5TB5A

Crystal structure of full-length farnesylated and methylated kras4b in complex with pde-delta (crystal form i - with partially disordered hypervariable region)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
184
structure length
172
Chain Sequence
GTEYKLVVVGAGGVGKSALTIQLIQNHFDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDKKKKSKTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of recognition of farnesylated and methylated KRAS4b by PDE delta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein
molecule keywords GTPase KRas
total genus 61
structure length 172
sequence length 184
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5tb5A00
1NVVR 3L82B 4W7SA 4Q48A 1VDZA 3CPEA 3DZ8A 1ZM2A 4JVLA 1KK0A 3BRWD 4PZYA 4XH9B 2O8BA 1G7TA 4PAMA 3FHTA 1T3SA 1UDWA 5C18A 2B7BA 1UAAA 5F3WB 2QAGB 3U44A 2QTVB 4PSAA 2A7QA 3A1UA 2CCGA 2N46A 3REFA 3RS7A 4B47A 4TYNA 2W0MA 5DYIA 1OJLA 5AJVB 1ETUA 2ZI9A 2QPTA 4ARZB 5KTYA 4DLSA 2Q21A 1KSFX 1DO2A 2ZJ8A 2ZU6A 2J7PA 4PR0A 2QGNA 2I3BA 2F43A 5LD2B 2RGGA 4ZIRA 1WMSA 721PA 2ORIA 4AK9A 1VHLA 1KJYA 2XXAA 3LVQE 1TMKA 1ZM4A 3RRYA 5L3SB 1G7SA 4NZYA 3DOEA 3CLVA 4TYPA 1OSNA 4BEJA 1NLFA 2OT3B 1KTVA 1L4UA 3J81k 1Z2CA 2IS1A 1RZ3A 5KDDA 2IS6A 4LHVA 1E4VA 3SQWA 1Z0DA 2YC2C 1KMHB 1VG8A 2FV8A 1E0AA 1M7BA 5EE5B 1JBKA 3AKCA 5KU1A 1GOTA 5K8IA 2QE7A 1E3MA 2GF0A 4PPFA 4UNQA 3P4XA 3WRXC 1G7CA 1LF5A 4QBIA 4Q4AA 1Z63A 1CKEA 1QG4A 2BOVA 3LY5A 1NP6A 1M2OB 5BXQC 1ZU5A 2RGNA 1XJQA 3PUYA 1Z6YA 3UWOA 1G8FA 3VU9A 4V0NA 3U7GA 2AR7A 4ARZA 3FDIA 1MO3A 5DSZA 1IN5A 3TSZA 1E9BA 1W46A 3KXKA 3K0CA 4JLDA 4LJAA 5EE0A 3SR0A 1CJMA 5IK2D 2GF9A 3WXMA 3THYA 3AM1A 1X8LA 3W3AA 3LWNA 1W49A 1Z47A 1Z06A 2YWGA 2VHTA 4PFSA 1UKVY 2ODBA 1JI0A 2E87A 2P5SA 1U98A 1E2KA 1OXUA 1P4SA 4LUCA 5B57C 1HQCA 1DADA 1A1VA 1KI3A 1CR2A 1CJTC 1UPTA 3VAAA 2JJ1A 2A5YB 3AVXA 1GFIA 1FQKA 2VIIA 2C8VA 4B76A 2CBZA 8OHMA 3EWAA 4DLTA 4C7OA 3T5DA 3SJBA 5JCPA 2WAXA 3Q5DA 2DCUA 3ZIAD 1Q1ZA 4B3BA 3HU3A 5L3QA 3FMFA 1AM4D 4PQFA 4OK3A 1OXXK 3PEUA 1KMQA 2G9NA 4XIGS 2H18A 3VR2A 3TVTA 3E1SA 4BLOA 4YMTA 2JLYA 2FSGA 3O47A 4UKDA 2EFEB 2ATVA 1G5RA 5ELXA 3ADKA 2RHDA 4ZDJA 4TYWA 2Q9CA 3GFPA 3QY0A 2O8BB 1Z83A 4X8OA 2D06A 3WYAA 2DY1A 4B48A 3EPKA 3ND8A 2YOHA 3CPJB 1Z0JA 1ZC3A 2OAQ1 3PUXA 1HTWA 4EPRA 2V7QA 2BV3A 2YKGA 1SHKA 4OQXA 1ANKA 4WZBE 4CEJB 1WB9A 3K9NA 1EFRD 5BW8A 1GG2A 3OEHD 2G77B 4H1VA 4HDOB 3MMPA 4CEHB 1XMSA 2R2AA 1CTQA 1W7AA 1MRSA 3IQWA 3E2IA 3K0SA 3GLHA 2VQSA 4QM7A 1KNXA 4EQ6B 2EVWX 4YC7A 3K0CC 1TQDA 4A6PA 5HKKD 2O8CA 1XMIA 3RYTC 4K46A 4X8LA 2PCJA 2X19A 5H68A 2CNWD 1BKDR 4XOIA 3G82C 4OI2A 1NVUQ 1C9KA 4RFSA 4PANA 3ZDQA 2CL6X 2OM2A 2IF0A 3FE2A 2V6JA 4JZKA 4MDFA 4V0MA 1CF4A 3A1WA 2YOGA 4E09A 4D4MA 5EXSA 1Z0IA 3ZZTA 1SZPA 4MGKR 4LSGA 3GLGA 2ZRDA 5FOWA 4CEJA 5KSOA 4C0KA 3CX8A 2XAUA 3KJGA 3ZS8A 3T1OA 4ZPXA 1CU1A 1JQJC 2PEZA 3GJXC 3TRFA 2KB0A 4ESHA 2WKPA 1P2VA 2PZGA 5HCNA 4D0LB 1TEVA 4OYHA 4JLNA 1JAHA 2ZYUX 2QRZA 3ZD7A 4TZ0A 4EPWA 3GLIB 1Y3AA 2JLZA 3S1AA 4Q47A 1NF3A 2QNRA 1DG1G 1GWNA 2Z4SA 4NYMR 3KX2A 4AKEA 1GSIA 1G4AE 1J70A 3DM9B 2NPFA 1XCGB 4POAA 1MOZA 421PA 1JR3E 4BLTA 2WWGA 1XMVA 2P65A 3LNCA 1IHUA 2FJUA 1S1CA 3TSWA 4QJ4A 4IOLA 4GZLA 5FH9A 2P6UA 3GJ5A 3KKNA 5E7MA 4BFYA 4Q19A 4JYBA 4LJ7A 4A0FA 1YZQA 3QUSA 4C0BA 2FX3A 3KFXA 4ZO4A 2ZJOA 2IYTA 3K0AA 2QGZA 3BB1A 1BS1A 5B64A 4RKEA 1SXJD 2G88A 2Q6TA 2V8OA 4JLKA 4ZDKA 1IN6A 4NYJR 1VYVA 4IDHA 4AI6A 4NMMA 4ASUD 1F2UB 3TMKA 3X2SA 5A4JA 1KO7A 1R0ZA 4LRWA 2V55B 5J4YA 2G0NA 1M7HA 1CR1A 2J7KA 1VCMA 3SEAA 4DEYA 2GVZC 5CITA 1DAHA 1T5IA 3CF0A 5C46F 2BKUA 4LJ8A 4AURA 1W4BA 4QKQA 1IONA 1Z07A 1E2IA 4DLRA 2BIFA 4I1VA 4F91B 1XD9A 3L2OB 1CJUC 3OHMA 4PTLA 2LWIA 1VIAA 1DBSA 1QHIA 3CBQA 4TYQA 2WWFA 2ZS8A 3IIMA 4HLQB 2H92A 3LXXA 1DOAA 3U3OA 1RIFA 4Q4LA 3SYKA 3TBKA 5EE3A 3U61B 3E70C 1EFTA 3LH5A 2IYUA 1E98A 1X86B 4M21A 1TQ6A 2IUTA 2PT5A 2GZDA 2H57A 1T9HA 3BERA 4MRRA 4GOJA 4PPQA 1G3MA 3GLHB 4IDOA 3IIKA 3TE6A 4HAWA 5DYGA 1RVDA 3QXXA 4TTPA 1F3OA 3X1ZA 3EZ9A 4RKFA 3PEWA 3ADCA 3KB1A 3I32A 1XEWY 3TW4A 3U3MA 1G17A 1DARA 3ZVRA 1FP6A 4JMPA 4P4SB 2HEIA 2HXYA 4P31A 2ZI5A 3ECCA 3TLXA 3QEJA 3ZLJA 3I1FA 2B7CA 5FOVA 4R2IA 2VSXA 1ZM3A 4LYJA 3LD9A 1JQLB 1X8KA 2RGDA 3SYLA 2PJZA 4KLNA 3VQTA 2ZREA 3T15A 4FWTA 1DVRA 3CR7A 4OQLA 1P9WA 2FMXA 4MUBA 4Q4JB 3GLGE 2KE5A 5FL7D 5G3YA 4BFSA 2BCJQ 5GJBA 5GJVC 1T6NA 5KSYA 5HE9A 1ELOA 2D7CA 4I81A 3TUJC 4YXWD 2X1VA 4DIDA 3BH6A 1ZYUA 1G8PA 4BLSA 4YMVA 1E99A 1JPNA 1RFLA 1N6OA 1E2FA 1Z6TA 2QROA 3UATA 2GJSA 3JVUA 4A82A 3R8FA 1YR6A 2FE4A 1WCV1 4R9UC 3AF4A 1WDTA 3SBEA 3U3KA 3U2QA 3X1YA 3ZJYA 1OKKA 5IHPA 2FOLA 4OHXA 3B1WA 4GSYA 5KPJA 1XPUA 2DR3A 2QUZA 2XJ4A 1UFQA 1UM8A 4Q66C 2PH1A 4TLCA 2IC5A 4G5OA 2YVUA 3W9YA 2RB4A 1CR0A 2XZPA 4H9GA 4BZXA 2YC4C 4DDUA 4B34A 5EE9A 1PJRA 4AWXA 2GXAA 5LBIA 3UG7A 3GLIE 1VTKA 5LB2A 1G7RA 1SHZA 2ERYA 1YQTA 2CLCX 2XNSA 1KO1A 5TARA 3THWB 4BFUA 2A5DA 4XSGA 1UEIA 3WNBA 1ZNWA 2WSMA 2NO1A 2CVHA 2PMDA 1Q57A 3ADDA 2BBSA 2ZE8A 5EZ5A 5HR5A 2PZFA 3EZ7A 1OIVA 5FTMA 2D2FA 2YV5A 4G5GA 4EPYA 2ORWA 2JCSA 4QGAA 4LPSA 1Q0UA 3K70C 3UPUA 1SXJA 1T4GA 3K70D 1GKUB 1QBKC 3PCRB 4P4TA 2CE7A 4URYR 3SFVA 3B1YA 3U3JA 5A5GA 5JRJA 4QM6A 4IRUB 3MD0A 4URVR 1S96A 1YR7A 3IBGA 2OCPA 4W5WA 2VH5R 4LHWA 1QHSA 1W2GA 2PX3A 4NCNA 2IUUA 3IO5A 4KAXA 3T12A 4QNMA 2FH5B 5TVKA 3LW7A 5DN6D 4JKIA 4ESVA 3C8UA 2F55A 2YHSA 1YJ5A 3U4QA 3B1ZA 1EX7A 4X8HA 4TWZA 1NG1A 3LO5A 5D3QA 4URWR 4OHWA 1NJGA 3V9PA 5FPKA 2WWWA 1QVRA 3F0TA 4C2UA 1RJ9B 1E79D 2GVDC 3ETLA 4M1YA 4PAQA 4TMWA 1XTIA 4WZ6A 2IWHA 2AK2A 3DPUA 1G3QA 1AKYA 5B2ZA 4A8JC 3Q7PA 4TL6A 1U90A 3W6OA 4AKHA 3IHLA 5FTNA 3ICQB 1SVMA 3WNCA 1F48A 1FTNA 2WJHA 3FHOA 3QXSA 4N0DA 4OJQA 4S2EA 2O8FB 1LS6A 1X6VA 2D62A 1ZMXA 4I4LA 1TL7C 1HEIA 4UNNA 1PZNA 1UBGA 2YWFA 2ZSEA 3FB4A 4NL4H 4QGFA 5K8UA 5CJ2A 3UMRA 2VHUA 4XWKA 1SVWA 5FPSA 1Y63A 2IL1A 4MYHA 1Z6AA 4HAYA 4ZDWA 2PL3A 3RDPA 2AXPA 2CMKA 4GMDA 3CRQA 4B33A 1UKYA 4AIIA 2HF9A 2YNMA 2VA8A 3DOFA 2J7PD 2P3SA 4R71A 4TLBA 4BASA 1NLYA 4PC2A 3W5IA 1XD8A 1E32A 4PHGA 5FOUA 3A4MA 4L8GA 4ZCIA 1KO8A 3RRMA 3NBFA 4EFMA 5LDDC 4TTQA 5SZIA 4M9XA 1OE0A 3QNUA 4EAQA 2O0JA 2GBLA 4TSFA 1HQYE 1EWRA 3K0AB 1GRNA 1WA5A 2GCOB 3P32A 1I4TD 1IN8A 4QHTA 4W5HA 5HZKA 4CEHA 4US2R 1COWD 3I4LA 3GMTA 2QE7D 3F3YA 4FCVA 3FHCB 1RE0A 2BDTA 1EFRA 3RLFA 4PZLA 3U3RA 4IDPA 1WQ1R 2FFBA 4KFTA 5FUVA 3A1SA 1HYQA 1GILA 3KQHA 1VIYA 4AYWA 3LV8A 3CW2A 5KNBA 3QE0A 3I5XA 4NU0A 5JJIA 3C15C 2IF2A 3HPRA 4RZ3A 4QJ5A 3GEHA 1LNZA 3O8RA 1KZ7B 3HU1A 3DKPA 1E9SA 1XXHB 1W0JD 5JSZB 2NMVA 2CNWA 2GJKA 1K5DA 5L3RA 1W36C 1IXZA 5EZ6B 4BFZA 2IA5A 3BAFA 1CIPA 2XEXA 4BZPA 1XPRA 2BWJA 5EP3A 3ZQJA 4KITB 3FFAA 4DLWA 3AB3A 1G4UR 1JXOA 3QG1A 1KSHA 1P60A 4JVSB 2J0UB 5JRZA 1LY1A 4AG5A 2AWOA 1KI4A 4F7WA 1DAIA 2OZEA 3MWJA 3W34A 4EFLA 1G5TA 1CS4C 2A78A 1P61B 4RZUA 4MH0R 1CRPA 2D7DA 1RJ9A 4IVRA 4GP7A 5C4MA 1W47A 2HT1A 3NH9A 3CF2A 1LW7A 5BN3A 2I1VB 3QVUA 1E2EA 3KKPA 1KZGB 1W44A 5FOSA 3AF1A 1D9ZA 5KNDA 3IEVA 1JEEA 4UNRA 1T91A 1YR9A 4M9SA 2NO6A 2QBYA 1ZD8A 4BFXA 1CR4A 1Z6XA 4GFDA 4GOKA 2ZRKA 4PHTA 1OFTA 4F38A 3Q7QA 4X8MA 1N6HA 5TB5A 3WBJA 1XX6A 5JBQA 5CIWA 1H8HD 4WBSA 2WKQA 2P67A 4Q00A 3EWSA 5CLLA 1DAKA 2DWPA 1Z6GA 1QZXA 2G83A 4DBLC 5J4LA 2ORVA 1NN5A 1IJEA 1OFIA 2ZR0A 3EA5A 1E2JA 1BO6A 2ZJYA 4Q7KA 1XB2A 1AKEA 4OK5A 3L8YA 2NO9A 1F6BA 5JI2E 3AVPA 1HT1E 2XNDA 4RVCA 1S2MA 3KQLA 2Q3FA 1E1QA 2ZR9A 3LLMA 3NDBB 4M4SA 3FWYA 2C78A 3B85A 1QHGA 1W2HA 1R5NA 2F3TA 2OESA 3MWLA 4O3MA 2LKCA 4U5XA 4C0SA 2H7VA 4BLPA 2GEDA 2GJAA 5EUQB 2YINC 4NPHA 4Q1AA 5LD2C 3MUFA 4G5SA 4EJSB 3BJIC 4D26A 2KI5A 3OF5A 1XMJA 2BCGY 2B21A 4QBHA 3EPJA 3BC1A 4HB2A 1MR3F 1FZQA 2OHFA 4HAZA 1S3GA 4YONB 1FTSA 4DCNA 4A36A 4RCZA 2IEZA 2IX3A 3M4YA 1JR6A 4UNPA 2AKAB 1H8HA 2ZI6A 2NZ8A 3BFVA 5FPTA 1KDOA 2ECKA 4YQFA 4JJZA 3C5HA 1XNJA 3FMPB 3R7WB 4JBWA 5FBWB 2ZAMA 3FOZA 4IVPA 5CB6A 2N42A 4JLBA 2VP0A 1Q12A 4D4KA 2JEOA 4RZXA 3HR8A 4A1FA 4DSOA 2R6FA 4AYTA 4HDQB 3D3QA 1LB1B 3OZXA 4GPTA 3VR3A 2FGKA 2QQEA 2IXEA 2XJ9A 5KYKA 3TQFA 2HF8A 3GLFB 2J5XA 1UKZA 5FR1A 3KQUA 1F5NA 1FW6A 1VYTA 3K9LA 2W6ID 5FBRB 4Q1DA 3B1VA 2H1LA 621PA 3NC0C 1FX0B 1KYIA 5G3ZA 3LQRA 4NCKA 2V4ZA 4KV9A 3KKQA 3LBIA 4DB4A 1U81A 2BMJA 2WIAA 4PHHA 3D31A 3SS8A 5EP4A 2AXNA 4Q9IA 3AVWA 4LWZA 1E9CA 4IDNA 4HEJA 4Q1CA 2WVJA 2D4HA 3PEVA 4PAOA 2AL7A 2EU8A 2V7QD 4JS0A 1HT2E 1AGPA 2EQBA 2R6DA 4LPKA 1QDEA 1NRJB 3EZ2A 2IWRA 1GKYA 1MH1A 4NDZA 2W2TA 3ZH9B 1BIFA 4YDSA 3K70B 3VKWA 2ZR7A 1MO6A 1JR3A 4BE7B 4DCUA 3A36A 3O8CA 3HJNA 1QHHA 5C1BA 4A8JB 1MKYA 4Q21A 1JECA 1W4AA 1E9DA 4TMKA 4JLAA 4ACBA 1I4LD 1E2PA 4OQMA 4TLEA 3CNNA 5GJCA 3EASA 1NMZA 2GK7A 2NIPA 1E9AA 2ZSBA 4DRZA 5JFGA 1D6JA 3EW9A 4QL3A 5EJEA 1R5OA 2QT0A 4TQUS 5IF9A 3K09C 1P2UA 2QG6A 4FWIB 2GKSA 2ZUCA 2O0HA 3GLHE 3LQQA 2Z0MA 1VMAA 2BKEA 3NHBA 2JJ8A 3NBXX 1R8SA 3RRZA 1XF9A 2QM8A 1P62B 2PEYA 4KI0A 3RRNA 1N5IA 4LYHA 2F43B 3BH7A 4A0GA 5FBVB 4KFSA 2GJ9A 4B35A 1W4CA 3D7MA 3E5HA 4RD2A 3EC2A 2CLSA 2XNDD 4BEBA 1E2NA 2J0VA 2QSZA 1P6XA 3SJCA 1T8TA 3TQCA 1PUJA 2C98A 4FMDB 1ZM7A 3W6PA 1R0XA 3BD9A 2CL7X 1UBFA 1ZIOA 1QHHB 3AGQA 4JL5A 4KU4A 4EPXA 3EX7C 2JA1A 1XD2A 1KSJA 4LHZA 4AG6A 1KSGA 4CVNA 2JLWA 2O8EB 3PXGA 3B60A 2RKOA 4K81B 5F98A 4LCBA 1N6IA 3ZVMA 5EUMA 3VKHA 1AGRA 3NTUA 2H8KA 1KY3A 2ZI3A 5J47A 3JZAA 3CX6A 2WJYA 5KO2A 3IHWA 3GJ3A 1NIJA 5C2JB 3PITA 4LJ6A 2ZYTX 5F9HA 5GVRA 4B75A 1U0LA 3PJRA 4K8OA 2OFWA 4HLCA 3KUDA 2OSBA 3T34A 3U6KA 1N25A 4B2IA 4DZZA 3OEHA 1RPZA 4QOSA 4FMBB 1KI8A 1R0WA 1NG9A 4ABYA 1E0KA 1GL9B 3TGPA 1IM2A 3MJRA 1UEJA 4G1UC 4DLVA 1S9DA 3HU2A 4CEIB 1F2TA 2OV2A 1E4YA 2FWRA 3L0PA 2HCJB 1OXTA 1OH8A 1US8B 3K0EA 2OILA 3KZ1E 3C16C 4AY2A 2WBLC 2BMEA 4OI0A 1GDDA 5DGXA 2J46A 4ZCLA 1G19A 2R44A 3L0SA 4Q1EA 3AVYA 4Q9HA 3T06B 3QENA 1XD2B 2NTYC 3P4YA 3TH5A 3TVDA 4PZZA 3LAWA 2O8EA 2ZRCA 3SYNA 2G1JA 1FUKA 3H84A 2QORA 3L0IB 1DE0A 4Z8YA 4QXAA 5L3SA 4Q4JA 3Q9LA 4UJ5A 4TL9A 5DH9A 2W58A 2IBMA 3B7GA 1D2NA 1TAGA 3CB4A 2WAYA 3WRYC 4C0HA 4URUR 3RC8A 5E7JA 2ZSFA 4F93B 1ZCBA 4JIMA 2NPIA 4LC1A 3JZMA 1HY3A 3RS2A 1E1RA 2YWHA 4WAUA 4MQBA 5JJLA 3EXAA 4LV6A 1ZINA 4LC0A 3W8RA 5JJKA 3EC1A 1R0YA 1GRRA 2ZU0C 2YOFA 3VFDA 4NKRA 2FU5C 3ND9A 4IJMA 4B6EA 1O87A 3FPAA 3BE4A 2ZETA 2DFTA 1UADA 2WHXA 4TMTA 4US0R 5JI3E 1KDRA 3T35A 4LI0A 2J45A 2OFXA 1RRGA 4O0MA 4D80A 1FFHA 3CF6R 3QEOA 2GXSA 2ZPTX 4Q1FA 1CULC 3RANA 1XWIA 1G291 5JZVA 1GL7A 4I1OA 3AF0A 3EIHA 3B6EA 4M2LA 4UXHA 4GZMA 3GLGB 2FFQA 3CZPA 1P72A 1YZUA 3X1DA 4NBSA 3DZDA 4GP6A 2HDNB 4ACAA 3DMDA 3TAUA 2FG5A 1P7CA 4GOXA 3AP2A 121PA 1KI9A 1MRNA 3SN6A 4V03A 1NLZA 1DAGA 5KHOC 5FUXA 2C77A 3GEEA 4Q1BA 3LX5A 4A2WA 1P3JA 2AD1A 3GEIA 1OXVA 2DFLA 3QKRB 3ZD6A 3PEYA 1XFAA 4HB3A 1U94A 4ITRC 4W5JA 4XVUA 4PQRA 4C3ZA 1FQJA 4DT1A 4MRVA 4U00A 4A6XA 2GCPA 5ANRB 2QI9C 2R9VA 2WJGA 3NH6A 5F2EA 4OK6A 1TUEA 2IYSA 3ADBA 4LJ5A 3AF3A 2WICA 3QPUA 1SXJE 3ZVLA 4MDEA 1TNDA 1N6KA 2GAAA 3EG5A 4TMXA 4IXMA 4WZAE 4LBVA 2XXAB 2J0QA 2C9CA 4IDQA 3TK1A 3TKLA 2CL0X 3I8XA 4M1TA 3NIBA 2KBEA 2FDCA 1Z0KA 3ONWA 1RW4A 1Q21A 1ZIPA 1KI6A 1LS1A 1I2DA 3FKQA 3RHFA 2C96A 1Z2AA 3AP1A 4HDCA 2FFHA 1YRBA 4MKHA 1FOEB 4OKSA 2XTNA 1ZU4A 1VPLA 2RH5A 4S35A 1KK3A 3QI2A 4EJSA 5FR2A 2I1QA 2JASA 1W1WA 4A2QA 2R62A 4AKGA 1XZPA 4R98A 3THXB 2ZEJA 5FUYA 4LV5B 2G1KA 2CHQA 3V4FA 4DLXA 2ZS9A 3QPVA 1WE2A 2DFNA 4RFSB 3LXRA 3GCGA 3PUWA 3A8TA 4DUGA 3RWOA 1XEFA 4OJKA 2GEUA 4M22A 1E96A 1R2QA 1YR8A 3QF7A 3AF2A 4HUQB 5CIQA 1U8AA 1ZCAA 3KJHA 4Y0AA 4HUTA 3QVVA 2R6CA 2L0XA 2QN6A 4J0QA 3GLFA 3U5ZB 1M8PA 2ATXA 2C9OA 1KO4A 1M7GA 1P5ZB 3QG5A 2RCNA 3QF4A 4CT4B 1ZW6A 4N3NA 2N1BA 1TQ4A 1Z29A 3AEZA 4LV8B 1S8FA 4U02A 1E69A 2A5JA 3AVOA 4C0LA 1T5LA 2CDNA 4Q03A 1ODFA 2F1IA 2VP6A 4GDFA 1AS3A 1ESMA 2OBLA 4US1R 5AR1A 3K8YA 3MLEA 3HYTA 1E6CA 1OYYA 2J0UA 4IXNA 4O25A 3UWKA 2RAPA 4ZDIA 1X1SA 3DDCA 4JLPA 2GXQA 4XVRA 2UVQA 1QHXA 1SQ5A 3C14C 4FW9A 4PHFA 2PJRA 3R9XA 2OG2A 1E0SA 1FL9A 2C04A 2AX4A 4G5QA 3P1JA 1NN3A 4FIDA 3UKDA 4HYYA 3A37A 2X8AA 1SKYB 3R20A 4TTRA 2OLJA 1ZNXA 4ERNA 3I5YA 1A2KC 1YZLA 4HLUA 5JHGB 3SFZA 2DB3A 2F6RA 2LKDA 1JJ7A 2LCFA 4DCTA 4DKXA 5FL3A 2ZYVX 1S1MA 2IT1A 2ODNA 1MV5A 1GAJA 1E0JA 2REOA 4MRNA 4QBGB 2JIZD 4PC3A 4FMCB 1OIWA 5EXXA 3ZS9A 1D2MA 1X3SA 4BPBA 2CK3A 4TL7A 6Q21A 1D8TA 1W0KD 4FI3C 5HCIA 3K1JA 5UKDA 3PQCA 1UJ2A 2O52A 2FFAA 4ON9A 3WP1B 2EFHB 3QKRA 1MABA 2O0KA 4KYUA 4DB2A 3OAAA 2AD5A 5AJXA 2XZLA 2FPLA 2QTHA 2CXXA 3LVRE 2REBA 1BMFD 1VHTA 1XCMA 4IFBA 3FTQA 2QA5A 3Q3JB 3CPHA 4Q02A 5DE3A 5JSZA 4MUAA 1Z0FA 4CRWB 4DIEA 3UK6A 4GT1A 1AN0A 2JLSA 1GNPA 2TMKA 2VHCA 3F8TA 4NYIR 4URXR 3EAQA 5FBLB 2ERXA 4YMWA 1E9RA 3A58B 3IPYA 2VTKA 3U7FB 4CT5A 1I4DD 2FZLA 2XITA 3H4MA 5GJWC 1TX4B 4OQFA 3A6PC 2ZJAA 2OUKA 1R7RA 4B32A 2OEPA 1W0JA 4WIAA 3DMNA 3OIWA 1TQ2A 4OHYA 2ONJA 4G3XA 1DTSA 2V6IA 1NVVQ 2ZI4A 1N5JA 5BYKA 2A5GA 4KVAA 3RS4A 2CLDX 5GADl 2VSFA 1GIAA 4L15A 5B58C 1WXQA 1N0UA 2XTZA 1NBMD 3OIYA 3F5FA 4RD4A 1OB5A 5JWRA 2FGJA 5JS8A 4FCWA 2OE2A 1NMYA 2HJGA 3LFUA 4QHSA 3KXLA 5DI3A 2WKRA 2GZHA 2ZE5A 1A7JA 3VHXA 1Q1QA 1RRFA 5JMTA 4LJYA 4L4UA 2UZ3A 2CCKA 2IYLD 4XD7D 1BYIA 2MSCB 2BBWA 1W36B 4P32A 1F60A 1WRBA 2QAGC 4ZV4A 1N6PA 5CK5A 5HKKA 1WF3A 3BK7A 4DUGD 4WOPA 1TF2A 1CRQA 3O8DA 1EWQA 2WJJA 2AFHE 3VR5A 4JL6A 1N0VC 3KTAA 4PQYA 2MMCA 2D2EA 3LBHA 4WVFA 4DHEA 1M6NA 2F1JA 2VF7A 1VECA 3GJ4A 1K6MA 2F1RA 2P2LA 4UQOA 5EP2A 5FUWA 4NP6A 4BWYA 2PZEA 5BYJA 5D3MA 1J99A 1P2TA 2QP9X 3QQ5A 5L8VA 5KUTA 1B0UA 1COWA 5FOTA 1ZVQA 1J2JA 2D3WA 4BRUA 2NO0A 2ZRMA 2CVFA 2JJ1D 4PO1A 3SDZA 3UMFA 2ZM5A 2C95A 4R2HA 4LJ4A 4FINA 3MRSA 1NY6A 2DWOA 3NBZC 1II0A 2GTPA 3CNLA 5BWMA 2VP4A 1ZUIA 3GQBA 2WJIA 1Z22A 3WMEA 4D4LA 5TXGA 4NYJQ 3OIUA 1GNRA 3K0FB 1DEKA 1BH2A 2EFDB 2ZRBA 4JYCA 3QKTA 4C0AC 4DT1B 1NBME 4M9ZA 2XZOA 3EPHA 3VNVA 3I8SA 5HZHA 2ZTSA 1ZUHA 4IHQA 4PSVA 5FPYA 2A3RA 2P0EA 3THWA 2VHQA 2ZRNA 5SZJA 2ZSDA 2WMNB 2ZRPA 4G01B 4B3DA 3IKJA 5H8WA 2WJVA 2P6RA 3V00A 4B44A 1SKYE 1IY2A 1KAGA 5FL7A 3AVTA 2QL6A 2YWEA 2CK3D 4UXJA 5AK0A 3RNLA 3C4JA 3DO6A 2CEAA 3H1TA 4JJKA 4LK2A 1O3YA 3VR4A 3BGWA 4FD2A 1D5CA 5AUPB 1QHNA 2XB2A 2ZJZA 2EFGA 2B92A 4O2LA 4RD3A 1BOFA 4AYXA 4DSTA 4HB4A 4TQAA 3RVBA 2DWQA 4LGMA 5KOYA 1JAIA 4B73A 5DNYB 2IK8A 4QRHA 2RGCA 2VSOA 3WNDA 2WPDA 3BB3A 1NN0A 2C03A 2ZROA 1HUQA 1SVSA 1A4RA 1VG1A 4Q9LA 4LDJA 4XTRA 1KHTA 1PUIA 1QG2A 4L16A 2GEVA 3NVAA 3DHWC 3WY9A 1DO0A 4B3CA 3U4QB 1XBTA 1U99A 2CE2X 2IYQA 3K0FA 4GL2A 1T0HB 1G8GA 2WMOB 2BBTA 2G6BA 1S9HA 3B5JA 4GI7A 4KBGA 4O2RA 3CONA 4TZ6A 2H17A 1RC8A 3B9QA 4XSHA 1OXSC 2PX0A 2Q9AA 3NBYC 2HYDA 3W5JA 1GITA 4ZIRB 4IEEA 2ZVPX 4JLOA 1S4QA 3L0OA 4CEIA 2EWVA 1FMJA 1ONBA 3VX3A 1KJWA 5E95A 4PX9A 4HLDA 1C4OA 1U8YA 2VP9A 3MCAA 3M1IA 1OHHA 1TEXA 2AK3A 3FVQA 5FTJA 4Q18A 2J9RA 3EA0A 3B9PA 3RS0A 1E1QD 1N6LA 4HZUA 2WV9A 4IFEA 3SC3A 1KKLA 4DLZA 4EUNA 2WPDD 2IS4A 2IUSA 2QMEA 4WW0A 4Q01A 5KPDA 1TUIA 2HXSA 2UZIR 2WSSA 2ZAOA 3QIAA 3N5CA 3SU8A 1N5KA 1RYHA 1UKEA 4Q4HA 2V54A 5DLQC 1US8A 3OFNA 521PA 5IT5A 2K5UA 1JALA 5JCZA 3VX4A 4IOKA 4DVGA 5LB4A 3VTKA 2EYQA 4D82A 2GDJA 1KI1A 3DKVA 1AZTA 2WWYA 4NCIA 1G3IA 3LA6A 3WP0A 4HAVA 1XDBA 1EFHA 4MITA 1OW3B 1E79A 1SXJB 3LDAA 4QG7A 5CYPA 3THYB 2GBLC 3KXIA 4F4CA 4B71A 3RSLA 3OEED 3QPWA 3MWYW 4MKGA 4FCTA 4RCYA 3T61A 3TW8B 1Z08A 2IHYA 4B74A 3THXA 2XSZA 5G41A 2AKYA 2BJWA 3BWDD 2VRWA 4JSYA 3CH4B 1SVIA 5JEEA 1DELA 3DM5A 3REGA 1VCNA 1J8MF 1KJZA 4F92B 1Z3IX 1VG9B 2CJWB 2WZQA 3DEFA 4II7A 4DJTA 1II8A 2MSDB 3FKSA 2F9MA 5EP1A 2ZANA 4C0QC 4D25A 1R5BA 2OCYC 2VLIA 4LY6A 2BJVA 3B1XA 3SJZA 2MSEB 4BLRA 3NWJA 4M53A 1OH5A 1W5TA 2E9SA 2W6IA 2Z6VA 5AUQA 3KB2A 4L9SA 3AQ4A 2ZI7A 2XOKD 3KKOA 4DSUA 2YYZA 2NO7A 2QY9A 3WMFA 2QENA 3QJYA 5CYOA 5EQTA 4P4SA 1WP9A 2BMFA 2XB4A 3IQXA 3L43A 2ONKA 2HV8A 1TTTA 3P20A 4MRSA 2O8DA 4D81A 4EFNA 3VR6A 3S1AB 5P21A 2ANBA 2G3YA 3G5UA 4B43A 1JPJA 2FSFA 1Q3TA 4HATA 2RMKA 1KO5A 3QBTA 3HR7A 2QMHA 3T5GA 4URZR 5AJWA 2OXRA 3KQNA 1OV4A 4KFRA 4LHYA 4IEIA 1CJVC 2QPAA 5AJYA 2ZRLA 3KDSE 4OHVA 3LBNA 2BM1A 1XEWX 1Z5ZA 1OFUX 1P9NA 1R4AA 1YVDA 3FGNA 3NHAA 3ZVNA 1M34E 2GK6A 2F7SA 1YRAA 5DO9A 5DN6A 5DHFA 2ZRGA 221PA 1G3RA 1RRCA 5DI3B 3BBPA 3IBYA 5J4HA 4JBXA 4Q7LA 2O8CB 3BH0A 3CM0A 4RZ2A 5F9FA 2GCNA 3VMFA 2ZUDA 3EIQA 1NKTA 4TLAA 3PENA 1G64A 1Q20A 2Q0HA 3TAHA 2P5TB 2QT1A 3A1TA 4EKDA 1VYUA 1P75A 4DXAA 2KBFA 4OQNA 2VYFA 3OIVA 1JB1A 1MABB 2B8WA 3TR5A 3I3SR 3PIRA 3D8BA 3M6AA 1FPMA 4PPGA 1W0KA 3HP1A 5FTKA 2BVNA 4CW7A 4OI1A 5CB8A 4JL8A 1AA9A 5J4KA 2QSYA 4IOMA 4Q4HB 5EXPA 2VP5A 5BQ5A 5CDFA 3SHFA 5G40A 4ASUA 1JEDA 4JSTA 1FNMA 4Q9KA 4M1OA 1EESA 2W00A 2OXCA 4FXPA 4PXAA 5H70A 1KI6B 3OFND 2GETA 5GVSA 1G6HA 2PLRA 5A0FA 4NHOA 1ZC4A 4XVQA 2ZVQX 5HE8A 4TL8A 2ASEA 4LYFA 4WA7A 5DISB 2BEJA 1KIMA 3CO5A 4Z1MD 4XWOA 4IW3B 4D6PA 3NC1C 5JECA 4MYUA 2V1XA 2DPXA 2YZ2A 2ZQ5A 4M9QA 3SE0A 1KDTA 2XTMA 4JVMA 1OH7A 1OH6A 3R9WA 2RGXA 5HTKA 3TJZA 1X1RA 1XRJA 3I92A 3P27A 1YZNA 1IJFA 5FPHA 1IQPA 4A0HA 3R7WA 1MO4A 1Z0AA 3TUIC 1A5TA 1WBDA 5KDOA 5M04A 2A9KA 3GFTA 2D74A 4JLMA 2FSIA 4FN5A 2OFOA 4DLUA 4E03A 2QQ0A 4MYTA 3ICEA 2JJ2D 4A0RA 1KK1A 2NGRA 1NVXQ 5D3MB 4PC7A 1MO5A 3TSOA 4M0LA 1HURA 3GJ8A 2NOAA 2XOKA 3PUZA 3CZQA 4CGZA 2IHBA 3RC3A 4Z51A 4V0OA 4XD7A 2OCAA 3QKSB 1H8EA 4HB0A 2P6NA 4PPNA 4TYYA 5G53C 4Z1MA 2QMOA 1G41A 1E9FA 1A2BA 1XP8A 2WTUA 4YXWA 2C2HA 3UG6A 1JJVA 2IXFA 5JEDA 4Y0VA 3CRVA 1Z8FA 3RABA 3IUYA 4PC6A 1KGDA 4DSNA 1OPXA 4HUQA 3U60B 2JIZA 3IEUA 4QJ3A 4AC9A 4M8NE 3VKGA 4KO8A 2VPPA 3I61A 4H1UA 1HH4A 3BXZA 5AJZA 1OKKD 2PLFA 3NXSA 3SJAA 1XTRA 2HLDA 4L9WA 4JT2A 3QXHA 1E2GA 2AHOA 3M0EA 5FI0B 3MG9A 4MKFA 4U7DA 2FEMA 4TQ9A 1T3LA 2IYVA 3BS4A 3Q5EA 3QOFA 2JATA 3FFBA 3GJ7A 1N6RA 1IY0A 1IY1A 1QVAA 5CM9C 5TDHA 1CXZA 4RY2A 2FF7A 2H16A 4DEXA 4C2TA 2IYYA 3RS5A 2V9PA 3MWKA 4CIDA 5EE1A 2ZXUA 2QEQA 3Q72A 1KMHA 3QF4B 1AIPA 1G20E 1DPFA 1HE1C 1IBRA 4NYIQ 3IGFA 4V0ME 2JLXA 3NG1A 1CJKC 4FMDF 4V0LA 3K09A 4HZIA 4NE2A 4EJSC 2WOJA 2ZRIA 3CIOA 4B6FA 2J1LA 5IK2A 4LJ9A 4Q4AB 2J59A 1U9IA 2GAOA 1KK2A 4Z54A 4PSKA 2W6JD 1OIXA 3GD7A 2ZIAA 1ZD1A 4D0NA 1DG3A 4KFUA 4PC1A 3CWQA 4NONA 5KDLA 4AD8A 1EFUA 3LX8A 4QGGA 4TSFD 5AWFC 1XJCA 4LOAA 3BIFA 4F4IA 1NJFA 4KODA 1XXHA 3RAPR 2AWNA 3FYHA 1V43A 4Q7MB 1KAOA 4ZKDA 2I4IA 1LV7A 4BLQA 2IYWA 1YZGA 3U7HB 4RD6A 2FSHA 3BORA 2HJVA 5E7IA 1G18A 1JNYA 3K53A 2CHGA 1D9XA 3IO3A 4M1MA 2Q9BA 4KYIB 3X1XA 2OLKA 1G8HA 3CKLA 4QNRA 1FUUA 2IEYA 3W6NA 2RGEA 4B2LA 3G0HA 3SBDA 4RFVA 2J87A 1UBCA 1NSFA 1P2SA 3PVSA 4GBMA 4E22A 4V02A 1UBEA 4KXFB 1ZM9A 1FMLA 1II8B 4DWJA 1TADA 2AN9A 2J0SA 2ZRJA 1E2MA 4P4UA 3VNUA 1DAEA 2UKDA 4KLZA 2W6JA 5FFMA 5FI1B 3A1VA 4E07A 4BFTA 4A9AA 2PBRA 2ANCA 1GVNB 1ZRHA 3UMSA 5DHAA 4HZUB 1OB2A 1G21E 1BYUA 1LVGA 2GESA 1XEXA 4TN1A 4C7OB 1PLJA 2JJ2A 4KVGA 3PUVA 4DLYA 1R10A 3RSOA 1VCIA 1OF1A 4ILEA 3U6BA 1ZP6A 3B8HA 2OBNA 3MAAC 2GZAA 2WIBA 4KBFA 4LZZA 4MA4A 2RGBA 1RRPA 3WBKA 1AK2A 3C5CA 4B3GA 4AKIA 1KNQA 1RYFA 4QBFA 3CNOA 2BHRA 4DDVA 2X77A 2W2VA 3WHKA 1NSTA 2JLVA 1X8JA 4JBYA 1L8QA 4JLVA 1G3UA 1Q22A 2C99A 4PO9A 1NKSA 3K9GA 1U2RA 4Q7JB 5LPNA 1KI2A 2JLQA 1WBBA 1ZBDA 2XX3A 2ZJBA 4Q5IA 4IVQA 4CZ2A 4TT3D 1M1YE 5E4FA 3EZFA 2F1HA 2QAJA 2FZ4A 2HLDD 5H1YA 3WYGA 1ZJ6A 2ZSAA 4JLJA 4YMUA 5CJPA 4D0GA 1K5GA 1AZSC 3KFVA 3OEEA 5JHHB 1EG7A 2CCJA 2O8DB 3QXJA 4LBWA 2BM0A 4LBZA 1P9RA 4KHZA 3P26A 1K8RA 3SQXA 2V1UA 2F9LA 1DAFA 2B8TA 2REXB 4Z8XA 4GMXA 3LW8A 4QGHA 4OBEA 1G5PA 4OHZA 5FBQB 1OYWA 1XPOA 2QAGA 3U44B 5JWOA 2WWIA 3B2EA 5CM8B 5TMPA 1AQYA 4LYAA 3FKSD 1W5SA 1ZNZA 3AH8A 4YLGA 3N2EA 1T0JB 4R7ZA 3QSYA 2GNOA 1Q1EA 2HCBA 3ZYCA 1W4RA 2EWWA 5DI9A 1IOZA 1KI7A 1GUAA 2ODWA 4CYMA 2PCLA 1XTKA 2X2EA 3NEYA 5BN5A 3CRMA 3N2IA 1SKQA 4V0KA 3HYRA 3BB4A 3QXCA 1YU9A 2QU8A 4QC2A 2WWXA 2FA9A 4P33A 1AJEA 3W8NA 4KSCA 4N1AA 2GXUA 1N6NA 2KJQA 3ZZUA 2QBYB 1YE8A 3L8ZA 1NI3A 2B6HA 5L3VA 2F3RA 3NDPA 1G1MA 4HI0E 2C5LA 2DBYA 2IYZA 4A92A 1N2CE 4M1KA 1N5LA 1G9XA 3MGCA 1E1RD 1QF9A 3KKMA 4I1UA 2IYXA 4JVNA 5CLQA 3GPLA 2W0SA 2WSSD 3AKEA 5FOXA 2JDIA 3MJHA 3SI7A 5IRCD 4DCSA 3C7KA 3FMIA 3LRPA 2PMKA 2AFIE 2QP4A 2QTFA 1T3HA 1VKJA 3KL4A 1LF0A 2IXGA 4E5UA 2ZRFA 3CWZA 4BGDA 3AV0B 3VHLB 2FNAA 2RHMA 821PA 1N3BA 3T1QA 1AS0A 1M74A 3B78A 2NZJA 4JKYA 4BQSA 1IN4A 1HA3A 1VCOA 2YJTD 3MSXA 1XJ0A 3JVVA 4RJLA 4D4JA 1TF7A 1XZQA 2A30A 2OAP1 2CJWA 4ZI3A 3CRRA 3OE7A 1XU4A 4A15A 2ZJ2A 4G5RA 1NBMA 4CF7A 1AS2A 2XSZD 2GHIA 3AKDA 4WXPA 5KSPA 5JLJA 2HYIC 5KNCA 4B3XA 4D2IA 3Q85A 5TV2A 1XTQA 5J4VA 3D6TB 1ZD9A 2FN4A 3H2YA 3HDTA 2RGNC 1J90A 3QKUA 3ZIAA 1GL6A 2A2ZA 3EIEA 2V3CC 1B23P 1DS6A 1JR3D 2GJ8A 3SNHA 1J8YF 2Z4RA 1T8UA 4PO8A 3IPXA 4IOJA 1U0HC 3A4LA 4F4JA 4EDHA 4P3YA 1J7KA 1LTQA 2VBCA 1N0WA 2KWIA 2VP2A 3BFKA 4HAXA 5J40A 1C1YA 1G8YA 3AGPA 3H86A 4LX0A 2J41A 1HE8B 3SZRA 3X1WA 3N70A 4L5BA 1XXHE 3DVLA 3IIJA 2R6AA 2KSQA 1UF9A 2JAQA 3U7EB 2ZE7A 4YMSA 4C0JA 1IXSB 1GZSA 1L7VC 3O8BA 3T1VA 1FNNA 4BFWA 1GNQA 1SVKA 1GM5A 1MT0A 1KKMA 4QFMA 3PR1A 2DHRA 3B13B 2Y8EA 2XGJA 4TLDA 3OE7D 1E94E 3AVUA 1U0JA 2QMUA 2WOOA 1I2MA 4TMZA 3ZZ0A 2ZE6A 4B2PA 3ASZA 1FX0A 4NCJA 1SVLA 4QHYA 3UIEA 4G0NA 3ZQ6A 2EYUA 3VU9B 1OHHD 4DDWA 1II9A 2GCOA 3MFYA 2SHKA 3CR8A 3BFXA 2OCBA 4W9MC 2CHVA 1IXRC 1PLLA 2GRJA 2VEDA 2R6GA 3V4RA 1ZAKA 2IW3A 5HPYB 5CK4A 2QPOA 5K8LA 5EXTA 3KUCA 3QKSA 3R9IA 4A4DA 2ZRHA 3GJ0A 2QP3A 4KCGA 3ZGXA 4WXRA 1Q3HA 5E3HA 5JS7A 3ASYA 1XTJA 2QM7A 1SGWA 4BFVA 2DYKA 2ZUBA 3AKYA 3RS3A 3OESA 1NMXA 2E1RA 1NIPA 2FEOA 2NQ2C 4OI4A 4EQ6A 2GA8A 1H8ED 3EZ6A 1QRAA 3CRW1 3I73A 1F2UA 2R8RA 1LFDB 2MMGA 3KQKA 2W83A 3IDQA 4BECA 1EXMA 4NH0A 1S3SA 2W2XA 4M1SA 1PVOA 2EW1A 3THOA 1L2TA 4XTCS 4KSBA 3AUXA 5FTLA 1P73A 4HLUC 4JT4A 1NVWQ 4Q9JA 2Z43A 1E2HA 4RD1A 2IYRA 1SULA 2QZ4A 4ZI2A 1RKBA 4DCVA 5SZKB 4XWAA 3KTAB 2WM9B 1EX6A 1CBUA 3WHLA 4NTZA 3AP3A 1L4YA 2JDID 4MKIA 3TR0A 2BEKA 2ZS7A 3IILA 4MGYR 4N0EA 1KOFA 1W48A 2ODEA 2ZRAA 3CH5A 1GP2A 1S0UA 1SXJC 4MYCA 3W3ZB 1Q1BA 1XEXB 1G16A 4M1WA 2BMDA 2Q3HA 1AQUA 4FMCF 1U9IC 2JLRA 3HPQA 2VL7A 1EFCA 1Z28A 4BZQA 1HV8A 5B30A 3UXMA 1EGAA 1XTSA 4NCHA 2FPMA 4YDHB 1FP7A 4MGZR 1CP2A 2ZITA 3A4NA 3KJIA 3CUEF 4CDGA 5AUNB 1E9EA 2Z83A 4ZCMA 1OFHA 1VG0B 2BC9A 3PFIA 4MGIR 3R8CA 2J3EA 4TMVA 4I1SA 4EPTA 5K8TA 2ZYWX 1F2TB 2VHJA 3AVQA 4UNSA 3GP8A 1YZKA 4HSEA 4MRPA 2Z5FA 3PG5A 5J5CA 1TU4A 1UDXA 1V5WA 4LBYA 2ZJ5A 5KSZA 2OO7A 3OAAD 5C4GB 1GKIA 1NY5A 2WWHA 2GILA 3GFOA 4EIWA 3NEJA 3GLFE 1PLKA 1BMFA 2BBOA 3Q8XB 2IS2A 3GJ6A 5DIFA 4RSGA 3TUZC 2DFKB 5BN4A 2O8FA 1TPZA 3UANA 4DDTA 2OBMA 4LHXA 1NN1A 1IAQA 1XCPA 4XJXA 3WMGA 5CDFE 1YZTA 1PV4A 3K9HA 3QBVA 4EPVA 2VF8A 3PV0A 4OL0A 4NYMQ 2R65A 4UXIA 2RGAA 4HAUA 1ZNYA 2X2FA 1OT3A 1ZUNB 2VO1A 2O5VA 2C9YA 4B3FX 4P0TA 4UJ3A 4I99A 3T1TA 3KJEA 4DC9A 2EFCB 5TY0A 3TNFA 3TIFA 4KJZA 1NL3A 3C41J 1G6OA 1U8ZA 1IN7A 3VR1A 1R8QA 3GLIA 3I62A 1R6BX 1YHNA 2JLUA 1TU3A 2H5EA 1KDPA 3DL0A 3EARA 4BUJA 4C4PA 3I72A 3AVVA 3B82A 1TF5A 2PT7A 4C30A 4GNKA 1D2EA 5IDVA 1CEEA 2FPKA 2GWHA 1ESNA 3H0KA 1Q44A 2HUPA 3WYFA 1YKSA 4C9BA 1H65A 2G0TA 3NKVA 4RD0A 4IKEA 4BRWA 1EK0A 1QHYA 3RWMB 3CX7A 1A82A 1E2QA 3FMOB 1E2LA 1OLOA 3AUYA 4GRAA 5AUOB 2QRNA 3LLUA 2HT6A 1CLUA 5L3QB 3SHWA 3W90A 2Q3MA 1GRQA 1SVOA 5SZHB 1JXMA 3HWSA 1KY2A 2JGNA 4A2PA 1E2DA 1DAMA 5JWHA 3SOPA 1NNEA 2A5FA 3EPLA 1W36D 4TT3A 4A8JA 3BOSA 2NG1A 1GTVA 4ZKEA
chains in the Genus database with same CATH superfamily
4YRRA 4CKYA 1L7EA 3ESBA 1VKHA 4AJJA 3LT1A 5DGIA 4PZYA 4JENA 2O8BA 2I6UA 5BN5B 2D5BA 3FHTA 3R0XA 2E6UX 2D0DA 4YMHA 2JAXA 2QTVB 3A1UA 3JALA 1A8PA 4LHEA 2XECA 2Y99A 2MOKA 1KBZA 2AFRA 1GGEA 1AGYA 2HRQA 4RK4A 4ENTA 5I5EA 1C1HA 2M6KA 3ZKWA 1ETUA 1T1RA 2EAUA 1BVYF 2QPTA 5F73A 4S1TA 3HM2A 5EWLA 4ARZB 4DLSA 5KTYA 1BNCA 2ZJ8A 5IT4A 1KA9H 3DAHA 4D43A 4D46A 3O4RA 2QVGA 4ZAGA 2QGNA 4OFBA 3BSSA 3HB5X 5CNIA 4QLOA 1UM9B 3GW8A 2QK4A 1M0WA 1WMSA 4DDHA 721PA 1KY5A 1LBSA 2BR4A 1QFMA 3EXHC 5BT8A 4H7JA 1TMKA 3MPOA 5HK9A 4LTMA 2H4HA 4DHWA 3R0IA 3R4CA 4NZYA 4PRLA 4G56A 2AZXA 4LZPA 3DD1A 1FRFS 1IH8A 1N9KA 1R37A 4OVKA 3WE7A 5FQNA 4BEJA 1L4UA 4ZRMA 1MJFA 1Z2CA 1RZ3A 4NMLA 4IKPA 3TCNA 1KMHB 4KE8A 3R7DA 4YROA 2CF6A 2DPYA 1F8XA 1H2BA 1JDPA 2VK4A 3DD5A 4JH0A 2G5GX 5KYXA 3RAEC 1ZHOA 1QKJA 4FI3F 3IQFA 5CFNA 5K8IA 2FPGA 3E03A 4EGAA 1QK5A 1XZEA 5B5SA 3MHTA 4WNIA 3P4XA 1TCAA 3RVMA 1B00A 3WRXC 3VSAA 4I4NA 1QYXA 4LVUA 1CKEA 2BOVA 2VAVA 3PHHA 1NP6A 1M2OB 3ZY4A 4M8KA 1ZU5A 1T2EA 3RTEA 4DGQA 5HZGA 4LF5B 3VU9A 3UWOA 4AM8A 4PG6A 1OA0A 3GNQA 1RQ2A 2AR7A 3ROQA 2J3LA 3VR2D 2ZDGA 4ARZA 1MO3A 2PGIA 1MVOA 2G25A 3OLZA 5DSZA 2XLBA 3WJ1A 1BXKA 1UMBB 2IZOA 2O7QA 3KXKA 4AZ3B 1RMQA 3UMMA 3ZLVA 3PGMA 2CLOB 1LSUA 4OKIA 1I4OA 3IUMA 2G9RA 4BB9A 1DJOA 2ALJA 1ZW1A 1PKEA 4HH0A 4M37A 4PLVA 3JU3A 5MN5A 4LGCA 3WGNA 2ZULA 4OGGA 5MFPA 4R2KA 3GIDA 3GFRA 3D3EA 1E2KA 2C97A 5B57C 5LDGA 3L4EA 4AUNA 3ZE8A 4EA9A 1NQAO 3MA0A 3IJ5A 1CY1A 5LCXA 1T10A 1IHDA 5AW2A 5KBYA 4WH0A 3MJCA 3VZSA 2WHPB 1BE0A 1JP7A 3PF9A 3PJFA 3ICCA 4DG5A 1I0ZA 2VIIA 3CZMA 4OGKA 2CBZA 2DEUA 3HN7A 3D4OA 4C5CA 4C7OA 4QQ8A 2RK3A 5AMXA 3T5DA 1XRRA 1JSLA 2PKQO 4BNYA 2WAXA 4DS3A 4CG3A 1G55A 3Q5DA 4G84A 2AN3A 3PBKA 4QVKA 5JZ9A 2GFIA 4B3BA 3RUAA 2BGNA 1BN6A 2GAIA 1GSHA 2VRCD 1AUXA 3E58A 4PQFA 2GYWA 5DM4A 4TV9B 1J2UA 1MGPA 2QF7A 4NHEA 2G9NA 4XIGS 4WA8A 3ZX4A 3E1SA 3EFBA 5C4IA 2JC3A 3FCSB 4I5EA 1AKNA 3FB1A 4LE0A 4Y8VA 3AIOA 3MQFA 3O47A 1ECBA 1XHFA 4M88A 2EFEB 3R7NA 3T5TA 3ILVA 2C82A 1UZNA 1I7LA 1T3ZA 2J5BA 1G5RA 2ETXA 4KWIA 3KLMX 5JXGA 3ADKA 4KQGA 3HNRA 4M9UA 4AF8A 4XRRA 1M2HA 4TYWA 4IIUA 2GF2A 3DOHA 2Q9CA 1U6IA 2X5XA 4QJBA 2I55A 2VJMB 3Q1KA 1Q91A 4X8OA 3IBFA 3KT6A 3ZBPA 4ZMBA 2VPWA 5CR9A 2DFDA 3Q10A 2OAQ1 4EPRA 2DECA 3C7AA 2H31A 1BEEA 2V7QA 2DFVA 1NC3A 1SNYA 2BV3A 1SHKA 5ALKA 4OQXA 1D2HA 3ROTA 4WZBE 2V58A 3NRJA 2B4RO 2BHTA 2HREA 1UBKS 3K9NA 1GG2A 1HZZC 5B6PA 2I5PO 3QOWA 5IX8A 2B78A 3R23A 5L4LA 4RLQA 1XMSA 5CCDA 2ZWIA 5E6RB 4J07A 5FI5A 1U5BB 5IASA 1UZLA 3IT3A 4XKJA 3GLHA 1Q0PA 1ZH6A 3DMPA 4FKMA 4LGYA 4YJ2A 2EVWX 3PQ3A 3K0CC 4B8ZA 2NQTA 4CCWA 3RFXA 3G6KA 3PLNA 3UKJA 2GRUA 1JFTA 3DBIA 1C1XB 1LPPA 4GQBA 4N0MA 1IVYA 2X19A 4YI5A 2CNWD 3HI6A 1BKDR 3W4JA 1S7GA 5CA1A 4CM9A 4NCAA 4KUGA 3TX6A 1NVUQ 5LMCA 1RP7A 5T8KC 1FNCA 2X4IA 1FFSA 4O4HA 1XMQB 2V6JA 2XQJA 5EWJA 1MXHA 3V2HA 1Y37A 4ZU6X 3BT7A 2FDXA 1N57A 4V0MA 3A1WA 1CF4A 2DCMA 3EDQA 3H1PA 3ZY2A 3TLEA 3UQYS 2M6LA 4U2KA 3N7UA 3HV2A 2VPZA 3HSYA 3IR6A 3DAGA 5LR6A 1JMKC 4F3RA 4X63A 3D6AA 4QSMA 4BVBA 2P9GA 3HJGA 3CTMA 1UC9A 3ZS8A 2VYND 2W2PA 3RASA 1D0SA 5EFZA 1U3VA 5I9TA 3TRFA 4R01A 1ODJA 3U1VA 4ESHA 1TGYA 2WKPA 4BATA 4D7AA 1DWOA 1P2VA 5EHIA 4D0LB 2B8JA 4J1QA 4F5DA 1NNLA 4U2DA 4EPWA 1IWBB 1P5FA 4RHUA 3WGMA 2H3HA 2TMGA 3AY0A 4YRCA 3S1AA 4G36A 2QIOA 4Q47A 1GWNA 1NFQA 1MTOA 1W6RA 4BGIA 3IDZA 1G4AE 1I1OA 3A7EA 2HDHA 4POAA 3HB4X 1JR3E 4MW9A 3VI3B 2G5PA 4BLTA 3AG6A 5I8WA 2HWUA 5CCBA 2Y71A 3I37X 4PGFA 4EY4A 1H4SA 4KYTA 4GP9A 4GVPA 4CNQA 2FWBA 4XDHA 3VHRA 1PJTA 4GZLA 5FH9A 4EL0A 4WJLA 1R9NA 3E35A 3X1KA 4A03A 1AMUA 4BFYA 4Q19A 1RIIA 1MN6A 2QUIA 1CZLA 1R27A 5G1PA 1N7JA 1GGNA 2Q3DA 3QUSA 3ZH2A 3VPCA 4C0BA 2HBZA 4CIBA 4QPCA 3K0AA 1EGMB 1G21B 1V7CA 3GRAA 4K05A 4D92A 5B64A 1EXVA 4RKEA 1SXJD 2Q6TA 2DUJA 4JLKA 5KVSA 5CBKA 4NYJR 2CFOA 3CEPB 4IDHA 1J0BA 2GBPA 3MTDA 4WKPA 5SV2A 1F2UB 3RV4A 3TMKA 3X2SA 5JAZA 3KEFA 1KO7A 2AZDA 1BGWA 2V55B 4J4TA 1M7HA 1RJWA 3VC3A 1CR1A 5L6MB 1KXJA 2J7KA 4JB0A 4LSZA 1VCMA 4DEYA 1CUYA 2FRVA 1GY8A 2MSLA 1IK4A 1LZLA 4Z0HO 2R7KA 1T2NA 2GAFA 5TF0A 3S68A 3U81A 4WXYB 1C41A 2FWIA 1CDOA 1QDLB 3EN0A 4NPAA 1IONA 3A1NA 2OYRA 2GX6A 2JRCA 4CTOA 1W5EA 1PTJA 5PGMA 4ALNA 5C5DA 4XQGA 1WQ4A 2BFPA 3NUGA 1L5KA 3L2OB 1CJUC 2V7BA 4O4LF 4B17A 1JE1A 1QHIA 3ZKWB 2WWFA 3IIMA 3U3OA 4BRZA 3VH3A 4H3HB 5JXIA 2P3LA 1RIFA 3OM1A 3T95A 3TBKA 2JGRA 1IVNA 2X58A 2GFHA 1A5ZA 3DJYA 3TNDA 3E70C 3LH5A 2IYUA 1E98A 2X9GA 2OD9A 4MLZA 4PIPA 1X86B 3NW9A 1GQOA 1CUFA 4PYNA 4BAZA 1E3JA 1IUOA 3DOCA 3TJMA 4UU8A 1JIJA 4GOJA 3IFSA 1H0RA 1O97C 4WOJA 4FFMA 1N4DA 1F3OA 2PFKA 4X97A 4YJGA 5J1SB 4RKFA 1V41E 2TRSB 5EZYF 1A4IA 4AJLA 4YCDA 1X2EA 3PEWA 3I32A 1XEWY 3PC3A 4OQDA 2R00A 2Y1CA 1DARA 1XZBA 4HN4B 3B1FA 5K2MA 4C76A 4BYGA 4CKWA 3NYWA 4LDAA 4P31A 2ZI5A 4A8HA 1OC4A 3ONEA 4ZN6A 1IZ8A 1SHTX 2RDMA 4M54A 2WTBA 4RNCA 5IARA 2II6A 1UOPA 4KQCA 4R2IA 2YYAA 4EGCB 5IM4A 1X8KA 2YWXA 4MS4B 2O07A 5A1TA 4KLNA 3Q1LA 3ACDA 4E5NA 1SKMA 4OQZA 1SG0A 3VQTA 4RTQA 4JI4B 4UHJA 4J1NA 1K7YA 1AN9A 3CR7A 4OQLA 4FNAA 2FMXA 4UUNA 3NJ8A 1Z4PX 4GZ5A 1V8PA 4XLLA 5DBOA 4BFSA 5E38A 1XVUA 1T6NA 5GJVC 3R9KA 1AY0A 1ELOA 4AJ1A 4UM9B 4I81A 3IB3A 1ZYUA 1G8PA 4YMVA 1JPNA 1QQBA 3KQMA 4CCAA 3BWEA 3T4XA 1J4AA 5E4TA 1YDHA 1NW7A 3V3TA 1W88A 1MEOA 3UATA 3LPLA 5BVGB 1EXWA 3QVMA 3X0DA 3F1LA 3AF4A 2NU6A 4I7EA 1WDTA 1OBFO 1N3YA 2QTRA 4Y18A 3SVZA 1CUVA 3A6ZA 3U3KA 1A77A 1YJQA 3AI1A 4IHJB 3VISA 3X1YA 4OHXA 3B1WA 2JVJA 1DLJA 1WUKS 1N1EA 1UM8A 1BHQ1 5KKAA 3ME5A 2PUEA 4TLCA 1FSZA 4EX7A 4PONA 5B7NA 3AERA 4ZT6A 3OU6A 1IMOA 3UT6A 5F7OA 4L72A 4R1UA 2YC4C 4DDUA 3DWIA 3OPQA 4GRDA 1V4BA 5TNXA 1Y4UA 1JEYA 4WZBA 1RAEA 3OX2A 4ZI5A 2W8BA 4CDRA 1SY7A 4UTVA 3UJBA 2ERYA 3C3YA 1YQTA 3T9EA 5TARA 4BP1A 1BFKA 5JD3A 1UEIA 1TQ8A 2YJGA 1YAJA 4QQKA 3EVCA 3ZXUB 1CQIA 1DDGA 2H1RA 4IDFA 4RV9A 3R0VA 3LLCA 5PNTA 5EZ5A 3SVLA 2RBEA 2JH8A 3KZXA 5FTMA 4X1YB 5I4KA 1NF8A 5E4JA 2D2FA 1GXSB 2YV5A 3D5QA 4R83A 5IC5A 5E9QA 2XUZA 3IEPA 3KV3O 1PUXA 5K0JA 3OCUA 3K9WA 4XX1A 1IEQA 4X00A 1QBKC 3SFVA 5A5GA 2MJLA 2EWMA 3MD0A 2DQ4A 1T24A 2OCPA 2FZWA 2L69A 3LE8A 5A5EA 1DWPA 2E4VA 3WJ2A 1KQPA 2P11A 3KHKA 1XSEA 2JHFA 3MQ2A 2P77A 3OJCA 4NSNA 4O8ZA 3T12A 2BFFB 3RYHB 4QNMA 4RF5A 5TVKA 1BE1A 1RPNA 3LW7A 4ESOA 2CXOA 1NC1A 3PD0A 5ENVA 5A2QA 1Z5GA 1UWVA 3S0JA 2GN6A 3FRJA 4JKIA 5ALYA 2HMWA 2F55A 4JLUA 4X8HA 5BW5A 2C3MA 4YJ3B 3U4QA 2FJPA 3LO5A 2AI2A 4U6NA 4URWR 5KQMA 1QZUA 5CEFA 4X85A 4GGOA 1G2IA 1RJ9B 1E79D 3ETLA 3GWZA 3O1IC 3PE4A 1GG8A 4TMWA 1ODCA 2EOAA 5G0TA 3ENQA 2Z08A 4K40A 3RFVA 1JDTA 1R4NA 2IWHA 1YQQA 2AK2A 3AKZA 1IEWA 4YO7A 1X7XA 4IGAA 3A3NA 5B2ZA 1NQWA 4TL6A 2NYAA 2IV3A 2V59A 3IHLA 5A03A 4QYMA 3LP8A 3MINB 5CIYA 4DWWA 3O1LA 4UOQA 3KZMA 4N0DA 1BJTA 1LS6A 3O8OB 1T1GA 4X1OA 5JCOC 3AIIA 4OAOA 4I4LA 4NJMA 4IH9A 5AI5A 3SS9X 3DZFA 4DPKA 4MS4A 4NL4H 4QGFA 1FFCA 1XGKA 4BO6A 5K8UA 3A04A 3UMRA 3CUSA 5FPSA 4UFPA 3Q3HA 2JCVA 2EC5A 3F7OA 1B73A 1SBYA 5C2JB 2IL1A 3NP9A 1D6MA 1Z6AA 4MYHA 4MUEA 3ZHXA 1SU4A 2QJTA 2BL4A 2YS6A 3E27A 1CWUA 1XZAA 1U6JA 3AHFA 3OQ1A 1EPUA 3RDPA 3AESB 2WP8J 4MLCA 4B33A 2H1HA 4K86A 4XDGA 1R9MA 2VA8A 3DOFA 1T9GS 4OHRA 1WWKA 2D1QA 3VNBA 2AHRA 1EDEA 4FQ8A 4TLBA 4KMRA 2GM9A 3S70A 4BASA 2P40A 3R3VA 1E9VA 2P5UA 4JUFA 5E2AA 4AJHA 1HQDA 5I5GA 1NTRA 4L8GA 4ZCIA 1VL2A 3ADOA 3D7NA 5LDDC 1JLSA 2POQX 2WPNA 2XDQB 4TTQA 3JQFC 4IJKA 4QPZA 3G9XA 1GTL1 1QO9A 2O0JA 2IDJA 3BD8A 1X7GA 1EDZA 3Q9UA 4PXSA 5LP6F 3DA8A 4KPGA 2NAFA 1J25A 1FFGA 1TM4E 1XF1A 2GCOB 2A4KA 3P32A 1I4TD 1IN8A 2YHIB 4QHTA 5HZKA 4IILA 3J80A 3OFSA 4K8RB 4P4NA 5EJ6A 3I4LA 3NBMA 4HR7A 3IPAA 4EYKA 2WB2A 4PLYA 1RE0A 4RBNA 1KEPA 1TJ5A 3BK2A 3K9QO 5DMXA 3ON5A 4TX1A 4OEHA 3U3RA 3GA0A 4MPPA 4IHJF 3D0OA 2GEFA 5JTUA 4MWOA 5IH3A 4BGVA 2B4AA 2AMLA 1YB5A 3CNQS 3DQPA 1KH2A 1P6UA 2BHNA 1C0IA 4GKBA 2GYUA 4KBYA 2IF2A 3HPRA 1W59A 4BQOA 5JJIA 5JH7F 1I7QB 5AIAA 3R5SA 2BKVA 5M7EA 2VR1A 3G02A 3HU1A 1MTZA 2ZT5A 1K06A 1RADA 2ZSUA 4JDUA 1TT5A 4CL3A 1CE8B 1EJBA 1H2EA 3U9LA 5A1JA 4AO8A 4XQ0A 2J6IA 4HXEB 5L3RA 4FDUA 2ZBGA 4HWKA 3EXG2 3ONNA 2HMAA 3GT0A 3BAFA 3OOJA 2CXTA 4HWSA 4N54A 1EZ4A 4BZPA 3ZYZA 4C6HA 4D3SA 1E3IA 2YV1A 3AX6A 3JQFA 4YJKA 2BWJA 5EP3A 4ZHQA 2H1CA 3FPSA 4CETA 1A50B 2I4TA 3CUUA 3RH0A 3AB3A 3EE6A 1ISGA 1P2FA 1XRLA 3IQIX 1O7JA 1KSHA 4ZJZA 4JVSB 1KORA 2TYSB 3ZHYA 4F7WA 4C04A 2D00A 2QD1A 1PGJA 4EFLA 1Z74A 4EW6A 3SXUB 2HUNA 4RZUA 4MH0R 1CRPA 3I52A 2PL9A 1R74A 2FZGA 3OQNA 3DOUA 3JZIA 4RDIA 5ELMA 1W47A 4AZ0B 3FTNA 2BGTA 1QGED 4LZOA 2Y1DA 5DYNA 4YJGB 1W44A 4L1KA 1JEEA 4UNRA 2G67A 2PSEA 3EVFA 2A0KA 3ZU5A 4F9FA 2C4TA 4J4BA 2I34A 1ZD8A 1OAKA 2EZ9A 2QBYA 1Y80A 1UBHS 4MV3A 1MIOB 2XPCA 4YRGA 3GJRA 1SQFA 1W73A 4PHTA 3F9IA 3Q7QA 1WOMA 4K6CA 3ZV3A 3WZMA 3HWWA 3IR5A 3K96A 2GPSA 2P7HA 5CIWA 1MFPA 4GXQA 4DKXA 3KVVA 4XX0B 2RAVA 1M2OA 2DWPA 4YPOA 4CHGA 4DBLC 2B34A 4CTMA 4EEXA 2ORVA 1RLMA 3CY6A 3UN1A 1R16A 3HBNA 3TFQA 2H07A 2YZMA 3I9MA 1WUHS 1WD5A 5GWXA 2AG0A 4DCOA 4JBHA 1VJRA 2R5NA 4GVLA 3THRA 1YI1A 1QE0A 4BMXA 3AVPA 1QOPB 2XNDA 1LNQA 4LW8A 4YCJA 3SXUA 1Z7EA 3VYVA 2ZR9A 2I7DA 3LLMA 3OQJA 4G4SO 3FWYA 1YC2A 4OH1A 3RRXA 2JIBA 4HQ0A 4N5LA 3DDOA 4WXHA 4F56A 1QHGA 3GEBA 5IC6A 3HZOA 1CUGA 2YFQA 3MWLA 4C0SA 4ZOLA 3NYIA 4M0MA 1ISFA 2AJBA 3T41A 4EJSB 5LD2C 5EIBC 5BXYA 3HKCB 1KRXA 4JU8A 4QBHA 3BC1A 1V1MA 2ZIXA 4HB2A 2JF0A 1FZQA 3PFNA 3PDUA 4FBMA 2OHFA 4G8CA 2GCIA 1KY4A 1FTSA 1QCZA 4A36A 1VBKA 1JL3A 3F67A 3HWRA 5F2OA 3UJ7A 1Q1GA 3NTRA 3FTCA 1I10A 1MDFA 2ZJ0A 4DPMA 2NUPA 3CG4A 1B0ZA 2FN8A 2ZI6A 3S8EA 3DVQX 4BX2A 5JLAA 2HJHA 3QU7A 1DMSA 4MO2A 1LLDA 2ZB4A 3R7WB 1GPLA 2XUQA 2ZAMA 5FBWB 1D6SA 3HL4A 1NF2A 3DTTA 1H2WA 3QUTA 3WYDA 1QUFA 4J1TA 3MW8A 1JRLA 2OBFA 4PS0A 5BMOA 3H11A 2UZ0A 1LH0A 4RZXA 3HR8A 4ETNA 1ZRMA 5BSGA 4OJNA 3D3QA 2QM0A 3MSCA 1LB1B 4XAQA 5EINA 3IIEA 2R25B 3AO0B 4C0WA 2QQEA 3EXHB 4CIYA 2V7TA 2IDKA 2QYTA 2XJ9A 2GHRA 1HMYA 4BV2A 1NUUA 3N8DA 5IAEA 3R7LA 1UKZA 3I6QA 5FR1A 2IKQA 3NLLA 4E5DA 5KQRA 2QRGA 2W6ID 2ZR8A 2OZKA 1P1RA 4KIJA 1TTQB 2H1LA 1GPH1 1WL8A 4EB6B 3OU7A 2VDRB 3MVEA 1KYIA 3IMEA 5G3ZA 4LTDA 3DE6X 4IG4A 2WMDA 4P3XA 2HSJA 3AFMA 2WIAA 3VI4B 4RMJA 2ZCUA 3ZZ1A 4Q9IA 2I2XB 2ONZA 2VJAA 1KZ9A 5GGYA 3UTDA 1VRCA 2D4HA 3PEVA 4PAOA 4JS0A 3EXFA 3DMTC 1P7VA 3R3XA 3QXGA 3FZQA 1Z73A 2R6DA 4R2WA 5HFJA 3EZ2A 3KQSA 1CYDA 4NDZA 5IJXA 2W2TA 2NXNA 4L50A 3CLTC 1U0EA 4YDSA 3ZWOA 2FW8A 1P5RA 3FUVA 4LSMA 4PEVA 1S2DA 3PXAA 3S6JA 4DKJA 4C6TA 2A59A 1NZDA 5JCXA 1QHHA 1GXSA 1L3IA 4W9RA 1YSCA 1Z62A 3SQLA 5C1BA 2HTFA 3UMGA 1DKMA 1JECA 1KQFA 1E9DA 1PSWA 2DG2A 2IOHA 4ACBA 3O2QB 4J6EA 4YCBA 1WB6A 1KMIY 4LMRA 4RTMA 2XUDA 5TT0A 1UXGA 1U3GA 2GK7A 3ZHTA 3PQ4A 1EAYA 2XDWA 3X1MA 3TFOA 1YQUA 1E5QA 4MYSA 4P2GA 4LOLA 1R5OA 4RA9A 4FSHA 3X44A 5IF9A 3K09C 1X87A 1GNSA 2Q5JA 2QG6A 4EY6A 4RTLA 2GKSA 1Y5LA 1ZONA 5FWDA 4AKSA 1S8AA 2BKEA 2Z0MA 2O4CA 3WIOA 1LBTA 1V1RB 1YAHA 4ENWA 2ZSIA 4F86A 1R8SA 1PJZA 4M7WA 1XF9A 3F49S 4BIMA 2X3YA 2XTAA 4LAFA 4X61A 3ISTA 4Y9DA 3S5UA 3O3MB 3CW8X 4U9HS 2VPTA 1N5IA 2HTEA 1OREA 4YRAA 4ITUA 4AG3A 1MMFB 3D7MA 3E5HA 1TLTA 3HHPA 3K4HA 3MGAA 4QEDA 1NI4A 3EC2A 3AR9A 4DA8A 1SC6A 2J0VA 3KSZO 2ASVA 5KQLA 3ZDEA 1XQVA 2EP5A 5ADVA 1YA6A 3OSZA 4Q9DA 4QUJA 4R05A 2FCRA 2C98A 4FMDB 4X7RA 3BD9A 3AGQA 4JL5A 4YFVA 3LBAA 1Z17A 5KVQA 5AP9A 2QG4A 4BMVA 3DV9A 3JD1A 3HXQA 2JA1A 3QHAA 1JSXA 1KSJA 2Q3CA 3VYUB 3HP7A 1K5HA 2OTCA 5DYTA 4AG6A 3AHIA 1AV7A 5DN9A 4FB5A 1AQJA 3B60A 4GUDA 3EVEA 4LY0A 5J1TB 1N6IA 1LCIA 5EUMA 2Q2VA 3PD1A 1IVSA 1RXEA 1UPAA 4Y9RA 2PKEA 4EHFA 3GGDA 1T2VA 2WI8A 4FZVA 2WSYB 4MP6A 1L4KA 5EGSA 5FDFA 5J47A 3JZAA 4GKJB 2P4QA 1R0LA 1WVIA 3V8MA 3GJ3A 1KVUA 2QTGA 1YQEA 1DC4A 5G02A 3Q3CA 4LJ6A 4O2AB 3JQ9A 3M70A 4PGHA 5CDUA 5GVRA 5JNSA 5F9HA 3DZIA 2BGWA 1JIIA 1SOUA 5ALEA 1F14A 4NDAA 1HNXB 1DBPA 2BY4A 1O08A 2D2IA 3INYA 4OLJA 4QXOA 1MHPA 2OSBA 3DR5A 1KERA 5I48A 1O0CA 1TVMA 1NA5A 3A2KA 1C2TA 4HX2A 4CQMB 4DZZA 5GP1A 3HGTA 3ESAA 4RPIA 4FSXA 3A6LA 4NWIA 1YH3A 4FEEA 4WFIA 1NJSA 2H5IA 3L5KA 5DT9A 3EJWA 4W1SA 4DLVA 5IJ0A 3HU2A 1JLMA 2VK2A 1TUBB 2C4UA 4UUAA 5C8DA 4P7KA 1F2TA 4KR2A 1N8KA 4CEIB 1G5FA 1TKRA 1T36A 2PXHA 2X22A 2MWMA 4L51A 2CNBA 3KUXA 1OXTA 1US8B 3FPFA 3EOZA 3KZ1E 2YN0A 4Q6WA 4ZYTA 3EDCA 2I9PA 2OMKA 5E8RA 2ILTA 5LNK6 4OI0A 5DGXA 5LQCA 1IL0A 1J1ZA 2QN2A 2YYSA 1EIWA 4ILKA 1Y81A 3L49A 4RC9A 3QENA 3K0HA 2C2YA 3P4YA 2FPPB 1CX9B 4JELA 4PZZA 2O8EA 1WSWA 3CNHA 1EUDB 2Y3IA 1YZ3A 4A7PA 5LA6B 1U8FO 3ZLBA 4CM7A 4GIBA 1T8WA 1DE0A 2ZBQA 4ZVPA 4RQUA 3C70A 4DUZB 2VT6A 2EARA 1V8FA 2JCXA 3DULA 2QW0X 3C3JA 1C4KA 1D2NA 2OO3A 3CB4A 3N87A 3FPGA 3NFRA 4IXWA 4ZANA 5E7JA 3RC8A 3K7EA 3DVRX 3HR4A 3W04A 2EJUA 2VDOB 4H6XA 3HBLA 5JADA 4GDMA 3QKWA 4LC1A 1YF3A 4OMFG 4YGYA 1X7ZA 4CF5A 2QTMA 3RS2A 3ZD8A 4GRIA 1MHTA 1X1TA 2PGOA 3O74A 4WEOA 1Z38A 2SBTA 4EKYA 4LV6A 1ZINA 1EXDA 1EUCA 1FP2A 2C4HA 5JJKA 3LZCA 3EC1A 1KC1A 2O1SA 3I2JA 3EGCA 4FOPA 4P1ZA 5FT9A 5FXMA 1MJGM 1OBCA 3FZEA 3U7IA 2YOFA 5ALPA 3G8DA 1U8UA 4G6ZA 4F5WA 1XLVA 3WK6A 4QD3A 3B6JA 4X90A 4K9DA 4ZCRA 4B6EA 1O87A 4P53A 4EGJA 5JZBA 3BE4A 4F60A 1WY7A 2BGMA 2AZMA 2DFTA 4FD3A 5C8ZA 3WL4A 1UADA 2FMIA 2H0AA 5FV7A 1DKLA 2HIMA 1JTEA 4JFAA 2K2WA 2RB5A 2MU1A 2QLMA 1E7SA 2OFXA 3ETDA 2I7CA 4DFDA 1RRGA 4D80A 1FFHA 2A6PA 3WLSA 2EGHA 4JQCA 4OBBA 4Q1FA 1NXTA 3D7RA 4O4LA 4Y6SA 3CGGA 1JDUA 1XWIA 2PO7A 3CN7A 3AR8A 3IMGA 4Q9NA 3VPBA 2UUCB 1A5SB 1CUWA 3WGYA 4DE5A 4I1OA 1XVVA 4PX5A 2G7MC 3KKZA 4J91A 4FS8A 1FFWA 1HF3A 4OPMA 1Y34E 1ZMRA 5T6MA 2O2EA 2FW9A 3H2BA 3KHTA 1NDUA 4N6NA 1OOEA 1ID1A 1J0EA 4GL4A 1UBTS 4P0PB 3X1DA 4NBSA 5EZSA 3JXEA 3S7TA 1NP7A 2BH9A 2HDNB 5DT2A 4NLLA 1KH1A 2MYNA 3S8MA 2AW3A 4X93A 1P7CA 4RK0A 5DX8A 3UQZA 2NP6A 1V6AA 2YASA 121PA 2Q6LA 3FMVA 5ICCA 5JCJD 5A3RA 2C77A 4K87A 4Q1BA 3LX5A 1M8GA 4A2WA 1P3JA 1JI3A 3QKRB 2DFLA 3DUWA 2PR2A 4LXYA 4DAEA 1JG6A 2FVYA 3DXYA 4W5JA 1H6BA 1J06A 1WABA 3EZGA 4XVUA 2DQKA 3OHPA 3HN2A 4EGSA 4YR7A 3U49A 4DT1A 5CDTA 1WXGA 4EQZA 3PC8A 5ANRB 1L7OA 2WJGA 2QRUA 1VMIA 3O92A 4YJ3A 1VKNA 4RK1A 4LJ5A 4H3VA 5HQJA 3AF3A 3IKTA 3RYCA 3A14A 4OU5A 1TNDA 1RWMA 4DMFA 1H4TA 1N6KA 3EG5A 4TMXA 1H1DA 4HDKA 4PZPA 5TQVA 4MGEA 2FMUA 1PQ4A 4N76A 2QX6A 4M0UA 4LBVA 4WZAE 2C9CA 1BCRB 1RM5A 3TK1A 3TKLA 1L6IA 2WF8A 3TQRA 3UB3A 1XHLA 1WHSB 4EHKA 1M76A 4KNVA 3BRWA 1H42A 1S2NA 3PPWA 3VOTA 1U1GA 1GV1A 1ORDA 1JHZA 1KI6A 2J3DA 1XZLA 1X15A 2SECE 2ZBFA 4NZZA 7GPBA 1APBA 3ANSA 2YNMC 5I4CA 1PS0A 3RHFA 4Z2YA 4L95C 1Z2AA 3JTMA 2FFHA 3GDWA 4IIDA 1X42A 5B2FA 1ECCA 2IY7A 1ZU4A 2C3OA 2REQA 5FORA 3QI2A 3AB7A 2I76A 1T4CA 1VE9A 3JAWA 3STHA 2HLHA 5JISA 1GSOA 1UFRA 5F33A 4IZIA 2M1XA 4MR9B 4LV5B 2PT6A 5HF6A 3V4FA 5CD9A 1BDBA 3QPVA 1WE2A 1L5MA 4RFSB 3PUWA 5C1DA 3A3KA 2WF6A 3O95A 3RWOA 3ZPXA 4OJKA 1CJSA 1YR8A 4H08A 2F17A 4HPWA 4HUQB 2GCGA 2IE0A 3E9QA 1ZCAA 4L5AA 1UMBA 3OF2A 4LFCB 4AZ3A 1NJ5A 2PQMA 1JX6A 1I36A 1JZQA 1SXHA 4H16A 1EBUA 4KN5A 1FLDA 3LHSA 2RCNA 2VS1A 4YUXA 3EEIA 2KW5A 4NNOA 1AKTA 5IKPA 1Z29A 4LV8B 1GVHA 1C9DB 1WMEA 3FJYA 4DILA 2GASA 4XWWA 1ZSYA 4W7HA 1N3IA 1PZEA 1ST3A 1VXOA 3PL1A 1GYQA 4Q03A 4RJ2A 2MINA 3RW9A 2ECFA 1JVBA 3QVXA 4JI0B 2F1IA 2OCXA 4PNHA 5FBHA 3LSTA 4RTNA 1MPXA 4QDTA 2OBLA 3K8YA 1IJBA 3MLEA 3ANTA 3HYTA 4Y30A 5E1DA 4DLKA 5LQMA 1EU1A 1QV9A 2JK1A 4EKIA 3X3HA 4IXNA 3DUFA 3KPVA 4RH1A 1K2WA 3MT9A 3CXRA 1D7OA 1AG9A 1T9GR 1X1SA 3DAYA 3LT4A 4JLPA 1GA1A 5EIBD 1Z36A 4XVRA 3EQ9A 2PJRA 4KXNA 1TJPB 4UTOA 3Q8KA 2OG2A 1M2EA 1GPWB 3R41A 4HDRA 4HDAA 2PMBA 4JROA 1DKQA 5FO1A 3UPDA 2C04A 1YUMA 4G5QA 5T8KA 3P1JA 4B31A 4FIDA 3DE4X 4HY3A 2YJ6A 4HYYA 4MWEA 4DXHA 2X8AA 3I5YA 1LBIA 2WZDA 2OLJA 2C7BA 2FPSA 3FD8A 4OY3A 4HLUA 4TTRA 4F72A 5JHGB 1P1CA 1QRUA 2F6RA 2HBYA 2LKDA 2WYHA 3HY6A 2AVNA 3A10A 1S1MA 3W5UA 3HXTA 4FMCB 1OIWA 5EXXA 3EGXA 2CV0A 3N2YA 4F1JA 1SU6A 4S0XA 4KWHA 2J5KA 1DCFA 3GGSA 3ZV5A 1UJ2A 1GUDA 3HCFA 5AM5A 4LX8A 2Z98A 3MGGA 3L8HA 4DMRA 2J85A 3QKRA 3IP8A 4K28A 3OAAA 2AD5A 1GL3A 1Q0SA 2FPLA 1JIXA 3LVRE 5AJXA 3T9AA 5K6RA 5CW2A 4A91A 2PUGA 1VHTA 3GAMA 3NM5A 3Q3JB 4R1NA 3U56A 2QTAA 5CGZA 1E5LA 1WF6A 3TTXA 1C4WA 5CFPA 2H54A 2JANA 2HPVA 2HN9A 2JLSA 3F8TA 4HGZA 4IDDA 3USCS 1CCWA 3CLRC 1N0HA 2PV0A 2Y1GA 5AM2A 2UXBB 4J2TA 3A58B 3OEYA 2WIKA 2B3TA 1DTWB 2VTKA 3SC4A 4HDRB 5IG2A 3U7FB 4GXTA 4C07A 2R1VA 4PBSA 1IJKA 1P4AA 2Z58A 4OQFA 4M7OA 5BNFA 2ZJAA 3ZU3A 2OUKA 2O1EA 1MZVA 3ENKA 3DXZA 4BNWA 4WIAA 3DMNA 1LSJA 1OGYA 1TQ2A 5C31A 3HB1A 2ONJA 2HPAA 2QLLA 5H82A 3MEQA 4XD2A 1WDLA 3S1LA 3RHTA 3HKBB 3OBIA 2NXEA 4NBWA 1N5JA 1HBJA 2P5YA 4BE9A 2H08A 1Y1LA 3DZJA 4LS3A 4NK4A 1M8FA 2O2JA 1WKCA 3RS4A 4CLRB 5GADl 2QW1A 3INGA 3KK0A 3VU3A 1GIAA 2E82A 2IOFK 4Q12A 1N0UA 1VPVA 5MN6A 2FGJA 3QBDA 2H00A 2OE2A 3COPA 1INLA 3MC1A 4FCWA 3LFUA 3H9GA 4NBUA 3KXLA 2O6LA 4QHSA 5DI3A 5ALMA 5ECDA 3SKYA 3WKDA 3EY9A 5LLTA 3VHXA 3MZ0A 2FWMX 4K7JA 4WDQA 4K9LA 3TD2A 2WFAA 3NBKA 5TR9A 1Q1QA 1ZG3A 3OQ6A 1NE2A 3FAKA 1RKQA 3OQMA 5I51A 3JQDA 4L4UA 2CCKA 4ZT4A 1BYIA 1XNRB 2BBWA 2EL9A 2EJCA 2QAGC 4WERA 5BNZA 4MUHA 1NDQA 5CT8A 5AFSA 4MQLA 3CSUA 4QECA 2IS1A 3QU5A 3MUNA 4L5YA 1CRQA 4LNAA 5BN4B 3O8DA 3KC2A 2LTAA 1JPUA 3GH1A 4P58A 1YNSA 1EWQA 1B3BA 4WUTA 5CNMA 3JD2A 1OI2A 1EJ6A 4JL6A 1N0VC 3KTAA 4O5AA 5JSKA 3VR5A 4D9CA 4KTVE 5HSGA 1FX1A 3ZHZA 5IW8A 8MHTA 4WVFA 4PZUA 1RI4A 4YECA 1M6NA 2F1JA 1B43A 2VOJA 4UASA 4J0EA 2P2LA 4RMHA 3HCOA 4WLVA 5EP2A 3GAZA 5FO0A 3OOWA 4NP6A 4RKWA 1UM9A 1MW9X 1EUDA 3G7NA 5BYJA 3QYAA 1HNNA 1T5DX 3HDGA 4N6GA 3C8DA 4Y2GA 1COWA 2YS7A 5F3RA 3BHNA 4X1IA 4QFCA 2DZDA 2ZAYA 3GC6A 1J7JA 4F4UA 3LK6A 4FE4A 4MHTA 1OR8A 2C95A 3HCEA 1VE3A 3GF4A 3MRSA 1JJBA 4TRMA 4WZAA 5F12A 5G0UA 3LF1A 1ISPA 1II0A 1THMA 3LBFA 3RIEA 2CXUA 4CMIA 3VOSA 4IIJB 5DKFA 5L3ZA 3HBMA 5BWMA 1GA4A 5JOQA 3GQBA 3BZWA 1WCIB 2ISSD 2ZVJA 5ESRA 5K05A 4DT1B 3QKTA 4C0AC 2VBGA 3HUDA 4IHAA 4TVBA 1HX7A 3SIXA 5HZHA 2DHCA 2JHGA 5FPYA 3QMWA 2ZZNA 2VHQA 2ZRPA 2H8GA 1PVDA 5CW1A 2P6RA 1M2VA 1U7DA 3LIIA 4WJZA 3W5SA 1IY2A 1KAGA 2OCGA 4JEHA 1V16A 2JJQA 1MH9A 5AK0A 3C4JA