1K86A 4CIVA 1QCZA 5LKRA 4G0WA 3BJEA 1OR8A 2IYAA 4IX9A 5NULA 2ZI6A 1F48A 3A0RB 5HW0A 4PZLA 1H2HA 3OIYA 2FEKA 2ZZNA 2WFMA 2BF4A 1DG3A 2PY6A 1H8HD 1M2NA 1MH1A 2BFFB 2P6UA 2X3YA 3H9QA 3HSKA 3LCVB 4B76A 5JJLA 2P2DA 4XDYA 1EK2A 4Y1RA 1J1IA 3ZCQA 4IKEA 1LF0A 3PXXA 2H11A 4J91A 3EZNA 4NABA 3FMPB 3H65A 3AVTA 3PPXA 2YWHA 2RGGA 3N0VA 5K3BA 5JQGA 4A0GA 5L3QA 3AP3A 1NONA 3L8DA 3R3ZA 3R44A 2O0KA 5FEUA 3KQOA 4TVSA 1ZMBA 2RH5A 2XKJE 3DNPA 3SYLA 3WGZA 4BFUA 1VTKA 3GLTA 1ULHA 1NQWA 5C7LO 4QKQA 3ESRA 2A5YB 1NFQA 1ZYUA 4JITA 2GX6A 3W05A 4QARA 1TA9A 5JSUA 4J07A 1E6LA 1MXHA 1ZN9A 2CDRA 4J0IA 4LE2A 3ETEA 3GA5A 5AHRA 4W5HA 2G8LA 4Q6BA 2P68A 1OFUA 5ALPA 3RSSA 5IJ9A 3PGKA 4CKXA 2WJVA 3ROKA 1MX3A 1PJ8A 3EH2A 1JALA 5CDUA 1QHHA 4HZIA 2VRBA 3P19A 1WVMA 3JRNA 3P0HA 3Q7PA 1NC3A 4QODA 4WW0A 2VA8A 2VP4A 3U19A 1OI3A 2YC4C 2DC1A 2JFPA 3QPBA 4YROA 1M2EA 3LKDA 1KPIA 2R4TA 1P31A 3KEQA 4LS3A 3UGQA 1JVSA 4RVOA 2FW7A 2KPOA 2LV8A 3LOPA 2MINA 5DK6A 1N5KA 3G0BA 4FE3A 4GUDA 4TKMA 1XPUA 2J9FA 2DUMA 3GAMA 5I9LA 4D3FA 3PHGA 5JI2E 5I7OA 2RCYA 1SBNE 4M83A 5CA1B 4Q37A 4MRPA 1H2ZA 1RLTA 3BZUA 3UUWA 3UA3A 2GUWA 1QH1A 1I7LA 5E7JA 1J2UA 2YMQA 4JAVC 4NCAA 2B4RO 3MINA 5I9BA 3UB3A 5BVGA 3AZQA 2QL9A 4OB6A 1TU3A 3CVVA 3ZU2A 1DC5A 3ZZNA 2AJCA 2BGLA 2YHBA 1AM4D 1VRVA 3TECE 4EGAA 2YN4A 1VMDA 5AKGA 5AVSA 1E63A 3N2LA 4FB4A 1E79D 1YNOA 2VDKB 2X1HA 2OYCA 1MPTA 2IHVA 5DM4A 2QBYA 5H4GA 2BFBB 1RRKA 3I2YX 4HZGA 4MQMA 5DHAA 5CFZA 3FPGA 5TQ2A 2FP4B 2PUBA 4BAGA 3SQLA 1JQAA 2Q5HA 3A6EA 4FHGA 4B3RB 3M1AA 2Y67A 4LKOA 4JP1A 3BAFA 5CPFA 2OO5C 3NW9A 1GNRA 2HV8A 3UB4A 4YBZA 2FSSA 3ZQJA 3AEKA 2OV4A 3CZRA 3RIYA 4ROTA 2FR8A 2Z1DA 3W4IA 1N1DA 3LZDA 2ZRAA 4DM4A 1K6MA 4RZ3A 1W29A 1Z9BA 4OG2A 1W44A 2V7PA 1FXWA 4MPDA 1K88A 4ZT4A 3DXZA 4YS6A 4QOSA 1NU8A 2K2WA 1R0YA 3UK1A 2QTFA 2IKSA 4DXHA 2PUGA 3N8IA 4DCNA 3BA1A 2IZ0A 4C08A 4X1OA 1U0EA 1WMDA 2WJWA 4NQRA 4XX0B 4FJ1A 1B7GO 3FRHA 2FEWB 2C4MA 1N2HA 3PKJA 2XT6A 4JOCA 4MS3A 3LUBA 4RGQA 1UKZA 1A69A 1KEUA 3Q8XB 1L4UA 3R6DA 4Z0NA 3UT0A 3OQ6A 3G59A 3LPLA 1I30A 5CNKA 2VJQA 1L7XA 1PGNA 3P9XA 4PRZA 1IMJA 5CBKA 1W88A 5DYTA 3VR6D 3ZLJA 3B3QA 2ZW9A 1G6KA 1SC1A 2YS7A 3OA0A 4FOLA 2XTAA 3T4UA 3V80A 4EO9A 5ESWA 4PU0A 2H3EA 4GQBA 3TLJA 4BVEA 1GXSA 5EYPB 4CN9A 3GHYA 5CD1A 1SPBS 3MIZA 4WVLA 1NHWA 1U2QA 2FW1A 3W0LB 3RUPA 3DHEA 4F4HA 1QE3A 5H59A 2IHZA 3ZCRA 1BS9A 2V55B 3EXFA 5D1HA 1LPNA 2PGXA 4NPAA 2GBLA 2H1LA 5KDOA 2BKXA 4P0QB 1G7CA 4Z1MA 3TNLA 5JTTA 3DAYA 1P8JA 4I99A 3GD5A 7AT1A 1NNEA 5A5FA 2CUZA 4BFZA 1GVNB 4JELA 2VQSA 5CX4A 1GCAA 1H5NA 4OP1A 4F2PA 4KMMA 4NY1A 3H0EA 2C57A 2WFZA 1X77A 3PUYA 2PGNA 4UQPA 4DB2A 3MYRA 3PVCA 5FUXA 3TRJA 3HC7A 1KZYC 1EDZA 3DHYA 4RHUA 3UTDA 2HU2A 3VZDA 4C89A 2IH4A 4GZLA 4DLYA 5REQA 1GG2A 4A10A 3T61A 4AU1A 2Q0XA 4MKHA 1BROA 5JZ9A 1UXOA 3P9KA 3W8DA 3THYA 4A9AA 3ZHXA 4XUEA 5DYWA 3SMVA 1NQUA 1G2OA 3K9HA 4PBTA 4QXMA 4D46A 3FZNA 1T9CA 2QNIA 3DMHA 2WIJA 2ZOSA 1YB1A 4BOYA 4EI7A 4LDAA 1W7AA 2WJZB 4YCDA 1ECPA 3D3KA 2AOUB 2YH2A 3A10A 2CNOA 3WYAA 1LZLA 2E6KA 2R4QA 4II2A 4NG5A 3RREA 5AVOA 4WN9B 5EJ9A 2MYPA 3RHSA 2JH3A 2HV9A 3DTTA 3FTFA 3NJRA 3O6VA 3EA5A 1C41A 2GEVA 2XW6A 4ZOLF 4ZO8A 4XJVA 3OZCA 4GWGA 1Q17A 5F5NA 3A9RA 4UHEA 2VBGA 4ETNA 4PCAA 3WWCA 3WE7A 2AN4A 5C32A 4DR5B 2JIQA 2Q2OA 5LMUB 4AJOA 3WXBA 2FZVA 4M4SA 4I1SA 3NI2A 5F3WB 2NU7A 4F6CA 4F8JA 3VX4A 3ZHCA 3L6OO 1SQ5A 2JJ8A 4H3HB 2PN1A 3LX5A 2IYYA 1KZ1A 1DKUA 3LYHA 3THRA 4GE0A 4TYNA 1NJ1A 4J0HA 1CYDA 2O8DB 4JU8A 4KX5A 1ESMA 1Z0IA 1TF5A 4JLUA 4RACA 3RIEA 1FTSA 1A95A 2VP5A 5D1NA 1R1DA 3WHIA 4MX8A 2XD9A 3ODGA 3NANA 2AD5A 3ITEA 3UZUA 1UBRS 1X7ZA 3Q9SA 1M1UA 1P4HA 2GBCA 4ABTA 3T52A 1Y7HA 1IWBB 2R66A 4IHJB 5BWMA 2JBAA 3JWEA 2HK7A 2NO0A 3GLIE 1Y9EA 4R81A 1ZC4A 3ETDA 3T4PA 3VR5H 3PEVA 4TMFA 1NOJA 4JQSA 4QREA 1D6NA 4N3NA 4X7PA 4AQ7A 2PJRA 5B1IA 4G5HA 4JC0A 4RFSA 1DJQA 1KYXA 2NXEA 4ZI3A 1JJAA 8OHMA 1G9TA 4HGQA 4MVJM 4J9UE 4OHWA 3NHYA 3TD2A 1L3IA 3IV7A 4RQAA 3P0FA 4TXMA 3U9LA 3MTDA 3RSGA 3UC5A 3QELB 1KKUA 3UHPA 4AS3A 1RS0A 3F6BX 3HXMA 1F8XA 1RXEA 4HDKB 1AQIA 4H7HA 1QO9A 2BEVB 3AY7A 1DIAA 2X76A 3SHTA 3JYOA 4KL8S 1GQSA 1D6MA 1I6KA 4M1ZA 3VDMA 4YK7A 2ETVA 5IDVA 4DLUA 1YIOA 2XYPA 2WAYA 1D7OA 1W5AA 2W0SA 1KQOA 2GXSA 3IKTA 4PZ0A 1Z5OA 3FE2A 2I3DA 4I4TA 3BVPA 4AFNA 1O0SA 2FV8A 1XD2A 1XL1A 4Z0PA 1L4EA 2EZ8A 3A4YA 3NVAA 4PLWA 1YTLA 2AG1A 5IK2A 4AJPA 1HT0A 3E3LA 3G8DA 4EB6B 1O6CA 4Q4AA 4BX9A 1Z5UA 3RIGA 4Y7CA 5C80A 3BICA 3DL4A 3EQ6A 4KPUA 1E3DA 5E38A 1ZD3A 3DOHA 3WB9A 3VC2A 4ARUA 3TRKA 2P9CA 3BD7A 3IA2A 4D9EA 1K5GA 4IJQA 3K3PA 4LW8A 2BT4A 2G9VA 3JRWA 4HWSA 4TLDA 1B2RA 4X6YA 4DPKA 2CY0A 3WLIA 2I6QA 1H2WA 2P9YA 1ZHOA 4P4TA 1ZJ4A 4KR0A 1UL1X 3FJYA 2HA4A 2FRDA 2WV7A 4IV5A 5TS2A 5HX7A 3RLFA 3ZV6A 1JDNA 3PCXA 2I2CA 3PC3A 4HCJA 4LYJA 5HJ7A 1XHFA 2VDLB 2WYHA 1EG7A 4OHUA 1UKBA 4BN5A 4FC6A 4OHCA 1YB7A 5CG2A 2OHGA 2O8BA 2PSDA 4C7XA 3MAJA 4KDRA 4DMKA 3RUEA 1A1VA 3JQGA 5A2GA 5A0TA 3L0IB 3P2MA 1HE1C 1C7QA 3KLNA 4B4DA 1PL6A 3K5HA 1HE3A 2QUJA 4GWKA 1HI9A 2YJGA 4WBSA 1WZ2A 4R1OA 4EO4A 4EHIA 4KR2A 1YJBA 2DQSA 4CRWB 1I36A 2H2HA 3THWA 3FHTA 2XE6A 2UZ0A 3AFIA 4MWEA 1JRLA 4TZ6A 5JJIA 4K2HA 3JATA 3I01M 4JT2A 5JV5A 1ADYA 3X43A 1LBTA 1XZBA 2C94A 2CNLA 3RFTA 4MIEA 2V7WA 4R7GA 1SZPA 2IUSA 5CK4A 2BKAA 2DKOA 3HJCA 3N6VA 4FPXA 4WBXC 3A2LA 2F3QA 4Q02A 2I7DA 2O2GA 4S35A 1V8BA 2QRKA 3OZUA 4LVCA 1NM5C 1XEAA 3GRYA 3L4SO 4ZVTA 3BGDA 1WPXA 5EINA 2GCEA 4DIOA 2QI9C 2LDBA 3ILVA 2VUSA 5K3SA 3S55A 5J2UA 1A2BA 4LY0A 2AW5A 2QL5A 4I50A 1F4LA 2HIMA 2AGVA 3DWFA 4MV7A 4D9IA 3S2SA 4Z53A 4DUGD 2K7FA 1ADBA 3WK5A 2BZGA 3LXMA 4GYKA 1ZCFA 4LQLA 1K6XA 4RVSA 2FFBA 3D8HA 2FR1A 3COZA 2PGLA 4B4KA 5K4GA 2HRRA 4RE6A 4B48A 4LC0A 3F9IA 3GGDA 4UC0A 4QFMA 3E9ZA 2HQ1A 4EA8A 5IJ9B 4N6OA 1EZ1A 1E0AA 2A9OA 5E1OA 1C8VB 4X5OA 3MGCA 3C43A 4XFJA 2CZCA 3K71B 3SYNA 3ZUGA 3AERB 3OO1A 4KXLA 3FOFC 1SCQA 4YB8A 5F52A 1JQBA 2FP4A 3H5LA 4C3OB 3PCTA 3HVUA 2AFHB 2OFXA 3I37X 3GB9A 4RK4A 2AN5A 3R9WA 3CVOA 2DBYA 3AILA 3ZZTA 4BKQA 1IOWA 5CXSA 4KPEC 2CVFA 4JLDA 1G7RA 5H02A 3BXOA 2C8LA 2H1HA 1IWOA 2HWUA 3BDAA 3HCFA 4TV8A 3V8RA 3RHFA 3WS7A 7ADHA 2E18A 5EZQA 1U7PA 3FGOA 2PMKA 4UM7A 1ZONA 1FUUA 1L8LA 4ZEOA 4REOA 1E9SA 1QYCA 1GZDA 3BCHA 4MVJE 3QE9Y 1PVOA 1T10A 2HJRA 3BQMB 4ZAZA 2HU8A 3RAGA 5HOQA 1OILA 4G1FA 3TCXB 3UH0A 1YJAA 4BEVA 2YIVX 4DB4A 4CM8B 2QQEA 3KOYA 1VBKA 4PG5A 4J2OA 1VI5A 1CNFA 2O1WA 4CMJA 3DQQA 3PGLA 4HAOA 2ZJ4A 4K9KA 5A5DA 2AHRA 3TR6A 3C48A 2DPGA 5HJ2A 1K9VF 1Q14A 4E2FA 3LXXA 1I13A 4MP3A 4DADA 1W0KA 2Y3IA 4OFWA 4WNAA 5AIBA 2UKDA 3BJRA 4O4IB 4FW8A 2VP6A 3I61A 2ZIXB 3K1ZA 4QAQA 2IV2X 1L5OA 1OXBB 2E3JA 2FUG1 4HH3C 4EY5A 1IEQA 2IEBA 1U2TA 2X4LA 3ONNA 2MHCA 4JJZA 13PKA 5IF3A 3L5OA 5JS2A 1C1XB 3ED5A 4R51A 3M4ZA 1DWQA 1FS5A 4UXJA 1TYDE 2OBLA 4JI2B 4Q3LA 3IUSA 3A2NA 3I9KA 3L6EA 2ODWA 3G8AA 4FFSA 5CP8A 5F64A 3DMTA 3I04M 1S7CA 3UNXA 4C6TB 5I5EA 3W5DA 4KFTA 3H2ZA 5FTWA 1QHXA 1O6BA 3D7SA 3M3DA 4RO0A 2VRCA 3LBFA 5BN4A 4FXPA 1DX4A 3FYTA 1FP7A 1E58A 1TLFA 4MR7A 1CIPA 4O4LF 3LQRA 1O5IA 2ZUBA 2XWPA 1Z37A 3GU3A 1LDMA 4QUHA 3WGQA 4DCVA 1TCCA 3N7UA 2WC1A 3OJOA 2QNBA 4BX2A 3U61B 1FFWA 3KQNA 1P4GA 1ZXBA 3E2IA 4PANA 4X93A 3BTVA 4NJMB 5K51A 4PX9A 4ZU1X 2B4AA 3A25A 2VSXA 3CW2A 3ZCXA 1JZTA 4YP9A 4PR0A 1XCPA 1NULA 2C5EA 4GGPA 1E6WA 1PCXA 1EFUA 1KKMA 1KOGA 1H2XA 3D3WA 3IHTA 2QP9X 2BKEA 2ZRGA 4F2DA 2WYUA 1C0EA 1CB7A 5EYPA 2P3QA 2JZNA 4Y3UA 1HC7A 3GFGA 3KWMA 3NNNA 4AICA 3I0ZA 1WMEA 4B7CA 1E2GA 1A8HA 5LIRA 2PKCA 3A1WA 4KVZA 4ZDKA 4ZZ0A 2WU4A 1KVRA 4LDZA 1Z15A 5GJCA 1T8WA 1L9XA 5JHGB 4LZAA 1SQFA 3Q2KA 3QFTA 4MWZA 5DI9A 2D5LA 3HZZA 5FUQA 5KYYA 4DUYB 2E4VA 1SCBA 1EXMA 4JS0A 1KJJA 2FVXA 1JXAA 5BQPA 3SZGA 2AYXA 2IS4A 1NZJA 1LX6A 1PJLA 4DCPA 5A0FA 5T4HA 4WY8A 3D9QX 3RSOA 3V46A 1N0VC 4PSAA 3HEBA 2NU7B 2NAPA 2J41A 1IK4A 2FMXA 4MV3A 1SIUA 2PX4A 3HFGA 1K0FA 3L4KA 2LCIA 4R8RA 1A9YA 4DFDA 2CFTA 3ZHRA 2G7ZA 4A73A 1LJLA 1EGVB 1JDTA 4Q3EA 4D9BA 4QPNA 1EFVA 2FK7A 3SIRA 3KAJA 5CVDA 2ECQA 4GE3A 2O1EA 3WK4A 2WHYA 4EEZA 5BURA 3MWEB 5KQMA 1EEXB 1RPNA 3X1XA 2PZAA 2Y1GA 4KPUB 1O95D 1SR8A 4NZ9A 1VJCA 1PTKA 2R85A 4R3UC 2DEUA 2Q41A 2QMHA 3MWLA 2P4SA 2RKBA 3ZXIA 4C87A 1M2VB 4O1MA 2VPIA 4CEJA 1RYBA 3AR5A 3HVHA 2D13A 3CUUA 2AXPA 4WMLA 4HUTA 2FX2A 1P7PA 3SJBA 4K9NA 3EOBI 1VLHA 3UCFA 1Z25A 4HVCA 5CFNA 5HTOA 1VKJA 2DF8A 2R1VA 3ITDA 1ZNQO 2HPHA 2HJVA 3O47A 4DA8A 4JROA 2Q3CA 3HP1A 4KIFA 2F1KA 3QP9A 2CLMB 3RC2A 2HWYA 1U3UA 2C03A 1WCXA 4S12A 2FPIA 3QUQA 3ZVNA 4E32A 1IH8A 3UK6A 3PFWO 2CJXA 4JY7A 3MT7A 1UR5A 3ETLA 3NC0C 4GPD1 4JLNA 4MEJA 2WJHA 3D7KA 5I9NA 2CCJA 4HRYA 4NBRA 3SCZA 3U2QA 3LCRA 2R97A 1KO4A 1I5RA 3Q41A 4QNMA 5LFAA 4AJ4A 4PSVA 3T7JA 4POOA 2GCGA 2QRZA 1WHSB 4X20B 1AK9A 1E1DA 1ZK4A 3Q85A 2UU9B 3RQIA 2HYDA 4FJ2A 2ZJ7A 2M9MA 2BE9A 3TQQA 1CHNA 4C6SA 4IHJA 1Y81A 3LK7A 1FZQA 2JAPA 1G2IA 3M3HA 5EE0A 4RS3A 3HJUA 4XX1A 2HMAA 4HQRA 4Q4AB 5BT9A 1E1LA 4LIPD 1J07A 2RK4A 1Z68A 1YQUA 1Z5WA 4PFJA 3F3MA 2P4EA 4G1EB 1V8PA 4ZT6A 4OKIA 1MDFA 4LF9B 2YC2C 2WPNA 4TV9F 1E0DA 4K9LA 4YVFA 4IHQA 1W2HA 3LPMA 4QQ8A 5EIOA 4ZTUB 2JGNA 1FDUA 3NEPX 4RZXA 2ES4A 4LY6A 1YB4A 3PHJA 4HUQA 4V2UA 1KYWA 2OL4A 3UATA 4FVTA 1I3OA 1N2SA 2D0PB 4FE4A 4ZYYA 3QWIA 2BONA 3VSAA 4Q3KA 2HO5A 4E0BA 4E7OA 4EFMA 5M2QA 3ZXSA 4Y6RA 2W8ZA 2UYYA 3SJUA 3M6FA 3MCTA 3AKEA 3L7NA 5B7QA 4IF4A 3Q8KA 3H84A 5CVTA 1G59A 1T29A 3AHEA 4O2AF 4BWGA 1ACMA 1J39A 1ULUA 1OTXA 4QFBA 1Q0TA 1C0KA 1NJFA 3H17A 3EDCA 3O8BA 3G02A 4Y2YA 3TZ6A 4LOKA 4BRWA 1LI4A 1NFFA 4CF4A 3G5AA 1U1DA 3ISVA 3Q1KA 4FBLA 3QYFA 1TQ4A 3C39A 3VSCA 2XRFA 2EOAA 2EKPA 1LNZA 1EP9A 3ZWPA 4DABA 1IN7A 1KYZA 3M1IA 3BBPA 2FMKA 1XAGA 2RC6A 3GT0A 2BGGA 1EESA 3GCXA 1KOLA 1MBZA 1ODIA 2G5GX 2O48X 5T67A 1PDVA 2KM1A 5IK2D 1G41A 2R6AA 1YIAA 1E5LA 3SVLA 2MIIA 1J2RA 2QV7A 5HMLA 4YGYA 1B3BA 2RGBA 3OM0A 5F5XA 3VDRA 2ATXA 2ZRCA 3MRSA 4AKIA 3T95A 1FYXA 5F1KA 4DLLA 3FPEA 4PG8A 3BXFA 2GHRA 3ZZ0A 3P9PA 3IX7A 4HB4A 1IB0A 3OTHA 2IYNA 1XCBA 3AKYA 1JMYA 4EPTA 1BQEA 4TLLB 2EGHA 4CG3A 1Q83A 2OORA 1FFYA 2FZGA 4F84A 4HGOA 7GPBA 1JPNA 2F62A 1VCNA 1XZHA 1C4WA 5K3EA 1X87A 3FMGA 1HEYA 1SVWA 4PHFA 2VYFA 2JLRA 2W42A 4IDGA 5B12A 2IHNA 2ZIXA 1GRRA 3LJKA 4JOSA 1SELA 5AKXA 1T1JA 3E0QA 5KOIA 3TJRA 2BV3A 1Z4PX 1H2RS 3K9GA 3NHSA 3PIDA 4U6QA 1G2QA 4Y9RA 2QF7A 1K08A 3K70B 1HTBA 4EY3A 3VH3A 5JD5A 1OH7A 1OW3B 3OFKA 3NX4A 4ZHQA 1WABA 2HA0A 1P0PA 4N5MA 4C88A 1W6RA 2BH9A 2WG0A 3VYTB 5BXYA 5CLGA 1TB4A 3PXDA 2DHQA 4Y6PA 4TYPA 2Z4SA 3IAS6 1M2OB 2FLWA 3ASVA 5DFAA 4ZI5A 4YQFA 2OTCA 2DGDA 1XHEA 3DZKA 4KKVA 1U5BA 3WRWA 5ECWA 2A5DA 3Q87B 1ZEMA 2YWGA 4N65A 2CJYA 3B3AA 5AJUA 3WG9A 4B43A 2FK8A 2JFGA 2XYHA 4BMSA 1E2KA 4Q7KA 4F1WA 5K45A 1NUTA 3WLAA 2ZQ5A 2Q6IA 4L8YA 3CEPB 3NOQA 4NI5A 1NLFA 4D4IA 2KJQA 2P90A 3AV0B 1L5RA 3KD3A 3LUKA 3WB0A 3QEKA 2XMZA 1TIKA 1TJ4A 4P32A 3TVDA 4PX3A 1U2DA 3MD0A 2HWKA 3EW7A 1GPKA 1Y4DE 2H8KA 1D0VA 4MJ7A 5A1JA 3KELA 4FFMA 1MB4A 1FQJA 1Q21A 2GAFA 3NH6A 4HRAA 2C99A 2XCOA 4P4NA 4E7PA 2QGNA 2ZXEA 1L7BA 4G8CA 1ZEJA 2R6GA 2WAMA 3E9DA 2AVNA 2C5LA 4MP6A 3UMJA 2FSPA 2XF8A 3KXIA 4F2HA 1NLMA 1YQTA 3ZK7A 3EWIA 4MVJA 5EUBA 1ETHA 3DVAB 2QTWB 2FZ4A 2BDTA 1QIGA 1GR1A 3ETCA 2CCGA 3G2OA 1DWPA 4NIMA 1WPRA 2B0JA 1KRWA 1Y37A 3CV3A 3D3EA 1T5BA 3HBAA 3MD9A 4Y1EA 1R2QA 4ZEXA 4EKYA 2J7PA 4UNRA 4ACAA 4R54A 2WICA 1WSDA 5KYWB 3PWTA 4FEYA 2X40A 5IDXA 5IZCA 4TV8B 1HQKA 2O19A 4L3WA 2WD8A 3HU2A 4BE9A 3QZUA 3KU1A 4OHOA 1EP3B 1O5OA 3KBBA 4ZQIA 4A2PA 3UGJA 4KXUA 1C7EA 2FJPA 3IV9A 3KDPA 3ZK9A 4CKWB 4D8TA 5BVHB 1GPUA 2PV7A 4OLHA 4B7UA 4PSCA 1UJMA 3GY0A 1KHHA 4ENRA 3A1CA 1GPJA 4HGPA 3AHDA 5SY9A 4C3ZA 5JXHA 3JQQA 2GEUA 5GVRA 3BFJA 3SP1A 1PEDA 4BGIA 1D3AA 4PZZA 5TC4A 2Z30A 4ZO6A 1NSYA 2LE0A 2XYRA 2J09A 3K6SB 3HYSA 2CK3A 3CZCA 3WMXA 3QH4A 2BMWA 5GOZA 1KY3A 1H5UA 1D5CA 1QGDA 1WLSA 4HMOA 2HX1A 3O3CA 2PIDA 5ILGA 1R8QA 5JCJA 4KW7A 3U4AA 4EB0A 1XRSB 2RKOA 5JRDS 5FEMA 1B8OA 3KT0A 5BY2A 3ZWVA 3WL6A 2OGWA 3VRHA 4MINA 2XMSA 4N7RA 4IQ8A 2PRIA 4EGFA 1ILWA 2PDAA 3GUUA 2QOEA 4MW4A 4RKYA 1Z0FA 4O5AA 1YA6A 4LOHA 5KTNA 4TT3A 3SF8B 2YDYA 3HJFA 3ASUA 2WQZA 3FLMA 2QMQA 1I5EA 4QNNA 1SVLA 1JR4A 1P60A 2OD7A 4ECAA 1BMFA 4IZIA 2UYCA 3H99A 5EG5A 2C2XA 4F5YA 4MS1B 4OQFA 1N8TA 3UFXB 2HMSA 3CGWA 4YJ3A 3DXYA 1JAXA 5GOTA 4G5RA 1WHSA 2E89A 5J2TA 3Q3GE 3T9AA 2PQ2A 5BN1A 1C9DB 1UAGA 3AR8A 5GZ6A 2SCUB 2F2TA 2BUCA 3D31A 3JQCA 4GYJA 3RVLA 4EKGA 5ER6A 1SN7A 2H52A 4HMPA 4FK8A 3O83A 4I36A 4U6NA 1DAIA 2PWZA 1I01A 4H9GA 4J0QA 4NJMA 4OHVA 2WNIA 1ZPDA 2C84A 1IBLB 2LNDA 4PS1A 3K6KA 4YAFA 2H7VA 4KDCA 3WLJA 1OBHA 2V8OA 1M54A 4FX5A 1KWKA 1U02A 4IFTA 1WBJB 1MZPA 2ZJYA 3NMUF 3OC0A 5FLXA 2AMVA 4QUKA 4K9RA 2C95A 1AK1A 2FEXA 2AH5A 3G2JA 2PKEA 1M8KA 3D7NA 4A0QA 4CV2A 3INGA 4WKBA 2XXAA 2UUBB 3T3MB 3AOEC 1RWWA 3W6OA 3C6QA 2BL4A 1YF3A 4YRDA 3TW4A 2IS1A 2JIRA 4D97A 5H8WA 5HM8A 1XRPA 1KFCB 4UNNA 3HRHA 5BRAA 4IBOA 2NYVA 3F8TA 1XCGB 2UDPA 4FOPA 5GADl 3ZNNA 1VXRA 3KHKA 4OP2A 2AOTA 1TU0A 1L7NA 5FXMA 1K97A 1LLFA 3OY2A 1M7GA 1NLZA 4XVHA 4EEXA 1PJ3A 3DLIA 3ESDA 4BNXA 4US2R 1L1QA 1WDMA 4TSRA 4UAVA 1CE8A 1UEXC 2QTRA 1RD4A 2OQRA 4I1OA 1G8YA 2X0JA 1EVIA 1YACA 2AJDA 2I62A 3LZCA 2HMWA 3QE0A 4L4UA 3GGSA 4PHCA 5HKLA 3I6YA 1ECCA 3LD9A 3B9BA 3HHPA 2G5PA 3B6IA 3KZOA 1M2JA 4JI1B 2M1ZA 3O2QB 3GA7A 4CIWA 5CLLA 3L0BA 2Z43A 1TZBA 4WK4B 4AUKA 1VSTA 3CH6A 3R5TA 3IOBA 2FDXA 2JZOA 4A0SA 3B9RA 2AMYA 3K4QA 1ICIA 4BNHA 3OOWA 5AM3A 4EX7A 1C9NA 2ODQA 1R15A 2O2CA 3ENQA 1ESNA 3T1TA 2IJGX 2JFVA 2WZCA 3TS1A 5IG2A 3NHBA 4UNSA 4A8TA 4G1BA 2HIGA 3GAFA 3GPBA 2Q4OA 4IJKA 3RAFC 3GFBA 3BXXA 4HK4A 1T3LA 3P7MA 2E4AA 3V4PB 3WDLA 2XCRB 4TL9A 1J0EA 2CL5A 3HKCB 2IEAA 3SX4A 1F9AA 3GLSA 2NUTB 3IDSA 5HGXA 1MP0A 1WXIA 4G0OA 5IBRA 2PPLA 2ZE8A 2LCQA 2C92A 3K73O 3V2IA 4QU5A 3BWMA 2W70A 3UWPA 4DYHA 4JJFA 4IAOA 2OAQ1 3UOWA 1R3DA 3D6JA 3LWZA 1DO0A 5GZ3A 3GZTB 2BSQA 5BWBA 2I7TA 1QU3A 4XD7D 4EP1A 4WKNA 3SS7X 1G16A 1UBJS 1VRCA 5HF5A 5LMCA 3M1YA 2X0NA 4J0KA 4REQB 1JHZA 4KFRA 4J6FA 4A8PA 1RFLA 4DNQA 1C9EA 3UJ9A 3DYIA 2WJ4A 3IEXA 4TKLA 1AY0A 2XB8A 3HY3A 4ZU6X 3SEFA 3ER9A 4YMVA 1U8CB 2RH9B 3B1ZA 3EXG1 2QD3A 4FUTA 4NOKA 3FBTA 2OO7A 5DXJA 5JU6A 3GVHA 3KCNA 4B40A 5CA1A 2WWFA 2FGKA 1FU4A 2IYQA 5TF4A 2NUPA 3AKZA 4MRMB 3M0EA 1DCMA 1E92A 3DHNA 1SHTX 2ONJA 3ZC3A 4BU1A 4ZVLA 4NAHA 3ZHSA 1J4AA 3LT4A 4EA6A 3K0CA 4PYQA 3G2IA 3TPFA 1YRLA 2WMYA 1OE0A 2H1SA 3VH2A 4E13A 5IX8A 3BMQA 4RABA 5AI0A 3VPDA 1FTQA 1S02A 2MSKA 4BGEA 4CTNA 1XOIA 1N2CB 2ZJ3A 1RBQA 4I08A 1XL0A 4R6WA 2WILA 3AF4A 3TTUA 3IUBA 4ND8A 1OVMA 5CJJA 4UU0A 3I5XA 4K9MA 1MB2A 2HAEA 3PHLA 4CM3A 2GA9A 1AOXA 2WNSA 3RODA 2X23A 1KVUA 4LMPA 5HKBA 3H9GA 1R0CA 1CUJA 1NASA 3DCNA 5JZSA 1DIHA 3C7CB 3LSYA 1W36B 4OQYA 3U3JA 3QIAA 2HPVA 4YJFB 5HE9A 1T5LA 1PFWA 5LP6C 4ZV7A 5DIZA 5A3VA 3RUIA 1JTEA 2H1OA 2OA0A 1U3FA 4K26A 3Q2IA 1L5GB 1JH8A 1NPDA 1QV9A 4TGLA 4GDFA 1NLUA 2X7JA 3CEAA 5AXBA 5E6SA 2DECA 4GLOA 5CMLA 4ZOQI 5E0KB 3A6KA 4PAWA 5FNVA 2X8BA 3MCUA 2I3GA 3KYDA 3KZ1E 2FEOA 2J9FB 1R50A 5AIAA 5G0TA 5B6IA 4G01B 3DJFA 3W79A 5DH9A 3DE5X 3UWSA 1Y1SA 1RPAA 4EGQA 3UW3A 2VXOA 4CCYA 4AULA 4RJKA 4EX6A 3G7SA 2F3RA 1R7RA 2Y93A 2ONCA 4CZ2A 4D5GA 1SAYA 5ANRB 4M7OA 3DDOA 3UBTA 3HFJA 4QYIA 4K28A 1IRIA 1LTHR 2GWHA 4O8CA 3W5HA 4O2BA 4R2JA 1XYYA 5J5CA 3T1OA 5CT5A 3FDIA 1HYEA 4X24A 3RS4A 4AMVA 1DTWB 5KYTA 3U4QA 1HT1E 1E7QA 3IESA 4GLBA 3GV0A 4WK6A 5FI3A 1DOAA 4J2HA 3IKJA 3NATA 3TSCA 4O5OA 2YMPA 3WGUA 4L5YA 5DHRA 1ZK1A 2VOEA 3OPXA 4YMWA 1YWGO 4ND5A 3PI7A 4BMOB 1Q1EA 3BK1A 4X71A 1Z88A 2R8BA