5TARA

Crystal structure of farnesylated and methylated kras4b in complex with pde-delta (crystal form ii - with ordered hypervariable region)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
184
structure length
184
Chain Sequence
GTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of recognition of farnesylated and methylated KRAS4b by PDE delta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein
molecule keywords GTPase KRas
total genus 69
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2016-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5tarA00
4YXWD 1G16A 4JLNA 1BYUA 2FMXA 5G3YA 4PAMA 5FPKA 3ZZ0A 3BRWD 5AUNB 1KKLA 1NMZA 2HYDA 2WKRA 4K8OA 5DNYB 2XEXA 4ZV4A 3P26A 3D31A 3KQUA 4KFSA 1U9IA 4D81A 1Z0KA 5KO2A 1N3BA 3OE7D 2QTFA 4US1R 3KQLA 1UBFA 2QM7A 3FKSA 2ZI7A 3NBYC 2MSDB 3QF7A 2GETA 2GEVA 1XFAA 3LD9A 1JR6A 1V43A 3QKRA 5IK2A 3A4LA 3Q8XB 5BQ5A 1CXZA 1T6NA 2YV5A 3KQNA 4M53A 2QA5A 2IUSA 4MKFA 4AKIA 1Z5ZA 1P60A 4LWZA 4XH9B 1K5GA 4NONA 1U8ZA 4HATA 4KITB 4RZ2A 2RAPA 2XX3A 4QFMA 1ZD8A 2RH5A 1ZC4A 4JVSB 3U6KA 4EIWA 1DS6A 4G5OA 3THOA 1E0KA 2Q0HA 2QSZA 3AH8A 3SJZA 1J2JA 1UAAA 3GJXC 3K9LA 3OZXA 4LGMA 2O5VA 1XD2B 2FH5B 1CJKC 2ZREA 1JBKA 2HYIC 2YOFA 1RC8A 2O8EA 1E32A 3GLGA 3AVUA 1MT0A 2NPIA 2VO1A 2B7BA 3I8XA 1E2HA 221PA 2GESA 3CNLA 3QXJA 5K8LA 2IYSA 1BYIA 3BS4A 3FB4A 4NYJQ 5FOTA 2QPOA 2DHRA 1S1MA 3TGPA 3W9YA 4I1SA 1E2IA 1KI8A 1YZTA 1FUUA 1DAHA 3WP1B 4B48A 2JATA 5AJZA 4KXFB 1UJ2A 5LBIA 1DADA 4HLUA 5HTKA 2BJVA 2O8DA 2O8BB 4Q1DA 1PZNA 4RD2A 2IS2A 1P3JA 1E0AA 2OXRA 3H4MA 4W5JA 3A6PC 1VTKA 3EAQA 3U3MA 4OI4A 2DWOA 4TSFA 1TUEA 2D62A 1TPZA 4PPNA 3U3RA 1M1YE 4TYNA 1R0YA 4RZ3A 4I1OA 3U44A 4RCYA 4LJ6A 1U81A 1DARA 2AK2A 4Q4HA 1PVOA 1LNZA 1QRAA 3C7KA 1OH6A 4BFVA 4LY6A 4B3XA 4OQXA 2ZI6A 4U02A 2QAGB 3RHFA 4FMBB 1Q3HA 4FCVA 5SZJA 3AVVA 2OILA 4DLRA 1CKEA 2QSYA 2IYQA 1QHNA 1G19A 1TADA 4OQMA 3ZZTA 4YDSA 4NP6A 1J70A 2P6RA 4US0R 4A6PA 1W4BA 3R20A 4LYFA 2K5UA 3AKEA 1SKYB 2EYQA 4M9SA 5BYJA 1PUJA 2V1XA 4YXWA 2UVQA 4O25A 4TZ6A 1EX6A 1UDXA 3E70C 4P33A 3I5YA 2QP3A 2ZUBA 4ZI2A 3GLGB 2V1UA 4DBLC 2P6NA 1NP6A 3GEIA 2GVZC 3KUDA 2CE7A 4NYJR 1GIAA 2ZSBA 3BFKA 4E22A 2ZANA 4ACAA 2EFCB 1PLLA 1YRBA 2DYKA 4CW7A 5SZIA 5DHAA 1KSHA 4JS0A 3ZDQA 5AR1A 3TE6A 1KDPA 3IGFA 4TMTA 5JHGB 2Q9CA 3UK6A 2QG6A 2A7QA 1N0WA 1SVSA 3AVXA 4BFSA 4OI1A 4Q48A 4D6PA 3V4RA 4C7OB 4HAUA 3L0PA 1AS0A 5JJKA 1II8A 2JLXA 1R5BA 4MRNA 2XOKD 5L3RA 3U7EB 1ZBDA 1P73A 2IYUA 4HUTA 2YWEA 3VHLB 3I72A 3B82A 4RD1A 4JJKA 1UADA 2QNRA 4TMWA 4BLPA 3MWKA 2BMJA 5L3SA 2IS1A 1PUIA 1LS6A 3H2YA 1SVMA 4XVUA 1KI9A 4DCUA 3ZLJA 3BD9A 3T1TA 2ONJA 2ZJYA 4YMWA 1TQ6A 5F9HA 2F3RA 2YYZA 1D2NA 3B9PA 2GCPA 4Z54A 1N0UA 5LD2B 4S2EA 1R7RA 4B3FX 4MYHA 4O2LA 5G53C 5L3VA 1L4YA 4ZO4A 2PLFA 4EPWA 4KHZA 2CLDX 3PEUA 5G3ZA 4KCGA 1KTVA 1Z47A 3Q3JB 2ZQ5A 2OEPA 1HEIA 4B2IA 4NDZA 4DB2A 5BN4A 2L0XA 3A4NA 2BVNA 3FOZA 1YHNA 1NI3A 4PTLA 2MMGA 4HSEA 3T61A 1P2SA 2Z83A 4LYJA 4BLOA 5C46F 4IFBA 4DKXA 2HCJB 1GAJA 1IAQA 4TQUS 2F6RA 3TSWA 2B92A 3B1ZA 1E4VA 3CX6A 4Z51A 3V00A 2BCGY 3NBXX 3AGPA 2PZGA 2ATVA 3W3AA 2ZU0C 3SU8A 1LS1A 2BM1A 4FMDF 3GLFE 4PSVA 1MR3F 2JLYA 4B6FA 2FV8A 4MGYR 5FBVB 4RJLA 1R5OA 3A8TA 3QVUA 3BFXA 4Q4AB 1HT2E 5G40A 5F3WB 3MD0A 4M8NE 2IYVA 2ZJBA 3HU3A 1AGPA 3JZAA 2V6JA 3ASZA 1K5DA 421PA 2GJAA 4DC9A 5JMTA 1RRPA 2ZRBA 3LX5A 1SVWA 2I4IA 5JCZA 2WWFA 1ODFA 3GJ7A 5UKDA 3SBEA 4OL0A 4DIDA 5JJLA 1GVNB 2HLDD 3P4XA 4M1OA 1JJVA 1FQKA 4TMVA 3SHWA 4RZUA 4AYXA 5C4MA 3ADCA 1YZNA 5E7JA 3RRYA 3KTAB 3EW9A 3PVSA 1W47A 2H17A 2WJJA 1VCMA 2OHFA 1OFIA 3AF4A 4JT2A 4ESHA 1XZPA 1BOFA 3P4YA 1XTRA 2GDJA 5HPYB 4R2HA 4TL9A 3BE4A 1OXUA 4KSCA 1ESNA 3NBZC 5EP1A 2ZM5A 3IQWA 2IXEA 4AURA 3WNDA 1XD8A 3AF3A 5DO9A 1TX4B 4RCZA 1W49A 1OF1A 4HZIA 2AL7A 3PCRB 2OCYC 1TMKA 2R6GA 2FWRA 2VF7A 4DEXA 1KHTA 3EC1A 1Z2CA 3DO6A 3L43A 1JQJC 3TVTA 1KJZA 4ARZB 3VHXA 2CK3D 3U4QB 1NN5A 3LH5A 2B8WA 4BFTA 5FFMA 1W0JA 3O8BA 3PEWA 3FHCB 3THWA 5BN5A 5DHFA 1BS1A 4JLPA 3MWYW 3CW2A 3VFDA 4Z8XA 3IBYA 5FTJA 2AXNA 1MO5A 2ZI5A 2BM0A 2MMCA 4KVAA 3K1JA 2ZITA 4KBFA 2OLJA 4L15A 1QHYA 4G3XA 4IW3B 1XMJA 2EQBA 4BZQA 4DLSA 1RYFA 4TN1A 3QE0A 3WMGA 4G5QA 4C7OA 4V0OA 1YQTA 3N2IA 4MA4A 3RS4A 4XTCS 3T5GA 3AP3A 3T12A 4TTRA 2LWIA 2QAGA 3SS8A 3HU1A 4C0SA 2W0SA 1W0KA 2NIPA 1Z2AA 2KI5A 5FL3A 1Q21A 2ZTSA 3LV8A 3OIYA 1E2QA 4V03A 2VH5R 4DRZA 1YZKA 4V0KA 2A5YB 5TXGA 4Q9KA 4A82A 4M9QA 3WP0A 1EFRD 4FIDA 3DDCA 4H9GA 4M1SA 5JFGA 3AP2A 4IDHA 2VQSA 2YOGA 3GMTA 3GD7A 4OQLA 5FUVA 1A82A 5K8UA 5KOYA 4QM6A 2AFIE 4WAUA 1QBKC 4JSYA 1TU4A 3ND8A 3F0TA 3SI7A 4B47A 1DG3A 1P2TA 3AKCA 1HE1C 2QRZA 4C4PA 4MRSA 3M0EA 1Z0AA 2IUUA 3O47A 3C16C 1UEJA 1DE0A 3W90A 4A92A 4BEJA 4OJQA 1XTIA 2EU8A 2GNOA 2XNSA 2YOHA 4RFVA 4TLCA 5CYPA 5HE9A 1KI6A 4NE2A 2IWHA 2NO7A 3B1YA 4NTZA 5AK0A 4N0EA 2A5FA 4PZZA 4NYIR 1CTQA 1MO6A 3BC1A 4GDFA 2IYLD 2QAGC 4MYTA 1OHHA 3C41J 4PO1A 4ZIRA 2BBOA 2CVHA 2ZRLA 4B43A 4WOPA 5FI1B 4ACBA 5BN3A 5J4KA 2YWGA 2P65A 4ARZA 4IOLA 2B8TA 3G0HA 2F9MA 2FOLA 3U44B 4RVCA 2P5TB 3K09A 1GG2A 3PUWA 4M1TA 4XWKA 4F38A 2O8FB 1M34E 1U0JA 5EE3A 2XZOA 1OKKD 1G5PA 4ESVA 1P7CA 1YR7A 2V55B 1CR4A 1CLUA 5DIFA 5AJWA 1P9WA 4OBEA 3MJHA 4H1VA 3MCAA 2OO7A 1L2TA 3THXA 1OXSC 1NLZA 2CK3A 1K8RA 5FOUA 4Q18A 4GI7A 1XZQA 2ZSEA 4BLTA 1P9RA 1UKZA 4HDQB 1Q12A 2R6FA 4JLJA 2EFHB 4TTPA 5EXSA 1NMYA 4EKDA 1NIPA 3RS2A 4P4SA 2GHIA 4LJ7A 2GAAA 1OSNA 3BB1A 3MSXA 4Q1AA 4ZPXA 3WHKA 4L9WA 2NO6A 3BH0A 1SULA 1ZUNB 3DMDA 3K0FA 3ZS8A 1AKEA 1NBME 4UJ5A 3RRNA 2C96A 4DIEA 1JEDA 2NZJA 3U7GA 5F9FA 3U3JA 1Z22A 4II7A 2VHCA 5CK4A 2CVFA 5GJWC 3LBNA 3GLFA 3BWDD 1EWRA 1QVAA 2ORWA 4Q03A 3PJRA 3EZ6A 4KSBA 1F48A 2CL7X 1TL7C 3WBKA 1XXHA 2TMKA 2R9VA 5IRCD 4V02A 5LPNA 4I81A 4CEIB 1X6VA 4KYUA 4MKGA 3KDSE 1NL3A 3H1TA 3EWAA 5L3QA 2D06A 2VL7A 2C78A 1U8YA 1I4LD 2IYXA 3KJHA 5HZHA 2WHXA 4JMPA 2OT3B 1JXMA 2Z5FA 1CP2A 1IXSB 1Z0FA 4PXAA 5HCNA 1FMLA 2QQ0A 1NVXQ 2ZROA 4PAQA 2QM8A 4GNKA 3RC8A 1VYVA 1FZQA 1D6JA 2QN6A 4C3ZA 2GF9A 3K9GA 1M7BA 2O0HA 1NF3A 3FWYA 5AUPB 5EXXA 1OH7A 5KDLA 4PHFA 5FL7D 1W36D 1SXJE 4JBXA 1E94E 1GL6A 1KSFX 1QHSA 3RVBA 5HR5A 3CPHA 2QGZA 5JECA 1FTNA 1GZSA 1X1RA 3NH6A 2NZ8A 1DG1G 1VDZA 3L8ZA 4N0DA 2VHUA 3AUXA 3KKMA 3GLHE 1E96A 1XEWX 2QQEA 2JDID 1G7CA 5L3QB 4WZ6A 2W6JA 3A4MA 3THXB 5KHOC 3JZMA 1A2KC 1N6PA 1TU3A 2FEMA 2IEZA 1XEXA 4O0MA 1E9CA 3KXKA 5GADl 1WE2A 4C0LA 2H92A 3QPUA 2FJUA 3P27A 5CITA 1OLOA 2P6UA 4LJAA 2J7PA 4JBWA 1KKMA 1JQLB 1R0XA 2QT0A 4URWR 1G4UR 2J7KA 1N6OA 3CPEA 1EXMA 3K0FB 1S3GA 4V0ME 1RIFA 3CPJB 5JWRA 2ERXA 2WPDA 4NCIA 4V0LA 2DR3A 3C5HA 2XNDD 4B2LA 4KO8A 4DZZA 3ADBA 1E3MA 3BB4A 4L4UA 4P4SB 2VF8A 3FYHA 3W5IA 3X1XA 1L7VC 1Q20A 1W2GA 5FOVA 5FBLB 1UPTA 4ILEA 5CB8A 4IDNA 2EWVA 3ZQJA 2XB2A 3QKSA 1AN0A 1DAEA 3IHWA 1B0UA 1DAMA 1WDTA 4PQRA 3UKDA 4A0RA 2GRJA 1DPFA 2WSSA 2NG1A 4DCNA 1A2BA 4WZAE 2WWXA 4YONB 1E4YA 2ZJAA 3N5CA 2PZEA 2BOVA 2GAOA 1G291 4TZ0A 2V4ZA 2VYFA 3C8UA 4TL7A 2WWWA 3PEVA 4JVNA 3F5FA 5K8TA 4Z8YA 1TAGA 3HPRA 3NH9A 3I8SA 3VKHA 2GEDA 3CIOA 3KB1A 4BWYA 1NKTA 2YC4C 3GFOA 1P72A 2VHQA 3LW8A 1OIXA 2JJ2A 2ZRNA 4LPSA 4A1FA 1E2MA 4CYMA 1TQ2A 2FNAA 2WIAA 4GOKA 1DO0A 4DDTA 2HEIA 3TVDA 3QNUA 1KI3A 4R2IA 4JBYA 2A9KA 2IXFA 3IIJA 3W6PA 2C99A 4UQOA 3ONWA 2OZEA 2R6CA 5FOSA 3AP1A 2JLZA 2AWNA 3GEHA 3FHOA 4ASUD 3FMOB 3QXXA 2B6HA 1AJEA 5J40A 3PENA 2VLIA 621PA 4XWAA 1LW7A 2HF9A 1HV8A 1U8AA 1JAHA 1G1MA 4NCNA 2CMKA 5JWOA 4TWZA 5KUTA 3VU9B 1OJLA 1ZM4A 4W7SA 1T3HA 2H16A 4B75A 3VR5A 3Q5DA 4A15A 2J5XA 3I1FA 3VAAA 4XTRA 1VHLA 3AF1A 3BOSA 3EPLA 2X77A 4AIIA 1AQYA 1OE0A 5P21A 5JCPA 3QY0A 4FI3C 1D9XA 1K6MA 2ZS7A 3ZJYA 1ZM9A 4M0LA 3LVQE 1GKUB 1OFHA 3GQBA 4TSFD 2C95A 3HYTA 1FFHA 1XMSA 1XPRA 4TQ9A 4BFYA 1HA3A 1LTQA 3U4QA 4IJMA 1OXVA 3W8NA 3DEFA 2FDCA 1X1SA 2X2EA 1F6BA 2ASEA 2ODBA 3EC2A 3CF0A 4FD2A 4S35A 1WXQA 1IJFA 5DSZA 1Q1BA 4YMUA 4EQ6A 2ZE5A 3ZVMA 1RPZA 5KSOA 1NJGA 5CDFE 4BPBA 1A1VA 3IEVA 1G7TA 3CBQA 2FA9A 1G4AE 3RWOA 1C9KA 1KMQA 4LHXA 1ZIPA 3E1SA 5B2ZA 3RAPR 3CRW1 4C0JA 4JVLA 2O8DB 4QGFA 4O2RA 3ZVRA 3I62A 1E0SA 5DE3A 3HWSA 2ZRKA 4TL8A 3ZVLA 3GJ3A 2AN9A 2GXAA 1W5SA 1S1CA 3AEZA 4G5RA 3R9IA 4BRWA 1H65A 1XEXB 3KX2A 4UNQA 2CNWA 4LYAA 4ZKEA 1KO7A 2J0QA 1BH2A 1S0UA 2PX0A 3KTAA 1NJFA 2ZJ2A 1AIPA 1Z63A 4QBFA 2QPAA 4NKRA 4Q00A 2VA8A 1B23P 3T5DA 1C1YA 4W5HA 5HE8A 3SC3A 1W0KD 4HDCA 3CONA 1R2QA 1WQ1R 1IBRA 5EUMA 2XXAB 4MUAA 1NVUQ 1KSJA 1TQDA 1GNQA 4NCJA 2F9LA 2G88A 2J0SA 3V4FA 2V6IA 5IT5A 3TUZC 2LCFA 2WV9A 1NLYA 1Z83A 2ZUDA 3GJ8A 2IUTA 3B8HA 1CR0A 2O8CA 2IF0A 2VP4A 5H68A 1GFIA 1R8QA 3QPVA 1AK2A 2ATXA 2W58A 1CF4A 1G6OA 2JJ8A 1QHXA 3IHLA 3SQXA 3OEHD 1RKBA 3RNLA 4EPYA 1M7GA 2ZRDA 4KI0A 4WBSA 4QM7A 1KZGB 3CNOA 4LC1A 1UBGA 4HYYA 4ZDWA 1CJUC 2IEYA 1OB5A 4TT3A 1KJYA 4C0KA 2QBYA 4CEHA 2WMNB 2G1KA 2V7QD 2CLSA 1G17A 3QVVA 4NHOA 2FPLA 2J45A 2ZRMA 2ZE7A 1GSIA 2GVDC 2JLRA 4US2R 5KSPA 4FMDB 5FOWA 2JAQA 3DKVA 3X1ZA 4F7WA 2FF7A 4Z1MD 4HZUB 1N5IA 4MKIA 2BC9A 4EPTA 5FPYA 4FINA 2A2ZA 1DAKA 3IDQA 3PR1A 4URUR 3BBPA 2ZIAA 2W00A 1Z0DA 5JJIA 1I4DD 1XJCA 3TRFA 3FE2A 3QI2A 1XEWY 4HB2A 5EUQB 5FUXA 2BMDA 1EK0A 3PITA 4Q4AA 2WWYA 1Z6GA 2R62A 3SYLA 1CBUA 4OQFA 3ICQB 3IILA 3VR3A 4OYHA 4D0GA 3LWNA 4DJTA 2ONKA 4HLDA 1G3QA 1XMVA 8OHMA 2WAXA 3CZQA 5JI2E 4HLQB 2UZIR 4PC6A 3AQ4A 1JAIA 4MH0R 4TLEA 3VR6A 3WBJA 1ZUHA 5KSZA 3TQFA 1U98A 4B3GA 2GZAA 1MV5A 3A1SA 5JZVA 1Q1ZA 3S1AB 3VKWA 2AXPA 2BKEA 3B13B 4WIAA 1OH5A 3SHFA 2QTHA 1A5TA 1XEFA 2R44A 4Q7KA 1KI4A 4Q7JB 2GXUA 1VYTA 5H8WA 2ZRCA 1TF2A 4JL5A 3TAHA 3NKVA 4A0FA 2I1QA 5EE1A 2NGRA 3TIFA 3FKQA 2QI9C 2ZUCA 2JLVA 2BHRA 3RSOA 2Z43A 1G41A 4V0NA 1E79D 1JR3A 5GVRA 1OHHD 3B78A 2ZS8A 3U5ZB 2WICA 1PLJA 3N2EA 3B2EA 2HT1A 2AFHE 2WOOA 4F4JA 4YMTA 1GL7A 3PUXA 4MYCA 1W48A 1IY1A 3MWLA 4CVNA 3SFVA 4JIMA 5CLLA 4AYTA 2WSMA 4FWIB 1TF5A 5A0FA 2J1LA 4PHGA 3NBFA 1WBBA 2OUKA 1UBEA 5HCIA 3U3KA 1YVDA 1G6HA 1D8TA 1XWIA 3WRYC 1BMFA 1DTSA 1KOFA 4GP7A 4F93B 3LBHA 1G7SA 3RLFA 5FPSA 5JRJA 1IXRC 4RFSA 2F43A 2ZI9A 2Q9BA 4TQAA 3QPWA 4HAWA 2OG2A 2RHMA 4B73A 4JLDA 2FG5A 2GK6A 1RYHA 1AGRA 4URVR 4KBGA 4R98A 3DOEA 2BDTA 1EWQA 4BZXA 1E98A 3FPAA 1Z0JA 4W5WA 2Z0MA 1YU9A 1E2FA 3GP8A 4DDUA 3RS7A 4JJZA 2O52A 1CEEA 4PZLA 1JPJA 3KL4A 4AG5A 1KDOA 1ETUA 5TV2A 3LNCA 2WZQA 1NBMA 1DELA 1ZD9A 5FPHA 1UKEA 3FVQA 3CZPA 5DGXA 2QL6A 1Y63A 4WVFA 4LV6A 3GEEA 4JLBA 1KO8A 3TAUA 1WRBA 3CLVA 3CX7A 2FZ4A 4Q1EA 2QE7D 4Q4JB 4Q4JA 2CCKA 5JLJA 4NYIQ 4OJKA 2JJ1A 1U9IC 3WYAA 4XWOA 4I1UA 1YZQA 4A2PA 2RGNC 2AX4A 1SVIA 2OFWA 2ZYVX 4AKGA 2CEAA 2IYWA 3HPQA 4CDGA 4TYYA 4XJXA 1NY6A 1COWA 2J46A 1GL9B 1ZVQA 3LY5A 2GEUA 5EP3A 2YWFA 2ODWA 1E9DA 1MO3A 4KAXA 5D3QA 4QGAA 2XTMA 4JL6A 5KNDA 2DFTA 1KK2A 1YR6A 4RD6A 2BMFA 3R8FA 3SDZA 2IK8A 1JI0A 4BRUA 5KPJA 4DUGD 3EPHA 3EIQA 2BV3A 1T0HB 5FOXA 1N5JA 3CWQA 3GCGA 2CHQA 3AV0B 4P3YA 4UKDA 2WOJA 3CH4B 4Q47A 4M9ZA 3LAWA 2GCOA 4XD7D 4XIGS 5EQTA 4D80A 2JLWA 2CLCX 5C18A 1G3RA 2ZRAA 1OYWA 3GFTA 4G5GA 1JB1A 2UZ3A 2VP6A 5LB2A 1OXTA 3O8DA 1AS3A 3I92A 4PX9A 4D4MA 2D2FA 5CLQA 3ZH9B 4IDOA 4CZ2A 3O8RA 3C5CA 1GTVA 3DZ8A 2WJVA 1E2LA 3RANA 5JSZA 2D7DA 3QKSB 5CJ2A 1Q22A 2VP2A 2AK3A 4TT3D 2CCJA 3DL0A 2RGCA 2WBLC 2ZVPX 3WMFA 2HLDA 3K70B 1GKIA 3GJ4A 5FBQB 1XPOA 2JIZA 3F8TA 3OF5A 4A4DA 3SOPA 3L82B 1OT3A 3IPYA 1DBSA 4XSGA 1N2CE 4LHZA 4B33A 4QG7A 3WYGA 1YKSA 2GXSA 2JDIA 1R5NA 3QENA 2I1VB 3I73A 3EZFA 4P32A 5J4HA 1SXJD 3KKOA 1S3SA 1U0HC 1VG1A 1R6BX 5FPTA 3SJCA 2OAQ1 4IVQA 2DFNA 3EX7C 4LJ4A 3NXSA 1ZNWA 4XD7A 2BBWA 4B74A 4UNRA 2C9YA 3SFZA 1G21E 1H8ED 2C04A 1YZLA 1QZXA 4FW9A 4JKYA 1E2EA 5BWMA 3ZD6A 3QF4B 3LRPA 1Z3IX 1G5RA 2BWJA 3ZIAD 3ASYA 2QMOA 4A2QA 1ZNYA 2J3EA 4I4LA 3EWSA 3UWOA 1DAGA 3W5JA 4E5UA 1WF3A 1IQPA 1ZC3A 4A8JB 1HTWA 1E1RD 3EIHA 1KAOA 3LA6A 4AG6A 1ZIOA 3PIRA 5KNCA 1DVRA 3Q5EA 4KVGA 2CBZA 1ZCBA 5JI3E 2OAP1 1P62B 2G3YA 2XXAA 5EP4A 2OSBA 1S9DA 2ZJ8A 4QNMA 2G9NA 1G8FA 4MGIR 4MGZR 1U0LA 5KSYA 4E07A 2MSEB 1ZUIA 2JIZD 3X2SA 4QJ3A 1OIVA 5L3SB 3AVWA 3UMRA 3G5UA 4PC1A 1XDBA 2CXXA 4R9UC 1ZMXA 2EYUA 4UJ3A 4HB4A 4BFZA 3OIVA 4U7DA 4FCWA 5SZKB 1IN8A 4YMSA 2D7CA 3N70A 1T4GA 2G83A 4KODA 2DWPA 1YR9A 5E95A 1EESA 2D3WA 2QBYB 1II8B 2WJHA 2YJTD 2IHYA 3IO3A 3MRSA 3IUYA 2IC5A 2QPTA 1TEXA 2GJKA 2FN4A 2NQ2C 4FMCB 4MRRA 4GL2A 1J8YF 1HUQA 2GBLA 1XRJA 3GLFB 3A1WA 2O8CB 1EFRA 4WW0A 2QMHA 3TSZA 3IIKA 1Z8FA 3TR5A 4QHYA 4OHVA 4RKEA 3BXZA 1P6XA 3P20A 3KJIA 5TVKA 4MDFA 3AKDA 3UG6A 1Q1EA 3ZZUA 1FL9A 3ECCA 1XTSA 4BFXA 1DAIA 3EA0A 4X8MA 2HUPA 3D3QA 2AKAB 4D0LB 2VHJA 1ZU5A 2F1JA 4TTQA 1KI2A 1KZ7B 5E7MA 1XNJA 3RS3A 3J81k 3FMPB 2CJWB 1OH8A 3AM1A 2RB4A 5KU1A 2OFOA 1GOTA 3TLXA 4UNNA 3I5XA 1XXHE 1UF9A 2EFGA 4UXHA 3T1QA 2YHSA 4OK6A 5SZHB 3RC3A 3GJ5A 4GFDA 1QF9A 4GZLA 3A1VA 4DCSA 5B57C 3NC1C 5DYIA 5HKKA 2RCNA 2IBMA 4XVQA 1Z6YA 2C98A 4Q66C 4BLRA 2GCOB 1KI1A 2RHDA 4QXAA 1VG9B 5DH9A 2EVWX 1HH4A 1RFLA 1E2KA 4AD8A 3PV0A 1FNMA 3QIAA 3TUIC 3C15C 3BAFA 2A5GA 2ZU6A 3MGCA 3OE7A 5FI0B 5FTNA 3Q9LA 1CRPA 2ZSAA 1VIYA 2H7VA 2VSXA 1SXJA 2F7SA 4G1UC 3KJGA 2XSZA 2P3SA 3R7WB 4B76A 4TLAA 2WWHA 3W6OA 4DT1B 3M6AA 3LFUA 3HJNA 3VX4A 4GP6A 1US8A 2IT1A 3ADKA 2FFQA 1U94A 3EASA 4ZI3A 1XX6A 2BCJQ 2EFEB 3CRVA 3EARA 5FBWB 5DLQC 2Q9AA 1N6KA 4RY2A 2ZR9A 1E1QA 3BFVA 3OFNA 1LV7A 4JSTA 4L5BA 3KQKA 4DCTA 2GILA 2GZHA 3THYB 3LO5A 1SHZA 3GFPA 3PEYA 4BZPA 3P32A 4PPFA 3L2OB 3BGWA 3KUCA 1KO1A 2ZAOA 4HAZA 1XP8A 1FPMA 1XTKA 3ND9A 3W8RA 1WA5A 2J7PD 4DSUA 4M4SA 1XBTA 3OIUA 3FDIA 3PQCA 1GILA 2G0TA 3K0SA 1YR8A 2ZR0A 1N6HA 4MITA 4GMDA 2G77B 5KDDA 2J87A 1W36B 4CEJB 2ZSFA 4URXR 1FX0A 4E03A 4V0MA 2QAJA 5CM8B 1O3YA 2ZJZA 1P61B 2V8OA 4LBVA 5EE0A 2XTNA 3BH6A 3TKLA 3W34A 1GNPA 1ZRHA 5KNBA 1SKYE 1EFCA 1XD2A 1YJ5A 4DSTA 1PJRA 2PZFA 5EE5B 1Z08A 1KNQA 4Q21A 2Y8EA 3UANA 3ZD7A 4DLZA 4LBZA 1LF0A 2HV8A 2ZRIA 1UFQA 3AVYA 4QL3A 3CH5A 2HF8A 4IVRA 2BBTA 3BERA 2YINC 1EG7A 2ERYA 2UKDA 4EAQA 3TQCA 3NIBA 5JS7A 1GITA 1VG0B 2WJIA 4AC9A 1KK0A 2JLSA 2J59A 1KGDA 4IFEA 3SQWA 3K70C 3QBTA 1Q44A 1W4RA 1ZM2A 2RGBA 1Y3AA 1ZCAA 2FZLA 2DCUA 2ZYTX 3JVVA 4YLGA 2QZ4A 3FMFA 3QXSA 2GKSA 4D82A 1E9FA 3E5HA 3SYNA 4F4CA 2KBFA 4EFNA 1U99A 4YQFA 4QRHA 4D26A 4LC0A 2HXYA 1ZM7A 4F92B 3TUJC 1ELOA 3QXHA 5FTLA 4BLQA 3LXRA 2FFAA 4GMXA 4Z1MA 2Z4RA 2FSGA 1M6NA 1JR3E 3CO5A 3LQQA 721PA 1F2TA 1N6LA 1UKYA 3DM5A 1NNEA 4A0GA 1Z29A 2P2LA 4Q9HA 1SXJC 3D7MA 2KWIA 2WIBA 4IHQA 4PO8A 3EA5A 2OE2A 2PX3A 3DM9B 3E2IA 5BXQC 1IOZA 1TNDA 5EP2A 5TB5A 1KK3A 4A0HA 4M1YA 3VNVA 1Q57A 1IM2A 4LCBA 3EXAA 1KY2A 4YMVA 3L0OA 3KJEA 3QKTA 4I1VA 4L9SA 5EZ5A 1Q3TA 1KDRA 1DEKA 1XXHB 2O0KA 4NYMR 2N42A 2VSFA 2REBA 4QGGA 1EX7A 1GRNA 1BMFD 5D3MB 1KAGA 3CX8A 2GA8A 1H8HD 3BB3A 3QEJA 1Z06A 4MRVA 2C03A 4BLSA 1R8SA 1CR2A 4D4KA 3OAAD 1IY0A 4RKFA 2IYTA 1YZGA 2PH1A 3RDPA 4QKQA 2KSQA 1JALA 3L0IB 4M9XA 1RZ3A 3SN6A 4CF7A 5FTMA 1YRAA 4FWTA 3C14C 1CU1A 5CDFA 4TL6A 4D4LA 3CF2A 5A4JA 1IY2A 3AVOA 4NMMA 2IWRA 1NLFA 1KO4A 1U2RA 3AKYA 4EJSC 3SJBA 5JSZB 3ZVNA 3REGA 3SR0A 4C0AC 1VPLA 4WXPA 2A3RA 2FPMA 1J8MF 1D9ZA 4W9MC 1OV4A 2EWWA 2VHTA 2XB4A 3LX8A 1FQJA 3WRXC 4QNRA 4EFMA 2RMKA 2EW1A 1N25A 2CDNA 2P0EA 4C9BA 1WMSA 1XTQA 1XD9A 1KIMA 2ZPTX 3RRZA 1HURA 4UNSA 1KK1A 2C2HA 4PQFA 1W4CA 2W2XA 1HT1E 4FCTA 3WY9A 3IQXA 1X8JA 3GPLA 4HB0A 2ANCA 4JL8A 2ECKA 4P4TA 2O8FA 3FTQA 4KYIB 4TMKA 3K9NA 2XTZA 1F2TB 4C30A 1NVWQ 2ZRJA 3GLHA 2LKCA 4B3DA 2N46A 4BECA 1P9NA 2Z6VA 3LVRE 2LKDA 4G01B 3QKUA 1XMIA 2PCLA 1XCGB 4IOMA 121PA 2P67A 5ELXA 4OK3A 1XCPA 3DPUA 4PC3A 1GM5A 2R6AA 1E2DA 4EJSB 1G18A 4WXRA 1LVGA 2GZDA 2OBNA 2W2TA 2GXQA 1ZNZA 2DFKB 2FPKA 5B64A 4JYCA 1FTSA 4DDVA 3VR1A 5EJEA 2AR7A 1XU4A 3I32A 4RSGA 1KJWA 1UM8A 1I2MA 2QTVB 4QJ4A 3X1WA 2REXB 3MJRA 2GJ8A 1G3MA 4OI2A 2PCJA 5CK5A 2VBCA 3K0EA 3MLEA 2HJGA 2WJGA 1VKJA 2FFHA 4GOXA 2XNDA 3RYTC 1N6IA 2FGJA 5FL7A 5C2JB 2VRWA 3REFA 3LXXA 2JCSA 3WNBA 3B60A 4CT5A 2F55A 4LJ8A 1VIAA 4HEJA 3T1OA 4JKIA 4URYR 4OKSA 3P1JA 4K46A 1KDTA 2QY9A 3H86A 1GP2A 2X19A 1VYUA 4IOKA 2PLRA 5GJCA 2FE4A 3ZIAA 4EFLA 3K0AA 1SQ5A 3LDAA 3CWZA 4PR0A 2ZYWX 4EPRA 4HAVA 1IN4A 3Q7PA 1R0WA 1S9HA 3NTUA 1VECA 4PC2A 5EXPA 3K0CC 2PT5A 3EZ9A 4L8GA 1QG2A 5DISB 2ZETA 1KNXA 4ASUA 1MABA 4BASA 4KLNA 3JVUA 3TNFA 1ZJ6A 3M4YA 3NWJA 2VP0A 1S8FA 4KFRA 4IKEA 3B1XA 3V9PA 5KTYA 4EUNA 1A4RA 5E3HA 3BIFA 5K8IA 4KU4A 2PMDA 3MUFA 3T15A 4O3MA 3CM0A 2ZJ5A 1MABB 1W0JD 2G0NA 4PSKA 4B6EA 4NCHA 5JEEA 521PA 4IOJA 1EGAA 1N0VC 3OEEA 4LJYA 4QHSA 4Q9JA 3IEUA 3QOFA 1T3LA 2QUZA 1RRCA 3DHWC 1R4AA 1TQ4A 4NCKA 2N1BA 4PHHA 1W4AA 4HLUC 3CR7A 3U6BA 3HR7A 3TH5A 4Q4HB 2PJRA 1IN7A 2QMEA 3KXIA 4XOIA 1J7KA 1G8HA 2HT6A 1CS4C 4M1KA 4ZCIA 4BGDA 1IN5A 1H8HA 3ADDA 1KY3A 2NMVA 3GLHB 5HZKA 1XJ0A 1T5IA 4P0TA 1GUAA 4DCVA 4KV9A 3NEYA 5JS8A 3FHTA 5C1BA 2NO1A 2PL3A 2XSZD 1KYIA 2OXCA 4NPHA 4OHWA 2F43B 1G8PA 3UG7A 1ZW6A 1X3SA 3VNUA 1CJMA 5ANRB 1W44A 2AD5A 4R71A 3OHMA 1NN0A 1CR1A 4MYUA 4Q1FA 1RE0A 2W6ID 5A5GA 2PEZA 4ON9A 4FN5A 4LRWA 3KXLA 4MRPA 2HJVA 1D2EA 2IYRA 1W2HA 1QVRA 2G6BA 4PAOA 4BUJA 5BW8A 1E2PA 4WZBE 3NHAA 4LX0A 4M2LA 4X8HA 4F4IA 3QJYA 1FNNA 1QHHB 2QP4A 3K53A 3MMPA 4TYPA 3DMNA 1E99A 3KKPA 2H8KA 4TLBA 4PPGA 2A78A 4DHEA 2VTKA 4DSNA 3MFYA 1QHGA 4NL4H 2VP9A 4B71A 2J9RA 3I3SR 4QOSA 2XGJA 2I3BA 4Y0AA 5AJVB 2W6JD 5JWHA 5FH9A 4LBYA 3ETLA 4XSHA 3TSOA 1M74A 1TUIA 3KFVA 2XZLA 3WHLA 5EE9A 4DLXA 4Q9IA 4AY2A 4ERNA 2YZ2A 1G3IA 2R65A 4CEIA 2CL6X 5CJPA 2J0VA 4UXJA 4DLWA 5M04A 3ZYCA 4RD4A 3WYFA 2IL1A 3A36A 2VEDA 2W6IA 4Q02A 4C0HA 1FW6A 1SKQA 2YWHA 3GLIE 1W36C 2KJQA 1IN6A 3HDTA 1D2MA 3I61A 3BORA 2OCAA 4ZDIA 1Q1QA 2ZYUX 2WMOB 2YNMA 1KMHB 1KMHA 4IDQA 4U00A 4MQBA 4B32A 4AYWA 5LDDC 3KKQA 4QBHA 4DWJA 2QP9X 3UMSA 1Z6AA 3BK7A 4F91B 4GZMA 1X8LA 2A5JA 3LQRA 2DWQA 3ZGXA 4NH0A 4IVPA 2CNWD 2WKPA 2OFXA 2PT7A 2Q3HA 3SYKA 2NO9A 3QF4A 4Q1CA 1ONBA 5D3MA 3DZDA 4A9AA 4IDPA 3EIEA 2IF2A 1G20E 2IYZA 1E2JA 3GJ6A 4X8OA 2IS4A 1JXOA 2XZPA 2KE5A 3BH7A 4LYHA 1COWD 3HYRA 1F5NA 4GRAA 3UPUA 2VPPA 4TMXA 4AKHA 2WWGA 4POAA 4LHYA 1A7JA 1NIJA 2FSIA 4LBWA 1NG9A 1CJTC 2QMUA 4CT4B 2GBLC 4QJ5A 2CE2X 2V54A 1II0A 3NVAA 1OKKA 3PUZA 3QSYA 4WA7A 2R6DA 3AB3A 2OBMA 2HCBA 2Q6TA 4OHXA 5GVSA 4EPXA 4EQ6B 3IIMA 1VG8A 4JLKA 1ESMA 4FXPA 4YC7A 2C77A 2HXSA 3OEHA 3PUVA 4LI0A 2IXGA 2FGKA 1E6CA 4DLYA 2JASA 4PC7A 4PZYA 5LB4A 1QHHA 2JGNA 2QE7A 4LUCA 3VTKA 5IHPA 5FUYA 2AWOA 4M21A 5DN6D 2RGXA 4C0BA 4IXMA 4KLZA 3A1UA 1T3SA 3TR0A 1GRQA 2H57A 1LFDB 1BO6A 2JJ2D 3K9HA 3EZ7A 3AUYA 2V9PA 1MRNA 2F1HA 3L0SA 5AJYA 3SJAA 1MRSA 1P75A 2NO0A 3IBGA 3K8YA 3RABA 4DVGA 4E09A 3W6NA 3HR8A 1J99A 2QT1A 4PFSA 3TW8B 4OQNA 1N6RA 4HUQA 1Q0UA 2AKYA 1P2VA 1FP7A 3KKNA 3CR8A 2DPXA 1P2UA 3QEOA 1SHKA 2D2EA 1NVVQ 2AD1A 1E9EA 2RGDA 4M22A 1E9AA 5L8VA 3A58B 3QUSA 2OLKA 3VKGA 1SXJB 5KYKA 3OEED 1TF7A 2P5SA 4K81B 1KI7A 4MDEA 4CEJA 3VQTA 2ZE8A 2OBLA 1LF5A 4RD3A 1Z6TA 2JLUA 1XB2A 3FFAA 3PUYA 3UIEA 4N3NA 1IHUA 3ZQ6A 2JA1A 2XJ4A 4JVMA 5AWFC 4RZXA 2KB0A 1AM4D 3Q85A 4DDWA 1PV4A 2WM9B 1AQUA 2EFDB 5FUWA 5FR1A 4ZDKA 3B85A 1F2UB 3ZS9A 1M8PA 2ZRPA 1T91A 1EFHA 4ZCLA 4Q4LA 1LY1A 4HI0E 1HQYE 4CRWB 3MAAC 4P31A 4HLCA 2O0JA 4AK9A 4JYBA 1HE8B 3K0AB 1EFUA 2WVJA 1P4SA 2BKUA 2NTYC 1II9A 2F1RA 4DUGA 4TYWA 2XITA 1OXXK 1ZYUA 4B44A 4BFWA 3R7WA 3Q72A 3AVTA 5BYKA 4UXIA 1JJ7A 1CIPA 5FBRB 1E1QD 3GLGE 4AI6A 2JEOA 4LHWA 1ZNXA 3B5JA 1RW4A 4LOAA 2XAUA 2OM2A 1S2MA 3B6EA 4HUQB 3LW7A 1YE8A 2H1LA 4LJ9A 2ZSDA 5J5CA 4ZCMA 1N5LA 4JT4A 3T1VA 4OK5A 1E79A 1JR3D 3FKSD 1DAFA 3KFXA 1SVLA 4IEEA 3CUEF 3NDPA 2OESA 2QROA 2BEKA 4DB4A 1JECA 1WP9A 1QDEA 2E1RA 3UWKA 2X8AA 1S96A 3LBIA 3UATA 4M1WA 4AKEA 3RS0A 3SBDA 4BFUA 1G3UA 1BKDR 3T06B 1RJ9A 5DI9A 3X1DA 3U61B 2CJWA 4FMCF 4KFUA 1UKVY 2ORIA 1EFTA 2F3TA 2WAYA 2O8EB 1XJQA 1CRQA 4JLVA 5CYOA 1NBMD 2OV2A 4LK2A 2ZEJA 2QORA 1AZTA 2ZR7A 5H1YA 1ZD1A 1F60A 3CRQA 2GK7A 3QQ5A 1LB1B 4PPQA 3NG1A 4QC2A 3Q7QA 3KB2A 1MO4A 1WCV1 5J47A 2SHKA 1G5TA 3PXGA 3GLIA 2QGNA 4D25A 5F98A 1BIFA 1VCNA 2ZAMA 2PJZA 5EXTA 4B35A 4HDOB 2IW3A 2QENA 2XOKA 3DOFA 2WWIA 4KJZA 3VR4A 4B2PA 2YC2C 1AS2A 4NZYA 4PQYA 2GTPA 3TK1A 1NG1A 3RS5A 5KPDA 4Q7MB 3NHBA 4J0QA 2H5EA 1RRFA 2PMKA 3NEJA 2B21A 4LPKA 3A1TA 3S1AA 2DY1A 2X2FA 2GJSA 4QBIA 4A36A 3VMFA 2IHBA 2YVUA 2QU8A 1FP6A 1T0JB 3QXCA 1CULC 1G7RA 3K70D 5CIQA 2R2AA 4DLVA 5JRZA 4YDHB 1E9SA 1U90A 4LV5B 1VCIA 3CF6R 3DVLA 3IKJA 4C0QC 2RGNA 3GLIB 4CIDA 1E1RA 2ZJOA 4MGKR 3MWJA 4TLDA 1M2OB 3W3ZB 1SVOA 1UBCA 3R8CA 1GNRA 1E0JA 3QG1A 1AZSC 3RSLA 5J4VA 1P5ZB 4OHYA 1MKYA 1H8EA 1WB9A 1ZINA 1JPNA 2BBSA 4GT1A 2Q21A 2Q3FA 1RJ9B 1R0ZA 5TARA 2Z4SA 2NPFA 1SGWA 4Q5IA 4NU0A 5H70A 1IJEA 2C9OA 4CEHB 1SZPA 3AGQA 1RVDA 4DLUA 4TMZA 1W46A 2CCGA 5AUOB 4B34A 5KDOA 2GF0A 2V7QA 2FSFA 3AF2A 5DI3A 2XJ9A 5J4LA 3LLMA 1XCMA 1OIWA 1S4QA 1TEVA 4EDHA 3B1WA 3EPJA 1NSFA 2FEOA 1VMAA 3SZRA 1OB2A 1HY3A 5G41A 3GJ0A 3OAAA 1OYYA 3HU2A 4P4UA 3TJZA 2J41A 4GOJA 1NN1A 2WKQA 5GJVC 1N6NA 2GWHA 3B9QA 3OFND 4ZDJA 1J90A 1X8KA 4QHTA 3M1IA 2RGAA 3R9WA 3D8BA 1X86B 1E2GA 2ZI3A 1NRJB 5E4FA 1DO2A 3TBKA 3CNNA 5IK2D 2RKOA 4L16A 5DYGA 4JLAA 3U7HB 1FX0B 1T8TA 4QGHA 6Q21A 1MOZA 2HDNB 3CKLA 1SVKA 4A8JC 3EZ2A 2CHGA 3KQHA 3T35A 5FTKA 1JEEA 1F3OA 1G8GA 2IYYA 3ICEA 5JHHB 5E7IA 1R10A 1UEIA 4QBGB 3LLUA 2FU5C 1WBDA 2F1IA 3QBVA 1NMXA 3EPKA 3IPXA 3THYA 3PFIA 4R7ZA 3C4JA 3BJIC 1FMJA 2RGGA 4GSYA 3K09C 3I4LA 5B30A 2ZRHA 5IF9A 1NVVR 4LHVA 1US8B 2BEJA 2W0MA 1KO5A 3TMKA 2VSOA 4GPTA 3D6TB 2AHOA 2B7CA 2MSCB 4CGZA 1V5WA 1YZUA 2FSHA 4LSGA 3U2QA 4ZIRB 2YKGA 2R8RA 3R9XA 2OCBA 2DBYA 1L4UA 2ANBA 1W5TA 2IA5A 4HB3A 1T9HA 1FUKA 3K0CA 3AVPA 5EZ6B 1F2UA 2KBEA 3MG9A 3TW4A 5J4YA 4DXAA 1NN3A 3WXMA 2E9SA 1KSGA 1L8QA 3OIWA 5CIWA 2O8BA 1OW3B 1NSTA 3VU9A 1OFUX 1KI6B 1PLKA 4RFSB 1JNYA 4PO9A 1MH1A 4Q1BA 3F3YA 4UNPA 1W7AA 2PBRA 2RGEA 2VIIA 3PG5A 5AJXA 1GKYA 1E2NA 2D74A 4HAYA 4GBMA 2V3CC 3CB4A 1OPXA 1N5KA 2FX3A 4RD0A 1O87A 1GRRA 2ZRFA 3UMFA 1IXZA 3THWB 4EPVA 4U5XA 2DB3A 3H84A 3A37A 3SEAA 1XTJA 4G0NA 1Z28A 3RRMA 2BJWA 2C5LA 4DT1A 1Z07A 3FFBA 2BIFA 1DOAA 1IONA 4JLOA 1G9XA 4PSAA 4Q9LA 2NOAA 2WJYA 4JZKA 2PEYA 2ORVA 2ZI4A 3SE0A 5IDVA 4ZKDA 3NDBB 2GCNA 4XVRA 5HKKD 3DKPA 1G64A 3FMIA 5DI3B 2W83A 2ZE6A 1T5LA 2Q3MA 2G1JA 5DN6A 4ITRC 4IEIA 5C4GB 4DLTA 5TMPA 3O8CA 2DFLA 5CB6A 5GJBA 3RWMB 2IX3A 5FR2A 1ZP6A 4Y0VA 4IXNA 3QKRB 3T34A 5AUQA 4LDJA 2VP5A 2A5DA 4PHTA 5LD2C 1XF9A 2X1VA 2ZXUA 4IRUB 4AWXA 2ZS9A 5TDHA 3HP1A 3VX3A 1Z6XA 3X1YA 4DEYA 5JBQA 4KFTA 4D0NA 4EJSA 4B3CA 1CJVC 2JJ1D 3AF0A 4MKHA 3KZ1E 2D4HA 4LZZA 2ZVQX 1E69A 2CL0X 2QEQA 2GJ9A 2CHVA 3U60B 5JEDA 1AKYA 4A2WA 1ZU4A 3NC0C 4PANA 2QRNA 1GWNA 1G8YA 2JLQA 4I99A 4A8JA 3QG5A 2WPDD 4C2TA 1TTTA 4BE7B 4MUBA 2E87A 3U3OA 4DSOA 3WNCA 4D4JA 4HAXA 2ODNA 4HZUA 2OCPA 2C8VA 3CRMA 4LJ5A 4M1MA 4OHZA 1E9BA 4Q19A 4C2UA 4Q7LA 1HYQA 2REOA 1VHTA 4NBSA 2H18A 1XPUA 1C4OA 2C9CA 3B7GA 1OFTA 5F2EA 4BEBA 2WSSD 3L8YA 2WTUA 3H0KA 2ZRGA 3FGNA 4URZR 4D2IA 1M7HA 1D5CA 1GDDA 1ZM3A 2ODEA 1QHIA 2W2VA 821PA 1T8UA 3U7FB 1I4TD 3CRRA 2BMEA 3OESA 4NYMQ 3IO5A 1W1WA 1QG4A 1RRGA 1NKSA 1Z0IA 3AVQA 1I2DA 4H1UA 4ABYA 4TYQA 1E9RA 5B58C 1AA9A 4BQSA 3B1VA 1VCOA 2A30A 2FFBA 1FOEB 3UXMA 2IS6A 3WMEA 2J0UA 1ZAKA 1UDWA 4G5SA 4JLMA 1NY5A 4X8LA 4OI0A 4B3BA 4Q01A 3EG5A 1ANKA 4N1AA 5TY0A 5CM9C 3G82C 1HQCA 2J0UB 4LV8B 3SNHA 3VR2A 4A6XA
chains in the Genus database with same CATH superfamily
1DU4A 5LNK1 4JLNA 3FDJA 5G3YA 4TX1A 5TT0A 4JLUA 3C43A 3SXUB 3BRWD 2WKRA 2A0WA 4K8OA 3OMWA 1HYHA 2XEXA 4JROA 5EUCA 4KFSA 1EXNA 5KO2A 1L7RA 3OE7D 3KQLA 3M3PA 4CGYA 4AQYB 1JHPA 5IZCC 4GQIA 3QF7A 1BFDA 5ALSA 3RAEC 2VJPA 2A6PA 2GEVA 3MRTA 5IK2A 2NSJA 3A10A 4RE5A 4HWRA 4YREA 1KQNA 4EATA 1GQSA 1PO7A 3LUBA 5JCOA 1ZGZA 2D1QA 1XR3A 2H07A 2YY5A 4AKIA 1VPDA 2QT9A 3QMMA 4X3PA 1HMYA 4HATA 4C4AA 1QIGA 2IPLA 3HADA 4JOQA 4RZ2A 1RPJA 3VNSA 1C4KA 3WTCA 5B7NA 2PFSA 1WETA 1M2VA 2YWCA 4UFPA 1H6BA 1U7ZA 3KQPA 3LC0A 5GONF 3I9MA 1KDZA 1TO2E 3U6KA 3G9XA 4G5OA 2DBVO 2O9JA 1SCUB 1CV2A 3AH8A 4JFRA 4E4TA 2R6HA 3LY8A 1U0FA 2I3DA 1XDWA 3OZXA 4LGMA 4FKBA 3AW8A 2NU8A 4BRZA 5JC8A 3CEAA 3HN6A 2YOFA 3U1TA 3W7VA 1TB4A 3RTGA 2JGMA 2VO1A 5KTPA 2P5YA 3TGLA 2B7BA 2ZBPA 2ZWAA 5JARA 2YS7A 221PA 2GESA 3CNLA 1QDLB 3SDSA 2XKKA 2PO7A 2QPOA 2DHRA 4Q9NA 1JGTA 3PJDA 5D86A 4I1SA 4DL9A 1N2EA 1R66A 2QRHA 1KI8A 4EKNB 4AQ7A 2OOKA 4FDMA 3HUTA 1FUUA 1DAHA 1OT5A 4ZEVA 1EGHA 3GVIA 5EWJA 2Q2VA 2C7BA 2C58A 4JGIA 3TLYA 1DADA 5K09A 2I7VA 4IZ6A 5DX1A 3S0JA 1G8SA 2IGBA 3DZBA 2O8DA 5CNKA 1RHQA 4RD2A 2IS2A 3RV3A 3FGPA 2OXRA 3H4MA 3OU2A 4C7KA 5CEJA 1VTKA 2RIRA 4IM7A 2FX5A 4HRAA 1NQTA 3CJRA 3U3RA 1TZ2A 2IH5A 3E05A 4OREX 2O8NA 3P2OA 1DARA 1I6KA 4QYMA 1XZDA 2LE0A 3UK2A 1OI3A 4Y9DA 1CCWA 1ZN2A 3D0QA 3T7DA 4CKCA 4ZCRA 1LNZA 1TRHA 3EXHB 3INNA 1R4ZA 2IXAA 4KGZA 4O4HF 5LCXA 1XVIA 3C7KA 1Y8AA 3E9DA 4J2TA 2O54A 4E2ZA 3LM8A 1S2NA 8MHTA 3HGQA 1QGZA 2ZI6A 3PHJA 4OQXA 2B6NA 2HK8A 1EE2A 2QAGB 4U02A 3WLTA 2Y1EA 4O5AA 1Y6QA 1YRLA 4ZOEA 1AZLA 1Y9JA 5KMGB 1B0AA 1ZWKA 2H52A 2OILA 2Y67A 5HIMA 1JLSA 1KJ9A 4GLBA 2QKYA 5E2IA 3QE2A 3VRHA 2B30A 1IBMB 1QHNA 2NTVA 2V7EA 1G19A 1T0IA 2GPWA 4EG3A 5HNKA 3KL2A 1J8QA 1NUAA 2P6PA 2I34A 4OOEA 4IHAA 4R9SA 1VHJA 3OLYA 3R20A 3NR2A 4GR5A 5P8WA 1PHRA 5JW6A 1NTOA 3TD9A 1SKYB 2EYQA 4FM9A 3ANLA 3B3AA 2V1XA 2YUTA 4YXWA 3E22B 1UDXA 3AEUA 1E3IA 2GM9A 3E70C 5ESXA 1J6UA 3I5YA 2POCA 1XP5A 1PX0A 4L72A 3G5MA 3JTEA 4AF7A 3GLGB 2V1UA 3FSRA 2P6NA 1N1MA 2VDJA 3FROA 2VEOA 4OB6A 4QX6A 3WZMA 1GIAA 1BVYF 1EVZA 1GA6A 1MJFA 2FF5A 3BFKA 2ZANA 2P9EA 2VKTA 3O03A 4KO2S 5F2KA 4DR7B 5DCWA 4YRZA 2ZGVA 1N4DA 3MA0A 1KSHA 3AJEA 1YR2A 3CZCA 2VDRB 5DMHA 4FB4A 1KDPA 2EZ8A 3OQOA 4AS1A 1CQXA 1CY8A 4TMTA 3VYTB 5K6RA 1NV9A 3O1HB 3UK6A 1I4OA 1KTIA 2GD2A 5ER9A 2EW8A 3ZCVA 4YP0A 2XXJA 1GG9A 4DZTA 2BLNA 2WP8J 2JCVA 3A6KA 4Q4CA 1X15A 1WLSA 2AC4A 3ETEA 3HKBB 2MYUA 2EF0A 4JD5A 3RQSA 3LGSA 4I9NA 3WADA 3ZK7A 1Z5PA 4W1SA 3TVYA 2O3RA 3TR6A 4LRQA 2JLXA 5JJKA 2V9ZA 2ZIUB 2L2QA 4MRNA 1Y6GA 5L3RA 1NU6A 1ZBDA 1P73A 1PR0A 2COKA 1PEAA 4CHGA 4YI5A 1KXJA 3F7TA 3RRXA 4RD1A 2AG5A 3PR2B 4F46A 1Y8ZA 3G9TA 3WZLA 1OU0A 2QNRA 3D3WB 4REMA 4TMWA 2O7NA 2BMJA 3GA5A 4FLFA 1R0SA 2IZOA 4PM4A 5HUQA 1LS6A 1IOVA 1VHDA 1SVMA 4XVUA 4DCUA 3JALB 2SCUA 1PJTA 3H7AA 3RAJA 5FFFA 2ZJYA 4YMWA 1TQ6A 2BCEA 2FSUA 2YYZA 3AO0B 5JZMA 5F9HA 3LK7A 2GCPA 3UJ7A 4Z54A 1N0UA 3LWZA 3RBVA 4E11A 2IP4A 3D81A 4NDAA 5G53C 4UU0A 5MFZA 1ONOA 2AIRA 2GPBA 5FA6A 4BFLA 5CFLA 3OICA 3BM5A 4EPWA 3R6GA 4KHZA 1ONSA 3W2HA 3VI4B 2JBWA 4DIBA 1GPH1 2YXNA 1CUHA 3Q3JB 2IODA 4MQUA 5AW4A 2OEPA 1YFLA 5MGNA 4AUNA 3E81A 1HEIA 1NF2A 1AKQA 3RRJA 4BEVA 1DFHA 3FLMA 3G2HA 3KHTA 1YHNA 3QMPA 4IR7A 4WN9B 5DTIA 4PTLA 4PRLA 1X87A 3OPQA 2MMGA 3KZOA 1VMKA 1LU9A 5J1TB 3T61A 2J0EA 5CGZA 2JI7A 3REQB 4CLOA 4KWEA 2HU5A 4FUTA 4PLHA 4LYJA 4BLOA 2RHCA 1QQ6A 1RACA 4IFBA 4M8IA 4N9QA 5C46F 1WV0A 4JXZA 1KYVA 2I6GA 3AR5A 4TQUS 5HK8A 1C0IA 3TD2A 4DSZA 3HFRA 3UBTA 2AFIB 1V2GA 3SQMA 2B92A 1Z15A 1G8KA 3CZMA 4Z51A 1X39A 2EBWA 2YIMA 1O97C 3AGPA 4MV9A 1U0EA 3W3AA 3VDXA 3SU8A 1LS1A 3VZBA 4E32A 5A4AA 4QG3A 5K99A 1VKNA 1RJEA 2JIMA 3TCXB 4B6FA 3GLFE 3ABSB 3EBOA 2JLYA 3EAFA 1N5DA 3A8TA 2ZBUA 2QW1A 4Q4AB 5G40A 1YBHA 1SVNA 3QM1A 2YWRA 2F3UA 1CT9A 3ASZA 3ADOA 3V97A 3DV9A 7REQA 5JMTA 1SVWA 2I4IA 2HA3A 5BSRA 4FE3A 5UKDA 4RBNA 1CERA 3DWEX 3JPWA 3P4XA 1T0BA 1YS4A 1N9ZA 1ZBQA 1JJVA 3KQVA 2YWXA 4M1OA 3WWZA 3ZDDA 3HXMA 5C4MA 3H5IA 3ZWXA 4RYDA 3HCPA 4U8HA 5DASA 1ZR2A 5L7TA 1H9AA 1QYWA 4PRKA 4WZZA 2WYUA 2H17A 4TV8B 4FS8A 5JNWA 3H6HA 1OFIA 3LOUA 3I52A 1C4XA 4ETWA 1XZPA 1BOFA 2C9BA 4H6VA 2IZ6A 1SHTX 4FFVA 4QLBA 4TL9A 4NBLA 1E3DA 2ZM5A 3PPWA 1ESNA 3NBZC 1E1MA 3AQIA 4Q15A 5LWHA 3CGWA 1XD8A 2AX3A 2I4LA 3AF3A 1VFPA 2F9FA 2FSVC 1EX1A 1X1DA 3EGXA 1G0NA 4Y1FA 5HMLA 1X7YA 2O3JA 2P2NA 4NXMB 4LGCA 1E59A 5IUKC 3MOGA 2VT3A 3DL2A 3RFTA 2FWRA 5BSEA 1QIKA 4DEXA 3ITKA 1Y89A 1MC8A 3PGA1 3HRKA 4C5CA 5DPMA 2BFOA 4I9GA 3CUYA 4EW2A 1X1TA 4V39A 3U40A 1KJZA 5C4IA 4WNYA 1GAEO 5E0KB 3LH5A 4FNMA 5TQ0B 1M34B 1JBQA 2B8WA 5D85A 4BFTA 2Z56A 3CLRC 1XYYA 3BXFA 3TQSA 3THWA 3USCS 4G07A 5DHFA 3SFTA 3MWYW 3VFDA 2Y99A 3AEUB 4Z8XA 2YJ5A 1V41E 3KZVA 4F11A 3DHVA 1MO5A 1NW4A 3CCFA 2CFOA 2MMCA 3JZDA 1OOEA 1IEVA 2AJBA 3R44A 3VOTA 3TLAA 3KS9A 4KBFA 1GUYA 1O9HA 3PGJA 5EYPA 1ZEJA 3M49A 4G3XA 4GE3A 1XMJA 5T3UA 4DLSA 5AVSA 2Y1OA 3IMFA 1DAPA 3QE0A 1AUVA 2C2OA 3FUCA 4C7OA 5B2EA 4RLQA 3GRUA 4CUJA 2PG3A 1C3XA 2HQ1A 4TTRA 2WD8A 1DMRA 2QRQA 4C0SA 5A5VA 4YLYA 2O5CA 2NIPA 2PBFA 3FDXA 1SKMA 3ONDA 2ZIGA 1Q21A 1CS0B 2PUGA 3EIFA 4UW9A 2WJZB 4W7HA 2BAGA 2NZVG 2A5YB 5TXGA 3UAWA 4NWIA 4I1IA 2VSNA 1EFRD 3BIWA 2V7BA 4TV8F 1DKQA 4RVNA 1DRJA 2VQSA 3PC8A 4OQLA 1X42A 1EUDA 2BSXA 3H65A 2ZJ4A 5FUVA 3IAFA 2AFIE 5BUQA 2V5AA 1K4MA 3F0TA 2P9GA 1L4KA 3AFIA 3AKCA 1Z0AA 2XWJI 2CKMA 2GWRA 3C16C 4GZ3A 1AKWA 1Z7GA 5JD5A 1P2GA 4IX9A 5EGSA 4IMPA 1DUVG 5IJWA 3N07A 4N7BA 3MB8A 3UJAA 1Y0BA 1SD2A 3BK1A 5E6SB 2EX4A 2NO7A 2ZSIA 3V3TA 2HHAA 3O8OA 2UYGA 5FCDA 5KNDH 2AOVA 4PZZA 2W9XA 4BWFB 3SM3A 5H5JA 3C6YA 3BC1A 5LLSA 3LKVA 4LVOA 1JDPA 3QFFA 3VVCA 4B87A 2QAGC 1OHHA 1XQ9A 2PSHA 3HKDA 4BYMA 1QH0A 3TX6A 1HDIA 1EM8B 1RWPA 2ZTUA 2A58A 2ONZA 4G1BA 3PX2A 3MJCA 4WXHA 4ARZA 4KO3S 5BO5A 3T3EA 4WKOA 4ER7A 3BWXA 4EVQA 3G0HA 2F9MA 1U1GA 2FOLA 3BRCA 3OMXA 4IJ5A 4EMBA 3U44B 3RK4A 4LF6B 1G55A 1U7WA 2DUJA 2P5TB 1MA3A 4IH4A 4UTXA 4QU8A 4D9MA 3KEFA 1QQBA 2AG1A 5DOZA 4F38A 2O8FB 4Q12A 5C7IO 1I1OA 3CA8A 3OQIA 3PNLA 2XIQA 3Q3VA 5ERYA 3BQ9A 3SXJA 1EX9A 3AFOA 1QTQA 4KDEA 4ESVA 1JF8A 1R5JA 1YR7A 2X22A 3BXOA 4V3CA 5JXIA 2R68A 3AIIA 2QX9A 4N0QA 3W7BA 1DOHA 1L3CA 3OOSA 5H3LA 2JAHA 3TNYA 4X1IB 4JOCA 5AJWA 1P9WA 3N0TA 1SBZA 4N47A 4D8WA 3MJHA 2BMVA 5JR3A 4H1VA 4JU9A 3MCAA 2I2DA 5ESWA 3YASA 1P33A 3U7QB 4P80A 1QRSA 2X40A 2PS0A 3IQGX 2NO5A 1PK8A 2H00A 4WCFC 2CK3A 1RWVA 2PKQO 4Q18A 1IAVA 1XZQA 1QMGA 3K3PA 4MYRA 3WLAA 2IEIA 5EIOA 1UKZA 4Q34A 1Q12A 3JWHA 1L8LA 1P44A 1NGSA 1PWZA 4A6DA 2G9VA 3HS3A 5D51S 3D2CA 7REQB 4NPAA 4FSHA 2BE9A 2O0MA 2QRLA 3QW4B 3OQPA 3ITNA 4L9WA 4W9NA 2CV0A 2NO6A 2VWQA 1ZUNB 4MULA 3ZS8A 1MAUA 3HEBA 3OU6A 3PZBA 1FP1D 2BHTA 4X93A 2IE0A 3PYMA 5E6RA 1JEDA 1K88A 4KXNA 3RRNA 1FDOA 1Z4KA 2GB4A 4PZDA 1V8DA 4K2AA 2ISSD 5TC4A 3LBNA 4D9IA 3GLFA 1QVAA 4Q03A 1QYDA 5DTJA 1GZ3A 2J85A 3BQMB 1YL7A 4Y6QA 3KZXA 4HN4B 4JASB 4J4TA 4ZT6A 2L19A 1Q77A 1ID8A 4KGVA 4KR2A 4IP0A 4F7DA 2I2AA 3A3YA 3H2BA 5HF5A 4HVAA 2NZUG 1BD4A 5EA2A 3U0BA 5IRCD 2ZDGA 2JGDA 4CM1A 4MJ7A 1ZH8A 4BXOA 3KDSE 5L3QA 2D06A 2C78A 3IMGA 2G1UA 2AUNA 3STTA 3D43A 1A9OA 1JXMA 1SBHA 4CJXA 3H2ZA 4RVDA 2P41A 5HCNA 1BQ3A 1NVXQ 2QQ0A 2LW7A 4HKTA 1RYZA 4PAQA 1Z8NA 2PD4A 3GRYA 4H7JA 4QYSA 4P0PB 3BYZA 4DY4A 1VYVA 5ICMA 2WJWA 1LRJA 2QN6A 4C3ZA 2GF9A 4RTKA 5DSTA 4M8SA 4KTTE 1NF3A 1RI4A 2PRYA 2C07A 1C7IA 1K9VF 3DMTA 4PNZA 4PHFA 5KDLA 5JNVA 1R6VA 4WDQA 1LBQA 4C3VA 1HFKA 4U5QA 1E94E 1KSFX 3RVBA 5CDUA 5HR5A 1ATZA 3T1YB 4CG1A 1YQQA 5AK4A 1Y8QA 2P2YA 5HUHA 5JAZA 1QKJA 1X1RA 2Q28A 1DO8A 1P80A 2VN8A 4NJEA 1YI1A 3DF7A 2D8MA 3KKMA 5A9TA 4I1PA 5IJAA 3CNHA 2JDID 3CVOA 3JS5A 4NK5A 3B3FA 2W6JA 3R3XA 4YRPA 3PRHA 3T9CA 3JZMA 4S1OA 2E2WA 4ITUA 2FEMA 3DDHA 6LDHA 4L8FA 5BOSB 3KXKA 5AXCA 1KERA 4X1IA 3WLFA 3V1UA 5CH3A 1EHIA 3P2JA 1ZWLA 1L5FA 2H92A 4WN9A 2JBHA 4TN5A 4BE4A 3S3TA 3QUBA 2P6UA 3SF8B 1N34B 4FLEA 4JBWA 1KKMA 2J4FA 1RC1A 4URWR 5EHZA 3NEPX 1ZESA 1G4UR 2J7KA 3LDHA 1RZRA 2AN1A 3P19A 1I7LA 1C2TA 1WPXA 2XCUA 5F3DA 1R74A 3ZI7A 4M9UA 3K0FB 1D2GA 3I2HA 3OETA 5I9LA 3LSYA 4MDHA 2Q1UA 2PZJA 3CPJB 2WUGA 2O06A 3CG4A 3KQWA 2FOIA 2I6SA 4L4UA 4P4SB 3W5IA 3FYHA 2D4AA 4QUKA 1Q20A 2KW5A 5FBLB 1I5OA 1UPTA 5CB8A 1QQ5A 3EBPA 5BVGB 3HLKA 3I9KA 1DAEA 4N49A 3SQOA 3IKVA 1NQOA 1QQAA 4BTVA 4FWBA 3LBFA 1D2RA 4RENA 3AHEA 1CUSA 1MXHA 2BOVA 4RK4A 3ZTWA 3TLMA 4NNPA 4TZ0A 4KPYA 2V4ZA 1QGYA 1T2CA 4CODB 2CMFA 5ERGB 4JVNA 4LE1A 4P7FA 3F5FA 3PE3A 4F5WA 1B6TA 3ESDA 2ZPUA 3H1PA 4ZC8A 4J75A 4YP5A 3B5IA 2VF5X 1BEZA 2PZLA 3EXHC 3BVPA 3I8SA 4YR9A 5ES4B 3IQIX 4BWYA 3ZHZA 1NKTA 4NDNE 3S8YA 4H6PA 1ZGAA 2MINA 2JIRA 3FNRA 1Y1RA 2QTZA 2VHQA 1TT7A 1OIXA 3CU5A 2XUOA 1JAXA 1GTSA 4P34A 2GCEA 3C24A 2A7XA 1TQ2A 5LOVA 4ZYXA 4L4YA 4AAYA 3OIGA 4EY8A 1U6JA 3T9AA 3LYUA 2A0UA 2IOYA 4R2IA 1EA7A 2G9RA 2CMDA 5E2BA 2IXFA 3TBHA 3TNDA 1GKKA 2B99A 4BNYA 1LH0A 1USVA 2OZEA 5FOSA 4CG0A 4PS1A 4C6RA 4EZEA 1KE2A 2AWNA 3OZWA 1M1XB 3QJ5A 3NHMA 1ZGBA 5J4VA 1M2JA 2HLHA 4ASUD 3KKKA 1AJEA 1G63A 2UU9B 1RQ2A 2E4XA 1ZHOA 2VLIA 3MTBA 4XWAA 2Q1WA 3UQZA 1G2IA 1LW7A 2OMKA 1VMDA 3G0IA 4XPIA 5I7WA 1Z6ZA 3WA6A 1YMUA 4IL5A 1LDMA 4KLRA 3LLCA 3Q12A 4MV6A 2ECFA 2CMKA 3CSDA 5DW0A 2IIPA 1ZM4A 2WTBA 3IQZA 4W7SA 5IU6A 4B75A 4A15A 1B7GO 3B5EA 3ETHA 1JIXA 2OORC 3EPLA 3OTWA 5LZ2A 3ESXA 4DMLA 2WIJA 3UAZA 2Y77A 3NGMA 1K6MA 3ZI4A 1ZM9A 4LXQA 4M0LA 3B1KA 4NULA 4XB6B 4AJIA 3LVQE 1GKUB 1OFHA 4TSFD 5HP4A 2X0NA 2VK8A 5D3KA 3E3MA 1U63A 3KU4A 3NZEA 2VZLA 4TQ9A 4RM3A 1YULA 4IJMA 3W8NA 2AH5A 3DEFA 4DLKA 5AW7A 4RV4A 2FDCA 2ZXFA 1ZS9A 3DJYA 3EHDA 4D9BA 2PV7A 2WF7A 3IHKA 4KN6A 5DSZA 5ILGA 3BF8A 1GQFA 1LTKA 2BP7B 2F8SA 1RBMA 1NJGA 3IEVA 5CB4B 1G7TA 4NCXA 3D6VA 1DBQA 3FR7A 4R0VA 1KMQA 1LSUA 1N2SA 1ZIPA 4LHXA 4GWGA 2QWXA 4I36A 3VAYA 3CRW1 3H2JA 1RKQA 4RU1A 4PXSA 4B6OA 1QOPB 5IAJA 2JHAA 5DE3A 2O48X 2X1HA 2PQ2A 2ZRKA 2D0IA 2L42A 2HQOA 4U4AA 5GWXA 2AN9A 1B8PA 2BN4A 5C0OE 4KIJA 5CT6A 1W5SA 1S1CA 3AEZA 2WVHA 3E7FA 3KC2A 2M6KA 4D3FA 3ZHYA 1ICEA 2P3LA 3B1FA 3DE6X 4LYAA 5DOVA 5ERXA 4ZKEA 4E7PA 1S0UA 2I33A 1QPGA 4MW5A 3F67A 5B4TA 2ORED 4D0SA 3H5RA 3EHEA 4WFQA 5BN5B 1OX4A 1R0CA 4QBFA 5E1OA 1OTXA 2GO1A 3KO8A 4JQZA 2CLLB 5B1SA 4E5DA 5IFLA 1B23P 3CKMA 1C1YA 5A5DA 1HO3A 5HE8A 2CJPA 3D8SA 4XZ3A 3SC3A 1D8AA 2B5OA 3QH4A 3T7IA 1IBRA 5DGIA 4LY3A 3RW9A 3A2NA 2W93A 2G88A 2F9LA 3V4FA 2V6IA 4KHPB 2ECQA 1KRXA 4B46A 3RVLA 2LCFA 4XX0A 4D43A 3KYDB 1ZGJA 5ALYA 4H0FA 5D1HA 3B8HA 1CR0A 1V35A 2HGZA 2VP4A 3P9ZA 1R8QA 1C1HA 4KXXA 1AK2A 4P3OA 4CKWB 4PIMA 1G6OA 4Z9BA 2JJ8A 3V1KA 4MUYA 1RKBA 3PEEA 1KZGB 1THTA 1PWEA 2IEYA 1HSZA 4TT3A 1KJYA 1M6YA 1GPMA 1REQB 4QTXA 4UDXX 5ALKA 3W9BA 1K4YA 4S0XA 4DPLA 1N9KA 5FBHA 2YUIA 3SPXA 1F8XA 4C08A 2FPLA 4G4SP 2GBIA 2Z2KA 2ZTMA 4OYRA 4PYMA 4LQLA 1ZN9A 1B2LA 2WG2A 2JLRA 4X91A 3ZD8A 5ALVA 1JV2B 3VR3D 3D6UA 3QKIA 4FMDB 4MLDA 1RS0A 4RGBA 4Q3BA 5FOWA 4YRMA 2FF7A 3I2YX 4ZT2A 1N5IA 1TAQA 5G1OA 1CIJA 4B6PA 4QDOA 3PR1A 2Q07A 5AI8A 2PSJA 3V4SA 4DREA 4DQXA 4WHMA 3TRFA 1W19A 3HWRA 5EUQB 3DGEC 5FUXA 4AJEA 3R5JA 5F9MA 1GPNA 1OASA 2WWYA 1Z6GA 1NA5A 3GELA 3LMKA 1OBOA 1JQ3A 4OQFA 5H80A 3SYLA 3BRWA 1V7CA 5HIKA 3ICQB 3IILA 2R751 2VUHB 4INJA 2OBFA 1PAUA 1U7PA 4PWZA 2K6GA 1G3QA 3LPMA 4RK1A 5CPBA 4JP8A 4ADSG 4R4JA 3SLRA 2FPGB 4AZ3B 2UZIR 1RAFA 3AQ4A 4C7JA 1JAIA 3PYLA 3QBDA 3R0QA 5DHSA 4EM6A 5CFPA 2L18A 1FNBA 1QE3A 1VM6A 2GZAA 4AW9A 4M0FA 3ZW7A 5I6DA 2GK4A 3S1AB 4JKOA 4RK6A 5JZVA 1FQWA 3B13B 5IKXA 1XDZA 2QTHA 5BNTA 4KB5A 2IHVA 4MXDA 1Z36A 3KEGA 4Q7JB 3UGJA 1VYTA 4MAAA 2I54A 1W6UA 2ZRCA 5FPQA 5LDGA 4EUSA 3LUKA 3N7TA 2WU4A 1GNLA 1RDFA 3U48A 5D5PA 3GNTA 4QOJA 4TVOA 3KTDA 4X7PA 4ALJA 1UPXA 4OUDA 5EE1A 3DOJA 3T4PA 5IW8A 1GTG1 1SUPA 3SOZA 4HTFB 1FYFA 2Q3JA 2QI9C 2ZUCA 4MUGA 5AW6A 1XROA 1CVIA 1DHRA 1Y3FE 1ZUNA 4XEHA 3RUPA 4ZQHA 1X19A 1A9XA 5THXA 3N2EA 2X9LA 5DK6A 2HT1A 1NFFA 2VRNA 4DJEC 2WIGA 1ENZA 3PUXA 3WK8A 3N86A 2ZYIA 2RKWA 4FCCA 3MWLA 2J5RA 4JIMA 2I87A 5CLLA 1BWSA 5KKCA 5M34A 2XODA 3IRVA 3E7WA 4EKIA 1TF5A 5A0FA 5T4EA 4PHGA 1NBHA 4ARVA 3ANMA 4FX2A 4QULA 4WGFA 1WBBA 2X8JA 1G5HA 1PNTA 3BMQB 1EUYA 3TXXA 1JW9B 2ATCA 3UMVA 1G6HA 1CETA 2BHSA 4P35A 4MJXA 1OI4A 3KOXA 1MG5A 5LVAA 2Q3CA 4AZVA 3DMHA 1LRKA 1MNAA 1BMFA 2QIOA 1DTSA 1E20A 2Q6LA 3IELA 4F93B 4CQJA 3G1UA 4GSLA 3A0UA 3L8EA 1L7EA 4ZREA 3ILXA 3I0NA 3UXYA 2XNHA 1F6WA 2H4HA 2Q9BA 2XUJA 2OPHA 3QPWA 1F38A 1KRHA 2R79A 1NHGA 1UJBA 2RHMA 3BD8A 5FA5A 4JLDA 1UAGA 4URVR 1RYHA 2OFFA 2LD4A 2M9MA 1BFUA 5TPWB 3DOEA 3ONNA 3NHSA 4PGFA 4PLZA 4CLHA 3T7RA 1YDMA 1TW2A 3DTVB 5CA1B 2Z09A 4ZYTA 3CVVA 4DR5B 4IF4A 1ODKA 3GVXA 1Z0JA 3RYIB 2Z0MA 4XB2A 4I9FA 3E2PA 1E2FA 1ZI8A 5AHXA 5HZMA 1JT9A 3T99A 1CIVA 1NLMA 5M29A 3DHNA 4JJZA 2O52A 3KB6A 4WUTA 2QMQA 3KL4A 3OFKA 2B9EA 2RE8A 1BDHA 2HGSA 4JQSA 1E6KA 2X4GA 1YBAA 5EESA 5FPHA 3MT9A 5B1IA 4XYLA 3IUMA 3PQ8A 2ID4A 2A1TS 3VI3B 2OPBA 2RK4A 2PX8A 4MJ3A 3I09A 5CVVA 4G1FA 2YRWA 4JLBA 3JQBC 4NY1A 5JT1A 1SG0A 3CX7A 3L7CA 4CLEA 4RKQA 4Q4JA 2I99A 3QWIA 3KR1A 4O59O 1XNQB 3EEQA 3GNSA 5HS4A 3HVIA 4MCJA 1U9IC 4XWOA 2O4CA 1RQGA 5KOIA 2AX4A 4HR7A 4BTLA 2JHCA 2OFWA 5H7XA 1TPYA 2ZYVX 1H1TA 4LQDA 4DMMA 1U3GA 2BEWA 2WD9A 2XMZA 1NY6A 1J06A 3NHKA 1UDBA 1DJQA 2JK0A 1RXIA 4KR0A 4HWKA 1M66A 4D9JA 4LF5B 2FPIA 2GEUA 2O8VA 4FI3F 2XH8A 4F3YA 1I2BA 1Z17A 4JL6A 4ZOLA 1HXHA 1P39A 1X9GA 2E4VA 2R84A 4U9HS 1PT7A 3RNOA 5KNDA 6ADHA 3C7CB 5I7SA 4ZEXA 3R8FA 2UV8A 1ABEA 1WMFA 2FP4A 3SDZA 2WE8A 2JFZA 2YVQA 3N3BC 2AC7A 1L4HA 4AWAA 1XN1A 1J0EA 4OA8A 1EAMA 4X95A 3MRXA 1BKYA 1R8JA 1ZOOA 2PRKA 2BV3A 2X3YA 2RHHA 2XBLA 2H1IA 4AX4A 1XJWA 3GCGA 2C42A 4X61A 1FFWA 3MT0A 1IMJA 1UWVA 4Q47A 4M9ZA 1JSCA 2G1AA 4WVLA 4OTZA 5L7YA 3UV7A 2ZRAA 3GFTA 3QU9A 1JB1A 3SS7X 2VZ8A 5BVHB 2DCMA 1QVWA 3A1DA 3ASUA 3NIWA 1OXTA 3O4VA 1MAWA 4MS4B 1AS3A 5B7GA 1C50A 2Z8ZA 1G66A 3U56A 3MELA 1B26A 1BJRE 3G9QA 2D2FA 4FVTA 4NVRA 1U9JA 3HCRA 3SEZA 3C5CA 2B4AA 4JVOA 4LZOA 5I9NA 4JB0A 3EUWA 4HNHA 3RANA 5BSFA 2H63A 5HJEA 4LZNA 1UWKA 1POXA 3ZJTA 1VSBA 2XQJA 4MARA 2FZVA 2CCJA 3BJRA 3BTSA 2BFEA 1SD1A 2WAOA 3MCZA 1NQWA 3NJRA 3AEQA 4D8TA 1DGQA 3NLLA 3R0JA 4FJ1A 4FZRA 4IEFB 4JX9A 4XUCA 3VZCA 1C0EA 3F8TA 4CV0A 4J9VA 4LOIA 2ZKIA 3UOWA 4C2AA 5DULA 3SOPA 3EDMA 9GPBA 1JHXA 1CSEE 4DCOA 5KCZA 4XSGA 3HV2A 2REQB 5JAHA 2DQYA 1GZVA 1R5NA 1VPEA 2C3MA 2JDIA 4L5IA 1UEXC 4OBWA 5NULA 3RVKA 4XKJA 1I2ZA 1KJQA 3I73A 1OAAA 1UBSB 1WPQA 2NZ2A 2R2GA 3AB7A 3EZFA 1HLPA 1I4EB 3DXFA 1XJ5A 2OAQ1 1D2CA 4IVQA 2PTHA 4LJ4A 3L5OA 5FUQA 3GT7A 4XD7A 3NXKA 2PIDA 1PU2A 3AI3A 2C9YA 4FBMA 1G21E 2XCIA 1IHXA 2DPGA 1PK9A 4W1PA 1C8VB 1ND5A 3FMGA 1U2PA 4FW9A 5TQJA 4ZJPA 5L7WA 2VLBA 3ZD6A 1EDOA 3QVGB 5TQ2B 3ASYA 2QMOA 1JIJA 4RJIA 1KEKA 2I3AA 4Y2TA 4YJ3B 1DAGA 1Y8QB 2GLUA 1WF3A 1Z18A 3T4UA 4I0WB 1H4QA 5JDIC 4HNQA 1E4EA 1HTWA 2W6CX 1CUBA 4RF4A 5C8YA 3QGMA 4DDKA 2IY8A 3Q9UA 5CFRA 1TTPB 1RWOA 1ZIOA 5KNCA 4L0DA 3VUFA 2X0IA 4YCMA 1ZCBA 2EKLA 1LBHA 1CWUA 2WE7A 3P94A 5EP4A 1F0YA 1S9DA 2C94A 1HC7A 1UFRA 1G8FA 4MGIR 1NUQA 1WPRA 2A33A 2X9GA 1POWA 2Y6UA 4UDNA 1ZUIA 3ED1A 4Z3KA 4Z4CA 3D7LA 5AW8A 3GMSA 4I7EA 1AQ6A 1PD0A 5L3SB 2VR1A 2I4MA 3ZOKA 3MJVA 1WZEA 4A1OA 3G5UA 4OAOA 5JSUA 1YRHA 4R9UC 3D4BA 2ZYGA 2EYUA 3MTAA 4UJ3A 4J43A 3ZHVA 4BFZA 3W9SA 1IN8A 3P2EA 4YMSA 4KODA 1OWMA 2OHGA 4W8OA 5IDWA 4D02A 1GSHA 2DWPA 3KSAC 1FJXA 4CCYA 1Q95A 2D3WA 2QBYB 1X0XA 2OY0A 1II8B 4BLWA 4D9GA 5DRYA 4W5RA 2UYOA 1L5YA 3G68A 1SUIA 2IHYA 5ALDA 2XUIA 1DIHA 2D00A 3NP7A 4BX0A 1K7XB 1OTHA 1FTYA 3I5AA 2PNJA 5DBHX 3T15A 3U4CA 4GIBA 4I5DA 1BZYA 5H02A 1GGKA 2GBLA 4HH3C 4D56A 5JAQA 2IUEA 2YV2A 1KPGA 2O8CB 1EFRA 1N2ZA 5U4XA 3TEFA 2QMHA 5LP6C 5KINB 5D00A 1V7PC 3RSSA 4BQNA 5FI3A 2C7OA 2OGZA 4BBPA 3AI1A 3OM0A 2XPCA 5ED4A 4OXIA 4KRXA 4NH4A 3WJ1A 2H9IA 3TKAA 3VOAA 4RK0A 2ACWA 3FWZA 3PPIA 4COOA 1FL9A 3VZSA 1XTSA 3PZRA 3KLBA 2OMEA 4C6TA 1DAIA 4HN9A 1V8PA 1YQ9A 4G4SO 4EHNA 1VIMA 4MQLA 3QU7A 5DLYA 1OH8A 2GSWA 1E18A 3G9ZA 1DKLA 3OQMA 1O4WA 1PGOA 2C88A 4X0EA 5AKXA 5KU1A 2WD7B 2JGRA 3VO1A 2EFGA 3T1QA 1V95A 1UMDA 1J1ZA 5F1PA 1SPBS 2I78A 3RVDA 4DJJA 3LU1A 2R7MA 3ABIA 4MOWA 5CW2A 3GJ5A 4GZLA 1SC6A 3A1VA 3S44A 3PKIA 4FYKA 1T1GA 1ZEMA 1FUIA 3KZCA 3ME5A 2C00A 4GKBA 4YRQA 5FA8A 3ZLUA 4BLRA 1QP0A 2GCOB 2MHCA 1KBOA 3K35A 4BO3A 2I67A 1AH2A 1TTHA 1RFLA 3EDRA 1E2KA 2EXXA 5KU7A 1IATA 3QIAA 3DXZA 3C15C 5C1DA 1W4LA 2QN1A 2N0SA 3L8DA 3OE7A 4H35A 5FTNA 1C2YA 2FOXA 3F7NA 3ZE6A 2HQSA 2H7VA 2VSXA 4B76A 3R7WB 2ZIXA 2P3SA 1GGMA 4BZWA 4TLAA 2FW6A 1P9LA 3ZWOA 2FW1A 3NDJA 3LFUA 2BM8A 3DE2X 2A0YA 3K6KA 1US8A 3PD1A 4MV5A 2HMUA 3KBBA 5K3CA 4UM9B 2SBTA 3D3NA 2BCJQ 3EARA 1JHAA 1H2BA 3DAOA 4W7IA 2ST1A 4G89A 1U02A 2ZR9A 3D4NA 3R5FA 4G8DA 3D4LA 4EL0A 1GU7A 4RHTA 4IFIA 2R8PA 4EUEA 3OI7A 1MA0A 1SHZA 4X6YA 4ZRMA 5BV1A 3S1SA 3I6BA 3PEYA 1YCHA 2H4YA 2BKAA 2Z2ZA 3KUCA 1UDRA 2H5JA 1YR1A 3FF1A 5KVAA 1ECBA 1XP8A 3ND9A 4DSUA 1ZVVA 3ROXA 4IKPA 1EVKA 1YS2X 1L4FA 4WTOA 1ZK1A 3UAOA 3URMA 4ZZ0A 4J3NA 4OM7A 1J0BA 2QL7A 4ZOQI 1YR8A 4XM0A 3TPZA 1WXIA 2CVPA 5G4KB 3WFJA 3QPCA 4JI0B 2H9AA 1VL1A 3U3XA 4A03A 5A3QA 3QP9A 2VCEA 4AUMA 1JB9A 5T6BA 2CXRA 1QPZA 3R9XB 1TCCA 4HHEA 2I7CA 3L6RA 1LPBB 2IH4A 3GN2A 1AHNA 1I0IA 4GE0A 2XTNA 4GOND 1VQ1A 4GRIA 1H9BA 4LBVA 2ADMA 4DANA 1YA6A 1EFCA 1NE7A 3IEIA 1U8FO 4WLVA 1K6EA 3Q7EA 1SCIA 3R3SA 4MVJP 3L7NA 3HK2A 1Z08A 1ZVJA 2GSDA 4B3TB 1J09A 5FEUA 2Y8EA 4RVGA 3DWIA 1CS0A 1PFWA 4LBZA 2WHPA 4GM4A 2GHRA 4DRYA 2P2ZA 4KNYA 4RWZA 4AKSA 3ZN2A 1KZ4A 2HV8A 3NWEA 4LOJA 1J8FA 1WY7A 1UFQA 3KVNA 4WZAA 3ND5A 1EVEA 3CH5A 4QL3A 4R1MA 5M5BA 2PL1A 2PGDA 1JMYA 4DG8A 3RSFA 1BVUA 1D09A 2AMLA 3OLCX 2WA2A 4KQHA 1EG7A 1P4RA 1QKKA 2ERYA 2JIOA 3HNRA 2JCGA 3TQCA 5DTEA 3ZCXA 3QVXA 1JJAA 3ZOZA 1KOGA 4O63O 2HY7A 2X7JA 3N39C 4XGIA 4AK9A 4DYHA 1B15A 3ELUA 4L6IA 2J59A 3PA6A 4V3BA 3SKVA 4ARAA 3VR4H 2FR8A 2I8AA 3WJ2A 4E6PA 4DNOA 1ZY2A 3OPYI 3PICA 3BMOA 1LZKA 3G5TA 4JEUA 4F5DA 4GS5A 5JANA 3JVVA 4QEDA 1A5AB 2QZ4A 2O7RA 1RQXA 2GKSA 2ZUVA 3FMFA 5KVQA 4GECA 3R74A 3RKRA 4EARA 2JVIA 4F4CA