5TB5A

Crystal structure of full-length farnesylated and methylated kras4b in complex with pde-delta (crystal form i - with partially disordered hypervariable region)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
184
structure length
172
Chain Sequence
b'GTEYKLVVVGAGGVGKSALTIQLIQNHFDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDKKKKSKTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
molecule tags Oncoprotein
source organism Homo sapiens
publication title Structural basis of recognition of farnesylated and methylated KRAS4b by PDE delta.
pubmed doi rcsb
total genus 61
structure length 172
sequence length 184
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5tb5A00
3AUXA 1XZQA 4ESHA 2D7DA 4W7SA 3VAAA 2RGNC 1RE0A 4YDHB 1KI9A 4A92A 1LTQA 1ZD1A 2KI5A 2ZRAA 1E96A 1W5TA 4Z8XA 2RAPA 4AK9A 2QZ4A 2BV3A 3LNCA 5KPJA 1E2EA 3FYHA 2OCBA 2QAGB 2VSOA 2WJVA 2VP5A 3VHLB 3K0AA 2FOLA 2ZRLA 1JQJC 4ZO4A 4R9UC 3UATA 3WMEA 5B30A 2L0XA 5JHGB 2J0UA 2V4ZA 3GLFA 5GADl 1VG1A 1N5LA 3HP1A 5KSZA 3I5YA 1XCGB 2E1RA 1BIFA 2ZQ5A 4JLMA 2C8VA 4NYJR 5TARA 2QROA 4LYHA 3EZ2A 4LHVA 4QOSA 4TZ6A 2LWIA 4IOMA 3C5CA 4KITB 3SI7A 2DFNA 5EXTA 1KOFA 2RGCA 1CXZA 2V55B 4NCIA 4Q00A 2A5FA 2F3TA 6Q21A 1ZM2A 2HUPA 4TLBA 3SBEA 1U0JA 3CH4B 5TXGA 2BM0A 1N25A 1P5ZB 1BMFA 4URZR 1PUJA 4GBMA 3KJGA 4MRRA 3KJIA 2NOAA 3SYNA 4P4UA 4MKIA 4I1SA 1G3RA 2IEYA 3OESA 3TVDA 2O8CB 1M7HA 2QGZA 1M7GA 1G4UR 4KI0A 1IY1A 3L43A 3CW2A 4RD4A 2YZ2A 5HTKA 3NEJA 3T12A 1DPFA 1KK2A 2ODEA 1QG4A 1Z6TA 2FFBA 3N70A 1ZW6A 1W1WA 3AVOA 4U02A 1E0AA 2IHYA 1D2MA 1E1RA 2YOHA 5JWHA 2ZYWX 3RSLA 5BWMA 1ONBA 4I99A 5DHAA 3MWJA 1X8KA 3LA6A 4WAUA 5GJBA 3EWAA 2WKPA 2ZRMA 3U6BA 2O8BB 1GM5A 3BC1A 5FOVA 1OHHA 2D7CA 3T61A 1CEEA 3KXIA 3D3QA 1FUUA 5ELXA 4KVAA 1IN5A 2GJSA 2OZEA 3SN6A 3W8NA 1FOEB 2KBFA 4PHGA 1QVAA 2IYWA 1CJTC 1WBDA 2Q3FA 4I1VA 1XU4A 2EYQA 4A0GA 3GJ0A 4XWAA 3ASZA 1CF4A 5LPNA 2XTZA 4XIGS 2OEPA 5IK2A 4TL6A 5EUMA 3AVPA 2JLSA 2QTHA 4OYHA 4F4CA 1SKYE 5KDLA 5DHFA 3A1WA 4ASUA 3ZQ6A 2V7QA 4Z1MA 4UXIA 5EE9A 3IEUA 4HSEA 4A0RA 3TAHA 3H1TA 4C0QC 1FL9A 2H57A 2HJGA 2QSZA 4W5WA 4MRPA 2QTVB 1GRRA 4LJAA 1HURA 1XCMA 2J5XA 1I4LD 1LS1A 4PSKA 1I2DA 3VR1A 2PCJA 2Z43A 4GFDA 4BUJA 3ICEA 5AJVB 5EE5B 3KL4A 2QNRA 3IO5A 5TY0A 1OIWA 1GNQA 1SVOA 3T5GA 1VECA 3MSXA 3IGFA 4HZUB 2W83A 1E99A 1RRFA 2H8KA 3KTAB 4XVQA 5AUNB 3K9HA 3WRYC 4F4JA 3GP8A 3I61A 1XFAA 1XTKA 3T1QA 4BFZA 2FEOA 4Q4JB 3BIFA 4B32A 4RD1A 3EPKA 2AX4A 4NCHA 3ADCA 1M34E 3SR0A 1IN7A 2IYYA 2J45A 3GQBA 3R8CA 2IWRA 2BC9A 4ACAA 4OKSA 1KMHB 1HV8A 5KNDA 2PX0A 2YWHA 4NYMQ 3QXCA 4R7ZA 3H4MA 2IBMA 1XXHA 2W0MA 1PLJA 3JZMA 3U3KA 2AN9A 2Z0MA 4NL4H 4D4KA 3GEIA 4IXMA 1G16A 3VMFA 1KY3A 4BRUA 1HEIA 2ZU0C 1Z47A 4TYQA 2OV2A 2REXB 2AK2A 4DKXA 1TQ6A 4TT3A 4AC9A 2XB4A 4NHOA 1Q12A 4GL2A 3ASYA 1RFLA 4P33A 4WW0A 3ZZUA 3CWZA 3MUFA 4DSTA 2ZTSA 2VF8A 5TVKA 2JLRA 1NKTA 2TMKA 5CIWA 4F4IA 5C2JB 3CO5A 5EXSA 1E79D 1Z07A 1A4RA 2FZ4A 1G6OA 2XTMA 1XF9A 4PPGA 4JZKA 5JFGA 5KTYA 3KFXA 2XXAB 1NN1A 4TLEA 4RY2A 2QQ0A 3EW9A 2WIBA 3SHFA 4YDSA 2AK3A 3LH5A 2FE4A 1JI0A 3FHCB 2ZPTX 2CNWD 1MV5A 5SZIA 3ZJYA 1G8FA 3E5HA 2H17A 4LJYA 1LF0A 1XCPA 2ANCA 1COWD 1ZM4A 2KBEA 2C5LA 2ZUDA 3F5FA 1SXJC 1II8B 3U2QA 3FB4A 2QT1A 2JEOA 3TMKA 4YXWA 4B6EA 2BHRA 5CDFE 1DAMA 2C9YA 4OJQA 3CF6R 4PZYA 4JVLA 1U9IA 3QJYA 4A4DA 2RHMA 2F7SA 4LZZA 3TH5A 2OESA 2RGXA 4DHEA 2YNMA 1S3GA 3LRPA 2D3WA 2ASEA 5KU1A 3I72A 2PJZA 2AKAB 3QENA 4EPXA 2PLFA 2CCJA 1W7AA 1RYFA 3U7GA 3THXB 1RRPA 1YZUA 3IO3A 3Q7PA 2HXSA 5E3HA 4MYTA 3TQFA 4XWKA 2ZU6A 2Y8EA 1TEXA 2C9CA 2EWVA 2P65A 4IOKA 4M1WA 5DH9A 1N6RA 1XMVA 2LKDA 1T8TA 5EP2A 2AD5A 2BOVA 3OFNA 2OUKA 2I1VB 3SJBA 3WNCA 3BFXA 4TZ0A 1G20E 2QQEA 4DUGA 1GP2A 1TNDA 3VR2A 2QMEA 2OBLA 4C0SA 1W36B 1CP2A 1Z2CA 3LAWA 1H8HA 3CWQA 4EPVA 2QP9X 4B3GA 2Q3MA 2GILA 1KDPA 3EZ6A 4HB4A 4MKFA 3PUXA 4JLDA 4OJKA 4MUAA 2WZQA 1F2UA 2ZAMA 5EP3A 3U3MA 5KOYA 3TUZC 2MMGA 2V1XA 3S1AB 1DADA 3EIEA 4M4SA 4B47A 3HR7A 1XEXB 4ZDWA 4YC7A 3HU2A 3GJ8A 4DSUA 1F2TA 1KNQA 2JCSA 5H70A 3IIJA 3T1OA 3WYAA 2A7QA 5KYKA 2QU8A 3MWKA 3KKPA 3RRNA 4QBIA 4QJ5A 3SQXA 3Q3JB 5FPSA 1KZGB 1DAFA 421PA 1N6KA 2QE7D 3O8DA 2Q9AA 4LUCA 3B9PA 1G6HA 1GITA 4TMKA 3LD9A 4JLPA 1P75A 1AQYA 1Q0UA 4C0LA 4YXWD 1QHSA 4O3MA 2X1VA 3BWDD 2G6BA 2ZXUA 5DN6D 2YC4C 2ZI9A 4URXR 2JLUA 3TE6A 1X1RA 4Q7MB 3V00A 2QBYB 3QXJA 1WB9A 1JJ7A 5TDHA 1R0ZA 2YOGA 3HDTA 2HCJB 3BK7A 3CRMA 3PUWA 1N6LA 3DVLA 4LHXA 2A5GA 5HZKA 3U44B 2O8DB 3CNNA 1E1QD 5L8VA 2F1IA 3IPXA 2FFHA 3A4NA 1FNNA 2PEYA 4RZ3A 1X3SA 4TMVA 2JDID 1O87A 3P1JA 1G4AE 1N6NA 2GAAA 3R7WA 4ERNA 4LOAA 2JLYA 4D0GA 2QP4A 4M1YA 2OCYC 1AIPA 3UMRA 4D4LA 4IFEA 1NKSA 4KODA 1XNJA 4LV5B 2FWRA 4PZLA 2ONJA 1JPNA 2QMOA 4XD7D 1GTVA 2GCOB 1G41A 4CEHB 1HYQA 3B13B 4A8JA 1E98A 2UZIR 3QKSA 1Z0DA 2XNDA 3QEJA 4JBWA 4BPBA 4AG5A 1IXRC 3L82B 1E4VA 2WIAA 1FPMA 4G1UC 4GRAA 3OIWA 2N42A 3U61B 5L3QB 1OFIA 3ICQB 3KX2A 2CXXA 3FHOA 1KI7A 1QHNA 3GFOA 1OFHA 1KO5A 1ZM3A 2FZLA 3LVQE 4OQFA 2AXPA 4DCUA 3R7WB 5BN4A 4WBSA 2G3YA 5H1YA 2Z5FA 1DG1G 2KE5A 1CS4C 1KI4A 4JLJA 3K0CA 3NWJA 2A30A 2WICA 1QF9A 4ZCIA 4YMTA 1TUEA 2B8TA 1ZIPA 2D2EA 2AFIE 1LW7A 3C7KA 3G82C 5FTLA 1W4CA 4JL5A 5FFMA 4D80A 4TMTA 1LFDB 2FPLA 3ZVNA 2OBMA 2YC2C 4Q4LA 4B3BA 2ZANA 2QBYA 5LBIA 2ZR0A 3BORA 5LB2A 1OKKA 4PSVA 5EXXA 2VHQA 1GIAA 1PZNA 2D2FA 3L0PA 1QG2A 4RFVA 4DLXA 4D82A 2VA8A 4KYUA 3RLFA 2ZUBA 4OQXA 1Z08A 1GRQA 1E79A 1T8UA 1N0VC 2GEUA 2MMCA 4GMDA 5B2ZA 2H7VA 2FA9A 2GAOA 3BE4A 3KZ1E 4DJTA 1M8PA 3PQCA 4ZI2A 2J87A 1CR1A 4DDVA 1RC8A 3L8ZA 1E9BA 1XBTA 2QN6A 3LW8A 5J4VA 2REOA 3U4QB 4JYBA 1JAIA 4CW7A 3PEUA 2NO1A 2QUZA 4UQOA 3EARA 1SVIA 4IW3B 5BN3A 3B7GA 1XXHE 3S1AA 2X2FA 2G88A 5CB8A 5CDFA 4JLNA 4D2IA 4B74A 4DLVA 4A6PA 4PHTA 3SNHA 1ESMA 2F3RA 2VSXA 1P2VA 4JT4A 3TUIC 1WRBA 1E2MA 1ZJ6A 3Q8XB 1AN0A 3BH7A 4TQAA 5JI3E 4IHQA 2R6DA 3ZYCA 1OIXA 5JECA 4B75A 1WCV1 3MD0A 2J41A 1UEJA 3W6PA 3JZAA 1Q1BA 1R0WA 3GLHE 4XH9B 4GDFA 3THXA 3Q5EA 4BFXA 5HKKA 5HCNA 2CVHA 4LBYA 3GLGE 1NMXA 3NXSA 5LDDC 1RRCA 3GFPA 3HR8A 521PA 4HAXA 5F2EA 4QM6A 2WV9A 3BRWD 4MDEA 1Q21A 3DM5A 3IIKA 4P4SB 1T9HA 1ZM7A 1R6BX 1PUIA 3OF5A 1ELOA 1QDEA 1G291 4MRSA 3E2IA 4FXPA 3VKHA 3WMGA 1UKEA 3UWKA 1OSNA 2JJ2D 3NVAA 3QKUA 5DO9A 3RABA 4CEJB 4OI2A 4M21A 4NYJQ 1OFUX 1YZKA 1G3IA 4MRNA 5FBWB 5GVRA 1UKYA 3THWA 2H1LA 3WXMA 1V43A 2FV8A 3AVQA 4RVCA 3VKGA 3CUEF 4HAUA 4QHYA 4LY6A 2ZREA 4TSFA 4ARZA 2WSMA 4EQ6A 3MJHA 3LX5A 5FI0B 1KKLA 4FN5A 2O52A 1WA5A 3U5ZB 4CT5A 4D26A 1IM2A 3I8SA 4FCVA 1ZD9A 1JQLB 1E2GA 2CNWA 3MFYA 2BWJA 1GFIA 3MCAA 1E9FA 2CEAA 2EW1A 1BH2A 1X86B 5E4FA 2NO6A 4XVUA 2JJ1A 4K46A 4OHZA 1W47A 1CU1A 5EJEA 3KB2A 1Z06A 1XTRA 1SHZA 1G17A 5JBQA 5KSOA 4DZZA 4EPYA 1NVVR 4DCTA 3U3JA 4CF7A 2ANBA 3EPLA 3VFDA 4G5RA 3T34A 3EG5A 5HR5A 2XOKD 2P2LA 1YE8A 3LV8A 1FW6A 4M1MA 4C30A 1J2JA 1KMHA 5AK0A 3W9YA 4DLYA 2HT1A 2QE7A 3E70C 3P4XA 4DEYA 4A8JC 2BDTA 2YWFA 4DC9A 2J0QA 1BKDR 1T6NA 2GTPA 2WAYA 2WWHA 4DT1B 4Q4JA 2GXAA 5C18A 4U5XA 2CJWB 3BFVA 3N2EA 3I92A 1NSTA 1DAEA 3T1TA 2ATVA 2SHKA 1G5TA 4TL9A 3CM0A 4IKEA 2CHGA 2EFEB 3CRVA 1SXJB 3QF4A 1Q1ZA 4AYXA 4FMCB 2W0SA 4HDQB 3ZVMA 1XPUA 1W44A 3WYGA 1MKYA 2P5TB 4OHXA 2EFDB 4JVMA 1QZXA 2QGNA 4ZDIA 2WJYA 3EXAA 4QC2A 2DY1A 3CPJB 1W48A 1Z6GA 1Q57A 4R2HA 1OH8A 1K8RA 4V0MA 5BYKA 1AK2A 4RKEA 3ZLJA 4DLZA 1YJ5A 3DOFA 4V02A 5JZVA 3GJXC 4OHVA 2D06A 4PC6A 1DEKA 1T0HB 3CONA 3REGA 4MYHA 1XTJA 2GKSA 2P67A 2ZROA 1G8YA 1CKEA 1G8HA 3BB1A 4NTZA 2GXQA 2J3EA 4TYNA 3IQXA 5BW8A 4EIWA 1IJFA 1SVKA 3X2SA 4ON9A 2ZRIA 1T3LA 1T0JB 1OH6A 4WXRA 1EFUA 4LRWA 5AJXA 3QXSA 3IEVA 2QPOA 4HB3A 3K70B 1CJVC 4UNQA 2OXCA 1TL7C 1YQTA 3WP1B 4H1VA 2O8FA 1FQKA 2CVFA 4PSAA 4QFMA 3IBYA 2O8FB 3UIEA 1P2UA 2IT1A 2NO7A 3BAFA 5CLQA 3AV0B 3MWYW 4JSYA 2GRJA 5G3YA 4CT4B 2JIZA 4LJ8A 3SE0A 4A0HA 2G83A 1TF5A 5IHPA 4A36A 3SEAA 2ZUCA 5G41A 3O8CA 2MSDB 1EWRA 2R2AA 5JWRA 1GNRA 3ND8A 2GJKA 2EFCB 2XSZA 4AY2A 2GF9A 3GEHA 1VHLA 3RS5A 2NO0A 1J7KA 3A1TA 2EFHB 2ZVPX 1NY5A 1YZQA 2VHCA 3LY5A 4TL7A 1KYIA 4B6FA 5JJLA 4EJSB 2GETA 3REFA 4ZDKA 5DIFA 3RS2A 4QKQA 1N6OA 1SVLA 4Q21A 4DUGD 2XB2A 1DARA 1SXJA 2CK3A 2ZRGA 4IVQA 5EE0A 1KI8A 2ZRJA 4NCKA 3F0TA 3FGNA 1E9CA 5GJVC 1TQDA 1JAHA 4JKYA 4F7WA 1U0HC 3B1YA 4OQMA 4US0R 1T91A 3SC3A 4HLDA 1NVUQ 1P2TA 1UADA 2CE7A 4M9QA 5FL7D 3WBJA 4DT1A 3A1UA 4A6XA 1UJ2A 3BJIC 3RAPR 1KTVA 3A58B 5FOWA 1SQ5A 2N1BA 3AKYA 2VLIA 1BMFD 2CHVA 2GEDA 5DI3B 3R8FA 3D8BA 3KB1A 4GNKA 2ZS9A 2YVUA 5E7JA 4B48A 3EIHA 3DHWC 3WBKA 3AF2A 2FG5A 4G5SA 3CIOA 5D3QA 3NKVA 3UMFA 3GLFB 1E69A 5EXPA 3KQHA 2ODBA 5M04A 2JATA 4TMWA 5AUQA 2V54A 2B6HA 1GRNA 3WP0A 4G5OA 1FFHA 1P6XA 8OHMA 2GK7A 4QGFA 1NLZA 4DB2A 1EFRA 4MQBA 2RH5A 4UJ3A 1Z6AA 3A36A 4I1UA 3IILA 4TYWA 3GLIE 1W4RA 3SBDA 5LD2C 4PHFA 1W0JA 4AKEA 2CE2X 1P9WA 3VX3A 2A3RA 2JJ8A 3QKTA 4HLCA 1E2QA 3G5UA 5CYOA 3SYLA 4Z51A 3L0IB 4HZIA 3BD9A 3B1ZA 3T1VA 3QF7A 3THOA 1E2JA 4H1UA 4Q1DA 2OLJA 1N5IA 1TADA 4Y0AA 4M1OA 2EU8A 1ZU4A 4XTCS 1ANKA 3FKSA 3FMOB 2VYFA 2F9MA 4PAOA 4A0FA 4NZYA 5FUYA 2PZEA 1D6JA 1OFTA 1D9XA 4LJ9A 4URUR 1ETUA 2G77B 3IPYA 1RKBA 1JECA 621PA 3K53A 4QM7A 5LD2B 3AVVA 5KPDA 1LY1A 1VDZA 2CCKA 1I4DD 1JJVA 3QG1A 1D2EA 1E2PA 1NLYA 1NRJB 1P7CA 1K6MA 2GCNA 4MYUA 2E9SA 2VEDA 4F38A 2V9PA 3FWYA 1N6IA 5H68A 1IHUA 3I5XA 2O0JA 2IS2A 2QT0A 3QIAA 4BFWA 2WWWA 3I4LA 4UXJA 4Q4AB 4PC3A 1UFQA 3Q72A 2FJUA 3AP2A 1F6BA 3ETLA 2BJVA 3TSOA 4LYJA 1KMQA 3SU8A 3ZDQA 3CBQA 1HUQA 1UBCA 3EWSA 1WQ1R 5FTNA 2PLRA 4F91B 2GZAA 2IUTA 1RZ3A 1NI3A 4LSGA 4B3DA 2GESA 2VHTA 2DWOA 5EZ5A 5EQTA 4LGMA 2NIPA 4B35A 3C15C 4KSBA 1MO4A 1YZNA 4JIMA 1W0KA 2Z4RA 2IWHA 4K8OA 2IYXA 3RSOA 821PA 5JS7A 1QHXA 1XP8A 3EPJA 4DIDA 2F1HA 2XX3A 3VX4A 1W4BA 1CULC 2AR7A 2ZM5A 1SVMA 4Q1AA 2J7PA 1QHIA 1VKJA 1RRGA 3GPLA 2W58A 1GKIA 5EP1A 3PUYA 1XTQA 3OE7D 1I2MA 1A7JA 3CRW1 4QBFA 4IDHA 5B64A 2CHQA 3K9NA 3KQNA 2QA5A 4TLAA 5JWOA 3K0SA 3PUVA 2CDNA 1N0UA 4RZ2A 2HLDA 1FP7A 5FUXA 1HE8B 1G5RA 4HAYA 2R62A 2QEQA 2VSFA 4RD2A 2Q21A 3NDBB 4B34A 2HDNB 3GLGB 1KDOA 2CL0X 4LHYA 2JAQA 5BQ5A 3K9GA 1JBKA 4KXFB 4GOXA 1ZP6A 3PUZA 4D0NA 4I81A 4B76A 2Q0HA 4QGGA 1X1SA 3KJHA 4Q1FA 3ZIAA 1NBMA 1OXTA 4ZCMA 1H8ED 4PXAA 4HLUA 3TSZA 1TUIA 4KVGA 3VR4A 3KQUA 1RJ9A 2A9KA 2ZSAA 1YR7A 4V0LA 2J46A 4FI3C 4KFRA 2GEVA 1MABA 4JL8A 3UXMA 3QUSA 2GZDA 4CEHA 2GCOA 5HCIA 1E0SA 3FFAA 2GBLC 1D2NA 3B60A 3NH6A 5DYIA 2PT5A 1GOTA 2ZR9A 4GT1A 1G19A 1HT2E 2V1UA 2XZOA 2VHUA 2ZYTX 1WDTA 3U7HB 1A2KC 1J8MF 2B21A 1VCIA 3C5HA 5SZHB 3DZDA 2XOKA 2ZI7A 4LBZA 2FGKA 2ZR7A 1ZD8A 4B3XA 3M6AA 4BLQA 1KO4A 1UBGA 1G9XA 2PMDA 2ZRFA 1S1MA 4HDCA 3ZVLA 5F3WB 2IEZA 2ZRKA 4MH0R 1GDDA 1E32A 2G9NA 1PJRA 4ZDJA 2YWGA 4NH0A 1CRQA 2PZGA 2O8DA 3GJ7A 3RWMB 2OT3B 4JL6A 2GXUA 1M2OB 4FMBB 3AP3A 3RVBA 4B3FX 3MJRA 2I3BA 1JR3A 4PPNA 1Q22A 3CR8A 4Q19A 4TWZA 4AKGA 1II9A 1LVGA 4MUBA 3VR3A 3LW7A 3QF4B 2EWWA 2FFAA 1TPZA 4QHSA 4XOIA 2W6JA 2Z83A 4G0NA 1IBRA 2GHIA 4HDOB 3V4FA 3QKRB 3L2OB 2NO9A 1NSFA 4PO9A 2C9OA 3K0EA 3N5CA 3NBFA 1GUAA 1AS3A 2CJWA 2WSSD 5EUQB 4DWJA 1TQ2A 1E94E 2GJ9A 3LQRA 2X19A 3B1XA 4A2WA 4ASUD 2CBZA 3AM1A 1TX4B 2WPDA 2ZI5A 1NF3A 3D31A 1UBEA 5JSZA 2ZI6A 1CRPA 1NMZA 5F9HA 1EG7A 3DKVA 4TMZA 4AYWA 1E0KA 4C0HA 1NG9A 1CR4A 1E6CA 4MA4A 1SVWA 1H8EA 2Q3HA 1LV7A 2IW3A 2ZRHA 1XEXA 2NG1A 1R0XA 2VP0A 5FPHA 1RVDA 3AGPA 2WOOA 3K0FA 2WMOB 2RGBA 5D3MB 3QBVA 5H8WA 1G64A 3P26A 5P21A 4BZPA 3Q7QA 4M9SA 1XMIA 5CLLA 1OHHD 2ATXA 1W2HA 2BIFA 2OLKA 3KXKA 3QXXA 3KQLA 2JLVA 1DS6A 2X2EA 4Q4HA 1AKYA 4PPQA 2XJ4A 3KKNA 2OSBA 1U98A 1H65A 1EFCA 1U8YA 3QVVA 5K8LA 1JALA 3FPAA 5J40A 1KJWA 5EE1A 4ARZB 2R9VA 1VYUA 1G5PA 4LBVA 2KSQA 2NGRA 2VO1A 1KK3A 1OXSC 3M0EA 4ZCLA 1TU4A 3H84A 5AR1A 5FPTA 2GBLA 1YRBA 5DSZA 4PQYA 3I3SR 1F48A 5FUVA 3FMPB 4UNPA 3CX8A 4LYAA 2V8OA 2V7QD 2PX3A 1E9AA 3BXZA 3TK1A 1YR9A 3VTKA 2RGEA 3BERA 1AS2A 4I1OA 3HYRA 4P4SA 4UNRA 5KO2A 4LJ4A 3R9XA 4JLKA 4CDGA 5K8TA 5FR1A 3QEOA 3VNUA 2RCNA 1J99A 4QNRA 2O0HA 2ZRPA 4N0EA 3X1WA 1PV4A 1IXZA 4Q9KA 2R44A 3KUCA 3TR5A 3WYFA 1II8A 1A82A 1P72A 3EA5A 1IN6A 3EAQA 1KAGA 1H8HD 2FFQA 1UBFA 4DLUA 1E3MA 1TMKA 2GXSA 1XJ0A 1U81A 2KJQA 1CR2A 5AJWA 5C4GB 4FCTA 4QXAA 2C99A 4B43A 4D4JA 1E4YA 1DE0A 2IXGA 2HLDD 1FTNA 2P5SA 4ZPXA 1ZNWA 4C4PA 1GL6A 3AEZA 1CR0A 1S9DA 3G0HA 2QG6A 3X1YA 4E5UA 4A2QA 4C0BA 4EJSC 4A2PA 1T3SA 4LJ6A 4EKDA 1MR3F 5A0FA 1IQPA 2Q9CA 4EUNA 2IS6A 4IEIA 3V4RA 1E9DA 1KSFX 2ZJBA 2P6RA 2ORWA 4FW9A 4ZKEA 1IY0A 3HU1A 1KO7A 4ILEA 2RB4A 1E1RD 4PAQA 3K0FB 3K09A 2GJAA 2QP3A 2AL7A 3ZD6A 4LK2A 1Y63A 5FBRB 4TQUS 3KKQA 3B78A 1Z29A 4QHTA 2O8EA 4XJXA 1XXHB 2JASA 1PVOA 4HLUC 3U4QA 2ZJAA 4GZMA 4ZI3A 1AS0A 5FTMA 2UKDA 1G7SA 4LC0A 2A5JA 3Q5DA 3SQWA 4CIDA 4JBYA 4Q9LA 1NN3A 4V0ME 1GVNB 4Q7KA 3R9IA 1L4UA 4OI1A 4B3CA 4KFTA 1OKKD 1BYUA 2QMHA 4RFSB 3QKRA 4RZXA 2OILA 5JEEA 3RDPA 1JEDA 4NYIR 3B6EA 1XMJA 1VIAA 1KIMA 1EFRD 1VYTA 4R71A 1E2IA 3D6TB 3SFVA 4UNSA 4OHYA 3D7MA 1KSGA 3TR0A 3UPUA 4NONA 2ZI4A 4W9MC 3KDSE 4DSNA 3NEYA 4TL8A 2PMKA 1OJLA 3ZZ0A 3IHWA 2ZS7A 1E9SA 4KV9A 4UKDA 3B9QA 1W5SA 1P9RA 1TF2A 3PJRA 1Z0JA 2GZHA 4BLSA 3K70D 3GJ6A 1S2MA 4DLSA 3QI2A 4FD2A 2OAP1 1U99A 2A2ZA 1Y3AA 1Z0IA 4WXPA 2ZJ5A 1Z8FA 1KO8A 2OXRA 3FKSD 1GKUB 3IBGA 4Q48A 2PH1A 3KKOA 3W34A 5CM8B 4E07A 2XNSA 3QKSB 4URVR 3M1IA 2IYUA 4LDJA 1XD2B 4A8JB 3P32A 2QPTA 3HYTA 1MABB 1OW3B 4B71A 1FX0A 4PC2A 2AWOA 3AVWA 2VBCA 1N6HA 2OG2A 4Q66C 3CPHA 2ODNA 4KFSA 3VKWA 4DCVA 5IF9A 3GCGA 5E7MA 2OM2A 4JT2A 4L8GA 3LQQA 4BECA 1U2RA 4KYIB 1ZIOA 1KK0A 4CZ2A 2ZJOA 3KJEA 1ZNYA 4CRWB 3ZZTA 1U9IC 2C96A 2ZITA 4R98A 3SJZA 5J4HA 2XAUA 1E2KA 5C1BA 4S2EA 3RS4A 5AWFC 4NYMR 4QBHA 4A1FA 3AVUA 1FNMA 3KQKA 4US2R 2OFOA 3AVXA 2HF9A 3GLGA 4ESVA 1EX6A 1YU9A 3U44A 4M1KA 4QG7A 1KZ7B 2DFKB 3EASA 3ECCA 4OK5A 4TSFD 1XD8A 2ZETA 1RYHA 1L8QA 5G40A 1KK1A 2IYLD 2JIZD 2VF7A 1DBSA 4DDTA 2D4HA 1NNEA 1WP9A 3EA0A 3EC2A 5FOUA 1OLOA 1UEIA 2O8CA 2A78A 4TQ9A 1YHNA 4GZLA 1MH1A 3DZ8A 4MITA 5IK2D 2QI9C 2WWXA 4AIIA 3QPUA 5EZ6B 2REBA 1S0UA 5J47A 4BFTA 3CRQA 4EDHA 2RMKA 3B1VA 1QVRA 4ZV4A 4Q1EA 2XTNA 2K5UA 3NDPA 4M0LA 3ADBA 3BGWA 2WAXA 5KNBA 1G18A 1XJQA 4WVFA 4FMDF 3K1JA 4DVGA 2W6JD 1MO5A 4LWZA 5SZJA 1F2TB 1MT0A 2BBOA 2QM7A 5HZHA 3JVVA 3CNLA 1DELA 4LBWA 3LBIA 4JKIA 3K0CC 2J0UB 4Q7JB 1UAAA 3A6PC 3KXLA 1G3QA 3AF3A 3W3ZB 4IRUB 3I62A 1D9ZA 1YZLA 4I4LA 4CYMA 1R0YA 1COWA 1ZMXA 4AURA 2R6GA 1JXMA 1M6NA 1RW4A 3A1SA 3TNFA 2YINC 4A82A 2BM1A 1G7TA 2P0EA 1NVXQ 1KDRA 1BYIA 5L3SB 2Q6TA 1BOFA 4FMCF 3K9LA 3BH0A 4JVSB 5FBLB 1CIPA 4PFSA 4Q4AA 3L8YA 3ONWA 5HE8A 2CLDX 3QNUA 3CX7A 4OQLA 1XZPA 2NQ2C 1NL3A 2DCUA 2ZRBA 1ZVQA 2YJTD 3DKPA 2J1LA 4RCZA 3DPUA 3RS7A 2NPIA 1E2FA 4V0KA 2H18A 2XEXA 3UG6A 2IXFA 5HPYB 5CIQA 1Z6XA 5TMPA 2QORA 1ZCBA 2C04A 3B1WA 4GOJA 3FKQA 4TTQA 1WXQA 3PITA 1B0UA 3GLFE 4EPRA 4O2RA 1E2DA 1XD9A 1ZNZA 2NMVA 5SZKB 1SXJE 4ZIRB 4EFLA 3W3AA 2PJRA 1P4SA 4PR0A 4FIDA 2WBLC 3TBKA 2P3SA 3EZ9A 4IOLA 1WMSA 4IVPA 2ODWA 3TW8B 3LXXA 2FEMA 4KCGA 4RD0A 4NKRA 4Y0VA 4BZXA 4DLTA 1VHTA 4PO1A 3FOZA 1OF1A 1E2LA 2VP2A 2FMXA 1QHGA 4M1TA 1NN0A 4C3ZA 3KKMA 1S9HA 3DOEA 3HPQA 3TKLA 4HAWA 2ZE8A 1AM4D 2QSYA 1L7VC 4LX0A 2BVNA 4E22A 4YQFA 1MO3A 2OFWA 2OFXA 4LPSA 4LV6A 1N5JA 3LXRA 4JJKA 3BOSA 3EIQA 4UJ5A 3QE0A 1IN8A 1NIPA 2QENA 2ZE5A 1AZSC 4D4MA 2DFLA 2OE2A 3PEVA 4M1SA 4Q5IA 1X6VA 2AHOA 5DI3A 5C4MA 4P0TA 4DDWA 5GJWC 3NBZC 2ZE6A 3TVTA 2GDJA 4GI7A 2BMDA 1KSJA 1VG0B 2ZJ2A 4NE2A 3A1VA 4MKHA 2EVWX 1NBMD 4MGYR 1UPTA 1SXJD 2A5YB 1JPJA 1E9EA 1E2HA 1ZAKA 1W2GA 2XJ9A 3A37A 4JJZA 3LWNA 1U0LA 1E9RA 1N3BA 2ZYVX 2WPDD 3NTUA 2IHBA 4FMDB 4PX9A 3BFKA 3QY0A 4JLOA 4QGAA 4W5JA 5JLJA 1OXUA 1YKSA 2FSIA 4RD6A 3CX6A 2KB0A 4LYFA 3UWOA 4DBLC 4EJSA 4KHZA 2VP6A 3ZH9B 4QNMA 1GL7A 1R5BA 1OXVA 3W90A 4GSYA 2IK8A 1YR8A 1XX6A 5BN5A 4BFYA 1VCNA 4RZUA 4PPFA 2FDCA 2ERXA 4OHWA 1P62B 4Q9IA 3ZS8A 1IY2A 4KJZA 2JJ2A 3SZRA 4C0KA 1P61B 5A4JA 2ZSEA 3PG5A 4PQRA 5IT5A 2IS4A 3HPRA 4HUQA 1ZBDA 4YMVA 2HYIC 2RGAA 3IUYA 3RC8A 3VU9A 2WTUA 1IOZA 2WWGA 5KHOC 2FU5C 2B8WA 2BMJA 1XRJA 1AGRA 1G3UA 3NC1C 1HH4A 4LV8B 3T35A 2NZJA 4HUQB 4TMXA 2J9RA 1U8AA 2JA1A 3DMDA 4AYTA 1YRAA 4HUTA 4M9XA 3C16C 2ZYUX 1S1CA 3IQWA 4CGZA 1Z63A 3QSYA 1SKYB 4AKIA 1C1YA 3OEEA 4PHHA 1DAIA 3OZXA 3W5JA 2OCAA 2PL3A 5EE3A 4EFNA 3I1FA 2V3CC 3QPWA 2ZJYA 2UZ3A 1JXOA 4TLDA 3CF2A 2F1JA 4IXNA 3ADKA 3AKDA 3NBXX 2FN4A 3QQ5A 3V9PA 2W00A 4X8HA 2OO7A 3TLXA 2B7CA 1U90A 1GKYA 3HU3A 1KDTA 4MGIR 4ACBA 2I4IA 3P4YA 1QHHA 4HAZA 3H0KA 5LB4A 1Q3TA 2WWYA 1JR6A 2FH5B 1DAHA 2WOJA 2GVZC 4NCJA 4O2LA 1W46A 4DB4A 3UG7A 1G1MA 1NJFA 3FDIA 2IUUA 4OQNA 5CITA 1KJZA 3K09C 4M2LA 4OK3A 4B2LA 4U7DA 1OPXA 1TQ4A 4QRHA 3T5DA 4Q7LA 1NIJA 1Q20A 4HLQB 2X77A 3HWSA 4IVRA 2I1QA 1J8YF 2GJ8A 5FPYA 2F43A 2YOFA 2IS1A 2ZEJA 1R5OA 3K8YA 2ZIAA 1V5WA 1FUKA 1KHTA 1W0JD 1Z2AA 4YMWA 4C7OA 2ZRDA 1ZYUA 5KSPA 1TF7A 2WJIA 2ZVQX 3K0AB 4G5GA 1CJMA 1QBKC 1C4OA 4BEBA 3MAAC 3E1SA 2CL7X 4B33A 3WHLA 1EXMA 1SZPA 4NBSA 2NPFA 1E0JA 2GVDC 5DE3A 2OCPA 4KFUA 5JRZA 1GILA 1R10A 3LFUA 4EQ6B 4L5BA 3QXHA 2DWQA 1KI3A 3PCRB 1Z5ZA 1CLUA 4X8MA 1G7RA 4Q1CA 3PXGA 4KO8A 3NBYC 3UKDA 4NYIQ 4HATA 4WA7A 3RANA 3THWB 2QL6A 3L0OA 5CJ2A 4BLTA 1S4QA 3SJCA 4CEJA 3FVQA 2H5EA 4WZBE 1Z3IX 4LJ5A 2IX3A 4M53A 2D62A 3TJZA 1F3OA 2PCLA 2OBNA 5FL7A 1AZTA 1SGWA 2IC5A 2XZPA 4LJ7A 3GLHA 1ESNA 3EZ7A 4XVRA 1DTSA 1YZTA 3MG9A 5DLQC 5JHHB 2Z4SA 5FOXA 3PIRA 2BEKA 3ND9A 2PT7A 1VPLA 1DO0A 3ZGXA 5GVSA 3WY9A 5J4KA 1TAGA 1Z22A 1WBBA 1PLKA 1W36D 4P4TA 2HT6A 4UXHA 3OFND 3B8HA 4GMXA 4V0OA 2IA5A 4DDUA 3GEEA 3BH6A 2E87A 4LHWA 2ECKA 2QAJA 4XSHA 2PZFA 3OAAA 4MDFA 5EP4A 4LI0A 4BEJA 5L3SA 2OHFA 1VMAA 2WJJA 3B5JA 5FUWA 3TSWA 3IDQA 4QJ3A 4A15A 5BXQC 5JI2E 4C0AC 1ZU5A 4JSTA 1Z0AA 1E2NA 4O0MA 1J90A 2W2XA 2J0VA 2ZAOA 1JR3D 3T06B 2O5VA 2HYDA 3I73A 4HYYA 3WMFA 1OB2A 5G53C 3B82A 3DDCA 4RD3A 1Z0FA 2FF7A 1UKVY 2FSHA 1MRSA 4PAMA 3LLMA 4TYPA 2ZJZA 1T5LA 2W2TA 3WRXC 1AQUA 4NU0A 1EGAA 4URWR 3OEED 4H9GA 4JBXA 5J4YA 3LX8A 1HY3A 3Q85A 3OEHA 5G3ZA 1P73A 2AFHE 3AGQA 4V0NA 5AUOB 5JJIA 1TTTA 2WSSA 4MGKR 4CVNA 3CB4A 3DMNA 1DAKA 1EFHA 5DNYB 1Z6YA 3PEWA 3I32A 3TGPA 1ZC3A 4TTPA 5J5CA 2FPMA 5TV2A 1PLLA 3THYA 4IDQA 3RNLA 1KSHA 3I8XA 2H16A 2QTFA 2WJGA 4BLOA 4YMUA 3NIBA 1BO6A 2VP4A 4WIAA 4II7A 4RSGA 1R4AA 5DGXA 3RWOA 5CK5A 4DRZA 1T4GA 3N2IA 4E09A 3U3RA 3MWLA 3OHMA 4BZQA 3EC1A 1R2QA 2HCBA 4LCBA 1Z28A 2FX3A 1TU3A 3AF1A 5DYGA 1G8GA 2Z6VA 3BBPA 5L3RA 5JRJA 1UM8A 1UDWA 2IYSA 4KBFA 3GJ4A 4NCNA 1Q3HA 2FPKA 3GJ5A 4P32A 2W2VA 4MKGA 2ZS8A 4BE7B 1RIFA 1US8B 2ONKA 2YYZA 4M9ZA 3RRMA 2ZRCA 1D8TA 2AWNA 4X8OA 1S96A 2EFGA 2GWHA 2NZ8A 1Q1EA 3F8TA 3RRYA 4YMSA 3VR5A 4C0JA 3A4MA 5JCZA 2VQSA 1ZC4A 4L15A 3OAAD 3SYKA 1AJEA 1WE2A 4BRWA 3RYTC 2NTYC 1WF3A 1FP6A 3B85A 5L3QA 1LNZA 4L9WA 3AH8A 5CJPA 1VYVA 3U6KA 1X8JA 4IDPA 1R8SA 2WMNB 4IDNA 3SHWA 4ZKDA 2B7BA 1XDBA 1FX0B 2BBSA 4JS0A 2P6UA 3C4JA 4Q9JA 1XD2A 2ZE7A 2G1KA 4J0QA 4IEEA 1M7BA 2WWIA 3J81k 2J0SA 2BKUA 3PEYA 3MRSA 5JEDA 1FQJA 1EK0A 1HQCA 1T3HA 2IF0A 3RHFA 1NP6A 5B57C 3ZD7A 1SULA 4M8NE 1N5KA 2ERYA 1ZUNB 1A5TA 2BCJQ 1M74A 4BFVA 1US8A 2AKYA 1Z0KA 3SFZA 2X8AA 5CB6A 2W6IA 4R2IA 4BFSA 2YV5A 4NDZA 4CEIB 2IYZA 2LKCA 4KLNA 5AUPB 1N2CE 2UVQA 5CM9C 1KAOA 2DR3A 3GD7A 1FZQA 1I4TD 1AA9A 2F6RA 2J7PD 3Q9LA 3NH9A 1KI6A 4RFSA 4UNNA 3NHBA 5UKDA 3LLUA 5IDVA 3R9WA 2YHSA 3THYB 3TIFA 1XJCA 4L9SA 1MRNA 1K5DA 1ZRHA 2ZSFA 4G01B 5B58C 4FCWA 1GZSA 2JLQA 2OAQ1 1NG1A 3AB3A 1G8PA 2B92A 3H2YA 4B44A 2F1RA 1KO1A 3ZS9A 4US1R 1NBME 2RGGA 3EZFA 2CLSA 4RCYA 3K70C 1JNYA 2O8EB 3CZPA 5JCPA 2IYRA 2VHJA 4XSGA 3AF4A 1Q1QA 5FOTA 1LS6A 1AGPA 3FHTA 1DO2A 2IXEA 3OEHD 3SJAA 5FR2A 4XD7A 1F2UB 3PR1A 5CYPA 1KJYA 4N3NA 2Q9BA 4WOPA 2G0NA 1IXSB 3EX7C 3AUYA 1ZUHA 2RHDA 3CH5A 4OK6A 2GF0A 2HF8A 2R6FA 3X1XA 1XPRA 4AI6A 1VG9B 1FTSA 4ITRC 3PV0A 2XSZD 4FWTA 1F60A 1AKEA 3PFIA 3A4LA 1LB1B 3DEFA 3LVRE 3MGCA 3X1DA 3A8TA 3U3OA 2C03A 2QM8A 3CR7A 3O47A 2YKGA 1HTWA 3L0SA 1FMJA 4EPWA 4AWXA 2ZSDA 2C95A 1SHKA 3RS0A 1NMYA 4OI0A 4NP6A 1OV4A 5FBVB 3O8BA 4FWIB 2DHRA 5ANRB 2FGJA 1P9NA 1GNPA 2WVJA 3ZVRA 4O25A 4PQFA 2VTKA 5F9FA 4Q1BA 3OIUA 3TAUA 3QVUA 4BLPA 3TRFA 1X8LA 4DIEA 3ZQJA 4POAA 1W4AA 4DEXA 2C98A 2JDIA 1DOAA 1KGDA 4OL0A 2R65A 4XWOA 3PVSA 4C9BA 4AD8A 4P31A 4HB2A 4PZZA 3F3YA 4URYR 3JVUA 5JMTA 1XTIA 4BFUA 4C2TA 1R8QA 1IONA 4NPHA 4Z54A 1OH7A 2IYVA 1CJUC 2LCFA 4GP6A 1CBUA 2R8RA 4L16A 4PTLA 4B2PA 2JLWA 2ZI3A 2RGDA 5HE9A 4MYCA 1II0A 4GOKA 1W0KD 3GJ3A 4HEJA 2XXAA 4NMMA 2BCGY 1L4YA 5DISB 4Q4HB 4LC1A 1D5CA 2WKRA 2CK3D 4OI4A 4Q02A 4DCNA 4N1AA 1HT1E 1U8ZA 4B73A 4DLWA 4X8LA 1DAGA 3SDZA 5L3VA 1HQYE 3FFBA 2V6JA 4PANA 5KDDA 2N46A 1NY6A 5D3MA 5FBQB 4C7OB 2C78A 1W49A 2ZSBA 3CKLA 2DPXA 3MMPA 2F43B 4PC7A 2XZLA 3AKEA 3OIYA 1VCMA 5JS8A 4D25A 1ZUIA 4M22A 4ABYA 1VTKA 1ZNXA 2IF2A 5TB5A 1BS1A 1OIVA 4QGHA 3FE2A 4BWYA 1HA3A 1M1YE 4HI0E 3QPVA 721PA 3GMTA 3BB3A 3BB4A 1U94A 5KUTA 5JSZB 3DO6A 2BJWA 3QOFA 3ZIAD 2BMFA 1G7CA 4TLCA 4WZ6A 1XEWX 1Q44A 4XTRA 1S8FA 1QHHB 2C2HA 4TN1A 2YWEA 2QRNA 1MOZA 2WJHA 1J70A 1CJKC 3W5IA 3TUJC 1C9KA 3KTAA 2F55A 1RPZA 4HZUA 2GCPA 4HB0A 3AKCA 4IDOA 4F93B 1KI6B 1VIYA 1OB5A 3RRZA 3EPHA 1IN4A 2R6AA 1R7RA 2WKQA 1YR6A 1MO6A 1UF9A 3U7EB 2VRWA 2QPAA 1SVSA 2DFTA 2XGJA 1T5IA 1SKQA 2G0TA 4DSOA 5BYJA 5FH9A 3CNOA 4CEIA 3AVYA 4D0LB 3C41J 3BS4A 3SOPA 1F5NA 2AXNA 5AJYA 3OE7A 3WHKA 3CF0A 1QRAA 1LF5A 1JEEA 3T15A 4DCSA 2CLCX 3VR6A 2DWPA 4KBGA 3LBHA 2GA8A 4PC1A 2R6CA 2WM9B 5E7IA 3UK6A 2J59A 1W36C 1EWQA 5FTKA 2V6IA 4LPKA 3W8RA 3WNBA 2FSFA 4C2UA 5KDOA 1NLFA 4AG6A 4Q01A 1IJEA 4N0DA 4FINA 5F98A 4KSCA 2CMKA 3C8UA 3OIVA 3UMSA 4JYCA 5J4LA 2HEIA 3AF0A 4BGDA 4L4UA 1ODFA 1NVWQ 3FTQA 4P3YA 3M4YA 4RKFA 1KY2A 2P6NA 4LHZA 3VU9B 1HE1C 1G21E 4B2IA 2MSCB 4BLRA 221PA 1P60A 4Q03A 5FI1B 4D81A 1RJ9B 1KNXA 2AD1A 4MGZR 2QAGC 4PO8A 3IIMA 4QJ4A 3U60B 1O3YA 2XITA 2VPPA 3UANA 2HXYA 5GJCA 2BMEA 4IJMA 4RJLA 2CL6X 5JJKA 5K8UA 3AQ4A 3CRRA 1YVDA 2O8BA 3CPEA 3P20A 1ZM9A 1TEVA 3W6OA 2JLZA 1A1VA 2GNOA 1L2TA 1DVRA 3KUDA 5FPKA 4IFBA 1N6PA 1IAQA 1VG8A 4IOJA 4TT3D 1OYWA 3MLEA 4OBEA 4E03A 3LO5A 1XEFA 2HV8A 2VH5R 2JGNA 4JLVA 2ZRNA 1DG3A 2DB3A 3CZQA 2JJ1D 5AJZA 1GAJA 2FNAA 4HAVA 2FSGA 4K81B 3TW4A 4BASA 4Z8YA 2WHXA 1ZINA 3NC0C 5IRCD 1GG2A 5A5GA 2QRZA 2IYTA 1XB2A 1OXXK 3DM9B 4JLBA 5FOSA 4F92B 3B2EA 1UDXA 2QY9A 4MRVA 4Q9HA 4U00A 4BQSA 2G1JA 2DYKA 3PENA 2J7KA 4Z1MD 5KSYA 3FMFA 1ZCAA 4JLAA 1P2SA 4TYYA 121PA 2H92A 2IL1A 3GFTA 4GPTA 1XTSA 3HJNA 1EX7A 2PBRA 2BKEA 3SS8A 2BBWA 1K5GA 4EFMA 4G3XA 3AP1A 1UKZA 3VNVA 3NHAA 4YONB 1FMLA 1XWIA 3KFVA 4DXAA 1XMSA 3H86A 2IUSA 4W5HA 1JB1A 2D74A 1OH5A 2GK6A 3DL0A 2RGNA 2VL7A 2JLXA 4QBGB 2VP9A 3C14C 1YZGA 1B23P 1GWNA 2WWFA 4JMPA 2ORVA 2IYQA 2W6ID 2RKOA 5DI9A 1GL9B 3FMIA 5E95A 2QAGA 4A9AA 1P3JA 3U7FB 3ADDA 1EESA 4Q47A 1G3MA 3W6NA 3X1ZA 2EQBA 4KU4A 2BBTA 5HKKD 4D6PA 2C77A 3VQTA 5DN6A 1Z83A 5KNCA 5C46F 2ZJ8A 4EAQA 4V03A 2HJVA 3QG5A 1OT3A 1EFTA 1NN5A 4YLGA 4KLZA 2CCGA 4JVNA 4Q18A 3NG1A 2QMUA 1S3SA 3RC3A 5CK4A 4G5QA 3TQCA 1N0WA 1XEWY 4GP7A 2VIIA 4AKHA 3QBTA 2EYUA 4S35A 5FL3A 1OE0A 2KWIA 4WZAE 3GLIB 4ZIRA 1R5NA 4KAXA 2O0KA 4DLRA 4TTRA 2DBYA 1KKMA 1KI1A 3GLHB 1GSIA 1KI2A 1A2BA 4QL3A 3VHXA 2BEJA 2A5DA 3LBNA 1QHYA 1XPOA 3O8RA 5FTJA 3AVTA 3P27A 2ORIA 3CLVA 2XNDD 3WNDA 1JR3E 1OYYA 3RS3A 2PEZA 3IKJA 3GLIA 1NVVQ 3R20A 2MSEB 1CTQA 1VCOA 1E1QA 3IHLA 2F9LA 3LDAA 5K8IA 1NJGA 4EPTA
chains in the Genus database with same CATH superfamily
2LXNA 2QT9A 2OHJA 5C8VA 4CUZA 3A27A 1XZQA 4TV9F 1JHZA 5E7QA 3TBFA 4CBVA 4LF5B 2EKDA 5CVJA 3TLJA 4K6MA 5LFAA 5EJGA 2XRFA 3PHJA 3WKAA 4F3TA 1GXSA 4HXGA 3WQSB 1XHEA 3B7PA 1CQXA 4HVLA 3EVDA 2RAPA 5JPIA 4OU4A 2IDJA 3KEGA 5GPBA 3GRUA 4BTLA 1E2BA 1E2EA 1S8OA 2EAUA 2PFKA 1ZGZA 1KC3A 2JGEA 1JG1A 3K0AA 4KNYA 3I0ZA 3VDXA 5DHRA 2Y1GA 2ZRLA 3UATA 2XW6A 4C4ZA 1JMYA 1GAQA 2J0UA 2IHTA 3M5CA 4RABA 4AZ0B 3I5YA 3VZBA 4AZSA 4ZJUA 1BIFA 2J3LA 4JJ7A 5I47A 1CUJA 4JLMA 5A4IS 2C8VA 4NYJR 4BP8A 1UBNA 1BHSA 2EJUA 4HEA1 3B51X 4PX2A 1B93A 1K63A 3WLOA 5E1BA 1NUHA 1PW5A 4LHVA 4UCXA 2WHPA 4MUHA 4QOSA 5IXYA 3IPAA 5KQGA 1IBLB 3FSGD 3QEMB 3R5XA 3O82A 5K05A 2P3LA 4EW6A 4KH1A 5KJEA 5JH7A 1M8JA 1P4HA 3DEZA 3FVWA 4NBTA 3WHIA 4DMCA 1OTXA 4LVCA 3GV0A 5EXTA 1O0BA 5I7WA 3SVTA 2V55B 4NCIA 1V45E 2F3TA 1ZM2A 3STTA 3WQQA 2PRSA 1M1NB 2I2BA 5I7SA 3FOFC 1C9YA 3CH4B 3D6UA 5TXGA 2R1TB 4X6LA 1P5ZB 2FPWA 4JK3A 1TCAA 5HXAA 1R9NA 1VKZA 2CUNA 3SYNA 4P4UA 1ZITA 3AR8A 3BM5A 4I1SA 4P4GA 4RIGA 4RJKA 4GC5A 2X2OA 3ZXIA 3TVDA 4MIKA 3RWBA 4DV2B 1CEQA 2GPAA 4H7PA 2OSVA 3D1JA 3SR4A 1ODSA 1P1KA 2YZ2A 2ONZA 4BCBA 1DLJA 4MV7A 3T12A 1DPFA 5BWNA 2YRXA 1BXKA 2HBZA 2Q2OA 1Y9AA 2VJKA 3A10A 1FDWA 1KY5A 2FFBA 1Y5IA 5BN1A 3USZA 4GF5A 3O7WA 3AX6A 3O26A 3GT3A 1R5JA 5KYXA 2HA0A 3RSLA 2J85A 4NZPA 2C2GA 2X0NA 2XY4A 4Z4IA 2B1IA 3Q11A 5LQRA 3CUKA 1X8KA 3V8EA 2ZRMA 5CFOA 2NZVG 3IAAA 2CUZA 4ZARA 5KTKA 2IPXA 2FQXA 1FUUA 1YB1A 2MSWA 3CZ4A 4NMHA 4YREA 3TJRA 5ELXA 3V4VB 3GGCA 3NOQA 3RYIA 3WKDA 2KBFA 3GPLA 1UJCA 1VCHA 3C6YA 2CGEA 2IHJA 2DRIA 3REQA 2Q3FA 1QV9A 3JX9A 4DBZA 3GJYA 4E5KA 1XU4A 2EYQA 1Q0SA 3DT8A 4RK1A 4DL9A 3PTAA 4M9UA 4JAVC 1E6KA 3CVVA 5BT9A 3E5MA 2GM4A 1D7OA 1BCRA 3C85A 4YP1A 2F1OA 4BP1A 3IMCA 3GZNA 1CS0A 4TROA 1S2NA 5ICEA 2RBEA 2QM3A 3OJLA 4F4CA 4IUBS 1QQAA 4G23A 3A1EA 4NU5A 4BQQA 3A1WA 3I2YX 4ASUA 3FKJA 3ZHBA 2CXSA 4KR6A 1UMBB 2I6UA 3AR3A 3ZQ6A 2V7QA 1RHUA 1ODJA 2BFOA 5EE9A 4Z1MA 3K35A 1ZXBA 3AZPA 3RIGA 1U2GC 3DT6A 4YCMA 4A0RA 1O03A 1TVCA 3H1TA 1PFKA 3TAHA 1P8AA 3CUVA 2A92A 3PNPA 1PDVA 3SWWA 1I6LA 4PLYA 1ODLA 2H57A 2QSZA 2P8SA 5FA5A 1QB7A 4Q9DA 1PRYA 4LJAA 1RWPA 2O4UX 2RBGA 5DBOA 3RKRA 2J5XA 4CLHA 4HH4A 2FW6A 1KQFA 1VE1A 1R50A 1KY4A 4MVJF 5AQ1A 1J8FA 2QNRA 2KPOA 2EF0A 4YRKA 1R6DA 4I1YA 4BNNA 3IAHA 3TD2A 3MSXA 1VDMA 4KPEC 3GP8A 2H8KA 4YX9A 5EPOA 4B3JA 1NBIA 3OC0A 2JLCA 2R8EA 4F4JA 1ONPA 3T1QA 4BFZA 2H4FA 3KDPA 2NV0A 1QVWA 2X41A 3TSYA 3K71B 3SR0A 3ISTA 3O31A 5EA2A 4A16A 2DX7A 2XKBA 3IAEA 1AX9A 2BC9A 4O2BF 4UHCA 2B69A 5AMXA 5F51A 3R8CA 4ACAA 4RDXA 2PX0A 1V1RA 3H4MA 1L0BA 2GVNA 1OC4A 3G1WA 1NW5A 3MILA 4LF7B 4NEHB 1J0XO 4HGNA 3KZXA 3LYAA 3WLIA 1HE5A 1MJFA 3SHOA 2PLAA 3ACDA 1A1SA 3TXYA 1Y7PA 3ESYA 4R0VA 3GEIA 1G16A 5DGDA 3CNEA 4NV0A 3HB0A 4N3CA 4ZRNA 3UAXA 4TYQA 2OV2A 2BFCB 2REXB 4X1KA 3LQKA 2RB5A 4UVDA 4NHOA 4RGBA 1Q1AA 1D1QA 1RFLA 4MJXA 4IYJA 4EJMA 1Z7BA 4R5HA 1XZDA 3AJDA 3W4KA 4WOBA 5DTQA 4E6PA 4UOZA 1JT2A 2JLRA 4PN3A 4DUYB 2QE6A 4JQZA 4ZOAA 1E79D 3OA2A 1CG6A 1O6FA 3OJEA 4RVNA 4LY0A 4U4AA 1XF9A 4JI2B 1E7MA 1GTZA 3FR7A 5JFGA 4ZEXA 3OZCA 4HC4A 1IB6A 5FKJA 4TLEA 1L4GA 4ZVTA 5AP9A 5ULLA 3RFVA 3UGTA 4BPRA 4YDSA 4M99A 3LH5A 4QU9A 1DJLA 2FE4A 3LRXA 1MV5A 3GYBA 1G8FA 1TO2E 1T5OA 1ZISA 1L4NA 2H17A 3E5HA 4LJYA 1E5QA 4YJ3F 5AH0A 1XCPA 3HVJA 5AIAA 2KBEA 3AZQA 3PC8A 1B8VA 2ACEA 4D97A 2PL5A 4FC7A 5T3UA 3FB4A 4G1CA 2D1SA 1UDAA 3OE5A 5AVZA 2O23A 2HO5A 3HXMA 4ZRMA 2D5IA 2JF0A 4MWTA 4HH0A 5F76A 3R3WA 2D1RA 5EQDA 4PZYA 1DDIA 3QJYA 4EY8A 4EKYA 5TPZD 2F7SA 1FEZA 5IUJC 1QO9A 2IDKA 3TH5A 2OESA 5G1NA 1JFFB 4AROA 4ZCIA 8LDHA 3HRKA 3GBPA 2CT8A 4W7IA 5BV2P 3FUVA 4GL4A 5BSEA 1UMCA 4EPXA 3UHOA 2PLFA 4WLNA 1H05A 3LBYA 2PNJA 4BS9A 1W7AA 4ZT2A 1N92A 1RRPA 3I83A 1DDOA 2HK6A 3E9DA 3CUWA 2X0JA 1CP3A 3O94A 5E3HA 5IVKA 1ZVKA 1L4EA 2ZU6A 4RJ2A 2GZ1A 3WKBA 4IOKA 4QECA 4INJA 4M1WA 1N6RA 1EAMA 4XR4A 3TL6A 1KQOA 2D5LA 2BOVA 3L5OA 3NDJA 3OFNA 2ESRA 4Y2GA 3QRWA 3R76A 3C74A 2I1VB 5TQ0B 3WO0A 3WNCA 2XYVA 1P1CA 1G20E 4FYHA 4KZKA 2A94A 1VYHA 3EGWA 1T9GR 1GP2A 4G4JA 4RZHA 5DGTA 3VR2A 5H3CA 2PX5A 1BOOA 2OBLA 3IJ5A 2AF3C 1CP2A 3LG2A 5JXWA 3SPXA 4EHJA 4G0MA 4MW5A 3CSUA 4YACA 4BRSA 1MUUA 4RQAA 5CDUA 4LF9B 2AG0A 4L4SA 1KDPA 3TJMA 1E3WB 3O73A 3PUXA 4CLRB 1BW9A 2YHIA 2CXPA 1DAOA 3KSMA 5KX5F 1YDWA 1ZA2A 2V1XA 3S1AB 1EWYA 1FFAA 3PUJA 5A62A 1NQAO 3C5EA 3HEMA 1XNRB 3S81A 4ZDWA 4WUTA 4O2BA 4DSUA 4EKGA 1KNQA 2Q5EA 1NJ2A 2F3SA 2EARA 2R79A 3P4UA 3T1OA 5IT0A 4X1YB 1SN7A 5KYKA 3RIMA 1OWNA 3CSDA 4EWLA 3KKPA 1A9YA 3KP1A 3KZCA 1L5SA 2FEKA 2D5AA 4QJ5A 5EZYA 1I1QB 4D92A 4G9EA 4CV1A 1KZGB 1SD1A 3FJOA 1XC7A 1WZNA 4JODA 4V1CA 2IV2X 5A2QA 1GITA 1KJJA 2VJMA 3LD9A 4AUEA 1QGUB 4RTSA 3RH0A 2PXXA 1KJNA 5AW5A 4FD3A 3O4IA 4MCJA 3Q0EA 4KQXA 2P6PA 1CUZA 3H2SA 1C14A 1N3YA 5BPFA 1T3ZA 4URXR 1APBA 2QZSA 3E7WA 5K0EA 4D99A 2AQ8A 3AUKA 5TDHA 1ZXLA 2R5FA 2VT7A 3UAOA 1UWKA 2HCJB 3BK7A 5AT1A 1M67A 2C4VA 3HADA 5ALDA 1N6LA 3LM8A 3HFRA 4MHOA 4YJ2F 2HV9A 4IUDS 5HZKA 3HWX1 5HF5A 4TTTS 2AX3A 4BJ5A 2JHCA 3U44B 1B6RA 3JPWA 2O7VA 3JQGB 3NIFB 1ULSA 2Z95A 2I34A 4U7WA 1EX9A 1WV1A 1WVIA 2ZSUA 5K0NA 1PG5A 4RZ3A 4TMVA 5HGXA 3P1JA 1N6NA 2AC7A 1DTEA 3TQHA 3QP9A 4CU5A 4W8HA 3CLTD 2MDTA 3AC0A 1KXJA 3PR2B 3KELA 4U7JA 5H9VA 4HFRA 2C4TA 1L7RA 4EF6A 1AIPA 3UMRA 3S55A 1KGSA 4UZSA 1LUAA 2DLDA 1PJ3A 1JSCA 2FWRA 4KXLA 5ALOA 3QVMA 3MOSA 2QMOA 5CFZA 1JDZA 4XD7D 1GTVA 2GCOB 1JR2A 1KKUA 1HDRA 1G41A 4ARVA 4CPDA 1HYQA 2BDEA 2UZIR 1IN1A 3QEJA 2XNDA 3I1JA 4WK4B 4TUYB 1A88A 5I45A 4OIFA 3MS7A 4YRGA 2VNKA 3UW1A 2NYAA 3ROQA 2WSBA 1OFHA 3OICA 4GWGA 2FZLA 3HVHA 1PT6A 2HA6A 2I8LA 3OD5A 2VPIA 4UDOA 5BN4A 4CKXA 2QTTA 2G3YA 2HHHB 3AHGA 5BOSA 3FH0A 1WPGA 2Z5FA 2WABA 2EKQA 1U9CA 4Q6BA 1CS4C 1KI4A 1UXOA 3MBKA 4JLJA 5HKOA 3K0CA 3U4HA 4Q3LA 3ZE0B 1PFVA 1ZIDA 4NJMA 4BNVA 1DG9A 3G79A 2D2EA 1ZIPA 2AFIE 1LW7A 1SO8A 1WHTA 3EWIA 3G82C 3I2GA 4JL5A 4Y1RA 4K0KB 4FJ2A 1U0RA 1ACMA 3LNTA 2FPLA 3HZRA 5F52A 1QYDA 3NBMA 2OBMA 4HAIA 1BE8A 2A9QA 2HJRA 2IV7A 5JD5A 3ZBQA 2V6BA 3QMPA 4B3BA 1R15A 1RFGE 1OKKA 4UUNA 4G97A 4KQEA 1GPMA 1VJGA 4FGLA 2Q7DA 3WGOA 5AW2A 2VA8A 3NB0A 4DMFA 1CSEE 2ZUBA 4OQXA 1EHCA 5FNVF 1T8UA 5E4JA 1N0VC 2MMCA 2J09A 1NF9A 5D87A 3T9FA 1IOLA 2H7VA 3NGLA 3AEXA 1RZVA 3O4VA 4GVXA 5KVQA 4I3HA 1YMQA 1KVQA 2C42A 4DJTA 4YUWA 5CFNA 5C1DA 5JDIC 1CR1A 3TL2A 3I2FA 1RC8A 3RRJA 4HWKA 3L8ZA 4EVRA 1IWOA 2P9GA 1GZHB 1G2QA 4K9MA 1KZHA 4E2YA 3E61A 2FDRA 4KLAA 1FDUA 2BZSA 2QN6A 3LW8A 4FDUA 3K5PA 2Z1MA 1NE7A 3CNBA 5C3MA 2ZAYA 3DXXA 4BCDA 1H4QA 3ZXUB 5ILQA 4BWVA 3ABQB 3ZCUA 4QYIB 4B3SB 1GPKA 1SVIA 1G20B 1I3KA 1SUWA 5HX7A 5BN3A 5KTSA 2Z98A 4MWGA 3S1AA 5CB8A 5CDFA 1E3QA 5F21A 4B74A 2JLZA 2NLOA 4Z53A 1E3WA 1EFDN 2AH5A 4Z99A 1JTVA 2G09A 3RVLA 2O07A 2OV3A 3G2PA 3H2KA 3SFTA 3T99A 2H1HA 3SSNA 1J00A 1JFRA 1IUNA 1ESMA 3DFKA 4XYEA 2A59A 2F3RA 1PYOA 1P2VA 4DZTA 1P7YA 3HWWA 3Q8XB 5ALFA 1OZ0A 3P52A 3BH7A 3Q15C 2JRCA 1OZAA 1FP4B 4BTVA 1Z8HA 5TQ0A 5T7BA 3S1SA 1E6WA 1U7ZA 1Y5LA 2PBFA 4L75A 1K6XA 2RGRA 4JASB 3RAEC 1XLVA 1KOLA 3TCKA 4IYRA 2GFQA 3MD0A 2J41A 2OGUA 3OPVA 2JRLA 2PH3A 3D3NA 3HO1A 1ISJA 3O2JA 1YVUA 4MINA 3JZAA 5DM60 1Q1BA 3GLHE 4XH9B 3G2KA 4YMGA 3Q5EA 1SKBA 3OIDA 3ESZA 5HKKA 4R7TA 1SKUA 1UMCB 3EMKA 2QAIA 4GI3A 2AFIA 1NMXA 3GC6A 1T24A 5IC4A 3GFPA 2LPMA 2YV1A 3RC7A 5AFSA 3UBTA 3HA2A 1QF6A 2XRYA 2OOSA 1X7ZB 1P3Y1 2M32A 4N8EA 4EG1A 3IIKA 3OX1A 4P4SB 5DCWA 3V8NA 1ZM7A 1R6BX 4A8HA 4F71A 2EATA 5E8RA 1G291 4WA8A 2V3WA 1P8JA 1RWXA 1ZW1A 2F17A 4FXPA 3DEYX 3FUXA 3WMGA 4O2AF 3VKHA 3HJBA 4NAHA 3H18A 2QB5A 3NVAA 3PC6A 1NHGA 2FPPA 2II6A 2DHEA 1PKEA 1C4XA 1ZCJA 2NU7A 3C3BA 1OFUX 3L7BA 5FBWB 5GVRA 4EI9A 1I5OA 3ENQA 1UKYA 1Y4ZA 2X15A 3EEIA 1V43A 1L3BA 3U62A 2CFTA 3HSKA 4KE9A 4CKWA 4HAUA 2ZREA 3L6OO 2WU1A 1HE4A 1WCYA 2VHVA 2VPYA 3VZSA 4EQ6A 4AJPA 3VH3A 4OY3A 4BY9E 1N57A 4MIEA 1ZH6A 2VR1A 1KH3A 4KQFA 3U5ZB 4CT5A 4D26A 1HF3A 3DUWA 4FCVA 2NZYA 3KT6A 4P92A 4KQ1A 3TFQA 1MHTA 2G9VA 3EFEA 1TRHA 3MFYA 1GFIA 5DHPA 5REQA 2CEAA 4KXUA 4WY2A 4XGKA 4L5JA 3DO8A 2NO6A 4LQDA 4IQGA 1WD5A 2J5RA 3EEOA 3UMCA 3BDAA 1XTUA 1CU1A 1M72A 1F4LA 1XIVA 2RGYA 1RLTA 1XTRA 4I5IA 4LDQA 4LKRA 3WYDA 5A4DA 1G17A 2FX5A 4IIDA 5JBQA 9LDBA 2AC2A 4RGYA 5KSOA 5BWOA 4E21A 3K1AA 1JE1A 3U3JA 1L5NA 3T34A 2P9HA 3FVVA 5HR5A 4MHTA 3ZGNA 1BZYA 2NZWA 2P2LA 4TV8B 5I48A 1SXIA 4C7XA 3CGWA 1FW6A 3CBGA 1YSCA 2WT8A 3F2VA 3H1PA 3HFJA 4WEOA 4DJFC 3UMMA 3W9YA 4UU0A 2HT1A 4EO7A 4X3OA 3BTOA 1CUIA 2J0QA 3LRTA 1GCIA 4PYRA 2JFOA 4BVAA 2BHNA 1T6NA 3KQSA 3QMMA 5KYYB 1X42A 1G5FA 1YL6A 3CT4A 3TRJA 4L51A 1DZIA 4DT1B 1FXWA 2WW8A 5M34A 2ECPA 4W1QA 3N2EA 4CV3A 1RM4A 3DBVO 5DLYA 3ZX5A 1GLVA 1G5TA 2A86A 3CISA 5HS6A 4PIPA 5LYYA 5ITSA 2ZWMA 2EFEB 2QJTA 1YTLA 3SEZA 3CRVA 4PV7A 7ABPA 5HM6A 4NIMA 3DF7A 3DDWA 1SXJB 2NUPA 3IP3A 3QF4A 4LHEA 2Z6QA 2W0SA 1XNQB 1YR1A 3JASB 3R3XA 3VVLA 4D57A 1MKYA 2P5TB 4OHXA 1BEUB 2GN8A 2EFDB 3ILVA 4P3XA 1FVHA 5AM5A 2WJYA 4QC2A 4O1IA 3SLGA 1R4NA 1W48A 5CGZA 2FZGA 4DOMA 1K8RA 2Q0QA 5MFPA 1AK2A 3K92A 4I5DA 3T0FA 2FK7A 3L7OA 3OCVA 4D8TA 1YJ5A 5E4TA 4RYLA 4YPFA 4NC9A 5D2CA 2OQIA 1I2BA 4OHVA 2PKEA 4F3CA 1DEKA 1BCSB 4MYHA 1LWOA 3FNRA 1BWQA 1B41A 2GKSA 3OQ6A 2OXTA 3BB1A 1I7NA 5BV8A 4A91A 3PC4A 5A04A 5BW8A 2B20A 3V1TC 4FS8A 1KZ4A 1LFAA 1XAHA 2A33A 3O4JA 3SYMA 3JD4A 1LPOA 4LJSA 2HDHA 4WXRA 4HDMB 1HK7A 4HS4A 2MINB 1TK3A 2OXCA 4UNQA 3WP1B 5BMVA 1FMCA 4H1VA 2O2EA 2O8FA 4B17A 1LDYA 4ARBA 3A6GA 3IBYA 2PWBA 1S8NA 3HCDA 4I0WB 4NFHA 1V26A 3WJ2A 3PEEA 2PANA 1QO0D 1KFCB 1TM3E 1XG5A 3BAFA 4LOHA 4FGUA 1BX0A 2V7BA 1MB2A 3GQVA 10MHA 2GRJA 4R31A 4W8GA 1E6MA 4CT4B 2QZZA 4L9AA 1J07A 2YY6A 4LJ8A 5ICCA 1V16B 4BNUA 2G83A 1K66A 4DKJA 3SGLA 5G41A 5A6VA 3USCS 1K08A 1SHJA 3RM3A 4G0VA 2EFCB 1XZCA 1VHLA 3H05A 2GM5A 3KT8A 2ZPUA 1EBBA 2EFHB 3QUTA 1WAMA 1NY5A 1ORDA 1T0BA 1UBUS 2CVZA 2I62A 2Y0PA 4B6FA 4BLWA 2AF4C 4CUJA 3KHUA 3VNRA 3REFA 3BK1A 3N2KA 3M9XA 3PD1A 3W6ZA 1A2QA 5DIFA 4QKQA 1N6OA 2DTXA 5JAMA 2VYNA 3BRSA 3MJTA 2PWPA 2WE7A 1DARA 1F38A 3LBFA 3NUZA 3WGYA 4ZO7A 4OHFA 3I04M 4I4NA 2VC2B 3LCCA 4B6SA 2OFPA 1BG6A 1JAHA 1RPTA 3N5KA 4F7WA 2HB6A 1JAXA 5JFTA 2PQMA 3A0RB 2XMSA 5IH7A 2WSLA 2R1TA 1WIWA 4HLDA 1UADA 4V3CA 5LMNB 3THRA 4A6XA 3R3UA 1JFLA 1YH3A 5EFZA 4A5SA 1DBWA 1KTVA 4UUMA 3KTOA 4MUXA 3FOEC 4CKYA 3SD7A 1QS0A 1EK1A 1ZH2A 2N1MA 1GCAA 2GS9A 1J0DA 2Y1XA 4H7DA 1UT8A 1CUDA 1LSSA 2CHVA 2Q4EA 3BWEA 1WCXA 3KK0A 4MV8A 1JHVA 4MVJE 4R1MA 3TB6A 4BO5A 4WD3A 3R8FA 2ZS9A 1YBVA 4L0CA 1MNAA 3KHSA 4CIAA 4G0PA 3SZGA 1CV2A 5B6IA 1PX0A 2FG5A 2DUMA 2Z57A 4XA8A 4OO3A 1O57A 3LX4A 3C1OA 4M0KA 3UMVA 1HL3A 2Y0CA 5EXPA 3WL6A 3OQVA 1JJBA 2ODBA 2EC5A 4JCCA 4RK6A 3H0CA 4FDAA 2ATEA 5AUQA 1LC0A 3IEMA 1EG2A 2V54A 3CYFA 3OY2A 3MT9A 4LNHA 3RSGA 3M82A 2YWRA 2GYUA 2XMBA 2JI6A 4ZVQA 5G4LA 1ATZA 2QTAA 4DB2A 1F51E 1JQKA 5I9BA 2QN9A 1E6LA 5FYQA 4UJ3A 2BZ0A 4UUQA 3A36A 4I1UA 3SBDA 5BR7A 4PHFA 5LD2C 4J8PA 3ZDAA 4DYHA 1QIIA 1P9WA 2CJPA 3IVAA 2A3RA 2VBIA 4GKKB 3GYGA 1M34B 4HLCA 2YJ6A 4M0FA 3OKAA 5COBA 4R9RA 3NBAA 2WVGA 4YDRA 1V95A 2XVXA 4KIJA 1KZ6A 2Y1OA 1WR8A 3D7SA 5HUQA 4KPFC 3JSXA 3AOEA 3FTFA 1XF1A 4Q1DA 2Q2NA 2OLJA 3WYBA 4CF6A 1JLRA 1VLHA 4Y0AA 1OBOA 3A1DA 2EU8A 4TWIA 4I8XA 3CLUD 4XTCS 2UZ0A 3FKSA 5TF4A 4CL0A 1UMDA 2F9MA 4KX5A 3SC4A 4ZHQA 2YICA 4A27A 4EAAA 2BFWA 3AFHA 5FUYA 3BUSA 1D6JA 3G89A 1NTRA 5K51A 3FHJA 1RKBA 4EHHA 3R40A 4JR2A 4YHBA 1HI9A 2QOEA 2HA5A 2PKWA 4KQMA 2POCA 1I4DD 1P7ZA 1TO1E 5KNDD 1D2EA 1E2PA 1NLYA 5L6LB 1K6MA 4KX3A 3JD3A 2E9SA 5HKLA 4LXTA 2SECE 3FWYA 4PGFA 4MAMA 3DTYA 4ZU3A 2O0JA 1Y34E 1FRNA 2WWWA 1M76A 3I4LA 4GWKA 1IRIA 1M2GA 3IAS6 4FYVA 1SCNE 1ZPDA 2WJPA 3WI7A 2PGIA 3RNOA 2AEEA 1KPHA 4GM4A 4LMPA 5CA1F 1BQ4A 3Q72A 2Q3LA 4JJ4A 1U1CA 1MD9A 3SU8A 2FETA 4L5IA 4DAOA 5TS2A 2UUPA 4EMSA 1KBZA 4U1RA 5ALHA 2PLRA 2PWZA 3QQPA 4F91B 1VJTA 4HXEB 2ET6A 2IUTA 3G0CA 5BSVA 4LSGA 5TR9A 1YFLA 5CBKA 3KU4A 4QUBA 3LFHA 1TW3A 5PNTA 3Q6IA 4D96A 4LGVA 4CM3A 1MO4A 1H2XA 5BURA 7REQA 4DR5B 3WR5A 4H1HA 1U2EA 1J2EA 1HL7A 4TPKA 3DAFA 3W06A 3JQRA 4G9BA 1I2CA 1XCBA 4HX9A 3EZGA 1RMYA 5AKXA 5JXGA 3IE1A 2X0KA 1JFSA 1XJ5A 3EPJA 4QEDA 4LYGA 2IPNA 2JGLA 2GZMA 4MWOA 1DC8A 5E2AA 3UK1A 1K75A 2A0KA 1I4WA 1U0OC 4XDGA 3VX4A 4A1OA 2F4NA 1XZJA 1H3NA 1T0PA 3MN1A 4KPUB 2J7PA 4ZVUA 3VZRA 2YIVX 4DJDC 5IMBA 1RRGA 3I1YA 1MTOA 2WYWA 4R16A 3F5DA 4GLLA 2I2FA 4HF7A 4CDMA 4DGQA 4QBFA 4IDHA 5B64A 2WJZB 1I9CA 4JDUA 1EK6A 1AV7A 1TAUA 2NTEA 2QUIA 5JWOA 3C5VA 1JSRA 1HDEA 1KYZA 1R6XA 1DQNA 3IT2A 2PUVA 4RZ2A 4BVEA 2CEKA 2DTDA 2HI0A 3FXAA 1NI4A 2RHOA 2R62A 2IIVA 2VSFA 4RD2A 2EP8A 4U2KA 1YB7A 3GLGB 2CL0X 1GPAA 1WABA 2JAQA 1DKMA 5BQ5A 2IIPA 3BJEA 1XZEA 2IPLA 2Q29A 3VOTA 4AZ3A 3S8EA 2ICAA 2B34A 3PUZA 2W2LA 4LNUA 4I81A 4B76A 5HW0A 2PFGA 3KJHA 3OLZA 3BXGA 2A1UB 4ZCMA 3H5WA 4OXNA 1V16A 1Q6YA 4EHDA 5B6PA 3VR4A 5C8YF 2GOYA 1WDWB 2OBFA 4GRDA 1RJ9A 2ZSAA 4W4TA 1YR7A 2L2QA 2PSDA 3GXOA 2CDCA 3ZOKA 2ONYA 2ZSIA 3DONA 1EVZA 1LPMA 2B25A 3LF1A 4AFNA 3F5SA 3RVQA 4DLLA 1MABA 2C1ZA 2YASA 1A8QA 4JL8A 5BRJA 5FX2A 1M6VA 4QYSA 3H5RA 4CEHA 4EYEA 4IWXA 3RFTA 1E0SA 1L3CA 2GBLC 1SZDA 3F6BX 5FPPA 2XCRB 4M6WA 1GOTA 1UANA 2H9IA 1VMKA 1QJCA 2VJDA 4IZIA 2COEA 2VHUA 2XZOA 1VCIA 3KWJA 3OT5A 3DZDA 2ZI7A 4HGZA 4PYIA 1A7UA 4B3XA 1HMPA 4EB6B 4ZOLF 1YVPA 1MMFB 1AKQA 2YTZA 3OLQA 3ZVLA 2Q4BA 4MSUA 2FP3A 2ZRKA 2Z04A 3ZNQA 1E32A 1REQA 1KDZA 4MWEA 3RG2A 1MG0A 3NFYA 3EXG1 4TWAA 1R4NB 3LGSA 3PHLA 3ZPXA 1DIAA 1UC8A 2PX2A 3MJRA 3PGVA 4UEJA 4B45A 1GU7A 4XM2A 4YRAA 2CXQA 1Q22A 3GLSA 4AKGA 4BUZA 3A6KA 5EXDA 3JWGA 5CXSA 1GCUA 2BR3A 2AJBA 3P5BA 3QF4B 3RS9A 3VR3A 1TPZA 3NAQA 4N8DA 4QHSA 1WLYA 2W6JA 3V8QA 1AT1A 1HLGA 1IBRA 1SAYA 2GHIA 3IESA 4HX5A 5C7IO 1MA0A 1IBMB 3L2OB 1Q91A 3VSDA 5ES4B 3NBFA 5K3CA 3ESCA 3L0BA 2X5NA 3IA7A 1W1IA 5IAAA 1PJLA 3DLBA 3B2QA 4ROTA 1BGVA 1O94A 1X77A 2ZI5A 1XUOA 2GD2A 4N65A 1GUBA 5EI5A 5IXJA 3FVTA 3U19A 1F0KA 1MB0A 1U7DA 2FPIA 2FZKA 2ZI6A 5DASA 4BMDA 1CRPA 1ZN8A 2PWAA 4TMZA 4AYWA 5ITZA 3QFFA 4KWHA 5AHKA 1BSVA 1CR4A 1Z39A 3GT4A 3E3NA 4I14A 2HMSA 4MA4A 2Q3HA 2W2LD 1Z33A 2E5WA 4OG2A 3TLYA 3JQFA 3DL7A 4PN7A 4N41A 1JR4A 3IQZA 4IZ6A 4AJ1A 1MDFA 4AN4A 4DADA 1R0XA 3BGIA 3DUFB 4GICA 1PG0A 5B1IA 1RVDA 3WGNA 3X43A 3K0FA 3KSUA 3QBVA 1QV6A 4ENUA 1G64A 5P21A 1ZI6A 5JYEA 3PVCA 5CLLA 3KXKA 3QXXA 3OJCA 2BAGA 4NNOA 1XRSB 3D3EA 1DS6A 2X2EA 1AHNA 2WUEA 2PUCA 1AQJA 2B3DA 1Z2DA 1EP9A 4IWYA 1Q0TA 2CLOB 5ED0A 2PPVA 5DW3A 1RYEA 5EL0A 4YLYA 4OGWA 1QFZA 3L7CA 5CYGA 2O9JA 2OD9A 3I9JA 3JD2A 4HWTA 4YVFA 3FZGA 2H7YA 1WXGA 2JEYA 4DWWA 2REQA 2KSQA 1GEGA 4ZZ2A 4J1QA 2NGRA 5LP6F 4IDFA 1T9CA 1KK3A 4C89A 1SURA 1DXYA 1YQEA 2BFPA 3LUPA 4NBRA 5FPTA 5AICA 3V8BA 2IU0A 3C70A 1PR3A 5FUVA 1O0SA 3NHKA 6ADHA 3CX8A 5ALTA 2V8OA 2V7QD 2PX3A 1E9AA 1JKXA 3A4YA 3HJHA 4MYRA 2RGEA 3PJDA 4IGAA 1KFBB 4P4SA 3R9XA 3AEYA 1VMEA 1RADA 3QEOA 1PJZA 1J9EA 1VBMA 3MWDA 4O8CA 5HBRA 2RI6A 2O0HA 2OD2A 3I01A 4N0EA 3IE0A 3MTAA 3X1WA 1IXZA 3WQBA 4Q9KA 3KHKA 3L1HA 1GA1A 3B6ZA 3L1JA 1KE2A 4J4HA 1P72A 4H31A 1IN6A 3A2LA 3EAQA 1EUYA 5FA8A 2C97A 1NLMA 1UBFA 1GFZA 2WTNA 2VT6A 3CFYA 4H0FA 1U1GA 4QLAA 3D3KA 1DIOB 1O97C 2BFBB 2WZBA 4P5PA 3EULA 5DCLA 5THQA 3RAJA 4NHEA 1UZMA 1YR3A 5IM5A 2OCDA 4D4JA 2HLDD 1FTNA 2P5SA 1WB6A 3F98A 3AEZA 3N76A 4GLFA 1S9DA 4ZCSA 5HQ3A 1V4BA 1WF6A 3DDOA 5TS3A 4C0BA 1P1HA 3DS8A 3I6ZA 3JATB 4XR9A 5A0FA 1JBQA 3KPYA 5T64A 1GAEO 2Q9CA 3ZIUA 1ZD3A 2Q3EA 1S5PA 2ZJBA 2Q50A 3BD6A 3M9WA 4FW9A 4ZKEA 2Y71A 1QTNA 3ZDYB 4ARSA 2P6RA 1E1RD 2O59A 1LQTA 3W1EA 3GHYA 4NDAA 1U0EA 1ACJA 1LDEA 4QDXA 1YVEI 2AL7A 3FTDA 4LK2A 4KN9S 3R7BA 2ZVDA 3GH1A 3CXRA 2QSJA 1PFYA 1G8MA 4P35A 4F96A 1DIRA 2XT0A 1F4PA 4XJXA 3TTWA 2NVUB 3TLKA 3HV2A 3K9CA 1Z7GA 4Z7NB 1MEOA 3U4QA 2JB9A 5DV9A 4AJIA 3OC6A 1AS0A 1BJTA 5FTMA 4ZI3A 2UKDA 3RUIA 4H0CA 1Q0PA 3I42A 4LC0A 3Q5DA 5ALZA 5GINE 2PWYA 4MGEA 2XAAA 3VA7A 4Q7KA 2C88A 2P2CA 2ON6A 4YR9A 1OKKD 2QMHA 5CH8A 1G8JA 2WHYA 4EY6A 3EYWA 1GVHA 2OILA 3ZTYA 5KZMB 1I3LA 1JEDA 1Y4DE 1VIAA 1ZJJA 3OZBA 1VYTA 2JFHA 1V9LA 2BY4A 2WIFA 1RXIA 1DC6A 3D6TB 3D8TA 2PTGA 4LISA 3HVUA 1YQWA 3D7MA 5K0LA 1Z62A 3RFCA 1SK8A 3C48A 1DPGA 5JY6A 3O3OB 2A84A 1LBHA 1AURA 3FLEA 4JGBA 2Q6LA 4NONA 5E8JA 4DSNA 4EARA 1R8YA 1YI1A 2OUIA 2O48X 4NJMB 3T7KA 1GZVA 2A1TS 4CLOA 4PAWA 4Y2PA 2FMHA 4CMHA 3MCZA 1A98A 3T5TA 4B4VA 4DA8A 3PJRA 1Z0JA 3HACA 1A9SA 2IGTA 1T15A 1QG6A 1PS9A 2X7JA 5EQFA 3GJ6A 5J2TB 1DKRA 3FRHA 4NX2A 1EQAA 1NYQA 1IPEA 1HYHA 2YZGA 2OAP1 1U99A 4KMRA 1BN6A 1Y3AA 2DLNA 1QH8A 1ABFA 2O5RA 2JLBA 4WXPA 2ZBRA 2XXJA 4DA9A 4DBVO 5IKPA 3QFRA 1YRHA 4CCWA 2YHUA 4MAAA 2YCLA 2I2XB 3KU1A 5TVGA 4F5YA 1S2LA 2XNSA 3RU3A 2HBYA 4IDGA 1XD2B 3HDHA 4S12A 2Y77A 5LCXA 2ETVA 2VYCA 4MDHA 4C4SA 3NALA 3HYTA 4XASA 2VCYA 3L0CA 5K6AA 3AVWA 5F1KA 4Q66C 1N2JA 3CPHA 3CU5A 4HY3A 3VKWA 3RU9A 3F96A 3GCGA 5E7MA 1XFDA 2XMPA 4JT2A 3SDSA 4BDSA 2XNKA 4KYIB 4FGJA 4YRJA 1IVSA 2ZOSA 3NHPA 3LUKA 3D43A 5C51B 1E7YA 1DOZA 1ZZGA 4S1VA 3W4IA 4BNTA 2J9GA 3II6X 3IJRA 1FRFS 2JIPA 4M7WA 4BB5A 5EJ5A 3H3JA 3O9VA 1OFGA 2BEWB 5C1BA 3FWZA 2HWKA 4OMDA 4US2R 1XYVA 4DMHA 4N01A 3O2SB 4YMLA 3U44A 3TLGB 4M1KA 4WZBA 2DFKB 3ECCA 3PJEA 3T41A 3I6IA 3EH1A 1A9XA 5JNLA 4R2LA 1DBSA 2D4HA 4FFPA 1T0IA 2H54A 1QMGA 5E2BA 5FOUA 1PQWA 4WBNF 1UEIA 2O8CA 2A78A 1A3CA 1DX4A 2H4ZA 1RQXA 2VJQA 4XPZA 1B8PA 1YHNA 2IEIA 5CT8A 1RNLA 4GOMD 4LG1A 3SIXA 1RQPA 1MH1A 1JSXA 4MITA 5L95A 1N3IA 3PGKA 4KDEA 2QI9C 2BSQA 4ZOEA 1SC1A 3QPUA 3WNVA 2FEWB 2G82A 3RASA 1Z56C 1BVUA 1RBMA 5D00A 4BFTA 1YIAA 4OL9A 3OU7A 2QF7A 3PRJA 4OBBA 2XUIA 3RYHA 2GN1A 3H6GA 4R9NA 4ZV4A 5B5SA 4DUZB 4M0LA 1PHRA 4H4CA 3WJAA 3KEOA 2CL5A 1G18A 1LDGA 1N2HA 1WVMA 3ORFA 5A7GA 5EUCA 3KQWA 5B3JC 3K1JA 3AL0C 4F9TA 1DQRA 1WP4A 2W6JD 4H3SA 4LWZA 3W5AA 1FYXA 3VBEA 5SZJA 5HJEA 2GN6A 1VZ3A 2IKQA 4JB2A 3JVVA 1ILEA 3P0FA 3SX2A 1O94C 1O8CA 4QIHA 2FWAA 3GRAA 1ETHA 4RLQA 4YUZA 4R83A 2O7RA 1UAAA 3BWVA 4Q7JB 4LMRA 4LGYA 1KMCA 4AVYA 1YV9A 3KXLA 1AUOA 1MJNA 4K88A 1IBCA 1F8GA 4ZO6A 1PVDA 1R00A 5DM0A 1YOVB 2H2GA 4NE9A 4I4LA