5TB5A

Crystal structure of full-length farnesylated and methylated kras4b in complex with pde-delta (crystal form i - with partially disordered hypervariable region)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
184
structure length
172
Chain Sequence
GTEYKLVVVGAGGVGKSALTIQLIQNHFDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDKKKKSKTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title Structural basis of recognition of farnesylated and methylated KRAS4b by PDE delta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein
total genus 61
structure length 172
sequence length 184
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5tb5A00
2QMUA 5FTJA 2P6NA 4TLAA 4V0MA 3SJZA 4P4SB 3GLGA 4HAYA 4NHOA 1OF1A 4BZXA 3U7GA 3QIAA 5TY0A 4JL5A 2OCYC 1E2KA 4C7OA 1EX7A 2CE2X 3LFUA 4LJ5A 2AFHE 4CEIB 4C4PA 4LV5B 4R9UC 4KSCA 2JLRA 2REBA 2QROA 3MCAA 2WM9B 4KI0A 4URWR 1KOFA 4E03A 2EWWA 1RZ3A 2GK6A 1VHTA 2ONJA 1OIVA 1N25A 3MGCA 4HB4A 2IYYA 4PQYA 3T15A 1S1CA 4JLNA 1LF0A 4G1UC 4Q4LA 3I8SA 3KJHA 2WOJA 4JVSB 4GNKA 1QVRA 4PC6A 4UNRA 1E0KA 4GOXA 3PEWA 3ZZUA 1NG9A 1CRPA 4NTZA 1OE0A 1DVRA 3T61A 2D74A 4DKXA 3N2EA 1HH4A 4NCHA 3TAUA 2GA8A 1UM8A 3EZ2A 2IC5A 1QF9A 4AKEA 1XPOA 3AVXA 2B8WA 1TQ6A 2D62A 2HXYA 1Z0FA 1KTVA 4P4UA 2CVHA 1CS4C 4US0R 4C0LA 1HYQA 1OXTA 4NBSA 4UXIA 4LSGA 1E1RA 2OHFA 2QA5A 2W2VA 3M0EA 1FPMA 2GJAA 1ZP6A 3QF7A 4JYBA 5KPDA 1X8JA 1II9A 4DLXA 4DEXA 3V00A 5C2JB 2NO9A 2FEOA 4N3NA 4URYR 1ZIPA 4NE2A 1WE2A 4OI0A 1MRNA 3A1VA 3OESA 1YZNA 4JJZA 3ADBA 4LYFA 3A8TA 1NJGA 4DRZA 3ZZTA 1PLJA 1D2NA 2VHUA 3FMOB 1TEVA 2WKPA 5DI3A 4Q9IA 1CR1A 2C9CA 1Q3TA 1P7CA 2GXAA 2BEJA 4D0GA 1Z22A 1ESNA 2DB3A 2QGZA 1R5NA 3VR3A 1M34E 3DOFA 2WWFA 3B8HA 3R20A 2DY1A 4A6PA 4TYYA 1DEKA 4XH9B 1GITA 4P33A 5TDHA 2UZIR 3FB4A 5HE9A 4QGFA 3EWSA 4JVNA 2N42A 1OXUA 2PZFA 5CJPA 1Z0IA 4YMVA 2O52A 3AKEA 1HQYE 4M1WA 5LDDC 3CH4B 2CK3A 4BFTA 2WIBA 2IW3A 3IBGA 4RFSA 4BLPA 4MKHA 1XMJA 1VG8A 4DCNA 4YQFA 4ZI2A 1IY1A 4RKEA 4OHWA 1KK2A 3EC2A 1JBKA 4IDQA 1SVWA 4BFVA 2ZRIA 2EYUA 2VHTA 2V1XA 4HDQB 5TB5A 3SOPA 2D3WA 5JEDA 1SZPA 1COWA 1P6XA 4K81B 2BV3A 4B3XA 1RJ9B 4C0SA 3LBHA 3U3MA 1DTSA 3WMFA 2QAJA 4C0KA 4EQ6B 1EXMA 1E1QA 1KJYA 3CF6R 2R6CA 3CRW1 1JPJA 3AVQA 3BFXA 1G9XA 3E5HA 4FMDB 4GMXA 2W2TA 4TT3D 1OXXK 4XWAA 2CJWB 3FPAA 4LUCA 5EQTA 1NVVR 5A0FA 4OL0A 1FTNA 5DHAA 2BVNA 3X1YA 3BWDD 3VR6A 5FUWA 3L43A 5JWRA 2RGXA 4I1SA 1A2KC 1C1YA 1Z3IX 2Z43A 2R44A 3K9HA 2V9PA 2QQ0A 4DLUA 4FCWA 2JEOA 1G3RA 2P5TB 1JAIA 1FNMA 4RD1A 2LCFA 2AD1A 1XJQA 1S9DA 1VG0B 2FX3A 5HPYB 1F2TB 4I99A 2GCOA 1RPZA 2FDCA 2R6FA 3KKOA 2GZDA 5BW8A 3IQWA 3Q5EA 4G0NA 1N0WA 1XP8A 3AGPA 4B35A 5H68A 3K8YA 1YZLA 3P4XA 1UADA 4HAXA 2ZR7A 1DAHA 3UIEA 4YXWA 4A0GA 1G4UR 3B60A 4BE7B 4GOJA 4RD4A 2ZYVX 1Z0JA 3Q9LA 1EG7A 5B64A 3VR1A 1LS1A 2HDNB 1OKKD 3RWOA 4YMUA 2OBMA 4DSUA 3RDPA 1KO5A 2CL7X 2C2HA 4R7ZA 1FP7A 1VPLA 3WMGA 2XZLA 1OXVA 2A78A 2OXCA 4Q1AA 3B1YA 4H9GA 3KZ1E 3QY0A 4OJQA 4JZKA 4GSYA 4QGHA 2FGJA 1XXHE 4MRRA 4LBYA 2DCUA 4DBLC 2FFAA 2F1IA 3DM5A 3P4YA 3NBXX 1SVKA 2F1HA 2NTYC 4TYQA 1GUAA 1NLYA 1YKSA 1AA9A 4NYJQ 3AM1A 1CF4A 1G41A 1NBMD 4HAZA 1T8TA 2HJVA 4KXFB 2AWNA 4LYAA 2IWHA 1YHNA 4IFEA 3JVVA 1XTKA 5GVSA 3ZS9A 1ZCBA 3VR2A 2JATA 1ZC3A 4PO9A 2Z0MA 4HLUA 2C8VA 1W46A 1AZSC 1NSTA 2B21A 3CBQA 4FMBB 4TL9A 3SYKA 1AN0A 3TK1A 2WSSA 2X2FA 3WHKA 2REOA 3AKYA 2OLKA 1XXHB 1XCMA 3OZXA 1E3MA 1W36D 1Q57A 2RGAA 4LX0A 4EPRA 2XZPA 4NL4H 4UNNA 1BYIA 1NKTA 3I73A 3LD9A 2E1RA 4Q7MB 4F93B 3OEHA 3LA6A 2O8BA 3VU9A 3P26A 5FPTA 5KDLA 4TLDA 1FQJA 5EZ5A 4PX9A 1RYHA 1II0A 3MMPA 1P60A 5JHGB 1UEIA 1Z07A 2X1VA 3TQCA 1KMHB 1U0JA 5FOUA 3X2SA 1SULA 2WPDA 2BMJA 4KHZA 2IYZA 5F9HA 4QGGA 2ZJ8A 2FZLA 2A2ZA 3OIWA 5AJZA 2VP4A 3E1SA 3UANA 2I3BA 1EESA 2CHQA 3U2QA 2KJQA 3QENA 3VKWA 1GWNA 3DPUA 4K8OA 1CR4A 2OFWA 1IY2A 1SKYE 2QPTA 3OEED 2R65A 4KCGA 5J4VA 3K53A 1VYUA 4DB4A 4QM6A 1CR0A 2O8DB 4B47A 4NKRA 3OHMA 5K8UA 2J0UA 4HDOB 3EPHA 1E2QA 4C0HA 3A6PC 5FOSA 5BN5A 3QEJA 2GXUA 5DH9A 1G18A 4QJ5A 1NP6A 4CEHB 3FFBA 2XB2A 2FPKA 4FMDF 4Z8YA 1OFIA 1NIJA 4NU0A 3SQWA 3I4LA 3IBYA 3QPWA 4LJ7A 5J40A 3U5ZB 2AR7A 1ZD9A 3AGQA 2GESA 3A36A 3QKSB 3VR5A 4C9BA 3VKHA 5FPHA 1UBFA 4Q4AA 4JLBA 4YLGA 4HZUB 5EXTA 5CLLA 5AJXA 3W5JA 4WXRA 1WMSA 1SKYB 4Z1MA 2X8AA 2R6GA 3CX6A 4JSYA 3EW9A 5DN6A 5EZ6B 1Z29A 1F2UA 1NKSA 5TARA 4DLVA 1KIMA 1ZNYA 2CE7A 2ZR9A 2HT6A 1AQYA 1QG2A 2QP9X 3TRFA 1E9RA 1OH8A 3IILA 3M6AA 1D6JA 2CNWA 1TQDA 2DFTA 1ESMA 4ZPXA 2Z4RA 2ZI9A 1JR3E 2FF7A 1Z28A 2JJ1A 3K1JA 4TTQA 5IRCD 2ZE5A 4LC1A 5BWMA 1HURA 3PIRA 4TLCA 3J81k 4BLQA 3V4RA 3DKPA 4D0NA 3NBFA 1U98A 4DLTA 3QPVA 1Y63A 4TSFA 3A4NA 3EWAA 4IXNA 1E2FA 2J1LA 2B7CA 2WWYA 1F3OA 3AVVA 3MUFA 2ZREA 1T3SA 2DWOA 2CLDX 2AXNA 4O2RA 3WP1B 1OH5A 3ASZA 2ZVQX 2ORIA 2J0QA 1P2VA 3QUSA 4M22A 5A5GA 1P62B 2KI5A 1T9HA 1U8AA 4M8NE 2ZYUX 2JIZD 3VX3A 2OO7A 5C4MA 2JJ2D 3H86A 4ESVA 1M7HA 4RY2A 2VP0A 1T6NA 1KNQA 4DLWA 2PZEA 1I2MA 2J5XA 3BB4A 5L3QB 1QVAA 3PXGA 3R9WA 2VP5A 1OYWA 4JBYA 1CJVC 1CP2A 1CJMA 4QNMA 5KU1A 3QXHA 2NGRA 4LZZA 1EFHA 1FUKA 2IS6A 1Z5ZA 4NYMR 2LWIA 4ZKDA 4TLBA 3QF4B 5HE8A 4GBMA 4Q19A 1L4YA 2XOKD 3AVYA 5FL7D 3EPLA 1QHIA 2R62A 2FSHA 4PAOA 4BWYA 5F9FA 2XXAB 4MYHA 4UKDA 2YHSA 1JI0A 5EE5B 3GLIE 3WNDA 4W7SA 4BZPA 5JS8A 3F5FA 5G3ZA 3DO6A 5UKDA 1U81A 4A82A 1KO8A 3EAQA 1MO5A 2FV8A 1DARA 1N6PA 3SZRA 3QQ5A 2PJRA 5LB4A 3SJBA 2A9KA 4EPVA 2AWOA 2NIPA 2G77B 1GDDA 1QHHB 3JZAA 3NHBA 3PJRA 2F6RA 4PR0A 4U7DA 4S2EA 1FFHA 2B7BA 1ZNXA 4V02A 2ZS8A 4P4TA 521PA 4CYMA 4B76A 3NTUA 1FX0A 5FBQB 3S1AA 5KOYA 5KPJA 4MITA 4FWTA 5FUXA 4QBFA 3UMRA 1CBUA 1N0VC 1PLKA 2VYFA 3I8XA 5CIQA 2VP6A 3BFKA 4L4UA 4KJZA 5FTNA 3RVBA 3KXLA 4ACAA 4BFUA 4FN5A 2OV2A 4IEEA 4DVGA 3RRMA 3GLIB 2ZJYA 3SS8A 3BD9A 2ZUBA 3RRNA 1KKMA 2W6ID 4R71A 3KKMA 3G0HA 2XX3A 3KQUA 3AB3A 4PXAA 2UKDA 3GLGE 1TU3A 4HLUC 4ZO4A 1OHHA 2YV5A 3EZ7A 3GCGA 1X1SA 1G7RA 3ZYCA 4BFWA 1Z08A 2XNDD 1CULC 3ASYA 2PCJA 2IX3A 1GL6A 2TMKA 2H1LA 4EPWA 2MMCA 3ONWA 4DLSA 4FWIB 5KSYA 1KGDA 3AF4A 1VMAA 3ZJYA 5KDDA 3C5CA 4L9WA 4DIEA 4BFXA 2YWEA 1P5ZB 4BRWA 5DGXA 1G6OA 4CEJB 1NVUQ 1KYIA 1S0UA 3QKTA 2PT7A 2PLFA 5GVRA 2BWJA 2G88A 4DDUA 4LJAA 4URXR 5GJBA 2C78A 1IHUA 4Q7KA 3GLGB 4EFLA 4RD3A 4A8JA 5ANRB 1NVVQ 1FZQA 1R4AA 2XGJA 3FKSA 2E9SA 1OXSC 2I1VB 4IOKA 2IYRA 1X86B 3PVSA 4JKYA 3K70C 4JMPA 4FI3C 4LHYA 1LF5A 2Q3HA 1G291 3B78A 4NP6A 3LNCA 5DHFA 2YC2C 2ZJ2A 1S96A 2P67A 1NVWQ 1GRRA 1YR7A 1T5IA 4DT1A 3TMKA 4CT4B 4FINA 1G8YA 1VIYA 2R2AA 3UKDA 3MLEA 1XTQA 2KWIA 2IHBA 5G40A 3LRPA 1RW4A 2AX4A 3U3OA 3L82B 4IKEA 2ZE7A 3QJYA 2DPXA 5LB2A 4C0QC 3W3AA 1R6BX 3U60B 4JLKA 2ZRFA 3IHWA 2BBOA 4WW0A 1Z0KA 5EE0A 2FZ4A 3QOFA 2VSFA 2Z6VA 3AKDA 4CDGA 4Q9HA 2ZAOA 2F43A 2WJIA 3ADCA 1G16A 3FMPB 1D2EA 2VHCA 4U02A 4D4MA 3TSZA 3B1VA 2JASA 4IDPA 2F1JA 3GEHA 5KNBA 5JI2E 2V7QA 2ONKA 1Q1EA 1XEXA 5HTKA 2LKCA 3TR5A 3FYHA 1KSFX 4LBVA 4UXJA 1YZGA 3IPYA 2JDID 4TTPA 3FTQA 2H18A 2JGNA 3D31A 1ZBDA 4QJ4A 4JIMA 5J4HA 1JJ7A 1G8HA 1SXJA 4TN1A 5AK0A 1XD2B 2BM1A 4IRUB 3CX7A 3TVTA 1ELOA 2J41A 4DCTA 2ZI3A 3PEVA 1G5RA 4OI4A 3LQQA 2HF8A 4BGDA 3T34A 1XTSA 3TH5A 3VKGA 1KO4A 1CKEA 3T12A 2PMKA 4UQOA 1XPUA 4XSHA 2RGCA 4QHYA 2ZEJA 4LPKA 3WNBA 4I1VA 5FUYA 3MRSA 2KB0A 4FCTA 5HCIA 1U8ZA 5JS7A 2P5SA 2NMVA 1WBDA 1R0ZA 4HB2A 2IXEA 4KBGA 3KTAA 2GK7A 3I61A 5DI3B 3KUCA 4OQMA 4URVR 2D2FA 3TNFA 1FMLA 4XWKA 3G82C 5EP2A 1OSNA 1B0UA 3BOSA 3HPQA 3E70C 2O8FA 3AEZA 3BH0A 4W5HA 1XTJA 3W5IA 3W9YA 3I5YA 2BBTA 4D26A 3ZQ6A 3TW4A 4GMDA 2F1RA 1A4RA 5TVKA 2Q3FA 2KBFA 4TZ6A 1TADA 2N1BA 4EAQA 3N2IA 2Y8EA 2OG2A 3CNLA 3I92A 2C95A 3CZQA 3L2OB 1NF3A 4RFSB 4B2PA 4MDFA 5JCPA 3OAAD 4XTCS 2BBWA 2ZUDA 2ZJOA 2NPFA 1R7RA 5B58C 2GEUA 3REGA 5JSZB 2AN9A 1TF7A 2GHIA 3UMFA 1GTVA 2GCNA 2GEDA 1BKDR 1U90A 2OM2A 1E2PA 3BBPA 3CRVA 3TIFA 6Q21A 3SN6A 1DELA 1N6HA 1SHKA 4PPFA 5AJWA 1XPRA 5L3SB 1WP9A 5E95A 1F60A 1WA5A 1YR9A 2ZJAA 3BERA 2W00A 5CDFA 1Q44A 4LJ4A 3AF0A 1H8EA 1GG2A 1W0JD 2KE5A 4QNRA 1I2DA 3HPRA 5KSPA 1XB2A 2CXXA 3WYGA 4DLZA 4LPSA 3SYNA 2ECKA 3NG1A 2XTZA 4YDSA 3MWYW 3SNHA 2RH5A 3GFTA 3ZD7A 5AR1A 3THXA 3OIUA 2CDNA 3T06B 2PEYA 2Z5FA 2ZVPX 4B34A 1KDOA 2HEIA 1KSJA 4E07A 3BJIC 1HY3A 4PQFA 3LX5A 2HLDA 3MWJA 1TUEA 5FI0B 1QRAA 2B92A 1AKEA 4XVRA 1N6OA 5F98A 2QE7D 5F2EA 1MT0A 4I1OA 4ZIRB 1ZM3A 2ZSDA 1W47A 3CB4A 4AG5A 4GDFA 4OKSA 1O3YA 2GCOB 3NEJA 2J46A 1G8GA 2QRNA 1F5NA 1ZU4A 3PUWA 2ZI5A 2J87A 1E0JA 2AXPA 4KODA 4YC7A 1W4AA 1HV8A 3OE7A 4A15A 1N5IA 1UKZA 2QT0A 3MJRA 4I81A 1P4SA 1W49A 4NMMA 2BHRA 2IYSA 3PITA 3SEAA 2W0MA 3W90A 3I32A 4BASA 4O3MA 3I72A 4JYCA 4EJSA 1U8YA 2HYIC 4JLAA 1EFRA 2ZSAA 3MSXA 4V0NA 4WZ6A 4MUAA 2GTPA 2C04A 3AH8A 3U61B 3MD0A 4DIDA 1DS6A 5AJVB 5FTKA 1GL9B 2WMNB 5C18A 3ZH9B 2GZHA 3VFDA 4ABYA 2ZRJA 4NCJA 1LNZA 1XF9A 1X8LA 3AP2A 4BEBA 1DAGA 1R0XA 3HDTA 4M9XA 5FR1A 4LI0A 5B2ZA 3WHLA 4ERNA 2ZU6A 3FWYA 3SDZA 3H1TA 4TT3A 5DO9A 1ODFA 5LD2C 1Z83A 3GJ5A 4JKIA 5FBWB 1H8HD 1HE8B 4A8JC 2H8KA 4Q4HA 3EIHA 5CYOA 1P2SA 1N5JA 1E2HA 3BXZA 3C5HA 5DNYB 4DJTA 4M1SA 2O0KA 2NPIA 4CZ2A 4KSBA 4WVFA 4PHTA 5CM8B 4Q18A 4FW9A 2PBRA 2A5GA 1GKUB 3L8ZA 4ZDKA 3BH6A 3SJCA 3VU9B 4MGIR 3PUVA 3T5DA 2CCKA 3EC1A 2X19A 4Z54A 1MH1A 2UVQA 5KNCA 5D3MA 4JVLA 1YZUA 2AL7A 2QQEA 4URZR 4PC1A 2JLVA 2HCJB 2OFXA 1DBSA 3V4FA 1G7SA 1C9KA 4MQBA 3L0PA 4M1YA 1N3BA 3G5UA 1CLUA 1IXRC 1IXZA 1GL7A 3FOZA 2QG6A 1E2MA 4LDJA 4JBXA 4X8OA 2ZE8A 3MWKA 1E99A 3RS7A 1B23P 1XD8A 3ZD6A 1KK3A 1QHXA 4XD7D 4LCBA 1W5SA 1VTKA 1XNJA 4EDHA 4DXAA 4G5GA 1OYYA 1Q0UA 5SZKB 4IOMA 1W5TA 4QRHA 721PA 2HF9A 1NNEA 2BIFA 5M04A 2J0UB 1KI6A 1NBMA 1S3SA 3RC3A 2ZM5A 1SXJC 4B3DA 3TW8B 2X77A 5K8IA 4LV8B 1XEWX 2IYLD 4M1KA 4WA7A 4JLJA 1J7KA 3BK7A 3IUYA 1DG3A 4OQLA 5FBRB 1P61B 5AUPB 4RZUA 4GT1A 2FE4A 1EK0A 3DDCA 3RS5A 3UPUA 1M74A 2EFEB 2V1UA 4Q4AB 1E1RD 1KI4A 5J47A 1XEWY 2JJ8A 3H84A 3NH9A 2H16A 2HCBA 4PHFA 4KFUA 2E87A 4P4SA 2WTUA 2ZS7A 2RGEA 2ZANA 5C4GB 5L3VA 1FTSA 1FP6A 3UMSA 2WMOB 1JXOA 1OIXA 1NMZA 3DL0A 1VYVA 3DMNA 1R10A 2AK2A 3W6OA 3O8CA 1KY2A 2Q9BA 2IF0A 2WZQA 1RC8A 4A0FA 2QSZA 1MABA 5IF9A 1OJLA 1NN0A 2XTMA 4BEJA 3CO5A 4HEJA 4RCZA 3AUYA 2OXRA 4RD0A 4AC9A 1AS3A 4M9SA 3IHLA 1DPFA 1TQ4A 1OIWA 2MSDB 1SKQA 3EIEA 2DWQA 4KFRA 3A4MA 4JLVA 5EXPA 4BFYA 3W34A 2YVUA 4QHSA 1RRFA 2IXFA 2NG1A 5FFMA 3WY9A 1Z0DA 3OEEA 1OV4A 2EFGA 2G3YA 1WF3A 4NCIA 1UKYA 3QXSA 3BFVA 4DCUA 1ZJ6A 3L0SA 1L2TA 3GPLA 2VPPA 2HV8A 2Q21A 3SBEA 2AKAB 2EU8A 3KUDA 3NDPA 4NZYA 4AKHA 4WXPA 2IEYA 3E2IA 4B32A 1KAOA 3KKQA 5HR5A 1E2LA 2OLJA 3EG5A 5AWFC 3MWLA 4S35A 2QN6A 4MGKR 1JJVA 1YRBA 2C98A 2QPOA 1IN8A 4EPXA 2GJSA 5FOVA 2W6JA 1COWD 2K5UA 3ZVNA 3THYA 1WXQA 3OF5A 4NH0A 4D4KA 3QKRA 1A5TA 2FMXA 1E0SA 1BH2A 221PA 1E1QD 2C96A 4V03A 5EUQB 2JAQA 3K0FA 1OFHA 2BMFA 2O8CB 3RSLA 2FFBA 4LY6A 3CF0A 4IHQA 3NKVA 2ZSEA 3KKNA 3T1QA 2H7VA 4OK5A 1FNNA 3THWB 2HYDA 2JLWA 3QVVA 4Q21A 5CK4A 4CW7A 3WP0A 4DC9A 1FMJA 4P31A 3ZIAA 4WIAA 1DAFA 1RFLA 4EPTA 1IY0A 1L4UA 1ZM2A 2RMKA 4GZLA 4ZDIA 2IS4A 3WYFA 3H2YA 1TU4A 3QKUA 2ZRBA 5EXXA 1W0KA 3BIFA 5DISB 1MKYA 4IVRA 4D80A 1AKYA 1K6MA 1VDZA 2W0SA 3B6EA 5JEEA 3TGPA 1BS1A 1T0HB 1GAJA 2AD5A 3GD7A 3TUJC 3IIMA 4EJSC 1A82A 4IFBA 2VTKA 2XTNA 3HR7A 4B3FX 3B13B 3BRWD 3S1AB 3SYLA 1PLLA 1SVLA 3T1VA 1KY3A 4GP7A 3GLHA 4O25A 8OHMA 3HR8A 4YMWA 2G83A 4Q9LA 5HCNA 2XJ4A 2GAAA 4ITRC 5IT5A 2DFKB 1PZNA 4A1FA 5JBQA 2YKGA 2OBLA 2J9RA 3BAFA 1GVNB 1OH6A 4V0OA 4W9MC 2YJTD 4EUNA 1JB1A 4Z51A 4UJ3A 2FSGA 3CPEA 3TUIC 4L5BA 1YZKA 2JJ2A 3PQCA 1ZAKA 3NVAA 4HAUA 3PUZA 1AM4D 4ON9A 2IK8A 1XWIA 1FL9A 1VCMA 3RS3A 4ARZA 4EQ6A 5BQ5A 2WJGA 1Q22A 2OUKA 2ZRKA 5GJVC 2BMEA 2YYZA 2GCPA 5DYGA 2P0EA 3RC8A 2XOKA 1XZPA 1E2IA 4Q9JA 2JLSA 1ZD8A 4XVQA 2YOHA 1J70A 4HUQA 3X1WA 4D81A 2NQ2C 3NEYA 1R5BA 2BBSA 1X6VA 4L8GA 1R5OA 2C03A 3O47A 1TTTA 2J0SA 4HAWA 4TYWA 3KQNA 3LW8A 4HUTA 1Q1QA 1VCIA 4QL3A 4HB3A 4KYIB 5IK2A 1YRAA 4D6PA 5LD2B 2YINC 1GKYA 1DOAA 2VHQA 4OBEA 5CK5A 2CHVA 1UPTA 3R7WB 2ZRGA 3OEHD 2PT5A 3EA5A 4X8HA 4BZQA 5FOWA 4KFTA 1NMXA 5E7JA 1KI7A 1MO6A 1TQ2A 2QI9C 1IN7A 3KQKA 2WPDD 2CBZA 2IF2A 3CKLA 4KYUA 1Z2CA 3H4MA 4DT1B 2V55B 5HZHA 1QG4A 5L8VA 3C15C 3HU2A 1RE0A 4W5JA 2A3RA 2VRWA 4PAQA 2FH5B 1G7CA 4AI6A 421PA 2AFIE 2WWHA 5K8TA 5C46F 3VNVA 4POAA 1SXJE 1E9BA 1XFAA 3Q8XB 1PVOA 1P9WA 5LBIA 1R8QA 2ZRHA 4V0LA 3EZFA 3HYRA 1G19A 3THOA 5KSOA 2GXQA 2GVDC 1KNXA 3LLUA 3GEIA 3RHFA 2F43B 2QBYB 3RRZA 4BRUA 4TL6A 4B6FA 1ZW6A 1IBRA 4DSTA 2XNDA 2WKRA 3O8BA 4DSNA 2C5LA 4PZYA 3CX8A 3U4QB 1NSFA 5DSZA 3FHCB 1G1MA 1T8UA 2PMDA 1G7TA 1FQKA 2G6BA 2PEZA 1XEXB 4U5XA 2G0NA 1ZRHA 3GMTA 4M21A 1XMVA 1DG1G 2A5YB 1KDPA 5DI9A 3RSOA 4AIIA 5KSZA 1N0UA 4FD2A 3AVPA 2BCJQ 3UXMA 2FA9A 1MO3A 4Q03A 1EWQA 3FE2A 4FIDA 3BB1A 1SXJB 2ERXA 1XXHA 2VQSA 4YMTA 1Q1BA 2QAGA 4US1R 2HUPA 2ZI7A 4TMTA 1NIPA 3F0TA 3C8UA 4Q48A 3UATA 3TE6A 4Z1MD 2QSYA 1KJZA 2ODNA 3QEOA 1AIPA 5DN6D 1E2NA 2HXSA 1E9DA 4OHVA 3DHWC 4R2IA 5JLJA 2V4ZA 2IBMA 1KMHA 1ZUIA 2ZAMA 3OFNA 1YVDA 4LYJA 5HKKA 4DSOA 1WB9A 2JJ1D 3O8RA 1VYTA 4M1MA 3KDSE 3GJ8A 1K5DA 2V3CC 2OESA 1RKBA 2BDTA 2X2EA 4PPQA 2BC9A 2Q6TA 5EUMA 4DHEA 2I1QA 3UG6A 1E98A 2ZI6A 1XTIA 4TSFD 5EJEA 1KO1A 4PSAA 4L9SA 1VHLA 4GFDA 3Q7PA 2BKUA 4B3GA 621PA 3UK6A 4V0ME 3KQLA 3LVQE 4LRWA 2ODBA 4AY2A 2PJZA 5HZKA 1ZUNB 3ZLJA 1VCOA 1ZM4A 3AP1A 2ZSFA 3WBJA 2Q0HA 4TQUS 3L8YA 4LHZA 1IXSB 1E9SA 1D9XA 3SI7A 2CVFA 2XSZA 4G5OA 4AYWA 2Q9AA 2CMKA 2QY9A 1KI8A 1E2GA 3U3KA 4P32A 3SHFA 3SC3A 4NDZA 2DR3A 3LY5A 3WRYC 4TMXA 1WBBA 2JDIA 2OBNA 2WV9A 1T5LA 1V5WA 2YWHA 3ZVMA 3QKSA 3AP3A 3KL4A 3W6PA 2JLQA 2ZRMA 4Q66C 3W3ZB 2RGBA 4WOPA 5DYIA 5FTLA 1JALA 2DBYA 4QXAA 1DAEA 1I4DD 1U99A 3IPXA 4Q1FA 2RCNA 4BFZA 2IUUA 4Q1BA 3ECCA 4B2LA 3IKJA 3TR0A 5KNDA 2OILA 3AQ4A 4PC2A 2A5JA 3DVLA 1JQJC 3K9GA 4NYIR 1E79D 2IS1A 1NY6A 3B1ZA 3THXB 1VECA 4ZV4A 2FSFA 4DLRA 4C7OB 4BECA 5JRJA 4PHGA 2J7PA 3A58B 1S1MA 3GFPA 1SHZA 1JXMA 5JWOA 2ZU0C 4ASUA 1DADA 4PO1A 3AV0B 2R8RA 3K0SA 4BLOA 1D5CA 2VL7A 3IQXA 5J4LA 2PX0A 2ZYTX 4RZXA 5AJYA 2QTFA 1ZIOA 1OH7A 2AK3A 2ZTSA 3C4JA 2FOLA 4IDNA 4DUGA 3R9IA 3NH6A 3HWSA 4EIWA 1D8TA 4OHXA 4H1UA 2SHKA 4LJ9A 4L16A 1U2RA 3TAHA 2ZQ5A 3NC1C 4FCVA 2P65A 4M53A 3CWZA 4M1TA 4NYJR 2F9MA 1GNPA 1MOZA 1BYUA 4PC3A 2GJ9A 4EJSB 1CJKC 1JR3A 3ND9A 3U6BA 3QG5A 4TTRA 3BORA 2VHJA 1M7BA 3AUXA 3VNUA 1OW3B 2XZOA 2QP3A 3LO5A 5TV2A 3WYAA 1KI9A 4GZMA 3CWQA 5KO2A 1BMFA 2WAYA 3I3SR 3K0AA 4EFMA 5FR2A 2Q9CA 4DWJA 5GJWC 3WNCA 4DCSA 1G5PA 2XNSA 3AVOA 3QBVA 2PLRA 5L3QA 1VG1A 2ORWA 3U44A 1NY5A 4G01B 5JFGA 1OHHD 4HLDA 2VSXA 2QMHA 1UEJA 1TPZA 4LJYA 2QTHA 3ZGXA 1NMYA 4U00A 1E94E 4B3BA 5AUOB 3I62A 4A2QA 1BO6A 2BOVA 2ZE6A 2GETA 2LKDA 1US8A 5G3YA 3KKPA 4DB2A 4DLYA 2BCGY 2FFHA 4Q4HB 4B33A 2WBLC 2D2EA 5L3RA 1CTQA 4FMCF 4LBWA 1AS0A 2VF7A 1A7JA 5EP3A 1GRQA 3CLVA 3EZ9A 5CITA 3CUEF 4F4IA 3HU3A 1GIAA 1UBEA 1IQPA 1U0HC 2YNMA 3NBZC 4RSGA 2O5VA 1LY1A 1PUIA 1Z06A 3ADKA 4LBZA 1QHHA 2FNAA 3W8RA 4AWXA 1XU4A 3FKSD 1TEXA 4DDWA 1ZC4A 2QM7A 4QOSA 3DM9B 1XCPA 3QPUA 3LVRE 1UBGA 3T5GA 2VF8A 1IJEA 2A30A 4G5RA 1G3UA 1WDTA 2BKEA 2EFCB 4TMZA 1T3HA 4KU4A 1QHGA 1CU1A 2FGKA 2W83A 4DEYA 3GLIA 3ZQJA 4OI2A 2A5FA 1M2OB 2ASEA 2IYXA 1EFCA 4MKGA 4Q7JB 1XDBA 2R9VA 4C0JA 4KBFA 1ZCAA 4XTRA 4RZ2A 3KB2A 3QG1A 4UNSA 2WJYA 2GBLA 2GKSA 5KHOC 2QPAA 2EYQA 3Q72A 3GFOA 2C9YA 4M1OA 4URUR 5EP4A 1O87A 2QMEA 4P0TA 5EP1A 1YQTA 3TLXA 4BLTA 4BFSA 1GKIA 1Z8FA 1ETUA 1J99A 1KI6B 4UNPA 4NONA 1M6NA 3TUZC 2RB4A 4AURA 5JZVA 1AQUA 1D2MA 2QAGC 2RHDA 3PR1A 4XIGS 1H8HA 2ZJZA 4IW3B 1N5KA 5KTYA 2V7QD 3DZDA 1TF2A 1H65A 1VIAA 3IEUA 1KHTA 3EIQA 5D3QA 1KDRA 4QBGB 1V43A 3AF1A 3LQRA 3O8DA 1NN5A 2GRJA 3DKVA 1SXJD 3M1IA 4PHHA 1NN1A 3QXJA 3IIKA 3V9PA 4BPBA 1S4QA 4MYCA 2QT1A 1XEFA 4GRAA 4MYTA 3NHAA 3IO3A 1E9FA 1ZD1A 4JBWA 1I4TD 4R2HA 4GOKA 5CLQA 2ZRDA 1IM2A 3AVWA 2EW1A 1Z63A 1GRNA 2O0JA 4Q1CA 3PFIA 2YZ2A 4CVNA 4LHXA 3SFVA 4ACBA 4MYUA 3SE0A 1MABB 2BEKA 2FPLA 3L0IB 1P2UA 1N6IA 1YR6A 2FJUA 3NDBB 4A2WA 4IOLA 4PO8A 4Q5IA 1QZXA 1R0YA 3BGWA 3PENA 4UJ5A 4A92A 2WSMA 4XD7A 3VHXA 1NVXQ 4Q1DA 3VHLB 1TF5A 2GF9A 1YZQA 5IHPA 1LS6A 3K09A 1P9NA 4I1UA 4TQ9A 1II8A 3GJ6A 3HU1A 4MKFA 4TL7A 1HUQA 3X1DA 3SJAA 2V8OA 3EPJA 3FHTA 1UFQA 2Z4SA 3NIBA 1XMSA 4ZDWA 4B44A 1GM5A 2W58A 3U7FB 1G3QA 1T4GA 1HT1E 1ZNWA 3FMFA 4OQXA 3MG9A 3FFAA 1E6CA 3RABA 3K0EA 4D4LA 2OT3B 1G3IA 3SHWA 5BXQC 3KFVA 4Q47A 3CIOA 2P6UA 4PFSA 4NCNA 3AF3A 4PPGA 4JJKA 1E4VA 3WXMA 1AJEA 3THYB 3QXCA 1S9HA 1X1RA 5E4FA 1JR6A 2RKOA 4G3XA 4Y0AA 3KFXA 4A4DA 2BMDA 2QORA 3QKRB 5K8LA 1ZU5A 1H8ED 1G21E 2XAUA 3FVQA 1XD2A 2F7SA 3K0FB 2MSEB 4NYMQ 1KKLA 4KVAA 3C16C 3GLHE 2R6AA 4PC7A 4QJ3A 2O8BB 2QUZA 4IXMA 2D7DA 2ZR0A 4AYTA 1ZINA 1EWRA 4IVQA 2H92A 5JMTA 4JLPA 3GLFA 3Q5DA 2IUSA 1W2GA 3DZ8A 2HLDD 2MMGA 3GQBA 5JCZA 4LOAA 1W1WA 1OKKA 4LHWA 4C3ZA 3GJ0A 5EE1A 3B9QA 4PZLA 1J8YF 2A5DA 5ELXA 4YMSA 1C4OA 5JWHA 1HTWA 2FG5A 2OCBA 3K70B 4MDEA 2D7CA 2IS2A 4TMKA 2J7KA 2QMOA 1PUJA 2RGNA 4TWZA 2ZJ5A 1Z6XA 3K9LA 1E2JA 3T1OA 4G5QA 2ZUCA 3GLHB 3OE7D 2UZ3A 2OCPA 3NC0C 3X1XA 4D0LB 2DFNA 5FPYA 3KB1A 3F8TA 2V54A 1FUUA 3F3YA 4M0LA 2EFHB 1E9AA 4HSEA 1N2CE 3CRMA 1L7VC 1KSHA 3LWNA 4JLMA 4E5UA 1I4LD 1DAKA 4Q4JA 5BN3A 5JSZA 2GF0A 1EFRD 1UBCA 3P1JA 5EE3A 2VIIA 4PQRA 4M9QA 2O8EA 2XITA 2EQBA 5L3SA 2JCSA 1M1YE 1TAGA 2PL3A 3BE4A 5F3WB 3K9NA 3CPJB 3D8BA 1W4RA 5TXGA 1G8PA 4ARZB 1IN5A 3AVUA 3ICEA 5G53C 5FL3A 4HDCA 1JAHA 4Y0VA 4F38A 2JA1A 4AKGA 4AKIA 4HLCA 1F2UB 1NN3A 2G1JA 3PUYA 4IJMA 4M2LA 2IXGA 4MUBA 2WWGA 5CIWA 4HUQB 4KFSA 3VAAA 4JVMA 4CEIA 1YZTA 4Q00A 3SR0A 3B1WA 1ZMXA 2CLSA 1UKVY 3HP1A 2J3EA 4F92B 3UG7A 2IUTA 5CM9C 4A0HA 2IYVA 2BJWA 2FU5C 5FTMA 4ZIRA 4N0DA 4QGAA 1NLZA 4W5WA 3RYTC 4A0RA 4NYIQ 2CL6X 2OFOA 4E09A 1RRCA 3MJHA 4LGMA 4TMWA 2OE2A 4PPNA 2CCJA 5JHHB 1IJFA 1Z6GA 5LPNA 4I4LA 1NI3A 3L0OA 3SBDA 4TYNA 5FPSA 2GBLC 1P3JA 1N6NA 1QHSA 2ERYA 1RYFA 1HA3A 2FPMA 4TMVA 4KVGA 3D3QA 4OK6A 4EKDA 3C7KA 2GZAA 2ZRPA 2CK3D 4MRSA 3REFA 3EPKA 3PCRB 1JPNA 2NO1A 3VQTA 3U7EB 1HEIA 1KDTA 3DMDA 1MR3F 4RD2A 5J4YA 1OB2A 1KAGA 2FSIA 3RRYA 3LBIA 3KQHA 3ZS8A 4QHTA 4MH0R 1YU9A 4ESHA 2ODWA 2D4HA 2JLYA 1WQ1R 1CEEA 3BS4A 4LHVA 1ANKA 2VLIA 4A2PA 4DDTA 2NO0A 4EPYA 3R9XA 1AS2A 1OFUX 3QBTA 4RD6A 4AK9A 2G1KA 4X8LA 3ZVRA 1GNQA 3QNUA 2WICA 2IL1A 4J0QA 2YC4C 3NXSA 5KYKA 3A1UA 5GADl 1XBTA 4OHZA 1CIPA 1W2HA 2OCAA 1BOFA 2GVZC 4A9AA 1N5LA 1A1VA 5FPKA 1NRJB 3I1FA 2ZROA 2ZRCA 1PJRA 4G5SA 2PX3A 3Q3JB 2RHMA 2B6HA 2QAGB 2IYQA 1GZSA 1W44A 3QE0A 3T35A 5EE9A 2JLXA 4MGYR 3QXXA 5BYKA 3ICQB 3GJ4A 2H5EA 2HT1A 4GP6A 3RLFA 4MRPA 5E7IA 2OZEA 2WKQA 4ZI3A 4GL2A 3T1TA 3OIYA 1FX0B 3ETLA 3EZ6A 1AGPA 5JECA 2QRZA 3VMFA 2KSQA 4LYHA 2ZRAA 4YXWD 1CJUC 3Q85A 1NLFA 3K09C 2ZS9A 4KAXA 1CR2A 3VTKA 4CGZA 2ZRLA 1KZGB 4KLZA 3C41J 3ZVLA 1LB1B 1MV5A 1GP2A 1HQCA 3LX8A 1K8RA 1XJCA 2QL6A 3RNLA 4M4SA 4WZAE 2PCLA 1NG1A 2JIZA 4CT5A 1Z6TA 2MSCB 4WZBE 2B8TA 2WAXA 1HT2E 3W6NA 1ONBA 2EWVA 5FH9A 5KDOA 3TKLA 1ZUHA 3CNOA 1RJ9A 2KBEA 4B71A 3LH5A 2EFDB 5B57C 821PA 5H8WA 1E96A 1KZ7B 5CB6A 4JT2A 2FEMA 5IDVA 5E7MA 1KSGA 3GJ7A 1X8KA 2CJWA 5JI3E 3B5JA 1DO0A 1E2EA 5FL7A 4NCKA 3K0CA 2N46A 1R8SA 1S3GA 4FXPA 2WIAA 1E9CA 2WWWA 5H70A 1GOTA 2V6IA 2ODEA 3GEEA 3LV8A 1KO7A 2W6JD 2YOFA 4HYYA 3EARA 2IT1A 1YE8A 2NO6A 1QBKC 3CH5A 5FI1B 2WSSD 4F4CA 4RZ3A 1Z47A 3PEYA 4CRWB 1EFUA 4MA4A 1G17A 4V0KA 1IN6A 2CCGA 1LW7A 3FMIA 1UF9A 4A8JB 4EFNA 4OJKA 3P20A 1F2TA 3D6TB 3N5CA 3ND8A 2GJ8A 2VH5R 2HJGA 1ZM9A 1Q21A 1Q20A 4XJXA 2DYKA 2ZRNA 3AKCA 3CRRA 1Y3AA 1J2JA 4US2R 4C2TA 3ZIAD 3KJGA 2QEQA 2RGNC 3IEVA 1IAQA 1Z6AA 2ZXUA 4LK2A 5A4JA 2F55A 3LLMA 1WCV1 2ZITA 1KI3A 1W0KD 1KI1A 3BC1A 2IYUA 3WMEA 1XD9A 2F3RA 3MFYA 2XJ9A 4GI7A 1ZM7A 3FKQA 4JL6A 1MO4A 3B2EA 4B3CA 2P2LA 2W6IA 2A7QA 3KXIA 3K70D 2DFLA 1E0AA 4P3YA 1W48A 5BN4A 2PH1A 3KXKA 1G20E 1JECA 2I4IA 1XRJA 4DCVA 1JEDA 3CW2A 3CONA 1U94A 2ZI4A 3TQFA 2GAOA 3WBKA 1N6KA 3U3RA 4II7A 1QHYA 1SQ5A 4N1AA 1KMQA 4KO8A 1Z2AA 4Q1EA 4LC0A 2O0HA 4MRNA 2IYTA 1A2BA 1KJWA 1W36C 1VCNA 3U7HB 2QTVB 4PANA 1XX6A 1J8MF 2VBCA 2XB4A 2DHRA 4RFVA 1N6LA 2WJJA 1TUIA 1GNRA 4ZDJA 4A36A 3R8FA 5DIFA 4YDHB 4F91B 1ZYUA 3K0AB 2CEAA 4MKIA 3KX2A 5E3HA 1TMKA 1WRBA 3U44B 2RGDA 1RRGA 1E32A 2ZSBA 4QM7A 3H0KA 2XEXA 4KLNA 4H1VA 3UWOA 1LFDB 2G9NA 2O8CA 3RAPR 1E79A 2QGNA 2IEZA 4JLDA 4FMCB 4PSVA 1VG9B 1G6HA 2GEVA 2OSBA 3CRQA 3THWA 3AVTA 1US8B 3FHOA 1W4CA 1J90A 2WHXA 3QSYA 4JSTA 4IDOA 2GDJA 3M4YA 2QP4A 4QBIA 1T91A 1U9IA 4B48A 2CNWD 4L15A 1YR8A 1P75A 3KTAB 3CF2A 3RANA 3SFZA 3LDAA 5FOTA 5H1YA 4OHYA 2C77A 4D4JA 5IK2D 2ZJBA 4HZIA 3U3JA 1SVMA 4D2IA 1RIFA 2ATVA 1HE1C 1JQLB 1NJFA 2FN4A 3CM0A 2IYWA 3SQXA 3EXAA 2O8FB 5JJIA 3ZDQA 1X3SA 1DE0A 3B1XA 5AUNB 1TL7C 5CDFE 1XTRA 4UXHA 4X8MA 5JJLA 1MRSA 4B6EA 2VO1A 1S8FA 4LWZA 4JL8A 4RVCA 4ZCMA 2O8DA 1UKEA 3B9PA 2Q3MA 5B30A 2R6DA 2CL0X 3A1WA 2G0TA 1D9ZA 1XCGB 3HJNA 2D06A 3B7GA 4QKQA 5JRZA 4XVUA 4HAVA 2QNRA 2WOOA 1FOEB 4HI0E 4CEHA 2NZ8A 3I5XA 1R0WA 3TJZA 4BQSA 3PUXA 4LV6A 5CB8A 5SZHB 4QG7A 5CYPA 2NO7A 2NOAA 3RWMB 2ZIAA 1GILA 1Q12A 4N0EA 3R8CA 4HZUA 2GXSA 2VSOA 4RJLA 4F4JA 1G4AE 3NBYC 1GFIA 2GWHA 1XZQA 2FWRA 1P9RA 2ANCA 1LVGA 4O2LA 4TLEA 3ADDA 4GPTA 2CLCX 5C1BA 4C0BA 1ZVQA 1VKJA 1JEEA 1P73A 2GNOA 2IA5A 3QVUA 1GSIA 3RS4A 1NL3A 2RGGA 4LJ6A 3EA0A 1F6BA 4AD8A 3A37A 2PZGA 4E22A 2IWRA 5SZIA 3B85A 3D7MA 2V6JA 1N6RA 4JS0A 5CJ2A 4B74A 4B73A 2CHGA 2J45A 1DO2A 3LXRA 3CNNA 2YWFA 3AF2A 2J59A 5DLQC 1LTQA 2JLUA 3WRXC 2VA8A 3A4LA 1E2DA 4ZCIA 2FFQA 1E69A 3R7WA 1IOZA 3DEFA 1BIFA 2QM8A 3PEUA 3P32A 1S2MA 3EASA 2C99A 2AKYA 1OFTA 2QU8A 4QC2A 4IOJA 3BB3A 2L0XA 3N70A 4CF7A 1W4BA 5J5CA 2C9OA 1OPXA 2ATXA 3OFND 5FBLB 1G8FA 5J4KA 2ORVA 3LW7A 5HKKD 1FW6A 4M9ZA 2H57A 3NWJA 3FGNA 3W8NA 2J0VA 2BM0A 1EX6A 4IEIA 4OK3A 1Q3HA 3OAAA 1E4YA 5SZJA 1PV4A 4OYHA 3GJXC 1OLOA 4UNQA 1TNDA 1KI2A 1UDXA 2JLZA 1K5GA 4DDVA 4LJ8A 3KJIA 2QZ4A 3K0CC 4WAUA 1II8B 4CIDA 3CR7A 2ZETA 2ZYWX 1XJ0A 2WWIA 4XSGA 2OEPA 1L8QA 1CRQA 3EX7C 1W0JA 1UDWA 1TX4B 2REXB 2WJVA 4HB0A 2YOGA 5AUQA 2QBYA 1KK0A 4ZKEA 1G64A 1SVSA 4B43A 4TL8A 2P6RA 1JNYA 1M8PA 3QF4A 4OQNA 3GJ3A 3GLFE 3MAAC 4Z8XA 3TBKA 3U4QA 1R2QA 2EVWX 2H17A 2XSZD 1QDEA 4AYXA 1EFTA 1F48A 1P72A 4C2UA 3JZMA 4HLQB 2XXAA 1AZTA 1IN4A 3C14C 3IO5A 3QI2A 2ZPTX 4Q01A 1OB5A 3IGFA 4PTLA 4HATA 1E9EA 4Q02A 4OI1A 4BLSA 3Q7QA 4K46A 3VR4A 4Q7LA 2QE7A 1UJ2A 1OT3A 4TQAA 4PAMA 2QENA 1P2TA 3PV0A 3IDQA 1U0LA 3LBNA 4B2IA 1Z0AA 2GJKA 3GP8A 3UWKA 1LV7A 1DAMA 3HYTA 2GILA 4B75A 3TSWA 4BLRA 4KITB 1RRPA 1T0JB 3X1ZA 4F7WA 3TVDA 1IONA 1RVDA 5GJCA 4MRVA 1M7GA 5D3MB 1XMIA 2WVJA 2YWGA 5TMPA 3GLFB 1CXZA 4DZZA 1NBME 4JT4A 1UAAA 5JJKA 4QFMA 4RCYA 3A1TA 4OQFA 2J7PD 1DAIA 3A1SA 1SVIA 3CZPA 4TYPA 2ANBA 4QBHA 1ZNZA 4YONB 2VP2A 4IDHA 4XWOA 3TSOA 2OAQ1 3RS0A 4ASUD 5FBVB 4O0MA 4PSKA 4BUJA 2F9LA 4D82A 3DOEA 2P3SA 4TZ0A 4D25A 4ZCLA 1QHNA 5G41A 3CR8A 4DUGD 1YJ5A 1CJTC 4IVPA 5P21A 4PZZA 3ZZ0A 5KUTA 4R98A 1W7AA 2Z83A 1T3LA 4NPHA 1SGWA 1AK2A 3BH7A 4ILEA 2F3TA 2IHYA 2RAPA 3LXXA 4KV9A 4Q9KA 3B82A 2NZJA 2VP9A 3CPHA 3FDIA 4JLOA 4RKFA 4Q4JB 1JR3D 3OIVA 5EXSA 4C30A 1Z6YA 3JVUA 1Q1ZA 2WWXA 5BYJA 4AG6A 2O8EB 1SVOA 1EGAA 2W2XA 2AHOA 3SU8A 3IIJA 5FUVA 4XOIA 5FOXA 3RS2A 1G3MA 121PA 1BMFD 3PG5A 1AGRA 1G5TA 2BJVA 3U6KA 2OAP1 4A6XA 5DE3A 2VEDA 4MGZR 2WJHA 3VX4A 1U9IC 4CEJA 3P27A 3LAWA 3KJEA 4WBSA 1W36B 2DWPA 1KK1A 4C0AC
chains in the Genus database with same CATH superfamily
1QFZA 2QMUA 2QZZA 3UA3A 1LBHA 3Q41A 1UC4B 4HAYA 4QU8A 3A9RA 1IPEA 4RGQA 4ZGBA 4U63A 5KUTA 1OF1A 1UFOA 3N8HA 1RZRD 3COPA 1SUCA 5TY0A 3EEYA 1BCSB 3D3JA 4BRZA 1E2KA 3KYDB 3N7UA 10MHA 3OFVA 2CE2X 1IRIA 3OZDA 3GLTA 4BVAA 1G8MA 1PGNA 2CLLB 4OXNA 4EBFA 1NA5A 1AV7A 1MC8A 2G9ZA 1UR5A 1JDVA 1ODKA 1CZHA 5THQA 4FEYA 4URWR 2E5WA 2Q8NA 3E0XA 3HB7A 1JVNA 3H2IA 1H2EA 2YNMD 4RJIA 2VCYA 2XYQA 1XRRA 4CV1A 1DJLA 1WXDA 1WP4A 2QJWA 3OHPA 1M0EA 1NW6A 2IYYA 3QPCA 3I8SA 5GONB 1WKBA 3LCVB 4OUDB 2H1WA 3BQMB 5FKJA 5A3SA 3PEWA 1LDYA 3JQ8A 1H2WA 1DC4A 3DE5X 3ZZUA 1RM0A 2VDJA 3HCWA 4MMXB 1CRPA 5IM5A 1RQGA 4IDEA 4NZ9A 5K1ZA 3RBVA 3RKRA 3GBSA 3N2EA 1HH4A 3ROQA 3PTZA 3O1HB 2PDAA 3IBFA 3EZ2A 2VUTA 2X5XA 5CHYA 3JAWB 1DRVA 2ZWVA 4FZ3A 4IJ5A 4P83A 3H5RA 5EMJA 3U9LA 2B8WA 1CY8A 2HXYA 3LK6A 3V48A 3VPHA 4A03A 3DG9A 2VZEA 2YFQA 1QYVA 4W5TA 3CZ4A 2C1XA 3NAQA 1QG0A 2JNWA 4IZOA 1CSEE 2CLFB 5EIEA 1SU6A 3L7BA 4X54A 1OXTA 2HPAA 4UXIA 3V97A 2IDKA 3G7SA 1NDHA 1A5ZA 3NIGB 1ISRA 1E1RA 5AM5A 4AG3A 2OHFA 2W2VA 5AVZA 1T2VA 3LUHA 1FPMA 4D9BA 1ZP6A 2RB5A 4GHWA 4TV9B 5LKAA 3LHSA 5DLEA 2V7VA 1II9A 3U7JA 5F4BA 5C2JB 3NYRA 4S1TA 1CNEA 1Y9JA 1G5FA 1ZIPA 4MWGA 3PFGA 1JA1A 4IGEA 3DQPA 3OESA 1YZNA 1LV8A 2AG8A 4LTMA 4RHEA 4MB6A 4QNNA 1N9GB 3AZOA 2QVYX 3WMXA 2GM5A 1NJGA 5HVNA 3RF7A 4F9GA 1F8FA 3NOOA 1MJHA 2R8EA 3ADCA 1TEVA 4J7AA 1DBWA 1FFXA 1ZRSA 1ZUD1 1P7CA 1HRKA 1QQTA 2IXTA 3F6PA 2BEJA 4NK5A 5JNSA 2IY7A 2GXAA 2JFGA 3CVOA 3JASA 2QGZA 5GQSA 1R5NA 3VR3A 3ZPXA 4A6PA 5KBYA 3GEDA 1DQNA 3R20A 5KTNA 4XH9B 3UJPA 3A6GA 4MO2A 3ZLUA 2MHCA 3BVPA 4PYLA 4YT8A 5H83A 1ZAYA 3Q3EA 4RA9A 5DKFA 5ERGB 4M7WA 4OO3A 3DFMA 5HE9A 16PKA 1SCUA 1ZK2A 2B78A 4TYMA 3V5NA 4DA8A 3PP8A 4JVNA 4CM9A 4CWAA 4PX5A 4QYSA 2GPYA 3SR4A 4MR9B 3L9WA 2O52A 3AKEA 3PEEA 3KBOA 1UK8A 1XO1A 2A88A 2VDWB 4MCJA 4QVGA 2IZ1A 3V7YA 1OBFO 1U80A 1GQSA 3L84A 5LDDC 1G55A 2FF5A 4IIYA 3E1GA 3DE7X 2IW3A 4MSUA 1EE9A 3B3FA 3NT4A 2E4XA 5ADUS 2PVPA 1M1ZA 3BSFA 5KYUB 4ML3A 3QE3A 4OHWA 3I01A 5BOVA 2P30A 1K6EA 3SXPA 4HFNA 3A04A 1V4NA 3LUAA 4E4TA 2D13A 2VHTA 3SOPA 3UICA 5JJBA 1UJBA 4MINA 3N0XA 5JEDA 1BX1A 1C4XA 2G04A 3AWIA 4LGCA 1N2XA 1AXEA 3TLZA 4L02A 2JRCA 1RJ9B 5KWJA 1DTSA 3L93A 5L6LB 4C0KA 2ZM6B 2VYVA 1E1QA 3PPIA 4FYPA 4QOFA 1ADGA 3RU9A 4MS3B 4ZMBA 1XQ6A 3DPIA 1JPJA 1NX6A 3AVQA 1G9XA 2HLHA 3E5HA 3E9MA 2O0MA 3FCSB 3HRHA 4BBPA 1OXXK 3FPAA 1U7XA 2Q2VA 3FDJA 5A0FA 1OXBB 4M37A 4NZNA 2WAMA 5DHAA 3ET4A 3X1YA 1U8TA 1T8YA 1WQ3A 2WQZA 1OX6A 4ZRNA 5J1TB 3VR6A 4B46A 1RAGA 4U2BA 2RGXA 4C03A 4O4HF 3P2KA 1M73E 5JAOA 2EFJA 1MRZA 1Z3IX 2Z43A 2YHIB 4I1SA 4OMCA 3D59A 2QVCA 3R0XA 4ND6A 3LY8A 2Q46A 4AJNA 3IOCA 4TS1A 3RAFC 3BREA 2O50A 5I3CA 4YDRA 4S0ZA 3R23A 2JEOA 4CFSA 1SEVA 4E31A 3OT4A 1JLRA 3ISTA 1OWPA 1XDGA 2PS0A 4ZTUB 1S9DA 1ECBA 4I99A 1RWVA 1JEAA 2AH5A 5CVTA 1YU6A 3IFSA 1HDOA 5KNCH 4OMFG 2XTJA 3WTCA 1UADA 2NXJA 1OA1A 5I7WA 3VJKA 4I55A 3ZX4A 3SF0A 3RT1A 1G4UR 5BURA 3KT0A 4HEA6 4JI5B 1Z0JA 3SVTA 1CE8B 1JI3A 1GYRA 3ZDXB 4W5OA 4Q39A 5E2BA 2HDNB 2W37A 3U39A 2D1YA 1QK3A 3JYOA 2C2HA 1WY7A 1WR8A 4F8YA 1MEOA 3WMGA 1CRLA 2XCIA 4ROSA 2YMPA 1LPBB 4P5DA 4RF4A 4MYRA 1TAHA 3QY0A 3F3SA 2LE0A 4JZKA 1VRCA 2W8BB 3FYUA 2OAEA 3JWGA 3KWJA 2WI8A 1N2HA 3DL4A 1J42A 1XXHE 4KYTA 4TM8A 4MRRA 2O14A 4Z99A 3UMCA 1OX5A 1Z4OA 5HMLA 1O0CA 1GUAA 1HFWA 5HW0A 3M2TA 4NYJQ 3PWKA 3IAS1 5T67A 1E3WB 2EFYA 1V0JA 1CY4A 1YHNA 2IVZA 2UUOA 3SMQA 2Q5FA 5HQ3B 9MHTA 4LVNA 3KYIB 1U9CA 3HKBB 1K4YA 2Q1XA 1PG5A 2JATA 3FY4A 1NM5A 1ZC3A 1NNUA 3QNMA 3VR2A 2H31A 4OA5A 1ZH8A 3U62A 2Z0MA 4HLUA 5KJ1A 1XSEA 2C8VA 4JQOA 1NSTA 3OOHA 3CBQA 3PDHA 1GLGA 2Y1CA 5TC4A 4TL9A 3SYKA 1R0CA 3KVNA 1EE2A 1I36A 4X71A 1XXHB 3OZXA 1E3MA 4WESB 5JXGA 1W88A 1Q57A 2BP7A 5AVOA 4D9IA 4NL4H 1AURA 1BYIA 3GJZA 1TYZA 3N7AA 2E1RA 1UH5A 4Q7MB 4J0CA 2Z58A 4DVJA 1KYZA 2VKQA 2PD6A 2RG7A 1DNPA 4PLZA 5JSQA 4YRAA 1N7HA 1UEIA 1WULS 2IZ6A 3HDVA 3N2GA 3TQCA 1KMHB 3UHFA 3ZE9A 1FLDA 2B34A 3F96A 3LIPA 3X2SA 4FNGA 1SULA 1FLVA 2AZDA 4O5AA 1PD1A 4OAOA 4Z9AA 4GH5A 1Y3HA 2BMJA 4Y6GB 2IYZA 2YL2A 1SOWA 4R31A 1T5TA 1ZK1A 2I3ZA 3N0VA 3R7FA 2E21A 3MGBA 4R3WA 5HGJA 3BTSA 2B0CA 1TA4A 2I3BA 3PX7A 1N34B 2P5YA 1R6UA 3TLCA 4FS3A 1OZ0A 4BVJA 4WTOA 1DKMA 2KJQA 4KVZA 4K5QA 5CTJA 3VNBA 3ZZNA 3QK7A 3VKWA 3CLHA 1F2DA 2E1PA 4OSPA 4AX4A 5AW8A 4CIWA 4S04A 1IY2A 1PE0A 1X7XA 4BGVA 2QPTA 3TSYA 2R65A 1ZD4A 1O96B 2NYRA 1DJQA 4G86A 4UPVA 3WLOA 1VBKA 4D5EA 1VYUA 4DB4A 3M6LA 2Y27A 3UWDA 2O8DB 2CZGA 4JI0B 4P38A 4KNWA 4KW7A 4YUZA 5AVSA 4M87A 4HDOB 4P7BA 2VBIA 3DHVA 1KFBB 4WRRA 3EPHA 1F0PA 1KDVA 4B81A 4EF5A 5FOSA 3L0ZA 4DZTA 2JFQA 4N76A 2XMCA 1ZMBA 4CQMB 4REQA 3O9VA 4WVLA 4XSVA 3FFBA 1BOOA 3LP5A 3OU6A 4Z8YA 5A0TA 3EK2A 1OFIA 1BS9A 1NIJA 2R84A 3I4LA 4MQEB 2DLDA 1SZDA 5J40A 2KS6A 4GPAA 1T8WA 1CD5A 3MS4A 2AR7A 5FF9A 3AGQA 1I7QB 1O8BA 1VLZA 3A36A 3ED1A 2WHRA 3GFQA 3JZIA 1KC1A 1T4BA 1V1RB 1NXSA 3DW3X 3FNBA 4YJFB 1WZNA 4JLBA 4HZUB 2ZBGA 1WPRA 3ZLTA 1BX3A 3ND7A 4FSXA 1WMSA 1IOWA 2OV3A 3CX6A 3DEJA 1VI2A 4JSYA 5EIOA 2GZRA 4Q4CA 4O1IA 5EZ6B 1Z29A 1F2UA 2H48A 3ABZA 1KFKB 3ONNA 4EELA 5JARA 2C7BA 2ISSD 1GGHA 3CEHA 4GZ3A 1DFIA 5LZ4A 2HT6A 5ALJA 1AQYA 4ISBA 3LQ1A 1E3SA 4BNTA 1ZCFA 2Q5HA 2CMFA 4MI9A 3Q6IA 1H1LB 1ESMA 2JBAA 4WH0A 1WHSB 3MXTA 3QU5A 3FUCA 2FF7A 1WDMA 2PL1A 3G2NA 4YALA 4B4UA 4BRSA 4EQZA 2QU7A 4TMFA 4TTQA 1KH1A 4HN4B 3FPBA 2I03A 4LC1A 2WVHA 1PKXA 3KSRA 5CCXA 5C8DA 3EYWA 3BCSA 3J81k 3TMYA 5AJUA 3C1AA 2FUCA 2XY4A 3NDRA 3O26A 1U98A 3QPVA 4AS1A 2WU3A 5FUBA 4UTRA 1N3LA 3EWAA 2C9BA 1B2RA 4OFWA 4IXNA 1GN8A 2HA4A 5JROA 2AF4C 2J1LA 3F8SA 4XPIB 1RWMA 2GZ2A 2WTXA 4J07A 1XHEA 1YL5A 4WXEA 3TG8A 1RIIA 2AOUB 3H1EA 2P7IA 4GGMX 1IVSA 3AR7A 3L8MA 1WHTA 1NFRA 1QOQB 3AR8A 4ZALA 5F76A 5CLJA 2ORIA 4HDKB 4JR2A 2J0QA 2FOIA 2PUHA 4ZVTA 1GTMA 3T99A 4X1KB 2XE7A 1NNSA 4ZI5A 5JR3A 2HMUA 1YQGA 2ZYUX 2CJXA 2Z98A 3PHGA 3AIOA 4J90A 3PI7A 2VZLA 1MDFA 2VJMA 4QDOA 2JJ2D 4R05A 3LPCA 3BWVA 4RY2A 3D6FA 3IQEA 1T6NA 5K6RA 4TUYF 5CURA 1KNQA 1XDDA 4DLWA 1I2MA 1TU0A 4GBJA 3VAYA 3M1LA 3PXGA 5DW0A 4G0UA 4CFZA 3R9WA 2VP5A 3JYNA 1OYWA 1IBKB 3VV2A 1FVHA 1CJMA 3DVQX 1OMOA 3QXHA 2FW6A 5LA6B 1EFHA 4OYRA 3O8NA 3T3EA 5KTTA 1Z5ZA 1SWWA 1Z5NA 3O73A 2UVPB 4FZRA 4ZKDA 6ADHA 1Y0BA 2BM9A 2O2GA 2P4SA 2CUZA 2KW5A 5F1KA 3FOEC 2B25A 3BCRA 3N1UA 4ND8A 4U8HA 3T3DA 1AUXA 1VE7A 2FSHA 3URKA 3VKVA 4MYHA 1XMQB 5EJIA 5C81A 1ATIA 2AG0A 4MVJG 5C34B 1FDOA 5CM2Z 2WABA 2O4CA 4MUJA 3KJFA 3S7ZA 3ICOA 4IIJB 4WFQA 5UKDA 2XLBA 4WCDA 3EEIA 1GGNA 4X7MA 2AJDA 4A82A 2RAFA 3EAQA 3NBKA 2HXGA 2YV2A 5AW6A 2ZB8A 3IA7A 5CVUA 1M8KA 5LB4A 1TYBE 3SJBA 4EHJA 3W78A 2G77B 1MOQA 1H69A 4RLSA 1NZFA 1OFUA 2IV7A 5DHQA 3PJRA 2AZMA 3GJSA 4S2EA 4U7DA 2XGGA 1RQXA 1X1QA 2B7BA 2ZKIA 1LBSA 1HDIA 5AVRA 1KERA 1JBEA 2GM4A 2MR5A 4TWAA 3HJGA 2B1QA 3C0KA 2R7LA 3B2QA 4LE1A 1TC2A 4QBFA 3HFJA 4QOJA 1CBUA 3T95A 3WKEA 5CFPA 3I8XA 4BKOA 2GAFA 2CKMA 1OZAA 3ED5A 4GR9A 1QMPA 5AHKA 3WX0A 1PP4A 4ACAA 1LBEA 4Z2YA 4CCAA 4CKBA 1FJ2A 5FDFA 3G5LA 1XQXA 3HC7A 4EA6A 4LF5B 4QUEA 3UOWA 4WLVA 3RRNA 4CQLB 1RS0A 2YRXA 4CBVA 1J0CA 3EVAA 4ZFNA 4JXXA 1OX4B 2BFBB 2NVUA 4MWOA 4ECEA 1JKXA 4R71A 3BK2A 3C2QA 4G1CA 4PNPA 1THMA 2R751 4S0XA 4FHGA 4FT2A 4UBJA 5KC9A 4ZO9A 4IUCS 3KS9A 3RGWS 4L2IA 2C29D 3M4XA 1TU3A 1L5YA 4RKQA 1JG1A 4RSMA 1VHDA 3H0CA 5J2TB 3GCGA 1X1SA 3W8DA 3ZYCA 5CXQA 4RW0A 2ASVA 3ZDQA 1DRWA 2ZAIA 1XU7A 1YQXA 3JZDA 5DVZA 4K9QA 5ER6A 3T4UA 1XK7A 1CULC 1X74A 3GDWA 4XYEA 2TMKA 2AYZA 1NRIA 1QKJA 4JROA 4EPWA 3RUPA 5C5EA 3ONWA 4P22A 4GD3Q 4AY5A 4DLSA 1WPGA 1KGDA 1RTKA 1BW9A 1VQ1A 5AK3A 5K4AA 4KMRA 2FETA 3F46A 3HUDA 4UM5A 1LVUA 4WZAA 5KDDA 3CT6A 2BH2A 4BFXA 2WD8A 1P5ZB 3THWA 3JQQA 1G6OA 4KQ1A 4EW3A 2Z6QA 2P2SA 1KYIA 4EA7A 1NDUA 1S0UA 1N32B 2PT7A 2FWPA 3V2IA 1NF2A 3FNIA 5IF3A 1VMKA 4DDUA 4ZOCA 5F7JA 4LJAA 1Z38A 1B7GO 1JJBA 3HEBA 3SF8B 4CF4A 4Q7KA 2E49A 1W6RA 2PLAA 3G17A 3UJBA 5ANRB 4A8JA 3KJZA 4R0NA 5EGSA 1R0SA 4V2IA 4GBED 4MAAA 4XW2A 4YB8A 1B93A 2QX6A 3OCUA 2XUAA 3F6CA 3S44A 2W22A 3H4VA 4LHYA 2W11A 1BROA 1G291 4YA6A 3E84A 1JU3A 3G88A 3HVHA 4EOGA 2OUIA 2W93A 5HK9A 1S96A 2P67A 1I5OA 1X80B 3IB6A 4DT1A 2ZXFA 3ABSB 1N2BA 4CT4B 3PPYA 1IHYA 1G8YA 2R2AA 4Y67A 3UKDA 5A1TA 1L8OA 1TUGA 1USKA 2DPLA 3QWIA 2YY7A 2BR5A 4N8SA 3TIIA 5JD6A 1RKVA 3LRPA 3KD2A 4KXQA 5CDGA 3BGIA 2H2WA 3KT3A 5CBPA 4V1CA 3FTNA 4R6WA 4WMLA 4WW0A 4R1PA 1EEXB 1O9HA 5EE0A 2VSFA 4UDYX 3A28A 2C7PA 4QYIB 2OV1A 1R3UA 3AKDA 1YK0A 5KU7A 1I01A 4FFLA 2F43A 4MDHA 2AUTA 3ETHA 1VLHA 4L0MA 4U02A 2C3PA 4D4MA 4Y2UA 3BXGA 3EZNA 4ABTA 3QUCA 2AQ8A 2RBGA 1U7HA 3PFHA 5TQ2A 3T9EA 3ZW9A 5LLDA 1TT5A 4OX9B 3NPAA 4JYZA 4PV7A 4CGZA 4XX0A 4V0SA 4YI3A 2QMQA 3NTOA 5IAEA 4F3YA 4MP6A 2LKCA 2HK7A 4UXJA 2OVFA 1PEYA 2COUA 3EVGA 4IMRA 2P9GA 4ZVSA 1DJPA 1QBGA 4EB6B 2II6A 3W1WA 3IQFA 2CBXA 2J3IA 1O4WA 3BILA 4LXQA 6REQA 5J4HA 1JJ7A 1C1DA 1U6KA 2DCMA 3I83A 3TAXA 1GJRA 5ICCA 5K0SA 3E1KA 2I6FA 3N0RA 3CX7A 4OCZA 3KVOA 2ZI3A 2R7AA 2IE8A 4L27A 4QTYA 2GHTA 1CKEA 3OZCA 2PMKA 1UWVA 4I1IA 1L9XA 2ZK7A 1DHTA 3IAEA 3WKDA 1FYXA 2NSDA 2HF7A 2IYNA 1Z5WA 1X1EA 4QHYA 3TQOA 4LPKA 3TTXA 3MRSA 2JFYA 2KB0A 2NV6A 3IVXA 4FCTA 5DK6A 1M1UA 3RJTA 1Q7TA 3VDMA 5A5VA 5JS7A 2DM6A 2O1EA 1K3FA 3MJDA 2GK7A 4BN5A 4CMGA 4ZHSA 3KUCA 3RJ5A 3UJ9A 1Y6JA 4E14A 2FN8A 3TNFA 3ZHSA 4EA8A 4U7FA 4X95A 5EP2A 3WWDA 3HKDB 5CLFA 3FB1A 2XT9A 3I4FA 5A0VA 2QS9A 4IP0A 4KQJA 4NARA 1BU8A 4HNAA 2DKNA 3BH0A 4RHTA 4ZT6A 1ODJA 5CYFA 1NXXA 1QRSA 1A7UA 1YR2A 2JFUA 2UDPA 5K0BA 3TW4A 4C2BA 2X13A 5LYJF 3HZHA 1U2GA 2F1RA 4DGQA 3NUZA 1E77A 1GL3A 4I50A 2KBFA 2HMSA 4R2WA 1VDMA 2N1BA 4Q93A 1CQIA 1T1SA 4WOCA 5DNUA 1HZZC 3N9IA 1M1XB 5MFPA 2Y8EA 2IY8A 5E6UB 3CNLA 2NU8B 2C95A 3DMYA 3M5WA 4TVSA 4DRXB 3RTEA 4E08A 3LF2A 3WHPA 2ZUDA 4ZVMA 2NPFA 5B58C 2EX0A 5ECDA 1Z4QA 2EP5A 2QD1A 3REGA 3CGWA 5JSZB 1UMDA 4S1WA 3TOSA 5D86A 2W90A 1BKDR 1U3CA 1U90A 3U48A 2BR3A 4FK8A 1DELA 1N6HA 1VYHA 4PPFA 1SU4A 5B12A 4ALNA 1WP9A 3FETA 4L6IA 2F8TA 2QY6A 1EINA 4K6MA 2NV0A 1JWBB 3BERA 2W00A 3IT1A 3OMXA 1TVMA 4MEJA 3AF0A 3MTAA 1BDBA 1H8EA 1MAUA 4QNRA 3OD5A 1I2DA 2V6FA 3DUFB 3FR7A 3JU3A 3OKPA 5KSPA 3KAQA 3BE8A 5JXIA 3PNVA 5KWVA 2ECKA 4O4HB 1QH1B 1A9OA 4YDSA 3WV4A 3ZV6A 3IT0A 3L8EA 2ZJ0A 3HSKA 5GGYA 5E3IA 2PUWA 2WUEA 3T06B 2W6OA 3FHLA 4AZTA 1INLA 1K7XB 3Q6MA 5MDHA 4E07A 2HEIA 4G1FA 3WK9A 4PQFA 3PHHA 3MWJA 5KWEA 3Q4GA 4NCBA 3GJTA 5FI0B 1E64A 1E5TA 2GM3A 3O8QA 1WLYA 1G2IA 2ECOA 2BF7A 4KVFA 2OO5A 4I1OA 1E1YA 3IJRA 3QY9A 1ENZA 1MCZA 1ZM3A 4X00A 2ZSDA 1TYEB 2DZDA 3CB4A 4F45A 1NMSA 2QW8A 4FB5A 4NCAA 1V7QA 4OKSA 2BFOA 4BC1A 2GCOB 2ZSJA 5K3CA 4QQ8A 3WGLA 3KK0A 5I8WA 2HBRA 2QRNA 1G8GA 3LHIA 1F5NA 4I4IA 2J87A 4TWRA 4BNMA 3GT7A 1JFVA 4WCFA 4DWOA 1RR6A 3AMVA 2WUVA 3ZZMA 2O3SA 4QASA 3H6HA 1PL7A 4FLEA 2N47A 5JD4A 4DNXA 2OR3A 1QNLA 3I32A 3IP9A 2O2DA 3I72A 2JFNA 3TEFA 3JQ7A 3V8QA 3ZHQA 4M89A 1B3BA 1C9EA 1U8YA 3FDFA 4RTNA 3DEKA 3P9RA 4V0NA 5SICE 1EQAA 5I9IA 1G8KA 4OY3A 2F8MA 2C04A 3IP5A 3FOAA 4Y0NA 5CFZA 1SA0B 2OHXA 2W5UA 5FTKA 3SK0A 3LYAA 1THTA 2WMNB 2VNAA 4WDRA 1IMJA 5AOVA 2HHLA 1SXIA 2C42A 2GI4A 3LOUA 1E1KA 4A0QA 1DC7A 1LNZA 3EZYA 1RACA 3AP2A 1GPMA 4JB8A 2X5NA 3HDTA 3PQFA 3QKWA 3AHEA 5B2ZA 4OHPA 2ZJ6A 2VJQA 1BXZA 1J6UA 1ABEA 3GVXA 4NZZA 4OVKA 4QXRA 2CHEA 1ODFA 5LD2C 1Z83A 1L7OA 3AXSA 3ENQA 4WXMA 2Y3IA 4YRFA 4J4BA 4ZEWA 1XTZA 1E4OA 1B3RA 2FQYA 3O2JA 1QGDA 1GTJ1 3KOXA 2VCEA 5JBIA 1PNQA 2IHZA 3I45A 3F7NA 4MGHA 2D1SA 1L5OA 1NI4B 2H8KA 4KQMA 3ASUA 4R54A 3ZE0B 1UOOA 2JGJA 3O4IA 1QNFA 2HSJA 5C1IA 1UDBA 1P2SA 1K4MA 1N5JA 3H2KA 4WNYA 2N9UA 2NNLD 5ARBA 3NHYA 3FCYA 3U5TA 2QR5A 3CUSA 1PWZA 3KU1A 1RTTA 5D51S 1CUAA 5EJAA 2NP6A 1M0SA 2JIPA 2PBRA 1N4DA 3N53A 2IZ7A 2W2NA 2CGEA 2XWBF 3L8ZA 4TX1A 1QYRA 4NZOA 5FA8A 2Y6VA 3GMDA 3PUVA 1I9GA 3OCVA 1RCTE 3R7BA 4DCGA 5EIAA 1SPXA 4BVHA 4Z54A 5KNCA 3AJDA 1QOPB 1SCBA 3F5QA 4JVLA 1EYZA 1NBAA 2C3MA 1QC5B 2GR9A 2QQEA 4URZR 3ETCA 3QM1A 2OFXA 4W9NC 1DBSA 3K1AB 5ED0A 4X64B 2OGTA 1CS0A 3E7DA 5EY5B 4AJKA 2R6R1 3VTAA 4NK4A 3HB4X 4L8YA 1K97A 1IXRC 4C22A 1VGQA 2VUUA 1QTNA 3S2EA 4UULA 3WGZA 3AONB 4EH1A 5BUCA 3BMOB 2NVBA 4HPWA 4J0IA 1DKLA 2ZE8A 1E99A 1B23P 2H2DA 2WUWE 3QVGB 3H8VA 4DM7A 5KJCA 2R1ZA 3PE4A 3ZD6A 2GAJA 3ZNNA 2PGNA 2VNIA 1IOLA 4LRSB 2UZAA 1XNJA 1PBNA 1M2HA 5ESWA 2FN7A 1PK7A 5JD3A 3DDNA 4DXAA 4HNTA 1OYYA 4IOMA 1O97D 4PNZA 1KOLA 1NNEA 3HVIA 2O2YA 2TMYA 4R41A 3CVYA 3ZNPA 3CNEA 5AKYA 3P9QA 4EWLA 8AT1A 5FWYB 5AW7A 3RC3A 3FNEA 2BL4A 5HOQA 4X60A 2IP1A 2UUAB 1X7WB 3HE3A 3LKDA 4K9OA 1FRFS 1NWHA 2F3SA 5IEBA 2LNDA 3D2CA 3AEQA 3HBNA 1XR3A 4JLJA 3MOIA 2PIDA 4MR7A 4WA7A 1OZGA 1DG3A 5FNZA 2IIBA 3ZW8A 1V41E 1Z7EA 3GUYA 2XQIA 3B20A 5DTRA 4GT1A 2FE4A 3C3YA 4EHBA 3NHWA 1RZUA 1DUVG 1RHMA 2BGIA 1VOTA 4ZQIA 4Z9BA 1HT0A 3UPUA 3HKEA 4XLTA 5F2KA 3GP3A 3TCNA 2WHPA 1JLSA 1XEWY 4CIXA 2FYTA 3I6BA 4CM3A 3C3DA 4JUFA 1RYMA 2G0AA 2JPDA 3S27A 2FUNB 4P4SA 4PGHA 3L4KA 2B2XA 2ZS7A 3VPBA 2FPIB 2RGEA 1SD1A 2ZANA 4R9RA 5KX5B 2CUTA 4RMJA 5JFTA 1FP6A 4RGBA 2WMOB 1JXOA 1Y8RA 1NMZA 3DL0A 5FO1A 1VL5A 3K2QA 3U4DA 4DNOA 1R10A 4OJYA 1V16A 5EVCA 3WAGA 3HXLA 3W6OA 3H2JA 3O8CA 4MI1A 1B6GA 2JD2A 2V3WA 2BMVA 4A0FA 3PQDA 2ZQYA 1ZGAA 8ADHA 5G0UA 3WLHA 3CO5A 3QLVC 2HMYB 3KYJB 4FFRA 3G9ZA 1AS3A 1FUYB 1XRSB 4OLFA 4TMYA 5DM0A 1NWCA 3EDQA 3IHLA 3ORQA 1TQ4A 2DUUA 2R3SA 3PJEA 4XI9A 2Q3LA 2DWQA 2ZUSA 1SJ9A 1HE5A 3B7WA 3LSTA 2OZLA 1ISIA 4KO3S 4XCVA 3W34A 1SKAA 3IJPA 4BFYA 2NG1A 4C78A 3WY9A 3U1TA 3PDJA 3UPDA 4P92A 1NLMA 4QUGA 2P68A 2CXPA 2G3YA 4EGSA 3ETEA 2IZOA 3JQGB 5H81A 4DLAA 5AKZA 1G5QA 1P1CA 1UKYA 1Z34A 3D2BA 4DCUA 3MT0A 4PNHA 1O95C 4ZVRA 2VQ6A 1HL7A 3BG5A 3IKLA 4BCCA 3SBEA 1PGPA 2G1PA 2AKAB 1WVIA 3GZNB 2EU8A 5BORA 2IDZA 3NDPA 5FADA 2QRVB 1GG8A 5E1DA 4K1XA 3LLCA 5D84A 1C1XB 1G8JA 2OLJA 4H15A 4MGEA 4XXHA 3T7TA 2QN9A 4MGKR 2VF5X 2C98A 1KXJA 3UUWA 4EPXA 1X9HA 5FOVA 5EZYA 5GINE 3ZVNA 3R0QA 2OECA 2RSLA 1AB5A 1T13A 2FSUA 1PQWA 2FMXA 1UZLA 4BMCA 2C96A 1UBTS 5EUQB 2IHJA 4JJ7A 1QIGA 2O8CB 5CHEA 1Z82A 4CNBA 1N2JA 3CF0A 3UFXB 4G63A 1Z0ZA 3T1QA 3WRYA 4FWBA 3JARA 3NRJA 3QVVA 1TYCA 1YFLA 4XGNA 2AEFA 5U4XA 1FMJA 3WLPA 4XASA 1CY1A 1E9VA 1JSXA 4P31A 5TSDA 5TQ0A 3U26A 4E30A 4EZBA 1RFLA 1BGWA 2ODTX 2HJWA 3QU2A 4JYMA 4LDPA 3TRIA 5IN4A 3WYFA 2L69A 1EUDA 4M0FA 4PX3A 3KKEA 3BIFA 4QATA 1UFRA 4LMBA 1UWCA 4IVRA 1M2EA 1AKYA 1K6MA 1VDZA 1ZSNA 4UU7A 3VPAA 4D80A 5L9AA 1BS1A 4ZCTA 3HU5A 1E7MA 1GAJA 2AD5A 3GD7A 3F7TA 4CR6A 3AW9A 3AF6A 4EJSC 1A82A 2WJWA 2GCGA 1QO0D 1SU8A 3WLSA 3FWPA 3I34X 3PT9A 4B3FX 3G9XA 5B5SA 3B13B 4O2AF 4GQAA 3S1AB 1PLLA 1Y4ZA 5LDHA 2XF2A 3T1VA 1SNYA 3UJ7A 3GLHA 4YUVA 1HSZA 4B83A 1SM4A 2J31A 4RGYA 4YMWA 2I2BA 1T8SA 2G83A 5HCNA 2XJ4A 4FI3F 2GAAA 3P97A 5IT5A 3OLYA 2DFKB 4J7XA 2VAWA 3ELBA 3G1TA 4D8WA 3GFFA 4KWEA 2OBLA 3CXUA 3GCDA 2J9RA 3AT1A 3BAFA 3N2ZB 3BZBA 4MVJI 3ZVKA 1LDMA 1OH6A 4MHSA 1SUWA 1UKAA 1CHNA 2JVIA 4ZVLA 1JB1A 1S2NA 4Z51A 3LXUX 4E3ZA 4MEBA 3RODA 4L5BA 4L9RA 2JJ2A 4M83A 3ZDCA 4EG7A 4YUWA 4ON9A 4X65B 4L0QA 3JXEA 1XWIA 1N92A 2BGJA 4IX1A 4D0RA 1EBUA 1SWVA 2KLHA 3DKKA 1WUYA 3TB6A 5ESRA 1ICEA 3MM4A 4X1OA 4PM4A 3K9BA 3RHZA 2X7JA 3HI4A 5T6MA 1X3LA 4KXXA 1LJUA 1N1GA 2F48A 3DS8A 2B99A 5DYGA 3RC8A 2GN9A 1O94D 4Q9JA 1AKQA 2JLSA 4XVQA 1Y9AA 3TD6A 2VRNA 1J70A 1GLVA 1W29A 2IX9A 3MWFA 4OFBA 1QO7A 1R5BA 1P1JA 4G9BA 1WABA 3X2FA 2Y1DA 1KYVA 1LRKA 1R5OA 3DOJA 1J2YA 1EWYA 1UBRS 2FLKA 5F1OA 5K0EA 1DU4A 2DH6A 2EKDA 4ZJZA 4HUTA 3KQNA 1Q1QA 1VCIA 5AKIA 5BV8A 1NVFA 2HU7A 2YINC 2YCBA 1FX1A 4KXUA 2NSJA 2VHQA 3GK3A 3KEOA 2CHVA 4KZKA 1UPTA 5C8VA 2HD4A 4ZCQA 4KEAA 2ZRGA 2W6CX 1T1RA 1USWA 3OEHD 2W6PA 2QV7A 5BSRA 3EA5A 3H05A 4WNAA 4X8HA 4Y2QA 5CA0A 1TTHA 1PX2A 4UTOA 5FOWA 5ITZA 1ISHA 3ZXXA 4MW9A 3TM5A 4KFTA 3H5IA 5BT8A 2SKCA 3RIMA 4C3UA 1KI7A 4MUNA 1Z0SA 2ID7A 4IINA 4K9NA 3LKBA 2OBFA 4AXXA 3VMMA 2IF2A 3PPWA 2HRRA 1KEEA 4FEGA 1AVTA 4BKQA 4OIMA 1Z2CA 3E27A 4GXRA 3KOYA 5HZHA 3ELWA 3C15C 1RE0A 3NP7A 4BUZA 4EGJA 1P74A 1N5DA 4OM7A 5EQDA 2WVGA 4PAQA 3UOGA 1G7CA 2NUTA 1L5HA 4AI6A 1CB0A 421PA 1OY1A 2WWHA 1VZ2A 5E4YA 4CTMA 1DJOA 1SXJE 4ENQA 2IITA 2Y93A 4U8GA 1P9WA 4TTTS 2ZRHA 4GPZA 5EHIA 1V37A 2QTNA 3EZFA 3HYRA 5E8RA 1U8FO 2C2BA 2YW9A 3JQ9C 4MQ6A 4YP5A 3R9KA 3ZQUA 4EHDA 1ODCA 2BLLA 3LPAA 4TL6A 3P71T 5E1BA 1JHVA 4RZSA 2WKRA 2O54A 3ON5A 4PZYA 1WCXA 1QWOA 2D1RA 1OASA 2UYYA 3CX8A 3R44A 3WGKA 2JAXA 4ZAFA 4B5KA 4ZT3A 4CG3A 3U4QB 2R8PA 4R5HA 3LZDA 3M9XA 3C87A 2GRUA 2G0NA 1QVVA 3A2NA 2X8JB 3ZDDA 4FD2A 1O58A 4YJDA 3UXMA 3NUGA 3H17A 4Y2GA 2FA9A 5EPUA 3UHJA 2OWDA 1REQA 3FE2A 5KYYA 1EK2A 1SXJB 3DW1X 4US1R 5HIJA 2XECA 4Q48A 4P4GA 2DBZA 4Z1MD 4CU5A 5LMNB 1ZWKA 5K4HA 3G2QA 1UL1X 5JVDB 5FB3A 3PFCA 3PCTA 4BNDA 4F3CA 5GM1A 3TSCA 4Z53A 3DHWC 3GU3A 4R2IA 4XUEA 1Q0PA 3QFRA 3AY3A 2V4ZA 4H3VA 1SR8A 2IBMA 4R7TA 1SUDA 2H7XA 2ZAMA 1X1DA 2JH3A 3C1OA 4I08A 5JNRA 5JS2A 3U4IA 1DAOA 5H9VA 3PBKA 2RAUA 4OXKA 1L5SA 4PLHA 2H0QA 3NP9A 4N9QA 1WB9A 3HVUA 3TM4A 2JJ1D 3KO8A 1HKUA 4OGFA 3COJA 4M1MA 4DBLE 1WG8A 2G9UA 3DFIA 2OESA 2X2EA 3T9DA 1DBIA 2BC9A 4YPVA 3RLIA 3UG6A 2XD9A 1HDZA 4PZ9A 3SIRA 3WWPA 1XTIA 3MJEA 4XB2A 4D4HA 5K05A 4Q37A 4JC4A 3TMAA 5KOJA 4GFDA 4X6YA 1QJCA 1GTZA 3CUUA 2K2WA 5D1NA 1NW5A 5IJ0A 4B17A 3FH0A 4HGYA 4F4UA 5HZKA 1B0ZA 2VZ8A 2PRKA 1RLMA 1ZM4A 3DZFA 4ROTA 4FBMA 3AP1A 5K5EA 2Z1MA 2NUPB 2B36A 2FSVA 3D6UA 3ZLVA 3IP6A 2CVFA 2XSZA 4BEVA 1H0HA 2X2OA 5IT9A 1IFXA 2JLCA 3SZ3A 1KI8A 1E2GA 1BXGB 1WSDA 1UFKA 2AYYA 3DF9A 3IAHA 5EPOA 3U3KA 4FS8A 3C5WP 3R24A 3RK0A 1OGIA 3I2GA 3CUTA 1WBBA 1F6DA 2YWHA 4X91A 3U3XA 3ZVMA 3KL4A 4XEUA 5IVIA 2HHAA 4J2TA 4YRCA 5FTLA 2O7VA 1U1DA 5GV7A 2DBYA 4F96A 1DAEA 1U99A 4UEJA 2QPLA 1Q11A 1J8QA 4NNJA 3SC6A 4QTXA 3ECCA 3ECSA 1NRXA 2OQVA 1K98A 4LXGA 4KG7A 1TM4E 5FNVF 1QP8A 1EHYA 2SKDA 1JQJC 2SECE 1EWTA 1NY6A 2QK4A 3F78A 2J48A 1ZI8A 3DWFA 3V6MA 3WLAA 1JVBA 4BTVA 2CYCA 1GYPA 5E38A 4ZV4A 3LOPA 3SQNA 3M1AA 3L7NA 4FLMA 5ARDA 1YIOA 4E5KA 1QFMA 3VH1A 4TZ0A 3JQAA 5JRJA 1HFEL 2VYNA 2HFJA 2Y0DA 3DLHA 3M6IA 2HC9A 5TF0A 3GFPA 2ZU0C 1BWRA 4ASUA