5TB5A

Crystal structure of full-length farnesylated and methylated kras4b in complex with pde-delta (crystal form i - with partially disordered hypervariable region)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
184
structure length
172
Chain Sequence
b'GTEYKLVVVGAGGVGKSALTIQLIQNHFDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDKKKKSKTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title Structural basis of recognition of farnesylated and methylated KRAS4b by PDE delta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein
total genus 61
structure length 172
sequence length 184
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5tb5A00
3NEYA 1KZGB 5LPNA 3CW2A 5E3HA 4AWXA 4A6PA 3SQWA 1CXZA 1Q1QA 2AWNA 5C4GB 5GJWC 3BIFA 2IL1A 4MGZR 1AN0A 4OHVA 5FOUA 1XPUA 1JR6A 3IGFA 4HZIA 1NVVQ 4URXR 2FWRA 4QG7A 5DI3A 3ZZTA 2N1BA 3THOA 3SFVA 1N0WA 3HPRA 1XEWX 1P3JA 2X8AA 5DHFA 2XZOA 1G6OA 1Z0IA 5HE9A 4BE7B 2O8DB 1L2TA 2EWVA 3AF1A 4KSCA 4AYTA 3GLIB 4CEHB 3UG6A 3CRRA 3BWDD 5EP4A 3K70C 4C7OB 3R8CA 3RANA 3NEJA 4AD8A 3QBTA 3FE2A 3O8BA 2C9CA 4LPKA 2OCPA 2UKDA 4F7WA 4WIAA 1DBSA 2DFNA 1OFIA 2REXB 2VF7A 3QY0A 2O8CB 3MJRA 1G21E 1W47A 1LV7A 3N70A 4WVFA 3GFOA 4FN5A 1NMYA 2HCJB 3MSXA 4DKXA 3I32A 1XMJA 2ORVA 2ZITA 1IQPA 2A5JA 2H57A 4DCVA 4ZKEA 2C77A 4GMXA 2EWWA 1W4CA 2QMHA 2CL6X 421PA 2XZLA 5FUVA 4DHEA 3EASA 3H84A 1E9CA 5IDVA 2GXUA 2ZRNA 2QP4A 3VU9B 3BFXA 2ZI7A 4DLTA 1MOZA 5A0FA 4DCTA 1Z28A 2WHXA 2QPTA 4M9ZA 4QKQA 1OXSC 4E5UA 1P7CA 2QTVB 2YOFA 3FKQA 1BS1A 3KKOA 4KITB 2O8EA 2WWHA 2H18A 3MLEA 1A7JA 4HDCA 4DCSA 2OFXA 2ZS8A 4BFVA 4TLCA 1TUIA 1VHTA 1ZVQA 1T3SA 4JJKA 4AK9A 1H8HD 1SXJE 3K9HA 3TW8B 2ZR9A 4YLGA 3UIEA 2WIAA 4UKDA 2P5SA 4DSTA 2VRWA 3OEED 2K5UA 3TW4A 4DWJA 2ONJA 1AS2A 2Z4SA 1XJ0A 1CJKC 3UMRA 6Q21A 2D7DA 1NJGA 3QJYA 1VG1A 3RWOA 5CYOA 2GESA 3U3MA 4QJ3A 1P9NA 5E95A 5IK2A 3D7MA 4RD0A 4HZUB 1E1QD 3GLFA 1IY1A 1DVRA 2AK3A 4FXPA 2N42A 4Q03A 4RZXA 1JECA 2C78A 2A9KA 1J8MF 1ZM7A 1GOTA 1KO5A 2I1VB 2RHDA 3FFBA 3GLHB 2GF0A 1JALA 1YR7A 4WW0A 1G3MA 2QSYA 3QE0A 4II7A 3BAFA 4XWAA 2JLXA 2QL6A 1MO6A 1VECA 2OUKA 5JWOA 2GETA 1ZJ6A 5HTKA 1D6JA 4A6XA 4D80A 5BXQC 1FUKA 4BEBA 1Z6TA 4G0NA 3LH5A 4KAXA 3VTKA 1UKEA 3HDTA 1D8TA 2BDTA 3EPLA 1SVMA 2IF2A 5ELXA 1Z29A 1DAMA 4TZ6A 2KSQA 1NBMA 1W0KD 2WKPA 3HWSA 3HP1A 3A58B 1OH5A 1E0JA 1LS1A 1NIPA 5AJYA 2JLZA 4EFMA 1P5ZB 2OBMA 2W6JD 3AV0B 3E2IA 4MGYR 5LBIA 4EKDA 5CK4A 4P4TA 4XJXA 5GVSA 4FMCB 4TQ9A 4B35A 2YJTD 1T3LA 2QAGC 3WMGA 3WNBA 2ONKA 3L2OB 4KBFA 1RW4A 3DM9B 4A92A 4BLPA 4JLPA 4TYQA 3QVUA 2DFLA 4BECA 3TSWA 2KJQA 2ZYTX 4YMSA 1KK1A 1T0JB 5JWHA 3K70D 4Q66C 2G0TA 2R6DA 4PAOA 4A2WA 3VKGA 3QXCA 4CVNA 2XSZD 3PEVA 1DG1G 2F6RA 1FW6A 4OHWA 4Q1AA 4WAUA 4A1FA 1T6NA 5FPKA 3Q8XB 1ZRHA 1NNEA 2R6AA 1NN3A 2J7PA 2ERYA 1XRJA 2G3YA 3OEHD 1AZSC 721PA 2J7PD 1P4SA 4OK6A 2D4HA 2QT0A 3BB3A 2HJVA 3UKDA 2I3BA 3T5DA 4DLZA 1GFIA 2VL7A 4XSGA 4TQAA 2H17A 5EXXA 1TF2A 2OXRA 2ZRIA 3L8YA 2ERXA 3D8BA 4Q00A 3RRNA 3QSYA 4Q02A 2BM1A 4OHZA 1XMSA 3NH6A 1GKUB 3THXA 1SVSA 1BIFA 5KNDA 2QRNA 1LB1B 4LUCA 5KTYA 1KGDA 1UDWA 2ZR0A 3FPAA 4I99A 1VKJA 4KHZA 3R9IA 1QHNA 1TL7C 4MITA 1NSFA 3SU8A 3EG5A 1S0UA 2NO9A 4NTZA 3CR8A 1RRFA 3BK7A 2RGEA 2IHBA 4WZ6A 3W8NA 1XZPA 2KE5A 3ND8A 1G7SA 1G7TA 1JJ7A 2P2LA 4L16A 2DHRA 3CZPA 5F2EA 4B33A 3PCRB 3ADCA 2JLYA 3AVWA 1F2TA 4PPQA 5BN3A 2Q9CA 2OLJA 4M22A 3B1WA 1FOEB 1S1MA 4HLUC 3LLUA 4XSHA 5FOVA 4DB2A 1TEVA 2J87A 3LO5A 4EFLA 3OFND 1XD9A 1VIYA 3TQFA 2NZ8A 4NE2A 3CBQA 5H70A 1KMQA 1TAGA 3CO5A 1UM8A 5B57C 1MKYA 1GNPA 3N5CA 5KPJA 4AYWA 5BYJA 2LWIA 1W36B 1OB2A 4S35A 3D6TB 2JAQA 1KJWA 1Q1BA 5FL7D 3LVQE 2ZSBA 3CF0A 2WWGA 2WVJA 3RHFA 4PC1A 2GEDA 3SJAA 2QE7D 2VBCA 2EYQA 1AKEA 1JR3A 1JEEA 1AQYA 1DAFA 1WA5A 1E94E 2I4IA 4KYUA 2PX3A 2CVHA 3AVYA 5FOSA 4RZ3A 4XOIA 2GVDC 4Q1DA 1U8YA 5L3QB 1N25A 2NGRA 4B73A 3K09C 1EFRA 3Q9LA 1OYYA 4HDOB 1ZM9A 4RFSA 1S9DA 1MABB 4EQ6B 1NIJA 2GHIA 3K53A 4F91B 3ETLA 1VG0B 2BBTA 2ZRMA 1R0XA 4BFXA 3NH9A 4PHTA 3ZZUA 1IY0A 1AA9A 1JNYA 4F4JA 3OIWA 5JMTA 2ZSEA 1E9AA 3M4YA 4E22A 2ZR7A 3LXRA 5EXPA 1G5PA 1XP8A 4ZCLA 4A36A 3FYHA 1XEWY 3KKQA 1N6KA 2YHSA 2KB0A 2ZRPA 5LB2A 3T12A 1E4VA 4YC7A 4NBSA 4PQRA 2H92A 3WYAA 1M2OB 1UFQA 5EE9A 4ARZA 3QF4B 1XF9A 2REBA 1G3IA 2OCYC 2AD1A 3AKEA 3SYKA 4M8NE 1MO4A 3IIMA 3AF0A 2OLKA 3EAQA 3DEFA 4PANA 1OPXA 3TVTA 3N2IA 3WNDA 2XTNA 3AKCA 4RKFA 4V0ME 4PPNA 3EA0A 2ZI4A 3KUDA 3ZVMA 1U98A 2PH1A 3BD9A 4H1UA 5E4FA 2GXSA 1EWRA 2BMEA 3VHLB 2GVZC 4IOJA 3E5HA 1SKYE 2CLDX 1P60A 2UZIR 1YR8A 3T1OA 4MQBA 1WMSA 1HT2E 1XCMA 2ZRFA 1N6NA 1SXJC 2JATA 3RS3A 3ZVLA 4F93B 3BXZA 4D81A 1KZ7B 2AXNA 4DLXA 1T3HA 1FTSA 5C18A 4HLUA 3LBHA 5CK5A 3GJ3A 4AURA 3CRVA 2XB4A 2IUTA 2V54A 4KVGA 5SZIA 1E0SA 1EX7A 1LW7A 2AKYA 2WJGA 2YC4C 3NC0C 1Z2AA 3QPWA 4HUQB 3RYTC 3T1TA 2CDNA 1LS6A 2HXSA 5KPDA 1JPJA 2Q3FA 2IYTA 1H8ED 4JL6A 4OQMA 5FTKA 3RABA 1QHHA 4JMPA 5F9HA 1LNZA 2W6IA 1U99A 3P1JA 4KBGA 1SHZA 3CPEA 4RCZA 2PT7A 2O52A 1M7HA 1UBEA 4U5XA 4D6PA 1FQKA 1G18A 1XEXB 1OXTA 1SVIA 3ND9A 3T06B 4JLJA 5DYIA 5EZ6B 1KDRA 2JIZD 3GD7A 4F92B 1UEJA 4PHGA 4W5HA 1HY3A 4L15A 4Q4AA 2O8DA 1QZXA 3IIJA 4DUGD 4Q4HB 4E03A 3K09A 4GOXA 4Q7JB 1KK2A 5JCPA 3GLIA 4YDHB 4YMUA 2CHQA 2YC2C 2QBYA 1TNDA 2EFCB 1CRPA 4C2UA 1DEKA 4DSOA 4IVQA 1F3OA 3A4NA 4UXJA 1UADA 1Q57A 4D4LA 4EUNA 1R0WA 2VH5R 3WBKA 1II8B 4IHQA 1KAGA 3CH4B 4IRUB 3TH5A 1N6LA 2PLFA 2WOJA 4ZI2A 2HF8A 5JZVA 4CDGA 1S3GA 4AKHA 2JJ1D 2WOOA 4W5WA 5LDDC 2IC5A 3WYFA 1QHXA 2O0JA 2XNDA 2ZANA 3A1TA 4HLCA 1AQUA 5L3VA 4PPFA 3X1WA 3N2EA 3UXMA 4XWKA 1WCV1 4FI3C 2R65A 3VU9A 1U81A 4RD2A 1XJCA 5C2JB 4F4CA 4KV9A 1E98A 3BB1A 4TWZA 1LTQA 4EPYA 2GEUA 3CX8A 2O8BB 1U9IA 2ZRHA 1KMHA 4W7SA 4A0GA 3SN6A 1V5WA 1W48A 4LV6A 2ATXA 2H8KA 1N0UA 2J41A 2OESA 3CNNA 1KSFX 2GNOA 5A5GA 3GPLA 4A8JC 1U2RA 2XNSA 2BHRA 2A5FA 4Q48A 1IHUA 3UWKA 3UWOA 3EZ9A 2E9SA 4IEIA 5FBVB 3GEIA 4IDQA 5JJIA 1AJEA 5L3SB 2J1LA 3W5IA 5JEEA 1KYIA 3SZRA 4DIDA 3I5YA 2FJUA 3Q72A 3VQTA 1F5NA 5FUXA 2AK2A 4L8GA 5FPYA 1II9A 1NY6A 1G16A 1SXJD 4G5SA 4DSUA 5FOXA 1E2DA 1Z0AA 2JLUA 1WRBA 1R0YA 4HZUA 4JYCA 4PO1A 2YZ2A 3Q7QA 4RJLA 4GMDA 4H9GA 3K0SA 4GDFA 1ZM2A 2WKRA 2R44A 4C0SA 4M1SA 1G4AE 1X8KA 1GRRA 1XB2A 3H86A 3SYLA 1TU4A 4E07A 4QHYA 3EZ6A 4JLKA 5LB4A 5CDFA 4MYUA 4B71A 2GF9A 3Q5EA 4IEEA 4M1MA 3AKYA 1JAHA 2B6HA 4Q4JB 5FH9A 1FNNA 3GEHA 2IS2A 2QN6A 1QVRA 4DLSA 1OFUX 3C16C 1I2MA 4OK5A 2RGGA 5D3MA 2IYSA 1GILA 3PEWA 2GJSA 2MMCA 2O8FA 1ZC4A 4LCBA 2PMKA 2EYUA 3QKSB 1KJYA 3QQ5A 4YMVA 1KHTA 1RYFA 4D0NA 4LBZA 4Q21A 1KDTA 1D5CA 2I1QA 4PR0A 4TYPA 4BQSA 3A8TA 3GJ8A 3QKRB 2F9LA 3LBNA 1Q1ZA 4QHTA 4RZUA 3ZLJA 4M1KA 5IF9A 1JQLB 3THWB 3FMFA 3MJHA 2C95A 3D31A 1PJRA 2QMUA 1S3SA 3EZ2A 2VHTA 3M1IA 2GK7A 4WOPA 4N1AA 3SE0A 1UJ2A 3ASZA 3BBPA 3QPUA 2J0UB 4AIIA 1TUEA 2A7QA 4JVMA 5J4HA 1JR3E 3L0SA 3GP8A 5J4YA 3BERA 5SZJA 1OV4A 1FTNA 4ITRC 1NVUQ 1YQTA 2IA5A 3BRWD 2J46A 4FWIB 1ESNA 4GBMA 1Z63A 4PX9A 2ZE5A 4PXAA 4G5RA 4V0NA 1KNXA 1QBKC 1E2KA 2V7QA 2X1VA 1F6BA 5KHOC 1KI3A 3PEYA 3KXIA 1EGAA 1V43A 3W3ZB 3TK1A 4DJTA 4MRSA 3CONA 3VKHA 1XPOA 1R8SA 4HEJA 2YKGA 5DE3A 2A5GA 2XJ4A 4URVR 3LW7A 2R9VA 2VP6A 4PZYA 2VSXA 3OIUA 4ZDIA 1F2UB 1ZD8A 4CEJB 1DS6A 4LY6A 2ZVQX 1SQ5A 2BMDA 2Q6TA 4LHWA 1M6NA 3DHWC 1DG3A 2QAGB 1KY2A 1CTQA 2FV8A 4CEIB 2BVNA 3F3YA 1JPNA 4YXWA 4NDZA 1RE0A 4OBEA 2RAPA 5DISB 4C0BA 3EZ7A 2BCJQ 2OHFA 1VPLA 1ZM3A 2ZYVX 4D4JA 2ZUCA 4B76A 1NKSA 2RKOA 1NMXA 2CLCX 3LDAA 1JXMA 1Q1EA 2GJKA 3WNCA 3VR2A 4Q9HA 3SNHA 5DN6A 4YDSA 4NYIR 3MUFA 2CNWA 2FNAA 4LGMA 3Q3JB 3VAAA 1J70A 5KSPA 4LJ9A 3C4JA 3TNFA 3KJIA 4ASUD 4K8OA 2D74A 2WTUA 3B7GA 3QPVA 4QGFA 4UJ3A 3SEAA 4OJQA 1Z2CA 3QXXA 1HYQA 2DCUA 4BRWA 2C5LA 3KJGA 3X1ZA 2JJ8A 4NL4H 1DOAA 1GRNA 1E2NA 4Q1CA 3FOZA 1N0VC 2ODEA 4MH0R 1WP9A 2VHJA 2CJWA 2HXYA 1KJZA 2QMEA 3CM0A 1NRJB 3IPYA 4Q9JA 4HAUA 1RRCA 2QI9C 4LX0A 3WMFA 5KDDA 1RJ9A 5KSZA 4B43A 2PEZA 3C41J 1Z07A 3WP0A 1Q3TA 1Y3AA 1ANKA 5GADl 1P75A 3ZD7A 1M7BA 1ZNYA 1FPMA 3HJNA 1RYHA 2ZSDA 2D2FA 3DO6A 3EC1A 3QXJA 3EWAA 5JEDA 4BLRA 2CMKA 1MV5A 3ZJYA 3NDBB 3DPUA 1NN5A 3S1AB 3AP3A 4ACBA 2ZRKA 1ZYUA 3LWNA 3U3OA 1ODFA 2EFDB 2NG1A 3L0PA 2L0XA 1ZNZA 4L9WA 3SJBA 2QTFA 4N3NA 4NYMQ 3VX4A 1I4LD 2WSSA 3W6PA 2ZJBA 3A1VA 4V0KA 1OH6A 1US8A 4DB4A 1P9RA 3Q85A 2WSSD 1ZUNB 4L9SA 1X1SA 5FI1B 1XDBA 1MRSA 1YZQA 2WWIA 3I8XA 4MGIR 1U8ZA 4LK2A 3AM1A 2FGKA 5J40A 4OI0A 3E1SA 4NMMA 1T8UA 2VLIA 4KLNA 4FW9A 4IDHA 4B48A 3QVVA 1JBKA 3AP2A 4TSFA 4QHSA 3C15C 3NBXX 1N5LA 1NY5A 1UKZA 2W58A 3IO3A 3LV8A 3OIYA 2BJVA 3QUSA 3RS4A 1WXQA 4DLRA 4TMKA 5FTNA 2G6BA 1ZIPA 3DL0A 3JVVA 3H4MA 1BH2A 3V00A 2JLRA 3W6OA 2NPIA 2GILA 1OYWA 1C9KA 4P3YA 3RRYA 1OXUA 2J0SA 2ZVPX 1KY3A 4PHHA 4JKIA 5DO9A 2DWQA 1FX0A 3PITA 5CIWA 3KTAA 5TMPA 1A4RA 4UNSA 4M1WA 1SULA 2VIIA 5TV2A 2P6UA 4OKSA 1M34E 4GI7A 3R9XA 3ADDA 1SGWA 3LVRE 1YZGA 1VYTA 1CR1A 4LC1A 2NIPA 4TMTA 2GCOA 4NP6A 1I4DD 1A2BA 2CL7X 3ZVNA 1OHHA 3WRXC 2XX3A 1R10A 3WRYC 1E2IA 1OHHD 4RFVA 3UMSA 4V0OA 1CJUC 4MYHA 4NYIQ 4TLBA 5J5CA 4C30A 2W0MA 2WPDA 2IS1A 2R2AA 1J90A 4Q47A 5LD2C 4MA4A 3EX7C 3IEUA 2RGNA 3QG1A 1GWNA 4DT1B 1XCPA 3GJ0A 4OQFA 3DZDA 2QM8A 1YJ5A 1QG2A 3CPHA 2QQEA 3T1VA 2F43B 3FMPB 3AH8A 3LX5A 4MRRA 3SDZA 2CXXA 1IN8A 4NCJA 4OQNA 1D9ZA 5IK2D 1CJVC 4PO8A 4MKHA 4RD6A 1K5DA 4XVQA 3U5ZB 1KI6B 1E4YA 4IW3B 2FOLA 3B2EA 2PZGA 3PG5A 4MDFA 2V1UA 1TX4B 1NF3A 1I4TD 2WWXA 1GKYA 3K0AA 2QA5A 1SXJB 3BH6A 3PV0A 4NCKA 4DCUA 3QKUA 3AGQA 3KQUA 5JLJA 3DKPA 5BN5A 1XJQA 1HQCA 4WA7A 1CS4C 5KDLA 4EJSB 4ZDJA 4A15A 5AJZA 3CX6A 1XTRA 4HAYA 2QM7A 1VYVA 4RD1A 2UZ3A 1G19A 2CLSA 2GBLC 3THYB 3KDSE 4M9QA 1NBMD 4G5QA 4IOMA 1CJMA 3QKTA 4PFSA 1O3YA 4QGGA 2YINC 4P33A 3PEUA 5BYKA 4X8MA 3ZYCA 2W2XA 1TQDA 1QG4A 3C5HA 4HB4A 1Z0FA 4TTRA 3R7WB 4D0LB 2FX3A 2AL7A 1W2HA 1PLLA 4MYTA 4B6FA 4F38A 4Q01A 2W00A 3SHFA 2WIBA 3KUCA 3RC3A 1OLOA 1Q0UA 4LHVA 1W4AA 2MSCB 1BMFA 3ZDQA 3T1QA 2RMKA 2C2HA 4Z1MA 3PR1A 4NCNA 3FWYA 2GJAA 1JXOA 2OG2A 5JHHB 1YRBA 1KTVA 4HB3A 1MT0A 2HLDA 621PA 3BJIC 2IWHA 4DIEA 1J2JA 1PUIA 2J45A 1KI7A 4GT1A 2BKEA 3WHLA 4B2IA 2Q3HA 4N0EA 4BLTA 2IYRA 5DYGA 2NMVA 2ZSAA 4RY2A 4LOAA 4C9BA 3PUZA 4LZZA 1AGPA 1HUQA 3HYRA 4L4UA 4BFWA 4OJKA 2DFTA 5DIFA 1UBGA 3LAWA 1XNJA 2VF8A 3ECCA 5FI0B 4BFSA 4V03A 1OIVA 4JT4A 4AC9A 4I1VA 3QIAA 4CF7A 2XOKA 3I4LA 5IRCD 1E2EA 4Q4LA 1PLKA 4DRZA 3P32A 3U6BA 1OFHA 5A4JA 1CR0A 2ZS7A 2SHKA 1QHIA 3PIRA 4BZPA 4GOKA 3I73A 3TSOA 1GITA 5CYPA 4KJZA 3C14C 4LBYA 3CB4A 2ZU0C 3F5FA 2IYQA 1S8FA 1ZNXA 2IYLD 3SQXA 2BBOA 3ZIAA 2DWPA 1J7KA 1X8LA 3AQ4A 3CNOA 3RRZA 1XTSA 1VHLA 1KKLA 1NL3A 2X2EA 1SHKA 2FN4A 3QF7A 2OBNA 4B44A 4JLOA 1VDZA 2NTYC 2ZRLA 4IXMA 5SZHB 3RSOA 4LV8B 4A8JB 2FG5A 4GOJA 5D3QA 1UKYA 1KAOA 1U94A 3MWJA 4TMVA 1N6RA 1HV8A 2YWGA 4P4SB 5AJWA 1A1VA 2A2ZA 3VMFA 1IXRC 3U4QB 2G0NA 4B3GA 1XTIA 2XXAA 2QY9A 2ZYWX 2GZAA 2VP0A 5KUTA 3V4RA 3GLGA 3B13B 5M04A 1Z6AA 3AF4A 1DAEA 3EIHA 1WB9A 2TMKA 3E70C 2GBLA 1KI4A 3KXKA 2WMNB 1XD2B 1KNQA 1ZU5A 2EFHB 1DPFA 4O0MA 5G3YA 2JCSA 3A4MA 1JR3D 3NC1C 4PQYA 1GTVA 1ZINA 2JJ2A 4DLUA 4A9AA 4PSAA 4AKGA 3KJHA 1ZU4A 1G4UR 3C7KA 1W5TA 4LC0A 3KL4A 3H1TA 3SOPA 1M8PA 1AIPA 1IN6A 2D62A 2LCFA 4JVSB 1XTJA 4BZXA 2ZRAA 2W2TA 5CM9C 2KBEA 2OFWA 1XD8A 3IHWA 1EFRD 3SR0A 3CRQA 1GL7A 2ZJZA 1ZP6A 5AWFC 2ZSFA 1YKSA 2YOGA 2YVUA 1BOFA 4US2R 2AKAB 2RGCA 1KSJA 2VP2A 1TEXA 3G82C 4UQOA 3PXGA 3EW9A 2A78A 4JLNA 3VR3A 1N6HA 1HT1E 2VSFA 4HAVA 3TQCA 4QC2A 2RGAA 2GDJA 2XZPA 3RS0A 3FVQA 1CIPA 3WYGA 3AEZA 1PZNA 3AVPA 2LKCA 1XXHA 2ZUDA 3IBYA 3LY5A 4P32A 4M1TA 5EXTA 1WE2A 1Q20A 2ZI9A 4HB2A 2IXGA 4JSTA 5FPHA 2CBZA 4JS0A 3SJCA 3SJZA 2B21A 1U9IC 3GMTA 3HU2A 3BE4A 4ON9A 2BMJA 2FA9A 5DH9A 2WWYA 2FH5B 4QBHA 3W90A 3DMNA 1KK3A 4M2LA 4R9UC 1LVGA 4MDEA 2QPOA 4QJ4A 4JBYA 3OAAA 4D4KA 1QDEA 4M4SA 1F60A 1G5RA 2C99A 4EFNA 5GJVC 1KIMA 3BGWA 5JSZB 1QHYA 3CR7A 3ADKA 4FIDA 5FBRB 1TQ2A 2BV3A 4AG5A 1WF3A 1E79A 2WWFA 1ETUA 1SVKA 3KKNA 1X1RA 4IFBA 2CEAA 2CL0X 4PSKA 4PO9A 4PQFA 2W2VA 2GCNA 4CYMA 1ONBA 3CWQA 5BW8A 2ZAMA 4I1SA 1ZM4A 2V9PA 1W44A 4OYHA 3LLMA 1XCGB 2OCAA 3GJ5A 5AJXA 5DLQC 5B30A 2WV9A 4DCNA 3ZQ6A 1XEFA 3AVOA 3EA5A 3KB2A 4LJYA 4GNKA 1E2LA 2FPLA 1J8YF 2WJVA 4KFUA 2XGJA 1T9HA 1QHGA 1N6OA 1GM5A 2F55A 1E3MA 1SKYB 2HUPA 2AWOA 2CCJA 2RCNA 2BC9A 2VQSA 3BC1A 3KB1A 4LRWA 4M9SA 4WBSA 4BWYA 2J0QA 3SI7A 4CRWB 5TB5A 3NBZC 2WAYA 2W6ID 3GEEA 1CRQA 4IOKA 4X8OA 1OKKA 3B82A 3IQWA 4B2LA 3GLFE 4IFEA 2FFQA 1W4BA 2XITA 3TUIC 3TGPA 3AVVA 1MO3A 2JEOA 2QQ0A 4I81A 5H8WA 2AFHE 1KSGA 2J7KA 5AUNB 4CEHA 5FBQB 2UVQA 2ZRGA 5F3WB 3FHTA 3U6KA 3ZD6A 4C7OA 2PMDA 1N3BA 3OHMA 4GP7A 4KVAA 1E9FA 4UXIA 2XTMA 4F4IA 2PJRA 1NBME 2AN9A 1G41A 3AUXA 5EE1A 1FFHA 4LYJA 2O8CA 1T5IA 2F1JA 5EUQB 4FCTA 1OXXK 1T91A 5CJ2A 4C0QC 2QGNA 5EXSA 5IHPA 3WBJA 3GLFB 3NHBA 1AS3A 5E7JA 4K81B 2ECKA 2Q9AA 3QENA 5J47A 4TLEA 1GIAA 4U02A 3VR1A 5DI9A 1GL6A 2XNDD 1GP2A 3RDPA 2F9MA 4XD7A 1OIXA 3I62A 1I2DA 4ZDWA 4R98A 1Z6YA 3OE7A 3FDIA 1LF5A 1A82A 1KI8A 2IS6A 5HKKA 2AR7A 5UKDA 4HDQB 3X2SA 2RHMA 2C04A 2X77A 2DBYA 1VCOA 5G40A 1HURA 1E69A 3B8HA 2P6RA 2WWWA 4Q9IA 3MCAA 4U00A 1E0KA 2IXFA 4ZIRB 1UF9A 4P0TA 1ZCBA 3WY9A 2QZ4A 3P20A 4M1OA 3L43A 3BS4A 4BGDA 1OJLA 1S96A 1U8AA 1OSNA 3QOFA 4P31A 1KDOA 1KI2A 3MMPA 5J4LA 3A4LA 1NLFA 2IW3A 3PFIA 5J4KA 2GAAA 3UMFA 3K70B 2GXQA 1E0AA 3QXHA 5DGXA 3T35A 4JLVA 2OXCA 5JS7A 1E2MA 1OT3A 4DEXA 1ELOA 2R6FA 2V6JA 2F43A 2PX0A 2WJYA 1AK2A 2WAXA 3BB4A 3SYNA 2DFKB 4OI2A 2QT1A 1JI0A 3MFYA 1W7AA 3TE6A 1J99A 2D06A 2FZLA 3GLHA 2JGNA 5AUOB 1FMJA 4DSNA 4FWTA 2PLRA 1OIWA 2EFGA 2ZJAA 1QHSA 1NSTA 4IOLA 5EE5B 3RS5A 2YOHA 5EE0A 3KQNA 4JLAA 1KO7A 1ZD9A 4TLAA 3BFVA 4Y0AA 1W36C 1R0ZA 2OM2A 3EPKA 1Z5ZA 1IXZA 3W5JA 1D2MA 1RIFA 4C4PA 1KOFA 4EJSA 3A1SA 2ZUBA 1ZIOA 5JJLA 3Q5DA 2QNRA 3SC3A 2OZEA 4JBXA 2IXEA 1WBBA 2V3CC 2WJJA 3AF3A 2P0EA 2H7VA 1II0A 2DWOA 2QSZA 4P4UA 4ERNA 3I5XA 4UJ5A 3THXB 5GJBA 1CEEA 4LV5B 1L4YA 1N5JA 3DKVA 4TL9A 3R7WA 4Q1FA 4EPXA 4TLDA 5BQ5A 3PQCA 4TMXA 4PC3A 4UNQA 5CITA 4QGHA 1KDPA 5LD2B 2C03A 1EFHA 3KKPA 2BEKA 2FU5C 2Z6VA 3FHCB 2HYDA 4NYMR 2FPKA 4B32A 5JBQA 2VEDA 3GLGE 2GZHA 2VHCA 3QEJA 2OFOA 3HYTA 5KOYA 2JDIA 2FEOA 4B74A 3U7GA 3SHWA 2NOAA 2QORA 1A2KC 1XTKA 2ASEA 1F2TB 2QP9X 3M6AA 4M9XA 3U7FB 1Z3IX 4JVNA 4D26A 1AGRA 2OT3B 1DO0A 3U61B 1KO1A 4IDOA 4JLBA 4BEJA 3G5UA 2NPFA 3AF2A 5KNBA 1E9BA 2YV5A 1ZUIA 2OAQ1 1PUJA 5FTMA 3HPQA 5FTLA 1P6XA 4ESHA 4XWOA 4B3DA 4Q7MB 4CT4B 1MR3F 3LBIA 2A5DA 4GZLA 2XTZA 2V7QD 2XEXA 2VHQA 5DHAA 1TPZA 3X1XA 1X8JA 1COWA 3IBGA 4NPHA 2ZTSA 4KSBA 5KDOA 1CULC 5F98A 1IBRA 1TQ4A 3NBFA 4BLOA 1DADA 1S1CA 2GA8A 3KKMA 4TMWA 1R7RA 1B0UA 4E09A 1DAHA 2AX4A 3AP1A 4MRVA 3TLXA 2F1RA 4Z8YA 3QNUA 1DAIA 2IYWA 1CF4A 1VYUA 1Z6XA 1G9XA 1RRGA 1XXHE 2VP5A 2VO1A 2CK3A 3P26A 1OW3B 3IDQA 4LHZA 5L3RA 4C0LA 5CLLA 2P5TB 4DDTA 1IN5A 2P6NA 4DLVA 2V6IA 4YXWD 1W0JA 4TTPA 2G88A 2ZI5A 3CRW1 5B2ZA 3MGCA 4A82A 4RFSB 2VSOA 4NCIA 3QBVA 5FTJA 1E99A 2DB3A 2GJ9A 1YZLA 4DLWA 2LKDA 3NDPA 1GVNB 4K46A 4ZKDA 4JYBA 5DN6D 4JLMA 4KFTA 1BKDR 2D2EA 1CBUA 1E96A 4TQUS 2CNWD 1FUUA 1RPZA 2OILA 4HAWA 1K6MA 3B1ZA 3MRSA 5FOTA 2FEMA 3IQXA 2IYZA 4LBWA 1W1WA 2OEPA 2BCGY 4TMZA 1Z6GA 3KX2A 1W36D 2WICA 1YR9A 2ZE8A 4LYHA 3G0HA 4ZV4A 4QM7A 1CJTC 4Q18A 2RGNC 4TL7A 121PA 3OF5A 1G8HA 1IM2A 4ARZB 2FE4A 1FZQA 3TAUA 4GRAA 1VIAA 1OF1A 4B3BA 4B2PA 4D25A 2ZM5A 2NO1A 1YRAA 3R20A 4PC2A 3AKDA 4G5GA 2ZE7A 3PJRA 5L3QA 2IUUA 4Q9LA 3CNLA 4XVRA 1UDXA 4GFDA 1D2NA 4C0AC 1YZNA 2A5YB 3F0TA 5CM8B 4YMWA 3LQQA 2RGDA 1YR6A 3B6EA 2ZXUA 1MABA 4EQ6A 4ABYA 4HATA 5B58C 2ZE6A 1KI9A 1Z08A 2PCJA 2Z0MA 1BYUA 4BUJA 2R6GA 3WXMA 3VR6A 1ZBDA 2KWIA 4HI0E 4JBWA 4EPRA 2AXPA 4XVUA 2JLWA 1VCIA 3QG5A 2CCKA 2EU8A 1BYIA 2ZAOA 3TUJC 2D3WA 4V02A 3IUYA 4TT3A 3PUWA 1Q44A 3GLIE 4D0GA 4B75A 2CCGA 2HV8A 3KFXA 4QGAA 3K1JA 3EC2A 5FOWA 4IVRA 1C4OA 4NONA 4MRPA 2RB4A 4IDPA 3LNCA 4KLZA 1S2MA 5FBLB 4OK3A 4UXHA 3TVDA 3AVXA 3I92A 1G6HA 4V0LA 1QHHB 4TSFD 4QBGB 3QF4A 4DDVA 4LJ8A 4LYFA 4US1R 5HCIA 1CP2A 5TVKA 2PJZA 5F9FA 1MO5A 1FP6A 1F48A 3KJEA 5E7MA 2Z83A 3C5CA 1G8PA 2ZRCA 2QG6A 3F8TA 4G1UC 1RKBA 4Q4AB 4TTQA 2BWJA 3VR5A 3W9YA 2WJHA 4KCGA 3K9NA 5JSZA 4JSYA 3K0CC 4TL6A 2JASA 1L4UA 4R2IA 2QBYB 2ODBA 5C46F 5IT5A 5JWRA 2VHUA 1TQ6A 3EPHA 4XH9B 3ZZ0A 1QRAA 4ZI3A 2FMXA 5CLQA 1E2JA 2JLQA 1K5GA 3ASYA 1UPTA 2ORWA 3PVSA 1P9WA 2BIFA 3FTQA 3T61A 3TR5A 3NIBA 4G3XA 4QBFA 5HE8A 3VX3A 2XB2A 2IT1A 2IHYA 3SFZA 3VHXA 2Q0HA 4BASA 1C1YA 4HUQA 1S4QA 4PTLA 2KI5A 4JL5A 4X8LA 4V0MA 1RVDA 2BOVA 3H0KA 3QXSA 1NG1A 2RH5A 5BN4A 5KSYA 4XIGS 2ZRDA 4HLDA 4ZCIA 3U3JA 4OQXA 3TRFA 3Q7PA 1WQ1R 5HPYB 1NN0A 2WPDD 1XU4A 1P2TA 4HAZA 3D3QA 4HLQB 3B1XA 4AG6A 3K0FB 4PC6A 2ODWA 5CJPA 1XEXA 3U44B 1X86B 4W5JA 1R4AA 4Q1BA 5C4MA 3BOSA 1EX6A 4TZ0A 1KMHB 2YYZA 3IHLA 4W9MC 1NMZA 3AUYA 2ZPTX 3GLHE 2IEZA 1EG7A 1TF7A 3T5GA 3VNUA 4ACAA 4CIDA 2IS4A 3NG1A 1G291 1H8HA 3P4YA 4Q4HA 4PPGA 5FUWA 1EESA 3DMDA 1UEIA 3B9PA 1TMKA 1ZD1A 1AKYA 2ZROA 1Z06A 5CDFE 3FKSA 4Q19A 5G53C 2EQBA 3OEEA 1ZW6A 3EZFA 1N6IA 2W0SA 5FL3A 3FKSD 2ANCA 4JZKA 2WBLC 1R5OA 4KXFB 2DR3A 3UK6A 5HZHA 3U7HB 1E9SA 1VG8A 4PC7A 4NYJQ 3ZS9A 4IVPA 1E1QA 4YONB 1II8A 1IONA 4QBIA 1E2HA 4NZYA 3ICEA 5K8TA 4O3MA 3PUVA 4Y0VA 5JJKA 4LPSA 3IO5A 4TYWA 2MSDB 2YWFA 4RKEA 2A3RA 3P4XA 2W83A 4GSYA 1M74A 1U90A 1YHNA 5JI2E 2BBSA 4BZQA 1T8TA 2HF9A 1DELA 2Q3MA 4QL3A 4DDUA 1N5IA 1HEIA 4TL8A 3O8RA 3RNLA 5GJCA 1P61B 1R8QA 1W0KA 2AFIE 4ZO4A 1DO2A 1XFAA 1RRPA 2O8BA 1DARA 1E9DA 2J59A 2W6JA 3TIFA 4HUTA 1BMFD 2OSBA 3CWZA 4GL2A 1GRQA 1QVAA 4MKFA 5D3MB 4ZIRA 4Z1MD 1OB5A 4LBVA 5FFMA 1XPRA 2Q21A 1NI3A 5DSZA 2O8FB 1Q12A 1TU3A 221PA 3GFPA 1HTWA 3NVAA 1K8RA 3W34A 2C96A 3LRPA 2HLDD 4EIWA 3DVLA 1R5BA 3TR0A 1P73A 5BWMA 1XZQA 3K0CA 5L3SA 4GZMA 3U60B 4Z8XA 1CU1A 2OV2A 2MSEB 2QRZA 3RSLA 2QU8A 2V4ZA 2XSZA 1IN7A 1T5LA 1SVLA 1NJFA 1OH7A 3JZAA 2RGXA 3MWLA 2ZJYA 2B7BA 2CE7A 1E1RA 1A5TA 3VR4A 2FSFA 4URUR 1P62B 2WKQA 1GAJA 1MH1A 1EFUA 5K8LA 1E1RD 3B1YA 2O0KA 2R62A 1KKMA 2ZYUX 4O25A 4QM6A 3OEHA 1Z83A 2XOKD 1TADA 4B34A 1G7CA 5FR2A 3W6NA 1Q22A 3R8FA 521PA 3ZQJA 4S2EA 3U3RA 4KI0A 1HQYE 3HU3A 5AJVB 3TKLA 1GL9B 1Z0DA 3GCGA 2FDCA 1GG2A 2E87A 2ZJ5A 4IXNA 4ZPXA 4Q4JA 2IWRA 4FCWA 4LJ4A 1FMLA 1EXMA 3DDCA 2IEYA 1E2GA 5EE3A 4A2QA 2EFEB 3SBEA 1S9HA 3ZIAD 2QTHA 3QKSA 3GQBA 4NCHA 5KNCA 2QPAA 4AYXA 4A4DA 4ZDKA 3V4FA 3O8CA 3QKRA 1IN4A 4KYIB 5EQTA 3THWA 1CR2A 3NTUA 2NZJA 3QEOA 2YNMA 2ORIA 2Z4RA 3IPXA 1Z0JA 2IUSA 1SZPA 1VG9B 2J0UA 2B8TA 3LX8A 3BORA 2ZRBA 4YQFA 1E9RA 1M1YE 4CW7A 1KSHA 1LF0A 1PVOA 1JQJC 4BLSA 3OFNA 4FMDB 3EARA 2FFBA 2VTKA 2H16A 2P3SA 2OBLA 3ZVRA 4M21A 4LDJA 4Q7LA 3J81k 5EUMA 1HE1C 4EPWA 2B8WA 3BH7A 3GJ6A 3FMIA 1N2CE 4R71A 2JJ2D 4M1YA 1ZCAA 5FL7A 2GWHA 1YU9A 2WJIA 3U7EB 3ZS8A 5EJEA 2QE7A 2NO6A 3M0EA 1G8GA 3U2QA 5FPTA 4A0FA 1RC8A 4DEYA 4QFMA 3O8DA 3CF6R 1M7GA 3L8ZA 3UG7A 3W3AA 2DYKA 4U7DA 2CJWB 2H1LA 2JLVA 5JS8A 1F2UA 5EP1A 4CEJA 2B7CA 1RJ9B 2V1XA 1TF5A 1EFTA 2QAGA 4C0JA 4RZ2A 3K8YA 3PUXA 2BKUA 4CEIA 2CHGA 2WZQA 3V9PA 1XMIA 2WM9B 1KI1A 3CPJB 4B3FX 2VP9A 2ZETA 3RVBA 3VFDA 4TYNA 4C2TA 4KFRA 2V8OA 4Q1EA 3RWMB 5K8IA 3I61A 5CB6A 1JB1A 3IILA 4LJ7A 2Z5FA 4Z51A 2ZJOA 1IOZA 5HCNA 5K8UA 1HH4A 2C98A 4NKRA 1US8B 3A36A 1FP7A 4LHXA 3C8UA 1R5NA 4LSGA 4B47A 4LJ5A 2R8RA 1D2EA 4WXRA 5CB8A 5DI3B 2EW1A 1LFDB 2ZIAA 4I4LA 3TJZA 4OHXA 1IJFA 1FL9A 4PAMA 4XTCS 2REOA 1Z22A 1JEDA 1SKQA 2C9YA 4JIMA 4NH0A 4WZBE 3OAAD 4FCVA 4JL8A 821PA 3GJ7A 2HT1A 5FBWB 4QJ5A 3PENA 1Q21A 1P72A 2ZU6A 2BJWA 4KO8A 2GTPA 5B64A 2AD5A 2EVWX 3A37A 3TSZA 3MWKA 3IEVA 5E7IA 1E79D 4GP6A 2WMOB 2ZRJA 4X8HA 2J9RA 2P67A 1LY1A 2FPMA 1G8YA 3UATA 3QI2A 4GPTA 3I8SA 1E2QA 2BEJA 3L0OA 4OI1A 3ZGXA 3A1UA 1MRNA 1W4RA 4UNPA 4I1OA 4O2RA 2GZDA 1XTQA 1NVXQ 1VCMA 2GJ8A 4PHFA 1FX0B 3K0EA 3JZMA 3KTAB 3S1AA 3FB4A 4A2PA 3DOEA 3K9LA 4Q5IA 4MRNA 1D9XA 4HB0A 2H5EA 1NVWQ 4MGKR 4EJSC 3X1DA 4CZ2A 1UBFA 4EDHA 3DZ8A 1G5TA 4N0DA 2N46A 3FFAA 3P27A 2J3EA 2GCOB 3CUEF 4CGZA 4IDNA 3JVUA 5P21A 5TY0A 4BFUA 1OKKD 1H8EA 2O8EB 1W49A 3NHAA 4AKEA 1NG9A 1H65A 1GKIA 5J4VA 1ZNWA 4KODA 1OFTA 5TARA 4FMBB 4UNNA 2G1JA 1XBTA 3B85A 3RC8A 2JIZA 1SVWA 4JVLA 4BFYA 4DXAA 1P2SA 3B78A 4Q9KA 4OHYA 2X2FA 4HSEA 3EWSA 2F1IA 2GAOA 4B3CA 1VTKA 1HA3A 2QEQA 3MAAC 4DUGA 4LJAA 5JI3E 3KQHA 4Z54A 3DOFA 3CF2A 3NKVA 1W46A 1G7RA 1AS0A 2X19A 5EP3A 5JCZA 5JRZA 3CLVA 4G5OA 2G77B 5AR1A 1WDTA 4PAQA 2OAP1 1TTTA 4TN1A 4HAXA 1CR4A 5GVRA 2FSIA 2NO0A 2HYIC 1XMVA 3K0AB 3GJ4A 1DAKA 2A30A 2DY1A 2IBMA 3OZXA 2ZS9A 4QXAA 3T15A 4BPBA 2F3RA 1RFLA 3B60A 2G83A 1NKTA 2MMGA 4XD7D 1BO6A 1GUAA 1O87A 2FSHA 2NQ2C 1Z47A 1NLYA 3OE7D 8OHMA 3EXAA 4AKIA 2JJ1A 3AVTA 1Z8FA 3KZ1E 2OCBA 5HKKD 1UKVY 3CRMA 3HR8A 2O0HA 1T4GA 1OXVA 2HEIA 1DAGA 5FR1A 3MD0A 3IIKA 4URYR 3SBDA 3A1WA 3TBKA 5KU1A 3A6PC 2VA8A 2OE2A 4MUBA 1N5KA 2PCLA 3B1VA 1JJVA 3AVQA 3KFVA 1Q3HA 1UAAA 4R2HA 5JFGA 5DNYB 4RVCA 2PEYA 2J5XA 3CZQA 4EPVA 1YVDA 3OIVA 4JKYA 2NO7A 4DBLC 1NP6A 3K0FA 1WBDA 3ICQB 2F1HA 4QRHA 2IYUA 4QNMA 5EP2A 1GZSA 5TXGA 4DT1A 3U44A 5JRJA 4CT5A 3VNVA 1CKEA 1N6PA 2JA1A 4MYCA 1U0LA 4EPTA 1G3QA 4XTRA 1R2QA 3REGA 1E2FA 2P65A 1W5SA 5KSOA 3MWYW 2IX3A 2GRJA 4ILEA 1VMAA 5TDHA 4WXPA 1E2PA 2ODNA 4A0RA 2GCPA 2JLSA 1AM4D 3UANA 1KI6A 3VKWA 4I1UA 1NLZA 2DPXA 3U3KA 2O5VA 1HE8B 1Y63A 2ATVA 5HZKA 3WMEA 1IXSB 1SXJA 2GEVA 4HYYA 2CE2X 4UNRA 4AY2A 3K9GA 3LW8A 1IJEA 1G8FA 2D7CA 1GSIA 1VCNA 2ZI3A 4MKGA 3ZH9B 4DZZA 2J0VA 5FUYA 3BFKA 4O2LA 4D2IA 3THYA 2ZEJA 4DLYA 4OL0A 4US0R 4BRUA 3LA6A 4LHYA 5AUPB 4TYYA 1X3SA 1EK0A 2F7SA 3RS2A 5KO2A 4Q7KA 4C3ZA 3KQKA 2QROA 3HR7A 4FD2A 4D82A 4M53A 5H1YA 1KO4A 4B6EA 3GJXC 3MG9A 1AZTA 2YWHA 2XAUA 2RGBA 4FINA 3TUZC 3AGPA 2OO7A 4BFTA 5C1BA 4JT2A 1PLJA 1R6BX 4FMCF 4R7ZA 3KQLA 2JDID 2GK6A 4NHOA 5AUQA 3SS8A 2AHOA 4URWR 3TAHA 1IY2A 2WSMA 1OH8A 1W2GA 3T34A 1YZUA 2VPPA 4B3XA 4J0QA 3CH5A 1E9EA 1G64A 1Z0KA 1X6VA 4OQLA 1L8QA 3R9WA 5AK0A 1U0HC 4BFZA 1P2VA 1ZC3A 4A0HA 1P2UA 3LXXA 4C0HA 1EWQA 4D4MA 2PT5A 3L82B 4G01B 1GNRA 3NWJA 2FFAA 2R6CA 5L8VA 1E32A 3EPJA 1G17A 1NVVR 5EZ5A 2XXAB 2Z43A 2G1KA 3EIQA 3LFUA 1ZAKA 5FPSA 3GLGB 2VYFA 3UPUA 2Y8EA 3B5JA 3FGNA 5G3ZA 3RLFA 1T0HB 1COWD 2QP3A 4WZAE 5HR5A 3ADBA 1YE8A 1CLUA 2XJ9A 1QF9A 2QAJA 3NBYC 3AB3A 1SVOA 3I1FA 3TMKA 3PUYA 3I3SR 2ANBA 1U0JA 2HDNB 3IKJA 4AI6A 2GXAA 1G1MA 1NN1A 3RS7A 2ZI6A 1OE0A 4RSGA 2IK8A 1EFCA 3GFTA 4YMTA 2E1RA 5CIQA 1RZ3A 4C0KA 4MUAA 2FSGA 5G41A 3DM5A 3WP1B 1PV4A 3AVUA 4DVGA 2CK3D 2FZ4A 2QMOA 2HJGA 2ZJ2A 1G3RA 4PZLA 1UBCA 2QENA 5SZKB 5KYKA 2BMFA 3OESA 1W0JD 2FF7A 3CKLA 4MKIA 4IKEA 1FNMA 4QNRA 3HU1A 4A8JA 1YZTA 4KFSA 2CHVA 3CX7A 4URZR 4ZCMA 4P4SA 3CIOA 3REFA 4NU0A 4POAA 2PL3A 2G9NA 2FFHA 5H68A 3WHKA 3O47A 4H1VA 4ESVA 3U4QA 2IYXA 2PBRA 2ZREA 4IJMA 1E6CA 2QUZA 4OI4A 1XXHB 1GDDA 2CVFA 4FMDF 2HCBA 3BH0A 2PZFA 2IYYA 4LWZA 3L0IB 2YWEA 2QGZA 4RD3A 1FQJA 3FMOB 3KXLA 3LQRA 4RD4A 1IAQA 2C8VA 2F3TA 5ANRB 2PZEA 1B23P 1XD2A 1L7VC 4LYAA 4ASUA 4KU4A 4JLDA 1XX6A 5JECA 2C9OA 2BM0A 2VP4A 1JAIA 2FGJA 2ZQ5A 3FHOA 3RRMA 1ESMA 4RCYA 4JJZA 4DDWA 4NYJR 4EAQA 3RAPR 4BLQA 2V55B 1G3UA 3EIEA 2B92A 1DTSA 2ZJ8A 1ZUHA 3ONWA 3I72A 3NXSA 1GNQA 2HT6A 1XWIA 4M0LA 2IYVA 1KO8A 2KBFA 4LJ6A 4L5BA 4PZZA 2Q9BA 1ZMXA 5JHGB 4LI0A 3H2YA 4QOSA 3W8RA 1YZKA 2IF0A 2BBWA 3B9QA 3X1YA 2GKSA 4PSVA 4DC9A 1G20E 1DE0A 3LD9A 4TT3D 1KK0A
chains in the Genus database with same CATH superfamily
4DVJA 4S1NA 2W71A 1JZTA 1QS0B 3CW2A 4O2BA 4AWXA 3DHVA 5IPFA 3SQWA 2R8PA 4D5GA 4IJKA 1FDUA 2B83A 1Q1QA 2AWNA 1XGKA 2GPAA 4QYMA 4DCPA 2ZXFA 1W88A 3NTOA 1AN0A 4BNVA 1SQSA 2R7KA 4DZTA 4RK1A 4HZIA 4CMHA 4NJEB 3WKAA 3ZZTA 1NNI1 1M6EX 1QNFA 3HPRA 1XEWX 2X4LA 4G81A 4TTSA 3QWBA 5LOVA 5AW1A 2QTTA 4TX1A 5DHFA 1DRWA 1T9ZA 2ZJ3A 1X77A 4NS4A 2OOSA 2ZUUA 3AF1A 4BE7B 4EJFA 5MN6A 4IDAA 5E0KB 1ZN9A 1TK2A 2Z2IA 3BWDD 3M49A 5H9VA 1PX0A 3LUBA 3PFCA 3K70C 2XIJA 4N6NA 1RZRD 4C7OB 4D79A 3VVMA 1PJTA 3X44A 3QBTA 3FE2A 5ES4B 5MN4A 2UKDA 3C85A 1DBSA 2DFNA 3HV0A 1DINA 2XE4A 4C7JA 2REXB 4HTFB 2VF7A 4WRRA 1YI8A 4I5FA 3CX3A 2O8CB 4MR7B 3FF4A 3M6XA 1B14A 3N70A 2QD1A 5EHIA 3EQ7A 2HCJB 4DKXA 4G07A 3JU3A 1KRXA 3TQSA 3WSTA 2ZITA 3ZCPA 1WD7A 2A5JA 4BLVA 3PLNA 2WC1A 4H1HA 3ESCA 2CL6X 421PA 4N18A 3JD3A 3C6YA 2E55A 5HQ3B 2DUJA 3NHUA 3NJ4A 1DXOA 1LBQA 3EASA 3GXOA 3ZWBA 1E9CA 1QNLA 2A1UB 2EKPA 3VU9B 5JYDA 1OLXB 3GPDG 3KHUA 2J8ZA 3KT3A 3QWFA 3WGGA 4IMRA 1IPEA 2QPTA 3DWFA 3PVCA 3RTBA 1P2GA 3FBGA 4TZTA 1VZ3A 5G0TA 3E5MA 3FKQA 4BQIA 1BGWA 1GTMA 1T5TA 3AILA 1YSCA 2QRQA 4RK0A 2O8EA 3CVUA 3U9TA 1A7JA 1NF2A 3M6IA 2ZS8A 1XC7A 3IBFA 4BFVA 3FYSA 1T3SA 9ATCA 3K92A 4P7JA 5MFPA 3AFNA 1N8SA 1U11A 3K9HA 4S1OA 2H2FA 5IM4F 4D3DA 2H4HA 5L6LB 1YACA 1WCXA 2GVNA 3KLOA 5AI6A 1IAVA 2QRVA 3E9RA 2QDKA 2VRWA 3FVTA 4F6LA 2J5RA 4GKJB 2VA9A 1PG5A 3LHKA 3HJGA 4KAAA 4X90A 4ISCA 1F6WA 4MQ4A 4NHEA 4IUCS 1VG1A 2VNKA 3ZY5A 5CBPB 3P9PA 2GESA 2VJCA 4IGFA 4MRAA 1KZ1A 5E95A 3FRJA 1Z36A 2IOYA 3KAPA 3P9YA 5U4XA 4FXPA 3GLFA 3HBNA 4J03A 4OHOA 4EA6A 3W5AA 2C78A 2PD3A 3CTMA 4XWGA 3SBOA 1GOTA 3VHQA 2WYWA 1ZVVA 3PHJA 1S2NA 2GF0A 4WW0A 2JLXA 2QSYA 3VHRA 1T5OA 4GOLD 2QL6A 1U63A 1EK5A 2OUKA 1N1DA 2E48A 5DHUA 4WGFA 4HX5A 4A6XA 3DJYA 4D80A 5LKAA 1KJ8A 2FJPA 5AKLA 4BEBA 2PNJA 1Z6TA 2J9FB 2QLBA 3VTKA 4BAGA 4C07A 2YVQA 1D8TA 4B83A 1SVMA 1AV6A 2IF2A 2BUBA 2O9JA 3FFTA 4PVCA 5ELXA 1DAMA 1Q14A 3CLRC 2KSQA 1NBMA 3G6KA 4MRMA 1UK6A 1X3LA 4RUKA 5HIMA 3VYTB 3NDJA 4PFQA 5B58T 1E0JA 1H2FA 4OM8A 5AJYA 5CFZA 5K6TA 2PZAA 2W6JD 2VYNA 3E2IA 3MA0A 3TL2A 1L5OA 3IXMA 1B15A 1VHWA 3DMYA 4BKPA 3RU7A 3EFOA 1L5HA 1SUEA 1I1OA 2X3YA 1L4BA 2E4UA 3QPDA 1SRQA 1C7ZA 1X0VA 3A6EA 3GZ4A 1ZKMA 3KPJA 3WMGA 4DLAA 2HB6A 5DB4A 3WNBA 1O95D 5FV4A 1D7OA 3DZKA 4UE2A 1JHRA 3RKUA 3CH7A 4JLPA 4TYQA 5GM1A 4BECA 5K4HA 2KJQA 1OBHA 1VLHA 5JWHA 1I0IA 5HEKA 1WXWA 1JSCA 4E1VA 1QIJA 1T43A 2AFIB 2ON6A 1UK9A 2O4UX 3PC2A 3EMBA 2O57A 5EHNA 4YP9A 2F6RA 1TD1A 3DO5A 5C31A 4FHGA 5KAMA 1SU6A 4Q1AA 1DPGA 1T6NA 1O5OA 5FPKA 5FBRB 3U3DA 1T2EA 1ZRHA 2C8LA 3C1OA 1P80A 3WGJA 3LC0A 5DM4A 2WD7B 3A28A 5ALTA 1NN3A 4AZ3A 2VCEA 4AMYA 2YMMA 2ERYA 1XRJA 1N2XA 4CMIA 4L85A 4U7PB 4ZYVA 1QFXA 4HBGA 3A70A 3WK8A 2XOEA 1P4SA 3A05A 2HU5A 3GPBA 1LDNA 2HM7A 3I01M 1E6MA 3IURA 2H5LA 3T5DA 1R0RE 3K7EA 3KJFA 4BNXA 1J8FA 1GFIA 1PFQA 2BM8A 3V2IA 2H17A 2BFCA 3HSYA 2QSUA 2N1MA 2ERXA 4OHFA 4Q00A 5L3ZA 4AKTA 1BAPA 5T41A 3HCBA 2JCXA 4ZO9A 2B1QA 4Z4HA 4FXOA 3E8XA 3PPVA 4HSGA 3PQDA 2H4FA 4ER6A 1OCEA 4YIHA 5ARDA 2KHZA 1SVSA 3DQPA 5DCYA 3SIWA 1BIFA 1FFCA 3TXXA 1RWOA 3NFYA 3OZRA 1OU0A 1KHHA 4I9NA 4DM7A 3CSSA 4IJUA 2O7NA 1UDWA 2J31A 2QTLA 4RTNA 4EP1A 4YYZA 2RIRA 4ZJYA 3D8NA 1JWAB 1YR2A 3SU8A 5DNUA 3FSEA 2NO9A 3MGAA 4NTZA 5BUCA 3OIDA 1RRFA 1Z13A 4R5HA 5KJEA 5JTUA 3PWTA 3GGDA 4PYMA 2BGRA 2IHBA 2OQ2A 2RGEA 4PZCA 3TI9A 2X8JA 5IWCA 1FF9A 4XLTA 1G7SA 3AVWA 4I9FA 2YNMD 2JLYA 1NKVA 2B3TA 2PKQO 1ADFA 4OQ4A 4QO7A 5IASA 1Q7BA 3C3XA 1IB6A 3ZH2A 2DTXA 1LC0A 4ZOAA 3TPZA 1ID1A 1FOEB 1S1MA 4HLUC 4XSHA 5FOVA 3REQA 3LO5A 3OFND 5DGTA 2G5CA 2O2JA 5JXWA 2ZT6A 1YWGO 1VIYA 4LTDA 4CG2A 2PS9A 3VOAA 3RT9A 1I1HA 1KMQA 4P22A 5IC4A 4FFMA 4UUBA 5EMLA 3FVWA 1MKYA 4RWZA 3ZNNA 1FCJA 2W4QA 3MB5A 3JQAA 4JUAA 4AYWA 3D6TB 4NOJA 1FSZA 4EM6A 2ZSBA 1I6WA 3SJAA 1QV9A 1HT0A 2VBCA 5AICA 1PTJA 2EYQA 1XHLA 1NW5A 3NASA 1AQYA 5H3HA 1DRJA 4R9VA 1DGQA 1E94E 1SPBS 3W3AD 1V41E 2PX3A 1IFXA 2YJ3A 1ZOPA 1CWUA 2Q0XA 3KDAA 3QVJA 4BQRA 4OCZA 3VPBA 2PZJA 1U2GA 4EW3A 2NGRA 2AR9A 4XYBA 4BMZA 5CB4F 1DJNA 3ZWCA 3DEAA 4HQLA 1ZIXA 1JIVA 1DQYA 1GA1A 1F06A 2F8MA 1N2CB 1Y5RA 1YZYA 1OYYA 1BKSB 2YW9A 3P0JA 4HDOB 3OQHA 1SRRA 2C92A 3AL2A 3EBPA 1T8YA 3K2IA 4RFSA 1MABB 3ZLUA 4BFLA 3BE6A 5CFPA 2GHIA 4IXDA 1QR6A 4ZXPA 3D4NA 2QG9A 3WDKA 3JQRA 4HYTA 5K3AA 3T94A 1BD3A 1T6ZA 2PS1A 3DOCA 4ZANA 5YASA 5A3JA 5HUHA 3NH9A 5F33A 1IY0A 4BUCA 4RY9A 1JH9A 2PMEA 2PUBA 3CXRA 1YCDA 1OI2A 1ENOA 1SKBA 1Y1QA 3EDQA 4ZQHA 2ZR7A 3LXRA 2H4YA 5EXPA 3HBLA 4FOOA 1AMUA 5AXCA 2WT9A 3GVXA 3O8OA 4Z9FA 3FYHA 1XEWY 1MFZA 1ZIDA 3ZKAA 2VNIA 2G40A 2ZR8A 4YHBA 1WETA 3WYAA 1BN7A 1M2OB 2RBGA 3GLVA 4WN9A 1UDCA 2VDJA 1L0BA 1U2QA 1TKCA 1QGED 2OCYC 1WXXA 1HQKA 2JFZA 3AW8A 2C9DA 3HCRA 1VHJA 4ZT7A 4HGPA 2EGHA 4IXTA 1DOHA 3ROMA 4J4BA 3RSGA 4N8DA 3ZWVA 3AF0A 4PANA 3DEFA 4LZWA 3IT1A 1Y48E 4GX1A 4ZOCA 3N8KA 2GPNA 1Z7GA 2XA2A 4B4OA 3EA0A 2ZI4A 3T7SA 3DZGA 1X13A 3GAZA 3TECE 3FPSA 1NVDA 1SCUB 5E4FA 2B1GA 4PAGA 3UC9A 1Z5UA 3QVSA 3S2SA 3E5HA 4IUYA 3S0JA 2UZIR 3F3KA 2ZTUA 4YV0A 3T1OA 5K3DA 1XCMA 3ZY2A 3C8MA 2WTAA 1SIBE 4F93B 5JNSA 2WDZA 3DL7A 3RVSA 5AVKA 3BXZA 4D81A 4YUZA 2OBBA 2KLBA 1CUSA 4ZVRA 4DLXA 3OCZA 1T3HA 3E0QA 5AK3A 3PTAA 4AQYB 3IEXA 4AY5A 3LBHA 5CK5A 2H2WA 4B7XA 1NTOA 3CLUC 3CRVA 2AF3C 2XB4A 2IUTA 1LQ2A 3S27A 2Q5JA 5SZIA 1EX7A 1LW7A 4G0ZA 2WJGA 4WLNA 1Z2AA 2CB9A 3DFUA 5K0BA 1LS6A 1V3QE 2H3HA 5CFOA 1JPJA 2WUVA 2AE1A 1XHEA 2HQ1A 4D44A 1QBGA 3QVKA 2IZZA 4OQMA 1O6GA 1OOEA 3MTQA 1QHHA 4YJFB 3I9MA 4DR5B 2BFAA 3PNLA 1E7QA 1UWLA 4JOBA 4RCZA 2FWMX 2CSUA 3KPVA 1ZN2A 3VV3A 1E62A 4OH7A 3GX1A 2DRIA 3BL5A 3VGJA 4D6PA 1G18A 1XEXB 1OXTA 1SVIA 2ONYA 3ND9A 4JLJA 4NJEA 2BLLA 1ZY2A 1KDRA 2JIZD 4ALNA 1KWKA 1Z8NA 3GD7A 3HB7A 1EMDA 4GOMD 6AT1A 4RA9A 4W5HA 1Q95A 5ILQA 4X1KA 4CM8A 1GNSA 2V45A 3QI7A 1Z2OX 3C5EA 4Q4AA 4X91A 3IXQA 2Y92A 4E03A 2XWBF 3K09A 1FDWA 3UFBA 4KWEA 5BT8A 1TNDA 1RHMA 1UMBB 2C20A 2YBEA 3OTHA 4WINA 4H7KA 5BY2A 1LI4A 3B9RA 1FTYA 1EVKA 4UXJA 3SOZA 4A16A 2IOHA 4J43A 4HTFA 1JF8A 2SCUB 2B9VA 3A6KA 5TPZD 5ITZB 5BN5B 1R0WA 2Z6UA 4MV0A 1Z7YA 1X9IA 3CH4B 2CHUA 3SC6A 4O4JF 4IP0A 3ORRA 1V4NA 1N6LA 3O3NB 2Q4OA 3FSGA 2Z6QA 3RVRA 2JJ1D 2R1VA 2WOOA 5DYWA 3HV2A 4W5WA 5LDDC 4RCVA 2PT6A 3DO8A 4U6NA 3SJ7A 1PZXA 1U9ZA 4EF6A 3R6LA 1T6XA 3QEKA 1LK5A 1CP3A 3QPAA 3ZUGA 4UTVA 4CM9A 1YFKA 3KPWA 3BXOA 3VPDA 3W34A 4YMGA 3VU9A 5C7YA 2GGSA 2RI6A 1P7WA 2PY6A 4KR2A 4YK7A 1PR9A 4F4CA 3G0BA 5KTRA 1V0JA 4Q3OA 3BB1A 1LTQA 4RQTA 3U0BA 2D8MA 2GEUA 3CX8A 3NTQA 1U9IA 2IPXA 5C37A 1KYYA 1KMHA 4GXTA 4W7SA 4A0GA 2RC5A 1QR2A 4D99A 3SN6A 2Y4NA 1V5WA 1PU2A 3GW8A 3HB1A 3I1JA 2H8KA 3JR3A 2VWQA 4RZSA 1NZJA 1EE1A 2J41A 4K26A 2GNOA 3QTLA 1Y82A 1Z4IA 4DL9A 1NPDA 2YZ7A 4ARIA 1ZHOA 1IHUA 2JRLA 1DTEA 2HQOA 3LC1O 3UWOA 1RP1A 3EZ9A 1D4OA 3GEIA 1AJEA 1ULBA 2VUUA 3W5IA 1RYMA 5JEEA 1DCMA 1CZNA 1HNWB 3Q4GA 4DIDA 3VQTA 1P0CA 5DJ5A 1CF9A 4ZHQF 1NURA 2AK2A 1I3MA 1Z5WA 1S2GA 3FYCA 4G5SA 5AVQA 2ZQYA 1EWKA 5JBIA 1WRBA 2O1XA 3GUVA 4JH0A 4ZRDA 4EJ0A 4N0QA 2SKCA 4JU9A 4YUAA 1I7QB 4LJKA 4DQXA 1NT2A 1IZZA 2PIAA 4AJJA 3WHIA 3K0SA 2QLLA 1ZM2A 1JN0A 2GS9A 2FZWA 1OTHA 4G1EB 4PGGA 5TQ0B 3RTAA 4I50B 3U37A 5ESRA 3GUUA 4U0KA 3PU6A 5DRYA 3TGWA 2OENG 4D43A 1XL0A 2CF6A 3EZ6A 4P82A 2NADA 3JAMA 3WLOA 3LDHA 5L51A 2OUIA 4B71A 1WKBA 1SD2A 2J3LA 2RH8A 3AO0B 4R9RA 3NHKA 3Q5EA 2A1IA 4IEEA 1LGYA 4AP9A 1W30A 5K4GA 1FBTA 1J56A 3Q7TA 1YVPA 3A6DA 1PG0A 1UIMA 2QN6A 1QVRA 2FSVA 4DLSA 1YVEI 3AEQB 1OFUX 3FRIA 3MTGA 3OJFA 4IL5A 3ER8A 1VLLA 2G0AA 4INJA 3ED1A 4PONA 2VOEA 5CIYA 4D9BA 1EGQA 3WLFA 3KT0A 4D3XA 4YRCA 1HTBA 3DF9A 3O9MA 4PR0A 2ZBPA 1CUIA 1TJNA 4AZ0B 3DQQA 1PNQA 3OPYB 5A1JA 2ZB8A 2I5PO 1BCSA 3DAOA 2GZ3A 3GJ8A 3O91A 5DHQA 4RZUA 5JY6A 4FDLA 3MGGA 3TX2A 3ZY3A 1T5HX 2P9GA 4ZU6X 4MQEA 5IF9A 5I7WA 3SK0A 4F2DA 3D31A 1PJRA 2BAGA 1S3SA 3M1IA 1J24A 3EBOA 1U04A 1W93A 4WL0A 5I7AA 4BYGA 5MN5A 4NBWA 5HJEA 3BBPA 2HNKA 1VKHA 5CFNA 2J0UB 4AIIA 1P9OA 1TUEA 1U2EA 3PC8A 3OUUA 2Q4EA 4H7HA 4U5QA 1JR3E 3L0SA 4HDNB 4D57A 4QFDA 3OZEA 5I9MA 2B9EA 1C41A 4CR8A 1N7IA 1YONA 3BGOS 4XXHA 5F1OA 3CUWA 2NU9A 3DVQX 3NHWA 4ITRC 1NVUQ 1YQTA 2IA5A 5IJ9A 1DBQA 1KFKB 3BRWD 3CU5A 4XSVA 3WB2A 1LLQA 2Q3CA 2YDXA 2ZE5A 1L5RA 2GZ1A 2B0CA 3PGJA 4Q4DA 4RENA 4V0NA 1E2KA 4XM0A 1NVKA 2FG7C 3ONVA 1F6BA 3UAOA 5IVKA 3WB9A 4L5IA 3ZXIA 1H3FA 4HF7A 2JEYA 3RVLA 2JCGA 3TK1A 5AVOA 4RVHA 5KNLA 2VDMB 5MGNA 2PGNA 1RI2A 4WOBA 1ODCA 2PJDA 1ZVJA 2XUDA 3GA0A 1PL8A 1JDNA 4HEJA 4LXYA 3D7KA 4YJDA 3KETA 1TIBA 1ZAYA 4TSRA 5A02A 2XNHA 3QU7A 3N1UA 3GNLA 4DRYA 2A5GA 4URVR 8ADHA 1PN3A 1Z7BA 3PI7A 3QUAA 2XGOA 4A8HA 4WESB 4CEJB 4DPKA 1EI9A 2ZVQX 3QWIA 2BMDA 2PKEA 5DM2A 2PWPA 1BDHA 1QRSA 1SOMA 2XDAA 1MGOA 1FEZA 2FV8A 4BDTA 2DVMA 4CEIB 2DUWA 4JA2A 4AJIA 3ZBTA 2XODA 3DV9A 1QYDA 4GUAA 2WF6A 4L8VA 1YD7A 4KZPA 7MDHA 1G8KA 2QN8A 1NJ8A 2DPYA 2OHFA 4WDQA 1ZM3A 4ZU1X 3WQBA 2RKOA 2EXXA 1KP9A 2CLCX 3EWIA 2F00A 2Y77A 1Q1EA 4QLBA 4N65A 3AOGA 1YC5A 3FGZA 1BJTA 1MXFA 4NYIR 4A27A 1YQDA 3MUFA 4PAWA 2EQ5A 4K9PA 5EESA 3BWXA 3GJQA 3Q3JB 1U8UA 1UBRS 1T6YA 4XM1A 3VAAA 4DJ5X 3F67A 3KJIA 3G8YA 3T3EA 1U65A 2D74A 4DMFA 2ZWAA 3QPVA 4QGFA 5DLPA 4YRAA 2HTEA 4OREX 4F45A 5CA0F 3QXXA 3QLJA 1ADGA 4R54A 4RE6A 4RSRA 5JH7A 4GLLA 2NM0A 4NL4H 3MELA 3FOZA 2WUFA 1E59A 2VXCA 3RCBA 4MQ5A 2EDCA 1W76A 5HBRA 5K5EA 1ZMOA 3OTOB 3CHYA 3KVNA 4NVRA 4AF8A 1KJZA 2AQHA 1Y42X 3IPYA 1M8FA 4Q9JA 5CR9A 1YS6A 4NWIA 3NP9A 1VMKA 5KDDA 2VXYA 4TV9B 4EI2A 1AF7A 2DHEA 4O4IB 3C41J 1JG3A 4LE2A 4LSZA 3ZD7A 1NOIA 2TECE 1FPMA 2Q0SA 5EHZA 3ZDDA 2PGLA 1T9CA 3BEDA 4AX4A 1IWPB 3LC2O 4GM1A 3QXJA 1I4EB 1Z4KA 1N2CA 3OOYA 3ES9A 4LCEA 1DIRA 3CYFA 5I5GA 2XVXA 1MV5A 2CYAA 3MJVA 5AM4A 3UUFA 4BNLA 4P4LA 4TGLA 4QBKA 4OX9B 4NV1A 3OCJA 3TCKA 3IHKA 4G0QA 3S1AB 1SUIA 1U9CA 1ZYUA 1N5MA 3LWNA 5TQ2B 1JDBC 2X8WA 3TLEA 4X1YB 5TT1A 4MUYA 4L9WA 1ZNZA 1Q7TA 2QTFA 4EGFA 4C06A 5D6OA 3VX4A 2VR1A 2WSSA 4EHIA 3ZVKA 1U0FA 2BMAA 3C43A 3E22B 3F2IA 3QJ5A 1D1SA 3RJTA 4DB4A 2OV3A 3PPXA 5T4HA 1NE7A 1X1SA 4NMHA 2VDPB 4LK2A 2YWXA 4NEHB 5J40A 3TL3A 3DAGA 3OZ7A 4PEVA 3GH3A 2GNAA 2VLIA 4NMMA 4FW9A 4ZCRA 4R81A 3LQKA 4IDHA 4O5AA 3TL6A 4MVJA 1R6TA 2A7XA 2VKQA 3AL3A 3I2JA 1N5LA 1NY5A 4KQJA 4W7HA 4IWNA 4R84A 3UHJA 3LV8A 2BJVA 5IXYA 3VU8A 2IH2A 5B55A 3W4KA 3V1UA 3QX3A 3L7DA 3URKA 1YXMA 5FTNA 3TB6A 2NU8A 2QXYA 4KRYA 1E1KA 2B4TO 4RNDB 4TT8A 5BQFA 2NPIA 4J0DA 5LJLA 4MS1B 2R5WA 3M5CA 2WUGA 5CU7A 2IZ5A 1Y8AA 4MWTA 4UFNA 4ZEXA 2G5GX 3NUZA 3O0DA 3WRVA 2J0SA 2GZMA 1Y9AA 4CF5A 1ZHFA 5A2GA 5AVXA 3L1IA 5IUNC 2IITA 3VM6A 3O9ZA 1GPLA 4GVXA 5A62A 4ESEA 2X41A 3PNQA 3JSXA 3RT7A 3R09A 2QDXA 5CIWA 3PA6A 3UK7A 3EDYA 2IYFA 4OB8A 4UNSA 4HEQA 4M1WA 3TG8A 2VIIA 1HPLA 5EJ6A 4HS4A 2RHCA 4MI6A 5F2NA 2GBPA 1MXHA 4P6VF 4OKSA 2E85A 3DOUA 3R9XA 2X42A 2PKRA 2JI6A 4MAFA 1W96A 5EQJB 3ADDA 1VYTA 1CR1A 4LC1A 1DSSG 4JBNA 3E3AA 3IOYA 2WHPB 1P1HA 1I4DD 3JQBC 4EYSA 1E2UA 2CL7X 1R9JA 2JD0A 1OHHA 5DNAA 3SSOA 5BV7A 1ZR4A 2FUCA 3D5TA 2RH9B 3RVKA 2DFVA 4MW4A 4IIJF 4EELA 5B12A 2DMRA 4RFVA 3UMSA 4E7PA 2YQZA 4FM9A 1CJUC 2Q3LA 4MYHA 1EXNA 4TLBA 4C30A 1V16B 2W0MA 1NV8A 1TLLA 1UQUA 2WPDA 5LQRA 4QU0A 3NYQA 1XZFA 4LXGA 2R2AA 3JQCA 1KH2A 2BGKA 3LCMA 2IEGA 4KMOA 4LDNA 4MWEA 3WYCA 4C6RA 4DJEC 5LD2C 3IEUA 3I6IA 2RGNA 1BMDA 4BE9A 3OOWA 4KNWA 4DT1B 5T3UA 2JLBA 1CUUA 2QM8A 3KDPA 3EGOA 3PWKA 4TTTS 3QITA 5F35A 4W5NA 3NEPX 2MTBA 2F43B 3D3WB 3FMPB 4HDRB 3UT5A 3LX5A 2Q29A 4QUEA 4BYMA 3GBVA 4OQNA 1D9ZA 2TSYB 5AM2A 4U7FA 5L4NA 4PO8A 2XMBA 4YUYA 3U5ZB 1LRLA 1FP1D 4FCCA 3G79A 4MWZA 5JFOA 1E4YA 4IW3B 1ZI6A 4KXMA 3NIWA 1I94B 2PZGA 2EBFX 4ZQCB 5TNXA 2WWXA 1H6DA 2QA5A 3BH6A 1Q0QA 1OREA 4OG2A 4RQBA 4RIIA 1GADO 4N7JA 1EVQA 1REQA 3L0ZA 4J2HA 4PCAA 3V2HA 2Y0CA 1T2AA 4TV8A 1NM5A 5BN5A 4ZDJA 4EJSB 1WF6A 4RULA 1SUFA 4RLQA 1XTRA 4KRXA 3G9TA 1VYVA 3D3EA 2ZDHA 1NBMD 2EJVA 2YJNA 5D85A 3CNEA 1I3OA 4RQAA 2BSXA 3VPXA 2UZAA 1HETA 3I9V1 1TO2E 2GCGA 2VYND 2W2XA 4HKTA 1QG4A 3C5HA 3AUAA 3ZYCA 1Z0FA 2POQX 2VJMA 4UBMA 1YUNA 1QO9A 4U4AA 5LCXA 4D0LB 2AL7A 4D56A 2IPLA 2OO5A 4QIHA 3HDHA 5H0IA 1KH1A 5I9IA 4K3VA 3CC8A 2C2YA 4FX5A 3DPSA 3D02A 3ZDQA 1N9ZA 9MHTA 4NU5A 1H3EA 2C2HA 1XJ5A 1K89A 2DLDA 1CZOA 1XQ6A 2HH9A 1AKQA 2YYSA 2DQSA 3AQIA 3NV9A 2GJAA 3RAEC 1YRBA 1QQ6A 3NPAA 3PDIB 4UDXX 4HDSB 3WJ7A 1VL2A 1C7RA 3LK6A 1AXEA 2FDXA 2RK3A 621PA 2YXLA 2OKCA 2GFIA 1D09A 1PUIA 1KI7A 4E11A 5DLEA 1F0KA 3AXSA 5DYGA 4OU5A 1UP7A 1VC2A 2BZ1A 2DCMA 5FBKA 5KAPA 4LOAA 4XA8A 2ZIVB 1UZLA 4HGRA 1V95A 2PIDA 1UEXC 1JJIA 4LZZA 3HYRA 3WDMA 1P33A 1ZL2A 2DFTA 2YFQA 1XNJA 2H6EA 3IUBA 4K2HA 5KKCA 2FN7A 2Y93A 3H9CA 5FO1A 4BFSA 4V03A 1OIVA 1IOWA 1I5OA 1ZK2A 3VDXA 3EAFA 2I6UA 1ODIA 1ISIA 3R7AA 2XOKA 3L6UA 1OWLA 4ETMA 4QPDA 3I2KA 2WYIA 3I4LA 4K86A 5KOHB 5H16A 1E2EA 4JMLA 1PLKA 4J9VA 4RJIA 4I50A 4KQIA 4P2GA 3U6BA 1OFHA 3PR3A 4K0KB 1CR0A 4YUXA 3OY2A 1YR1A 1D4AA 3NAZA 1M9NA 3PIRA 5KNDD 4WTOA 4QODA 3F6BX 4FHZA 3C70A 1XAJA 5JVDF 2UXCB 3FW1A 2G8LA 2EBHX 1W6RA 4IDFA 3FTDA 2Z04A 4ZT3A 1A69A 2Y0PA 3FPFA 4KYTA 3W6ZA 4A0SA 3NBMA 4BRZA 1F1JA 5A5DA 3F5FA 4L4XA 1YV9A 4BEVA 4BV9A 4L6IA 4XE5A 5JAHA 3ZIAA 3AEQA 2IELA 2DWPA 4W6QA 3IP3A 2UYOA 1NQUA 3RRZA 3U3XA 5KTSA 2X2EA 4WJZA 1KKLA 3KO8A 3RSSA 3QF7A 3UPTA 5J2UB 4JLOA 3TXAA 4KLCA 3U17A 5IDXA 4FJ0A 3RE1A 3OH8A 5AKHA 2FG5A 4HBZA 1TK3A 3OPYA 1OX4A 1U94A 2DG2A 3LSYA 4U7HA 3WFIA 5EEHA 5EKDA 1Z7WA 3K3PA 2HCRA 1A1VA 1RKVA 2WE8A 2IYNA 5ALYA 1MB3A 5CVVA 3BJEA 5JAQA 2R66A 2HK8A 3UEOA 1ZK1A 2QV7A 1I01A 2QHXA 3VMFA 3FI0A 5COQA 1H2BA 1EJ6A 3I04A 1XTIA 3FJ1A 3KNZA 4LZLA 5AKKA 5DNVA 5EZSA 4ZT6A 3AT1A 1A9YA 3JQAD 2MSNA 1KQNA 3H5NA 1NZDA 5CT4A 3DCJA 3V4SA 2OCGA 5DHRA 1N8KA 2VK1A 2HWKA 2I78A 3CJTA 5HVNA 4NCXA 3VI3B 3MWEA 3EDRA 2R7AA 3TOVA 1DPFA 2VT7A 1RWPA 4MV3A 3A4MA 4PQYA 3WB1A 1U0BB 1GTVA 1P6UA 3LY7A 1WS6A 1JKIA 4L3VA 4G09A 1P9LA 1I36A 1ZU4A 3CS3A 1P6QA 1YVRA 4GE3A 4JODA 3MWFA 4Z7OB 2AG6A 5JCJA 1NR5A 4QQFA 3SOPA 3U7RA 1IN6A 1TW2A 1UANA 4MS3B 2A4KA 2QRHA 5AQ1A 5L7WA 3AG5A 1KMIY 1KTIA 3I9OA 1GO2A 2JZNA 1SC3A 1GL7A 4MUNA 2F3SA 3LL7A 4JEHA 5JV5A 1EXVA 1YE3A 5AWFC 5TX7A 1DRKA 3H1BA 3VZPA 2HF7A 3E48A 3LUJA 2RDMA 2YVUA 2IU0A 3L6EA 2AKAB 3FR8A 1W75A 3OIGA 1QANA 1T15A 2VP2A 1E3LA 3ORHA 3VYSB 4F9TA 2XF2A 3G82C 4UQOA 1Q1AA 2FW9A 1LK0A 1RXCA 1A5BB 2OO3A 3KOMA 3ZLBA 4HTAA 5ISMA 1ZH8A 4MW1A 2FPXA 3L93A 3RS0A 1RRMA 2C2GA 4E2XA 2LKCA 1DZIA 1P1BA 4B5LA 2JJYA 2ID7A 1C4KA 4LC9A 4DM3A 3EGXA 4P32A 2P9FA 1MP0A 1WPGA 2QMYA 3Q1KA 3U80A 3QX9A 4EOGA 4M0UA 4DE5A 1X0XA 2I9PA 3MHPA 2IXGA 5FPHA 2CBZA 4RLFA 5AKJA 3DV0B 3SJCA 4CQLB 1V8FA 1A98A 2P3LA 2VXBA 1AQJA 4L28A 4NV0A 5DH9A 2BMJA 2FA9A 4QSMA 4EKIA 1PNOA 1TYAE 3GOHA 3HCCA 3UZUA 3VPSA 4QBHA 4MQUA 3W90A 5A9SA 1T2CA 4JBYA 2ZBEA 3OAAA 2QD5A 4F8EA 5DCLA 3OKAA 5AI5A 3BGWA 5FX2A 4UE6A 3KELA 2FRXA 1MX9A 3AR8A 4TKLA 2A9RA 4F1JA 3G2QA 1A8HA 4AG5A 3NETA 3ZE1B 1N2SA 3HYLA 4GE0A 1SVKA 4MVJM 4ZCSA 1WO8A 3B3JA 4B6QA 1JAYA 4DGSA 1X1RA 3DVAB 4OXQA 1ACMA 2UVPB 2OBXA 2J3KA 4MEAA 4EGQA 1S7CA 1MTZA 2CL0X 4PSKA 4QDTA 2O3JA 4FS3A 5EEGA 3WIEA 2AI1A 1OASA 2HWYA 3ITEA 3HA7A 3BXEA 2YS6A 4G2NA 4O02B 1RZRA 1W44A 1RLOA 3A7EA 3AIMA 2FPUA 5T5QA 5I4KA 3GRVA 1IQ0A 1XCGB 3RTCA 5JAZA 5ER9A 3WKCA 3GJ5A 5KOJB 4HXYA 3UVEA 1CUHA 1J0DA 1V71A 2P79A 2AZTA 3ZNQA 3ZE0B 1XEFA 3EA5A 3L8MA 1AK9A 4CM1A 1E2LA 4BJ5A 1J8YF 2B69A 3RG8A 4KFUA 3GRRA 1JR4A 3AY6A 4W5OA 1GM5A 1F3LA 5ALQA 2ZBQA 2HUPA 2AWOA 1E7SA 2R8EA 4M9SA 4AY6A 2J0QA 4BWYA 1OBOA 5BOSA 4G5YA 4EHJA 1Y7TA 3LT2A 1WUHS 1GLVA 3NBZC 3UTDA 1EUZA 1EVZA 1CRQA 5FI3A 4X8OA 1CQWA 3H9QA 4B2LA 1YRWA 1DXQA 4OX9Y 3E3OA 1KIFA 3PEFA 4KK4A 3TGPA 2E82A 1OTYA 5INTA 1I5RA 4Q3LA 1YDEA 3ABIA 4CL0A 2AFHE 4HLNA 1ND6A 2IXAA 3PICA 1E8NA 1EZZA 2TMDA 2ZT8A 3HXTA 3DWEX 3N75A 4NZPA 1R3DA 4XQ0A 1KSGA 4WEOA 4MW9A 4LF7B 2UVQA 4MUFA 2IDZA 3U6KA 2GZSA 3ZD6A 1E6EA 1JU3A 3HCPA 3IDOA 3TO5A 4OJNA 4GP7A 1CY7A 4JBHA 3WQSB 4UXIA 4EHKA 4PHCA 1MQ9A 3WOVA 4OATA 4OA8A 2XTMA 4QAJA 2AN9A 3H1GA 1Y1RA 3DC7A 3E9MA 3MLBA 4LYJA 2CSXA 1T5IA 2F1JA 4FCTA 2KX7A 4DQ0A 5IMSA 2LIPA 1VGRA 2FOIA 2QGNA 2O2GA 5BW6B 4BE4A 5GIOE 5IHPA 3WBJA 4LF6B 3UJHA 5E7JA 3ZR4B 4CL3A 1K0FA 3OMWA 1QGAA 2ISSD 4KXLA 2ECKA 4BIMA 1O08A 1VPVA 3OQPA 2XW6A 1JSLA 1F6DA 1IHDA 1Q0RA 1WCYA 2P7IA 1M76A 3FSGD 3UJ9A 4B3JA 4ZI7A 5J47A 3ZU6A 2D1QA 1J49A 1EB9A 2EKQA 4NFSA 4U02A 2WYUA 1ISRA 4PG7A 2I22A 4UZEA 2VZ8A 4H31A 3RDPA 3WNQA 2PUCA 1UMKA 3HDQA 2H1CA 1OIXA 2J0EA 3CXUA 5EIBC 1H9CA 1JDBB 4CM9D 4R98A 3ZX5A 3OE7A 1IBSA 5A3SA 1KI8A 2AEJA 5HKKA 4RF3A 2AR7A 3X2SA 2WHPA 1MG5A 5I7OA 2DQYA 2QTVA 5G40A 5LYJF 3B8HA 3ELYA 2WWWA 9GPBA 3F74A 3MCAA 2ZJFA 5CA1A 1E0KA 2IXFA 2VJYA 3UWPA 2W8BA 4P0TA 1YT5A 4BQPA 4M1OA 3IT0A 1S96A 1U8AA 5DMHA 5IBRA 1KDOA 4AJEA 5J4LA 2ZKLA 5IZCA 2VDWA 3IBTA 3PFIA 1RM3A 2VKTA 4Y6RA 5ALKA 4H6PA 4R1OA 2H52A 4NBRA 3R5KA 4CKZA 3QXHA 4I8XA 1OVGA 3SFTA 1IVNA 1M2HA 1SG6A 1WZEA 4JLVA 2P2NA 3T35A 5JS7A 1OT3A 1RWNA 3HCWA 2R6FA 2ZIZA 4C4YA 2ZB2A 1RFGE 2F43A 3NHPA 3MWGA 2WJYA 2WAXA 2WFZA 2GHQA 3FDZB 4NOMA 4AJHA 2IBSA 1T13A 1SBQA 2XMPA 4LRXA 3GXBA 3I6MA 1J99A 2D06A 2FZLA 3DXXA 4I9HA 3G02A 1XRLA 4RGQA 5AUOB 1FMJA 2JAWA 4DSNA 4FWTA 1PQWA 3L4KA 3PFHA 1QHSA 1T2VA 5L4LA 4I3FA 4DV0B 4AP6A 1PR6A 3MLAA 1N3YA 2VN8A 1W36C 3KUXA 3K9BA 2OM2A 4DWVA 2HLNA 3P9KA 3W5JA 3D6MA 3IE1A 2QLMA 1KFCB 1SCKA 5BO5A 3A1SA 1H4VB 1JDVA 3HKEB 4GLFA 1SZDA 4UHEA 4YJ2B 3T38A 5MHTA 4OXYA 2CMHA 2VQ6A 2WFLB 4KIGA 3NAMA 2JHGA 4I4TF 3UNXA 2Q5CA 3OCCA 3KWJA 3EXG1 1XZDA 1J0EA 5DULA 3IERA 4YRDA 1M1ZA 5EGSA 5AD1A 5KNDH 1II0A 1Q0HA 2DWOA 3GJTA 4NECA 5BP7A 3C48A 1CS0A 3G59A 1QMGA 4LV5B 2VDNB 4PRLA 4UJ5A 4NOKA 1K9SA 1NJ6A 2J4DA 1BWPA 3MOIA 2H9YA 4Q1FA 1Z2PX 4U3JB 1U1CA 3UBMA 2VPQA 3PQCA 3BF8A 4XIFA 4PC3A 3O94A 3OO0A 3F9CA 3OWXA 2QKYA 5LD2B 1EFHA 2IY7A 3L4BC 2HD4A 2FU5C 4B32A 3VZSA 1Y80A 2Z1NA 5ALOA 1U4OA 2PQ0A 1BXKA 2ZBGA 4JA0A 1QKKA 2B4RO 4LOIA 3ZE7A 4RKYA 4FQ8A 1GQFA 1UJ6A 4B74A 4NXMB 1DNPA 5LQSA 3SHWA 3PDIA 1XZKA 2QORA 1FRVA 2GPTA 3OKFA 1F2TB 1XR3A