5TDPB

Crystal structure of the fab fragment of anti-her2 antibody 4d5 with redesigned heavy and light chain interfaces
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
220
structure length
208
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVREAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWAMDYWGQGTLVTVSSASTKGPSVFPLAPSGTAILGCLVKDYFPEPVTVSWNSGALTSGVHTSPAVLQSSGLYMLASAVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti-HER2 Fab Light Chain
publication title Crystal structure of the Fab fragment of anti-HER2 antibody 4D5 with redesigned heavy and light chain interfaces
rcsb
source organism Homo sapiens
total genus 45
structure length 208
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tdpB02
1SJEA 1Y6MR 3N06B 5ITFA 4GKSB 1INQB 4XP4L 1HHHA 2BP3A 4OM0L 3SJVD 1I3GL 4OFYA 1Z9OA 2R0KL 2DDQH 2XZZA 1XF5B 4L4VE 2UYLB 1U8LA 1U2HA 2EICA 2FZ3B 1H3WM 3PWJA 3KPOA 3S96A 3T4YB 4WDIB 2A73B 1QRND 1FPTL 1MEXH 5JW4Q 2DWDA 5E2JA 4PJFF 1AD9B 3L3HA 3LKRB 3IXTA 3D0LB 1CE6B 4CBPA 3BRFA 4KJYA 2I5YL 1CK0H 4UI2A 1W2KT 3B9VA 5CD5C 2XACC 1HKLL 1BGXL 4JKPH 5IGXH 4G5ZL 4GG6E 2HLAB 1LQSR 3SGKA 4JPVH 5MEOA 2P4AB 4ODXA 1Q72H 4PRHE 5DXWA 2BVQB 1PFCA 2C3GA 4IHOA 3RTQD 2VXTL 4S1SH 1T6VN 3QUYA 4YFEA 3VFUB 4QRSB 5J56B 1WBYA 4ONHA 3QXDA 2EDXA 4BFIB 5E95B 1OD7A 2GK2A 4MGXA 5DHVH 3WXVL 4M03A 5CZVL 4UILL 4M7JL 1P9MA 1I3UA 1KJMA 1BFTA 1DUZA 2ADJA 4JFHE 4JM2C 2FR4A 2IFGA 4X98B 4KPHH 5ALBL 5AUMA 2F5AL 4Z7UF 1R5VA 1V7NL 5AZEL 3OL2A 4MXWH 3RVVD 3DGGB 3C6LD 4O5LH 3QXVA 1P7KB 3MLPA 3KXFA 2NPLX 4DVRH 4Y4KD 1ZHKA 4JJHA 5DDHA 3DTXA 5GSVA 3VI4F 3QUML 4OLZL 1V5JA 2BERA 1OAKL 2IPUK 3HZVB 2XTJB 3HLAB 3I9GH 1MJJA 2Z9TA 1ACYH 1JPTL 3KYMA 4AT6A 4RAVB 2BVYA 3O8XD 4PUBH 2VLRE 3DX7B 4PJBB 2VDNH 1QSEB 4PJGB 4O2FA 4C56A 5F72S 1Q1JL 3NZHL 4XC3L 1A3QA 3MLVL 2D3VA 2NY3B 3BP5A 3RGVA 1X5XA 2P5EB 1MI5E 1IC7H 4Z7WB 1EMTH 4JRXB 3MJ8B 3D2UD 4ODVH 3MRNB 3G5XB 5JLZA 2IH1A 4GKNB 4OUOA 1ZXQA 4NWTH 1FORH 5B4MC 5FOJA 4RMQA 3ZE2E 1PSKH 4TQEL 1AJ7H 3VFOB 4RDQG 4LEXH 4UINH 3WS6C 1AXTL 1GOFA 4YDKH 3LD8B 3O3AB 3ZKND 1DVFB 5D7IF 3ARFA 3T0XA 4HULB 5FOBB 1V8HA 1TQBB 3B8YA 3DV6A 4O51B 4POZD 4DUXA 5CLWA 1EHLH 4JAMB 1CBVL 3KPMA 3ZDXF 2DKSA 4P3CL 1T20A 2OTPA 4P2OC 2A77L 4XP5H 1L0YA 4HFUL 4X4ZA 1LEIB 4PJXF 5J3HC 4F9PA 1CL7H 1LD9A 2ZKHL 1IEHA 3UTZB 5SX5H 4MS8C 4YHLH 2BMKA 4MB3A 1FSKC 3TPUA 3L5WA 3L3KA 1JF1B 3OKMB 3LEYL 1A3LL 5EG6C 5IBTH 1OP9A 3H9HA 1FN4A 1NAMH 2W0FB 3FN0H 1KYOJ 2DBLH 4JANA 4HPOH 2UZXB 4L29A 3V6OA 2R8SL 3GJFH 1Z0MA 4O9HL 5D96B 2AJXH 3SDXE 4WNQB 3MBEA 4X8XA 5FGCE 3MMEB 5HD8C 5H35B 5JQ6L 2V5MA 1W8OA 3QDMA 4S1DD 5TE7L 5GRWA 2X4PB 4YH6A 3UPRB 1GZQA 3HNSL 1NCBL 1BIIB 5AD0A 4OT1L 4DTGH 4FHBD 4JPWL 5B38B 1G9NH 5D1QB 3HPLB 4M43L 1R5IB 2Q20A 4NO3A 1F45A 4ZXBB 4KK5C 2IH3A 4KROD 1FZJA 4MXVE 5KZCB 3P30L 4JO3L 5AYUL 5CBAA 1JWUA 4JQXC 5DUPH 4R8WH 4PR5B 4Y2OA 4CN1A 5L88L 1EXUA 1UXSB 1MFAL 4FZEH 4NZRH 1AXIB 2PYFA 3RDTA 4OLEA 3P4OA 3TO4A 5KW9H 2W9DH 4KQ4L 2PCPB 1M7DA 1UB5B 5J6HA 1TETL 4FXKA 4XH2B 7FABH 1RIUH 3QZWG 1UZ8A 5IBLC 1YEJL 4U1JA 5KVFL 4WWKA 5GJSL 3DUUB 1OAUH 5EWIH 1LO0L 4JN2A 3GFUA 2V5SA 5IEKA 4JFFE 4F33A 2ICWI 5DVLA 3WXWH 2VNCA 1XR9A 2VLJE 4JRYB 4NCC2 2BNQB 4ISVB 2OBGA 1AH1A 4KI5E 3PWPE 2LVCA 2VH5H 2ESVE 4UOJA 1CR9L 1T5WB 1NFDB 3PWLB 1F8TL 4U0RB 4FFYL 3TWCH 5HYSB 3ARWA 2CLVA 2IADB 2NNAB 1WV7T 1SM3L 4R26H 1PYWB 1I1YB 5GRXG 3QUXB 5C0CB 5KSAA 1SEQH 2PO6D 4IMLA 1B9ZA 5LG1A 1YYLL 1I7TB 2HMIC 1NMCC 4GOSA 2DD8L 4TSAH 5HVGB 1EZVX 3L1OH 3O2DH 1XF4A 1AR1C 2X9WA 4U1MB 1G7HB 4B53A 2MQCA 4HFWB 4C54A 1S9XA 4LLQB 2AERT 5I15L 2XXCB 3TN0B 4YUEL 3ULVD 2DICA 1WFNA 3CH1B 2OJEB 4LPVA 4M93C 4PGBA 1D5XA 3E8UL 2R69H 3MLTB 1I1AC 4M6AA 2AV7B 4YX2H 1KT2A 3D9AL 1ADQL 1WBXA 1OLZA 1QLRB 2EDYA 1A1NA 5C0FA 3FB5B 5E6YA 4KKBC 2ICWB 3RVXC 3UYOD 4MSWB 3NCYS 3IDXH 3CDGA 2X44D 1RMFH 3UTTB 3H7BB 3M8OH 5HHME 5E2WL 1F90H 4HUUB 3JVGA 4G9FA 1MIEH 3N0PB 4Z8FH 5EZJA 1QVOA 1UCBL 4U4BA 4NCC1 1MJUH 4QRTA 2R1WB 1P7QB 3QR2A 2B39A 4HIIA 4X8JA 1YEEH 1T1WB 3VFTA 5FKPA 2J88L 1L0XA 3I2CH 4NQSB 5F7EH 3THML 1EUTA 3CFJA 1T83C 1MHCB 2IQ9L 4XNZB 1FIEA 2VZSA 2AJSH 2P8MA 5DEFA 4HUVB 1NDGB 4M8VA 4P5KB 4YIQA 2HN7B 5KVGL 5TE6L 3QJFB 1OGTB 3FO9B 1KGCE 1ZS8B 4HUWA 5D7JD 1L4IA 2AEQL 2FJFB 1MCPH 2F58L 3ARUA 4R4FL 3QA3B 3MRCB 4RZCA 4KZDL 4U6VL 3CCHB 2I25N 1FL3A 2M26A 4WO4A 3RWDB 3DOSA 3K4AA 2IC2A 1ZVSB 2D7TL 1F4YH 2EDBA 2DQHL 4GSDL 3RWCB 3JWDC 3FT3B 4XHJD 4YDIH 3RZCB 3U83A 4WV1C 2GTWA 3OKYA 1NSNL 2F54E 2YXFA 1TZIB 3V5DB 5BZDA 3MODL 5K9OB 5JW5B 1LO2L 2R2BA 4Z77B 1TTUA 1SJVA 5DHVB 2VABA 3PNWB 5KSBB 4LVOB 4LMQE 2MHAA 5D1ZB 1DEDA 3KPSA 1CXFA 2YN3A 2QQNL 4FS0A 3MRFA 4QWWD 3ROOB 4PJHF 4KAQH 5ANMB 4GG8B 4WFHD 4I3RL 3RI5F 2JB5H 3GSNH 4KGJA 4N8CL 3U46B 1LK3H 1GPOL 4Y19B 5AAWA 3GSVB 3U4BH 5D6CA 4KC3B 3KPPA 2Y5TB 1PG7L 2NY3D 4L5FH 2X4SA 1CL7I 4TSCL 5KTEH 1Z3GL 3JZ7A 2CDEB 3GKWL 5H94B 1DSFL 4RGOH 4YHZH 2PXYA 3RTQC 2HKFH 2EYRB 4H8WC 4NO2A 5EU5A 2CLZA 4S0SD 1QBMH 4GW4A 2Z31A 4Z7NF 1JGUL 3MR9A 1QBLL 2ZCHH 5BO1L 5I8CA 5CEZL 4K9EH 4P99A 1NMBL 1FV1A 4OCYL 4F37F 1CGTA 1MRCH 1KLGB 1HHKB 3DV4A 3FO0L 1AGFB 3D87B 3EFFA 1S7RB 1U8JB 5C0GA 1UM4H 1D9KD 3Q5YA 3VGDA 4Z95H 1IAMA 3QZWB 3U7WL 2AEIT 4OD1L 1BEYH 4MJ5A 2D0FA 2NX5A 3R1GH 4AM0B 2EE6A 1OARH 4TSBL 3O6FC 1S9VB 3UJTL 3OZ9H 4V2CB 5IFAH 3O6LH 5F89A 2OR8A 2SEBB 1QKZL 5DEGA 5GS0D 4ODHL 3V4PL 1OAYL 4S2SA 3RVTD 3TIEB 1XMWA 2BVPA 4PB9L 3O4OB 3VXNA 4LSRL 5DJ0B 1A6UH 1GZPA 5IR1A 5DF0A 3DYOA 3C5ZA 1II4E 3CZFA 3OGOE 1T2QL 3MTRA 1N0LA 3W5MA 5DQDL 1XAUA 4XAWL 3S5LG 5JW3H 3QXAA 5EOCJ 5FIEA 1WBZA 4ZD3H 3Q1SH 3GJEB 3IDNB 4D9QD 4P23C 1IKFL 1HQRB 2QR0A 4FQQA 3S37X 1MFBL 2Q3ZA 4LSSL 4E9LA 3F7YA 3K4ZA 4NJ9L 4OLXL 4RGMC 3MRDA 1N7MH 4XXDA 2GK0A 2NW2A 3IF1B 3L6FA 4OZGE 4E41B 4EI5D 4Z78A 1NAMB 2ZSVA 1JP5A 5SWZA 4ZXBD 1H5BA 3HPJA 3UC0H 3GJFB 5KZCD 2F5BL 4PG9B 4U1GB 4D8PB 4PTTA 4OLWL 3W0WE 3GSUA 3PJSA 4K3EL 2H2PC 3NMEA 1IAIL 4M1CD 3TZVA 1I3VA 3MRRB 3IJHB 4MJ4A 4FQCH 2FHCA 1A4KA 4GAGL 1RZ8B 5CD3B 4M8QB 5T3ZL 4M6NL 4L4VA 2AJYH 3WLBA 3TIDA 2XZCL 3X3FL 1YEFH 1GVIA 4JLRA 1NC4A 3ZE0E 1WVZA 1DQTA 1HH9A 3PWVB 2BNQD 3P9WB 2KDGA 1KPRA 2A0LC 1PKQE 5LCVH 4P2QE 4NRXB 3H3BC 4AL8H 2HTKC 2MCPH 4U05A 2A1WH 2VLMD 1NC2A 4U3CA 1NLDL 5F7WC 3IXAB 5SV4A 4IMKA 2YD1A 5FO8B 1DBAL 1MCEA 2WANA 3UO1L 4GG6A 4OFIA 2CXGA 4RAUB 3AAZA 2Z8VC 4PJDB 5IEHB 4YQXL 4MB4A 1U8MB 4JFZH 5GS1A 5C0CD 3CLFH 1MFDH 5C9JB 2WM0A 1EHXA 4M02A 1T89C 3AREA 2JCCB 4JO2H 5JMOC 2BJMH 5EC1A 5HYEA 2NY1B 3QFJE 4MJIE 2F8VA 3V5HA 2RQ8A 1YPZE 1S7TB 1IARB 4UB0H 4KY1H 3LEVH 4B7IA 4LCCC 3BZ4B 1YN7B 2ZCLL 4LVHC 1U8OB 4KROC 2GFBA 2BX5A 4JFEE 3FOMB 4CN4A 5C7XL 1H15A 4KHXL 1ZA3A 1QFWM 5TF0A 4R90H 3SCMA 1QFWI 4IJ3C 3H2WA 4D2NA 1BD2E 2QKIA 4HKBB 1HCFX 4CVWA 3O3DA 3NCJH 5T1LB 4IS6B 5EBLA 5DZLA 4IM8A 5ESVA 4OB5L 4DGYL 4H5SA 1CLYL 2H1PH 3UTTD 2R2EB 2J6EH 2NY0D 4HCRA 3L3DB 2R39A 1U8QA 3WN5A 4LHJB 1TXKA 1N4XH 1VGKB 2AJ3A 4HIHA 1R3HA 2XG5A 4L8CA 1A6AB 1I8KB 5FYLH 5HVFB 2VLRA 3WNKA 2YRPA 3SOBL 1P7QD 4IIQB 4LSQL 1N59A 4X6BB 3TPKA 5LAXA 1XH3B 3IFNL 5KOVC 3MLZL 4WW2C 2DLFH 4YHMH 3RL2A 5IF0B 4PP2A 5IKCB 1MI5A 3ISWA 3MRJB 4LCWE 5HY9B 1CFTB 4P4RB 4IRZL 4N1HB 5HJ3A 2BVTA 4XHQA 4OGXH 4RBPK 1YEDA 1L7TL 4JFPA 3V5KA 4JDVA 1T22A 1URLA 4PRIA 2WSKA 4HWZA 5M95B 2DN7A 1IZJA 2CSPA 1VACA 2PO6C 3RU8L 3WD5H 5HHVH 3VFSA 4X7FC 5IFHL 3UTSD 3GSQA 3QUKA 4K7PH 1HINH 3DNKA 3KLHD 5BS0D 1Z9SA 3SDCC 3C5JA 2OS7A 2DLGA 4HLZG 5JDSB 2X2YA 2H26A 1G6RA 4EOWL 4GO6B 5DD5H 4OQTA 1G7JA 4G42A 2VDQL 3B9DA 3MJGX 1JF6A 4U7MA 4QF1A 3RX7A 2BCKA 5GRYA 1ZGLB 3QCUL 5I0ZA 1MH5A 4O4YL 4YDVB 5CCKL 3GSOB 2Y5EA 2EXWC 4TUKL 5GISL 4R7DB 3BMVA 4TVPD 4QYOB 4NKIH 3MRKA 4MNGE 5D71H 4F58L 2CRMA 4QHLB 2CRYA 3F58H 5FYJL 2N4IA 2RR3A 4TULL 3VA2C 4LLYB 4J23A 4YGAB 5C3TA 4ALAL 5GGVH 1GSMA 1SYVB 1CDIA 2X4NA 3D85B 4GBXB 3NA9H 5IMKA 2I07B 1JZ7A 1BIHA 3H42H 5HDBE 2WBJA 1MPAH 1MF2L 4ENED 3OAYH 5E1HB 3SDXA 1MOEA 1NPUA 5D4QA 1NJ9B 3B83A 3CC5B 1CFVL 4GRWH 2E7HA 4HF5L 4Y19D 3BEVB 4XX1G 3RPIA 3SKOB 4NQCE 4UQ2A 4JZOA 1IAIM 3HRZA 3VXPB 4G8IB 4U33A 1A6ZB 3C2AL 3SO3B 4QHUB 4JFOA 4YK4B 4JY5H 4DWHA 2JELH 4G80B 4JKLA 4JGUA 4PRBA 1SY6H 1T1YA 1HYSC 1U8PA 1F00I 3U0TA 2GAZA 3DBXA 4I3SH 4ZOAA 3MCLH 1ZLSH 5GGTH 2PR4L 4OF3A 4G6JL 3GSNB 1AO7B 4YE4H 5FDWB 1H8OA 4ELME 3ZKMD 1T21A 3M45A 1S7WB 2Y6SD 2ARJA 4LSDA 4L8BA 2H2SD 5EUOB 4U1HA 1YNTB 4DKDC 2VDRH 1IGIL 1N26A 3ULUH 5DJ6A 3BQUB 2NY6B 1MIML 4JQVC 3AU1B 5H2BA 2VXQL 1CFQB 4YHKL 3REWB 5F6IB 1IAOA 4PJAF 1H3XA 1T5XA 2JK5A 3MPCA 4MD4A 5C92A 4HWBA 1J05B 2CIIB 4HIEA 4JFFA 1IGJA 3LSOA 4H26B 2AI0L 2VLJA 5DJ2B 3RWIB 3QWQB 3MO1B 3VWJD 5IB3B 3L7EB 3QEQD 2HWZL 2ESVA 1ZA6B 4H0GA 4J3XA 5F9DC 2DQEH 4XNUH 1EIBA 4K23L 1KNOB 1YN6B 5EIIB 2D7NA 3V4VL 5LQBL 3LN4B 5DWUH 2XTJC 4TRPH 2E6PA 3FL7A 5TFSH 1W0VB 1J8KA 1XF1A 1DN0B 2FJGB 3V52H 1HILB 3P4LA 2ORBL 2OTWB 1ZANL 3HE7A 1I8MA 1MCOH 3HZYB 2R4SH 3EUUA 1RD6A 3MLWH 4J4PD 4YEFA 1AQKL 5FHAL 3WL9A 2YWYA 5I1EL 4G3YH 1HXMB 2ZUUA 3PE9A 2WBWB 1ZVHA 1HHHB 5FO7A 2FSEA 5DRZA 5FCUH 5SWQA 4U31A 3P9MB 3H0TA 4LRIC 1YNLH 4E41D 3BAEL 2E9BA 3L3GA 1U8LB 3E3QE 1KB9J 5FFLA 4NC1C 3SBWA 2ICWJ 4QXGL 3PQYD 4PY8J 1DQQB 1ND0A 3L3HB 4HLJA 3IXTB 1Q38A 2FEDD 5HYIA 4D0DA 4KJYB 4BQ6A 3BGFB 3LD8C 3S8WA 4DZBB 4JG0L 1DVFC 4EUPA 5H37G 3EGSA 1TQBC 3HI1A 5MEOB 4XPAH 3S35X 3VXTA 1NCDH 4IHOB 2CGRL 3CXHJ 3MBXH 1F58H 4F8QA 2XA8L 1MQ8A 3GBLA 4KRPD 43C9A 2Y36L 2KKQA 4ONHB 5ILTL 3B9AA 3LS5H 5I17A 1HH6A 1OL0A 5GS0C 1RY7B 4XXCC 1XIWA 2ITCA 5D2NB 1CLZL 1HCVA 1BX2A 2FGWL 2YA2A 1OTTD 1QA9B 1WZ1L 5GSRA 1UH2A 3N1MC 4AJ0A 1F4HA 3IB4A 2ADJB 1A3RL 5MERA 1IMHC 2FR4B 2VOTA 5D96C 5JZ7D 5AUMB 5IMMB 1R5VB 3VD4A 3MNZA 4I77L 2OK0L 4O58H 5HI5C 5A2FA 2P8LA 3LEXA 4GXUN 3RAJH 1NGPH 3KXFB 4AH2A 1OQXA 1Q9LA 3QP3A 2NLJB 5ECJE 5I1DA 2VUYA 5D1QC 1ZE3C 4Z7UE 4O02H 3MV9A 1T0NB 2J5LB 1BVKA 4ZXBC 5BJTA 4FQHA 3JTTA 2D0GA 2G75A 2JIXA 4NZDA 4P46B 4EVNA 2ZUXA 4NN5B 3BDBA 3KYMB 4HJJL 4KUZL 4EBQH 2F54A 1YNKH 2VDKH 3CSBA 1UM6H 4OZ4A 4GJTB 1JHKL 3KYAA 3VI4E 5EO1A 1QLFA 2HFGL 3X13B 3MXWL 3BP5B 3OG6B 3JTSA 4X7DC 1CGWA 5FV1L 2NY7L 3DWTA 1NUNB 4Y5YA 1EAPB 1L0QA 5BW7A 5C9KA 5T1LD 3OB0K 3BKJL 4OZIF 1IKNC 1RUKH 1KB5H 3EYSH 4JFQA 3MJ9A 1ZLWK 3KS0J 3U1SH 1JHTB 5SX4I 2ZP0T 5JLZB 2IH1B 4DVBB 2DQGL 1CG9A 1KYOK 4OCLC 4K8RL 3SE3C 1T3FA 3K4DA 4PGEA 1FG9C 4XVTL 1XGRA 4L8DA 4BFBD 3VWKA 1KCRH 4WEMB 5I75B 1T2XA 3S88H 3SY0A 4RGNE 1CLOL 5CAYB 4YPGB 1F11B 4U0RC 3HC3H 4W81A 4YGVB 5J1AB 1A9BA 1JV5B 4RRPA 3IDGA 3FN3A 4BKLA 4U1KB 5HYQB 1CGXA 5JUEH 2OTUA 1J18A 1RZIA 3EDEA 2WIIB 2Z35A 1Q9WA 5E2UL 3E0GA 1IFHH 3QUXC 3U9PH 5D7IE 1PZ5B 4JJ5B 5A2IH 3CXDH 5EZIH 4X80L 3L3KB 3L5WB 4XMPL 4NCDA 4OD2B 3ZDXE 4K3JL 2MWCA 3U0PB 5I1AA 4BFGA 4PJXE 3T8XA 4RFEA 3NAAL 4LBEB 3S7GA 4JANB 4CNIB 3TN0C 5IWLC 5TE4L 4DN3L 5LWYL 5DQ9A 3MBEB 1LP9E 4PV8A 2MQ0A 1I1CA 4P5MA 3CK0L 3QDMB 3KLDA 5AG9A 4TUOA 1W72A 3BN9D 3W5NA 1GZQB 1VERA 3G9AB 1DCLA 3MA9L 4O00A 5BRZE 5AD0B 4ODTH 4Y88A 5EBWB 5KSUB 1GRWA 5CGTA 8FABA 2X6MA 5CEZD 4HBCL 1WAAE 4LCUA 4JR9H 3D85D 2IH3B 1GHFH 4GBXD 1IGTB 2LU4A 4AIZA 3CFCH 2EE2A 1U42A 4IRJD 2P5WE 5KAQF 3IVKA 4LU5L 5JORA 4FQLH 3MOBH 3BP4B 2XV6B 4NUJB 3CVIL 2V7NA 1M7DB 1J12A 5J6HB 4N0FA 3DURA 1JGLL 1O5DT 4KVNH 4XNZC 4U1JB 3UBXA 4OZGA 1UKTA 4HH9A 2P43B 3EKCA 4JN2B 4OUUB 3MV7B 5CMAA 5IEKB 2H6PA 5ERWA 3TBVA 3Q3GB 3FT4A 4KTDL 4F33B 1MVFA 1I8LA 1PX3A 4Y1AB 4MZ2A 1KJ3H 5HHOE 1FG2B 1NL0H 3UDWA 5HI3D 3C8DA 3ELAT 3LHPH 4GRWB 4N1EA 4LSVL 4PJCE 3GSWA 5IJKA 3W0WA 1A7RL 4X6CB 5E8OB 2BSTA 1CDUA 4AEIL 3I02B 5T1MB 1CDGA 4MCYA 1TVHA 5KOMC 1ZLUK 1FJ1A 3BQUD 2NY6D 1NBYA 2UZIL 3QDGD 2CLVB 3O6MH 4NM4L 4QO1A 1BQHG 5CJOH 3BIAX 1IL1B 5D7LB 1XGUB 3OBAA 2UVFA 3RZCC 5MENB 4N5ED 5IVZB 4HX1A 2IPTH 3RNQB 1NCAH 3P73B 3FCTB 5L8KB 1RJLB 5C07E 1Q8MA 1JTTA 3QFDA 4TOYL 2ADGA 2JJSC 4FTVE 3E1F1 4UT7L 5D8JH 2WNGA 5SWSA 3STLB 5JHLL 4LVOC 4XCEA 1PKQA 4PJ9A 1C7SA 4P2QA 3ARPA 1OGAB 3MLUL 1F3JA 1PAMA 3C08H 2YPVL 1JK8A 3CU1A 1JTPA 1XF4B 5D1ZC 5DD3H 1KTDA 4EXKA 3MZGB 4J6RH 1L7IH 2N7AA 4WWID 1QBAA 1BLNB 2YK1H 4JHZA 5GQBA 2E9IA 4ENEC 1MEXL 3V6ZA 5GJTH 4DUVA 2EIBA 3IDMB 3GK8L 3WNOA 1CXEA 1SYSA 3BKCL 3D3VA 4H20H 1IC4H 1WBXB 3G6JF 2Z92A 2W60B 4R7NB 4YPJA 3QFJA 3HC0A 4X5LA 3MFGB 4OFYD 1Q72L 3ZE1F 1YPZA 1E4WL 2YBRB 4OLYH 1JI1A 2FIKA 2ZPKL 5HI4C 3B9EA 4LEOB 3HFML 4J1UB 4BK5A 4JFEA 4G9FB 3N1QC 1QVOB 4H25A 5IFJB 3ZKMC 1ZHNA 4XWGL 5HGAB 4QRTB 2Y6SC 1A21A 3WS3A 4HIIB 3LKNB 3PDGA 4X8JB 1DUYB 1BZQK 2H2SC 3IDIB 4ZFOA 5TH2A 1BD2A 4ACPA 3RNKA 1G6RH 4XTRC 2YMXH 3CFJB 2L7JA 2R4RL 4HS3B 4NSKA 3BIBX 5EZLA 2P8MB 1INDL 4R4BA 1UJ3A 5DEFB 1JPST 3CX2A 4JPIB 3S3PA 4YIQB 3QUYD 4OCSL 4HUWB 2WWMC 1WFOA 4HCRL 1IQWL 1NGXA 4RZCB 2WUCH 4NRZA 3GBNL 5F1NB 3DHMA 4F7CA 5HXMA 1FL3B 4WO4B 3O4OC 5FO9B 1IM9A 3EJYC 1OSPL 4QHMA 4LCWA 2HAZA 12E8L 4BSWB 5EZOH 4RQQA 1IGYA 1WTLA 4YZFF 1PG7X 2VDNL 1FFOA 1CQKA 3LKOA 1C12A 1UEYA 5ICYB 2VABB 3H9SE 4OCXH 1KEGL 3KXFD 5IVXB 1YY8A 4AEFA 4YBHA 2I27N 5GGRY 3PV7A 1I9IH 3QUZB 1K6QL 1MY5A 2MHAB 3KPSB 3QCTH 3CFBB 4LKCB 1KIPA 2K9UA 3NABH 2XN9E 2R1XB 2B5IB 2RGSA 4P46D 3K1KC 3HR5B 1NCWH 5T5NG 3SE9H 4NWTL 4OQTL 2DI8A 1PSKL 1A22B 2MJWA 3TA3B 4ODSH 4C56D 5D6CB 3CD4A 3QIUB 2EDJA 3OKOA 4MNGA 1YZZA 3RGVD 1RZJH 5DUBA 2X4SB 2VLKB 1WC7B 3OXRB 1G9NC 2KZ1B 3VFGL 4XVJL 3UROR 3U6RB 1F13A 4L8SA 4Z18A 5GHWH 1VPOL 1S8DB 1A7BA 1PY9A 4GW4B 2Z31B 5BV7B 3LMJL 3MR9B 5F1IA 3RIAK 4WFGD 5CSGA 1A0QH 5DD6B 1KLUB 1FV1B 4KJQD 1HSBB 1QO3A 3VXQB 1BJMA 3DETD 3GMPB 3DV4B 4LDLB 1Q9OB 4NFDA 4HJ0D 4AG4H 1OTTC 2YUWA 3DROB 3RI5K 1FO0H 2VQTA 4TN9A 3BGAA 3ARFD 2GTZA 4ZFZA 4Z7NE 5C0GB 1WWWX 5CUSL 1LGVA 4KK9C 1GGBH 4WENB 2VZVA 1BBJB 4HPOL 2R0LL 1O7SA 4PG2A 1JGVL 5JXEA 4MJ5B 4LLWA 4FG6D 5JZ7C 2VC2H 1B2WL 1GOGA 2H8PA 5FYJD 5IB4B 1CZ8H 4ELMA 1VA9A 2K3TA 2JE8A 3WSQL 2FHFA 2FD6L 3CPLA 3MRHA 1KC5H 4S2SB 5FCSH 1ES0B 2NY1C 4M62L 3V9FA 3WIHA 5IQ7H 3VXNB 4TUJA 5FYKE 4A6YA 1GZPB 4ZOEA 4HXAH 1ZWIA 5T3XH 3C5ZB 1MWAH 3PGFH 1BQHB 5GS2H 3BIKA 2XT1B 4NM8H 3MBED 5DUPL 4R8WL 1GGYA 3QDMD 1A6WH 4NZRL 3BYYA 4NN6B 4MD0B 1V3KA 4FQQB 4OCWH 4XNXH 2W9DL 3F7YB 3F6LA 5LJYH 2BVOA 5E6IB 1MCIA 2NW2B 2QHRH 4LAQL 5KJRH 4JGMA 5EWIL 5KG9A 2ZSVB 4NO0B 1IQDA 1X5LA 4YHPA 2QTEA 3VXMB 1KJ2H 4TVSa 3VXRE 4KWUA 1QYGH 1RURH 3ZKXB 3GSUB 4IIQC 3T2PA 1KFAH 3TYGL 3RDTD 1EHAA 3TZVB 5DD1H 3TO4D 5L6YL 4QXWA 2C3VA 3ILQD 1Y6NR 5I1HH 5TGBA 2DTMH 1EGJH 2ED8A 2VQ1A 3OR6A 4LSPL 5H8DA 5HDQL 1EEZA 1KBGH 4H88L 1NC4B 4W6XB 5TF1L 4WI5A 3EO1B 3V4UL 2XRAH 3PDDA 1I9RH 4HIJB 4OGAD 3WJJA 4ERSL 3V6FB 4LRNH 5EO9A 4YLQT 1NC2B 2XI9A 2DQTL 3BXNB 4ZOCA 1MCFA 1N5AA 1EVTC 3MLRH 4XC1H 2PTVA 3K2UL 1CXLA 3JV0A 5D7LD 3AAZB 2BHZA 2I26N 4I18A 5GS1B 1EJOL 1SJHB 2R0ZH 2BNRB 3BE1H 2C3WA 5DT1H 2IQAA 4WW2F 5BVPH 3IFPA 3U9UB 5EC1B 3CIQA 4G9DA 4Y8AA 3ECBB 2G60L 3V5HB 4MAYA 1Q0YH 3ULUD 1X5HA 2E6JA 1A4JA 3S3SA 2R9HC 2CRZA 4AY0A 5MP6L 3ZT6A 1F90L 1U8IA 5E1AB 2H3NA 4GBXC 4UIMB 4GQ9H 3TBSB 4NGHL 5HGHB 5JW4R 1H15B 1KJVB 1DBKL 1Q9KB 4KU1A 1HOCA 4EUPG 1B88A 5E8PA 1F3RB 2ZG2A 4NZUH 2JLLA 5ICXA 3SO3C 1IAKA 2FLBT 4D9RE 3AY4A 4YK4C 5ESVB 5IK3A 3WHXA 4F9LC 1CU4H 4H5SB 4Z7UA 2E5EA 1U8QB 4PREA 3WN5B 1HQ4A 4FABH 2AJ3B 3KDMA 3OF6D 1HHIA 1F4AA 4G9FD 2DQFA 1MCPL 3HE6A 3KYOA 5CJXC 5BZWA 5TPWH 3T77A 5CEXA 4UTBH 5BCAA 2WLZA 2DI9A 2VIRA 1N3NB 3QQ3B 4MA8H 1Q0XL 4PGCA 5DRWB 1XGTB 1ZT4A 3BQUC 1F4YL 2NY6C 2D2OA 3HN3A 5I1CH 1G7PA 4QRPB 2X89A 1DQDH 4U1SA 3E6FB 3Q2CA 2HRPL 4YC2B 2AV1B 2IEPA 4ODWA 5EOQH 3SGJC 1JGEA 1YEDB 1K4DB 3V5KB 4JDVB 2OLDA 4PRIB 1UACH 3MJ9L 4HWZB 4C4KO 4K9EC 4OFKA 4U6YA 1VACB 4FFVD 4K94H 4HDIB 2R23A 3VFSB 1W72H 1A1MA 2VR9A 3QUKB 4O2CB 1YC7A 3RWHB 3TNNA 1VHPA 3C5JB 3AGVA 5KVDH 4WO4D 5K33A 4LPTA 1MUJB 1DBBH 3FQWB 4GAJL 1G6RB 3W2DH 4YAQA 4I2XB 3C2SA 2LAGB 1G7JB 1MCBA 1J11A 3I85A 4QF1B 1YMME 2BCKB 1TZGH 2B2XL 5HGBA 1LO4L 4DKFH 1B0RA 3RL1B 2GT9A 5D7IA 3W9DB 2MKWA 3BKML 2AQ1A 3U4BL 4QRUB 4HSQA 5C0EB 4K7PX 2M2DA 4G7YH 4FQPA 3QUZD 3EOTL 4MQ7B 2X4UA 3KPSD 3BMWA 1A8JH 4PJXA 1WZKA 3NPSB 4NWUL 4XP6H 4K8RD 3DX6A 1U0QA 3I50L 4DKEL 5IMKB 5DMIH 5EULV 4G6AC 2PTTB 4QCIB 3AM8A 2ZCHL 3B4NA 4U1LA 2EDQA 1FH5H 2OJZL 3RPIB 2CH8A 1RIVH 2FJHA 4UQ2B 3BGFC 3QIUD 4QXUH 2X4TA 1UWEH 3O3BA 1ZHLA 5MI0B 3DYPA 1RUAL 32C2B 2AVGA 4WHCA 2VLKD 4RRPG 5BRZA 4JFOB 2X4RA 3VXUE 4C4KT 4DQOL 4JO1L 1MHPL 5T1DH 4AENA 3PGDA 4PRBB 2HT4C 3O2VL 4ZTOL 1T1YB 2G5BA 2FH8A 3U0TB 3TFKC 3FZUC 4NBZB 3DBXB 4K07A 3ZZ1A 4F2MA 1D5IL 2Z31D 4PJBF 1NKOA 4OIIH 1TCRB 4PJGF 2P5WA 1H0DA 5TDOB 1VEMA 5I19L 3QYCA 1T21B 3D1MC 5D2NC 2W07A 4XCCL 5D7SH 4U1HB 3UAJC 5IB5B 4JCMA 1P9MC 4BQ8A 4Z7WF 3LPGA 2R0WL 3PGCA 3VXSE 5CGYC 5LGJA 1BBDH 3MX0A 5DJ6B 5DS8B 4DW2H 2A83A 4X4YA 3CX5J 1HIMH 4DCQB 1CD8A 1IAOB 2IANB 4OZFH 5I8EA 4MD4B 1K9TA 2BSED 1RVFH 4X6DB 1X6LA 3INUH 1FNAA 4JFFB 2VDPL 1KB9K 3H8NA 3LSOB 5I1GH 5CJQL 3Q6FA 4X6EA 4AIXA 1E6JL 2ITDB 2D03H 2V9TA 4JDZB 3MA7A 3C5ZD 4P9MH 2J5LC 4P46C 3UC0L 3OX8A 3QG7L 4NN5C 1RZKH 3CXHK 4OI7A 1WEJL 4MHHG 4GW5B 1BQLL 4HXBL 4PRDB 1TQCB 5C07A 3WJLA 1I8MB 1JZ6A 5L2KB 2DQDL 4FTVA 2BOCA 2AXFB 3WL9B 1OCWL 5DR5H 4AMKH 5C0BB 3T0EB 5FO7B 3UBXG 2FSEB 5DRZB 5SWQB 5IVNA 4L9DA 2R2HB 2I9LB 4M4RA 3L3GB 1TJIH 5SWZD 2JTDA 4O2EA 3H3PL 1F3DJ 4KFZC 3EYOA 1ND0B 2A9NL 3LQAL 5LXGL 1RUQL 3BWUC 4WCYL 2B0SH 4KJQC 2G9HB 3FO1A 4MWFA 3A67L 4RBPH 4D0DB 3DETC 3QQ4A 1N6QH 2GJ6E 25C8H 3IGAB 5I75C 3JSSA 3C60A 3EYFA 4KHTL 1AE6L 3TZVD 1EEYB 4EUPB 3WKML 1CGUA 5DK0A 3EGSB 3HI1B 1S7VA 4KDVA 1A7NH 2X4OA 3AXLA 3VXTB 4RNRA 2VMFA 1SQ2N 4L4VD 5E56A 3S4SG 1B6UA 1KJ2B 4F9PC 1NC4D 1T2JA 4X7SH 1ZHBA 5E03A 5J06A 2GHWB 1FAIH 5CINH 5I17B 1HH6B 2ZOLB 1XIWB 2ITCB 3DXAE 1DANU 4HEME 1QBBA 1U3HA 5JHDB 4JO2L 4Q7DA 1BX2B 4APQB 5DLMH 3GMRA 1NC2D 3PHSA 3T1FB 3T2OA 3KNBB 1U3ZA 1P4IL 4LSTH 4UB0L 4NKDB 1XR8B 3GIVA 3GM8A 1OM3H 4FFZH 1ROWA 4XBEL 4NKQB 5DVOA 4UT6L 1DBJL 1SVZA 3MBEC 1OP3K 2V17H 1T4KA 5I1IH 2P8LB 3LEXB 1HE7A 4G8EB 1VENA 1N64L 4DKAA 1NFDF 4AH2B 1Q9LB 3ARED 5ICZB 1H3PH 1EVUA 3RWFA 4DZ8A 4X6FA 5IQ9A 1MVUA 3K81A 1Y18B 1BOYA 3S36L 3TV3L 4KKNA 3VGAB 2MFNA 1KN4H 1RFDH 3MV9B 3QIWA 1AHWA 4Q6IC 1BVKB 4JFHD 4FQHB 3JTTB 2G75B 2JIXB 4EVNB 1FGVL 1R0AL 1R3LA 2RHEA 4ZO7A 2F54B 4P5TB 1ULVA 3JWNC 4KJWC 3BPOB 1J88A 1F4WH 4U1IA 1LO5B 1Z9LA 4KKLC 2J8HA 4U49A 3VG0H 2VR4A 3V0WL 3UTQB 5IVOA 4ONGH 4BQ9A 2NMSA 3BPCA 4FMKA 5T1KA 1HHJA 4FQ1H 1A2YB 3GI8H 3BP7B 2R1YA 3TJEH 4YXHH 2XN9A 2P42B 1UENA 1AI1L 5HHXL 3EHBD 4XI5D 1CG9B 3RKPA 2BHYA 1JVKA 1N2RA 2VLRD 4PGEB 4P9HL 4OGAC 1XGRB 4L8DB 3QDHA 3U2SA 4CU7A 4OZIE 2AJVL 4XCYA 2E3VA 3TBWA 2DJUA 3UYPA 4C59B 1M05A 5CP7A 3SY0B 1YECH 4HGMA 3HKFA 3NA4A 3WIHH 2O5YH 4PJHA 4A6YH 1J0YA 3UCRA 1MI5D 1YUHA 2Q76A 5DD5L 3OJMB 1A9BB 3WFEH 3HS0A 3NZ8B 4MHHI 1T1XA 1R3KB 3LN5A 2OTUB 1KSRA 1RZIB 4H1LA 2Z35B 3MCKA 1Q9WB 3NPZB 4P57A 1J1PL 1BQSA 4PRID 3MZTA 2RCSH 3T0WA 3IS0X 3OMZA 4K7FB 3OXSA 1OAXH 5KS9B 2APWA 5I1AB 4YHYB 3ULUC 3GJFK 2XNAB 3T8XB 1JZ2A 4RFEB 2VXUH 1IT9H 4P2YA 1MHEB 1IZKA 4P59H 5GGVL 2Q86A 1K5NA 3ZSSA 1MHHB 3NA9L 4XP1H 4GG6F 4Z7QF 4OCRL 2Z4QA 5KVEL 3BZDA 4WHTA 1TTFA 3U36B 3EYVB 4JO4L 4F3FB 4KH2A 5AWNH 2DQCH 2CJUH 4YHOL 4N0UE 1W72B 1JPSH 5JW4M 3BEWA 3V6BR 5F96L 2VE6A 3FTGB 5BMFL 2CK0H 5L9DH 3OB8A 1F2XK 3G5ZB 4JKMA 3P0VH 4QHKI 4DEPB 2RB8A 5DTFA 1I1RA 4FA8A 4HK0A 4LSUL 2IBBA 1YEIH 1HN1A 5KSBF 4V1DB 3IVKB 3D39A 1FNEB 4FQIH 4X99B 5JORB 2C4XA 1MFCL 2P7TA 3MV8E 3ALXA 3JV6A 1CCZA 3PV6A 3ARBB 3BD5A 4JM4H 1B0WA 3VG9C 3D0VA 2V7NB 1LEGA 4N0FB 2V2TA 3DURB 4X7TB 4LIQE 3EOYG 4X4XA 4XP9H 4OZGB 4PV9A 3O9WB 5JOFA 1I1FA 1BZ7B 3Q5TA 3TBVB 3FT4B 5DZNA 2AJUL 1RZ7H 5J11B 4DGIH 4FFVC 2EDFA 4HMEA 4LCIL 3P0YL 3VFWB 4Y4FB 2FEEL 1IGML 3N50A 5I73C 4U0QB 3VDAA 3HNTH 1RQ5A 4WO4C 4RISH 1TVHB 4OQ1A 5L2JB 1JRHH 4LARL 5DZOA 4XPBH 2BDNL 4Q9RL 2IAND 3MGOB 4NQVA 2R29H 3V52L 2FLRT 1QR1A 2FX8H 3FQNA 4JFFD 3S4SB 5CHNB 1YEKL 2VLJD 5SWSB 4G7VH 2VB5A 4KI5D 4JHWH 3QULA 4WI6A 2DB8A 1WCBB 5FF6A 2ESVD 2XOTA 2DLTA 2YD5A 2VN7A 1QFUH 1F3JB 4OZHE 3QUZC 3WFCH 1FDLL 1HYRC 4HJGB 1KTDB 4HQQL 3QBTB 4LVEA 4PJ7B 1G6VK 2B5IC 4LLMB 3NFNA 3OB0H 4XPGH 3PXJA 4KVCH 3QH3A 1YMHA 3CVHA 1CICB 5F7KC 3FJTA 1ZLWH 4Q9CA 2F53B 1EHNA 1U8HB 1CFBA 3TA3C 3HE7D 5EPMB 5A3ID 3D3VB 5CBEB 5L2KD 1UWGH 3QIUC 2C3HA 4M61B 2HVJA 3EJZD 1UKSA 5C0BD 1AKJA 4CGTA 5J9PA 1U2CA 2FX7H 1FQ9C 1X5JA 4DOHE 2FIKB 1CFNA 1FP5A 3OKKA 2K7PA 5GS2D 4ZS6D 1SHMA 4WUUE 3G6JE 2NY4B 1IGFL 4H25B 2NXZB 3SKJH 1ZHNB 3EFDH 35C8L 4PRNB 2XYCA 2OYPA 4LCYA 1FYTE 3ZE1E 4UDTB 3SE4C 3MRQB 4ZFOB 3GUTA 1JMZA 1QNZH 1S3KH 3KPLA 3GMMB 4NQDB 5I8KL 3BDYH 4NSKB 3VCLA 3NH7H 2HFEA 1XGPB 1PG7W 3MRLA 4ZYKA 2CMRH 1D5MA 5D70H 4OF8A 3RIFF 2Y1VA 3PP4H 2FATL 4HV8A 3SJVE 1N6UA 1LE5B 3I75B 3N9GH 1PEWA 3KJ4B 3RAJL 5F3HA 2X42A 1XIWD 1UXWA 2CKBH 5F7UA 5ALCL 5JHDD 2EO1A 1R3IL 1DFBH 3MXVH 3FT2A 4APQD 1QRNE 4F7CB 4NBXB 2HT2D 3FN9A 1G9MH 1QP1A 1VGEH 1FZKA 1JZ4A 2V2WA 2ZNWA 3NCCB 2B4CC 2A6JB 2I60H 2APXA 4O02L 4CVZB 2P8PA 3P11H 5JTWA 6FABH 3DO7A 4M1DH 4G43A 1YNKL 1FL6B 1KGCD 4WFFE 5LBSH 4MNQE 1ACZA 4LQFL 4A2LA 2OI9B 3RUGB 1C5BH 5T5FL 4NN6C 1YY8B 5D7KE 5HHQA 1NEZB 3WNNA 5E6IC 1HXYB 1KB5L 2EYTA 1P1ZA 4YZFE 4XBGA 3MV9D 5E5MA 5IB1B 3DVNA 3Q6GH 4QOKB 2JIXD 4R96A 2MSPA 4Q9BA 3QWOA 2F54D 3ZKXC 4FZ8H 4BZ2L 1BZ9A 1JNHA 2JCCF 5I66A 1XZ0A 3EZ8A 3G04A 3I6GA 1RJYB 5DUBB 3ZLQC 1JYVA 2DL9A 4HMCA 2WQRA 3R8BB 4GMTH 4KMTH 2EDOA 5D5MB 4JFYA 3NCYP 4ONFL 2MNUA 4LPXA 2IMMA 1ZLUH 5FA3A 5HPMA 3F7PC 5EA0H 4WJ5B 5C0JB 1K3IA 4NKMB 2PYEE 1G7LA 3VWKD 1KCSH 3QIBB 4K7PY 2QQKL 4DGVH 2FEEI 1WT5C 5DK2A 4IOSD 3KWWA 3O41B 5FAAA 2BK8A 2F8XC 3P77A 2GYSA 4MNHA 4ZFZB 3VXUA 3DI2B 5IHUH 1NLBL 4W4NA 1A1OA 3SE8L 4D9LH 2O5ZL 1NAKH 5C08E 5IHZB 5E8EB 5E94B 4RWHA 5GS1C 1GAFL 2HLFD 3DX8A 5EU4A 4Y5VA 2H8PB 4OGYH 4JGJA 3I3BA 4ELMB 2Y07H 3T2NL 5FM4A 2OZ4A 4LFHG 1HNFA 5C70A 1BFVH 3QPXL 1A02N 1JUFA 4PS4L 3VXSA 5EUKA 4Z0XA 4A6YB 2I9TA 5J1TC 5D2LB 5GGVY 4PBWD 1EDQA 2F74B 4JE4B 4F7EA 3BIKB 4G8FB 2J4WH 3CUPB 2PW1B 1AQDA 5DFVD 4JZJA 3O2WH 3K8MA 2P24B 3LH2L 3C6SB 3LZFL 1AGDA 1YDPA 3M1BB 4JY4A 4WGWB 4HIXH 4OKDA 2BVOB 5F8RC 5TDNA 4Q58C 4GAYA 4QKXB 2KPNA 4DAGL 4AQ1B 4CUCA 5KG9B 4ZAKB 3WN5C 1IQDB 4WI8A 4WFEE 3IAPA 4YHPB 3W11C 3RY4A 3EHBC 3MRMB 3ZL4L 4EDWL 1BQUA 3VFRB 1J8HA 2ZSWB 3ARTA 3BZFB 1BFSA 1P5VA 5LGHH 2H32A 2FWOA 1JRHI 5IT2L 3KLAA 4EN3C 1JHLL 1SBSH 3I6KB 2EYSA 1QSZA 4L3CB 4C83B 2ZOKA 4OSUL 2ZJSL 5EDXA 1ZSDA 1JNLH 1VFMA 2VZOA 4JB9L 4BELD 4XCFL 5CJOL 1T66D 3KPNB 4YC2C 3O9WD 1NCCH 1EEZB 1O0VA 2FCBA 3ESUF 3WNLA 2F19H 3Q48A 5FA4B 1I9JH 5CP3H 4Y4FD 3T4AB 5INCA 3HUJE 3W0WD 4IEFB 1M71A 1D6EB 2V9QA 1RJZA 1P7HL 3QNZB 3EOAA 5K9JL 1HSAA 1GCFA 3OJDA 3WEXB 1C08A 4MDJB 1N5AB 1LE9B 1KXVC 3VE0A 4PJFB 3MLXH 3U0WL 5DUML 2WUBH 1T04B 4WVRA 5A2KH 1AD0B 5ISZE 3CMOH 3WIFA 3OV6A 3RWEA 1JWMB 4S1QL 4XWOC 5EUOF 1IC4L 1M7IA 5SWSD 3DXAA 3HNVL 4ZTPH 2IQAB 2A2QT 3FFCE 4PJ9D 1ZK9A 4F7MA 4JQIL 4P2QD 1UCTA 3TCLB 2X4QB 4GQPH 1TJHL 3GNML 4G9DB 5FK9A 2W9EL 1UVQB 4KQ3H 4MAYB 5DJYA 1NMAH 5ESAB 5JIHA 4NNPH 3UX9B 3WUWA 4MA1C 4U6HA 2GY7B 3NPSC 1ORQA 1BHGA 4EI6A 5DGRA 1A7PH 3OG4B 1U8IB 4JDTH 2H3NB 4NUGL 4HH8A 1BM3L 3HCVB 3U4EB 1OTSD 2EKJA 5EU6B 3D3VD 5ICXB 2VISB 4JPKL 5I30L 5MI0C 4RMTA 5EOCH 1TENA 3F12A 5T33H 3SKMA 3QEHB 3LVEA 4ZFGH 3ULVH 2AXHA 4PREB 3A6OA 1MFEH 1HQ4B 1U95A 3MREB 3WS6A 1DJSA 1HHIB 4JFED 3WV0A 1FFQA 2DQFB 4ZODA 2NXZD 4YFLI 3HE6B 3KYOB 3UYRH 3A6BL 4BUGA 3HMXA 4QY8A 2B1AL 3S37H 4WU7A 2VDLH 2B1HH 4AZ8A 1JPGA 1Z0NA 3AB0B 1RZJC 2WAHA 3D5OF 4GH7B 3EDKA 4PGCB 3DGCR 2OL3H 1ZT4B 1T03L 4M6MH 3RKDD 1EAJA 4J3SA 1JGEB 1FNHA 2YSSB 3WFBL 4OM1H 5GGQH 4EQ3A 3R0NA 1FFNA 4MB5A 3EZJB 2QBWA 3SQBA 5IBUG 5L8LB 3IFLH 4U6YB 2I24N 1A7QL 4Z7VB 2R23B 4KI5C 4OZIA 4M1GL 5F88A 1A1MB 1X6NA 4KRMB 3MNWA 4S10A 5I18H 4RGNB 1IM9D 4X5WA 4YAQB 4IDJL 4MD5B 2BRRL 4LCWD 1MSPA 3BUYA 1VADA 3IJSB 3ZYZA 5C2BL 1RJCA 5HGBB 4OJFL 1ERNA 1B0RB 1ZTXL 2O26U 4MX7B 1TQCC 2O93L 4OKVA 1CI5A 1BVLA 1QRKA 2VDMH 5GGSY 2CKBB 2QHLA 3GIZH 4JN1H 3WFDL 3SQOL 3ZT5A 2DYPA 5HGDB 2XWTA 3O3EA 1YJDL 1DL7H 4ZO8A 4NZJA 1WCQA 3T0EC 4UMGA 3UJIL 3NFSL 2AEPL 4JQXA 4OBRA 1NGYA 2EDTA 2OP4L 5HVWA 1M6OB 3NTCL 4ZUTA 4QLRA 5E70A 1TJGH 3A0OA 4ZS6C 3FFDB 4LLUB 1JNNL 3CX5K 3ROLA 4U1LB 1A0QL 1IC5H 4JKKA 1AGCA 4M7KH 3OKDA 4ZO6A 3T09A 1XGYL 2FJHB 4M5YH 3EYQC 2HJKA 4I5BA 1FO0L 2X4TB 4I9WD 4XRCB 4TPRL 1ZAGA 1JBJA 1ZOXA 4MXQC 4OF5A 2Q7YB 1K8IB 2DBJA 1UT9A 4H1LG 1J1OH 1S9KC 3UZEA 1NDMA 5JOPE 2ZUVA 3TEUA 5GZOD 1XF3A 3IS1X 1ADQA 3F65A 3O0RL 1P5UA 3MRGB 5C0IB 3RP1A 4JVWA 5FYKL 2P5WB 3TNMA 4E0RA 3LIZH 3C6LB 4UV4L 4KDTC 2P45B 1XIWC 3BDXA 2XTJE 2YWZA 4UV7H 1RK0A 5FHBL 5BQ7A 2FBJH 5E8DH 3DI3B 4APQC 3MV8A 4WFHE 3FO2A 4Z9KB 1ITCA 4M5ZH 2AJZB 4PJBE 3JUZA 3WFHA 2DF3A 1QSEE 4PJGE 1HZHH 2A83B 4X4YB 3IYLW 4NZTL 5F3BB 3RWJB 3BJ91 3GRWA 3F7RA 5C71A 5JXED 3BSZL 3OKLA 1KF9B 1A14L 3O8XB 3HB3D 2P5EE 2NY5L 2ID5A 4H0IA 2BSRA 2VXSL 2R56L 4Z7WE 2XWJA 3CFIC 5CEYB 3MJ6A 4JRXE 1U8KA 3RZWA 2B8OT 4N1CA 4Q0XH 4X6EB 2OQJB 2XZQH 1L9MA 4NC1E 1GC1L 1LK2A 4OCWL 4I13B 4KK6D 1QUNA 1C5DA 3HI6L 1UQSA 1D5ZB 2ATKA 3VGAC 1KIRA 1OSZA 1PQZB 3QHZH 1MREL 4LNRA 2AGJH 1BAFH 3NACH 3OX8B 3ZTNL 4AQOA 4Z76B 3QHFH 4P5TC 4BZ1H 5F9OL 4XZUB 3BPOC 4XVSL 2BOCB 1OF2A 2FYYA 1KIQB 4K2UL 3FQXA 2APVA 3B2VH 3QPQD 5GGUB 3ILPA 4PJIB 1K8DA 4CL7A 5HPOA 3V95A 3UP1A 3KYKH 2EH7L 4KZEH 1E6OL 3KG5A 1NBVL 3BH9A 3GMNA 4JHAL 2ZNXA 4E42B 4MCZA 1OB1A 4GS7B 3GHEH 2XRAL 5CSZB 1GXEA 5AZ2H 1UA6H 3FO1B 3TT3H 1VB9A 4N0RA 1VKXB 1T83A 2AK1H 3IETA 3CVHL 4LLVA 3C60B 1WFUA 1E28A 1FVCA 1PEZA 1UC6A 3FMGH 1X5AA 2NTFB 1HHGA 5JW4N 1S7VB 5DD0L 4HC1A 3T3MF 2X4OB 1RUPH 3AXLB 4UAOB 4WW1A 3J8F7 3QO0B 1U8NA 1NEUA 3P4NA 1ZHBB 1OAZL 4WUUA 3G6JA 4KKAC 4OIAA 1G7IA 3ARQA 3S36X 1F4XH 3DUHA 1U92B 3O4LA 1S9WA 2RIKA 1FYTA 4WV1A 5IOPB 1FL5A 1I7RA 4LDOB 4HMDA 3FRUA 5ADPH 4YHYC 3IFOB 5JPNB 1B4JL 3GB7B 2D4DA 1X7QA 3GIVB 2VITA 3U79A 4GQ9L 4XNQB 5DYOB 5F7YC 2VDOH 3CMGA 4GRWF 1ZT1B 4GKOA 5HYJA 1JPFB 1T4KB 4X6CF 3LQZB 4UDUB 5DFVC 1KPVA 3E6HA 4K94C 5LKNA 4LLDA 1DLHA 1EO8H 1FYHB 2IG2H 4DZ8B 1R3JA 3RWFB 5EFIB 2OSLA 3D18A 3L3IA 1K2DA 3DUSA 2DQIL 4JRYE 4MAYD 2BNQE 3WHE1 4YFDB 7CGTA 1KACB 1CU4L 2ICCA 3QIWB 3ARGA 1AHWB 4PGJA 4N0CD 2IFFH 3TBYB 2C4FT 4DEPC 5FECA 1UZ6F 3QRGH 5D6DC 3B2UD 2QSCL 1NFDE 1H3VA 1R3LB 4DN4L 3STZA 5ID0A 4XP4H 3F62A 5A16B 1MRDL 4OM0H 3MV01 1I3GH 1I3RA 4I4WA 3SDYL 2XKNA 1NUFA 2K1MA 2R0KH 2ZUSA 4MNQA 4NC0B 3W39A 3CGTA 3ARBC 5D9SA 2DLIA 1PLGH 5C0CE 1FPTH 3BPCB 5FGBC 5T1KB 1K3ZA 1J87A 5GRJL 1DDHA 1WK0A 1T66C 2BC4B 2WIMA 2J7LA 3VDBA 3O9WC 5EOQL 2OCFD 4XBPA 2I5YH 3JWOL 4CDHA 3RBSA 1I8LC 5EIQA 1HKLH 1UACL 1BGXH 4XPHL 5J11C 5CWSB 2BVEA 4QHNB 4G5ZH 1E27A 3UDWC 3HE6D 4ONOA 4OLUL 1V7ML 3U2SB 4Y4FC 4RFNB 5IJKC 2NXYC 1M05B 2VXTH 5CP7B 2JJTA 4PJEB 1D7FA 1ONQA 3N85L 2FHBA 4BUHA 2HP4A 4PJHB 3O6FA 1WITA 3TESA 5B8CC 1Z9MA 1I7UA 2Q76B 1QSVA 3HS0B 2X89D 4KRNA 2P44B 5A2JH 2DMBA 1BJ8A 1TZGL 2EIZA 3RVWC 4MAUH 3PDOA 5CZVH 4UILH 4MVBD 4M7JH 1JZ3A 4U1NA 2H9GA 3UTTE 2PYEA 1AXSA 3BESR 4MZ3A 3TP4A 2DMCA 5I1LB 3L95B 5D1XA 1FVDA 1I85C 5ALBH 1P4BL 2F5AH 2OL3B 4RGND 3S35H 3MUGA 3LPWA 1X5YA 4UTAH 1V7NH 2V7HA 5GZNC 5AZEH 4HHAB 4JRWA 4P23A 1K5NB 4BH8B 5ACZB 1S7UA 1RHHA 4KUCF 5DMIL 1PVHA 3QG6A 4I0PA 5TQ2L 3ZYJA 1CICC 5FM5O 5C08A 1YEGL 2X1OA 2XWBA 2WINA 2ADIA 3LCYA 2MMXA 3QUMH 4NHUB 4OLZH 4YBQC 4WU5B 1OAKH 2FGZA 3GSXA 4NDMB 4P49A 3U30B 4NQUA 1NQBA 3BEWB 4HZLA 3MRIB 4HKJB 1JPTH 2VE6B 2IAMA 4XMKL 4LFHD 3WUZA 4Z7QE 5DHYA 3VH8A 5IMLA 1HKFA 2OZ4L 2VWEC 5E2VL 2EEDA 4B7LA 1Q1JH 3NZHH 4XC3H 3MLVH 4HK0B 1D6VL 3CFKA 1FNGA 1RZKC 2BNUB 5D7JB 2NR6C 2NY4C 2NZ9D 3TVMA 5IVXF 4TVPH 3D39B 1Z2KA 1Z5LB 2DM7A 3AMKA 3H7LA 5D7SL 3JV6B 1S5IH 3PV6B 3RX5A 3TO2B 5CILL 5DJCA 1J0KA 3EO0A 4N68A 3D0VB 3FB7A 5BRZD 2YS4A 2JB6A 3BKYL 2V2TB 5I9QB 2FBOJ 5F1OB 8CGTA 5EOTA 3H3KA 4TQEH 5KSBE 1J5OL 3HC4L 4DFHA 4GKZB 4TTDD 2P5WD 2DM3A 1S7QB 3L3JA 3KJ4C 3P4MB 4R3SA 1CBVH 3KS0H 1OP3H 4FQ2L 1N5YL 5ANME 5E9DA 1W8NA 3BZEA 2A77H 3QNYB 2FO4A 2D31A 4FP8L 4HFUH 3WCYA 5F44A 1DTUA 2Y25A 4Y19E 3SDAB 2ZKHH 1MRFL 2ERJB 4NKOA 1T89A 3ARYA 4NQVB 3LY6A 3WE6A 2GIYA 3SPVA 2IBZX 3X12B 3LEYH 1RZFL 2XY2A 2CO6B 2C1OA 5EB9A 3FONB 3VFNA 3MRPB 4J12A 1A3LH 5E2TL 3K3QA 2OI9C 2DLHA 4NQEE 3QULB 5FF6B 3RA7L 4AMKL 2WWKO 2R8SH 3R06A 1LNUB 1BFOA 4O9HH 5DMJB 4PJ8C 1NGQL 3V0VA 1FNFA 3B9KA 4HZAA 2UWEF 5JQ6H 5GIRA 3VGHA 1TJIL 4NJAL 5TE7H 2E7LC 1KCLA 1YMHB 3HNSH 1NCBH 5JNYA 2CO7B 4TYUA 4KXZH 4OT1H 1RK1B 5GXBB 4JPWH 5ISZA 3FQRA 3DIFB 2EDKA 2PF6A 2Z91A 2KQMA 4M43H 1IGCL 4NP4H 2XPGB 4HWEL 4FTVD 4Q2ZB 1FZMB 1JZ8A 3FFCA 2HA1A 3HAEA 3GGWA 2EDLA 1D9KB 3P30H 1G7QA 4JO3H 5AYUH 5J9PB 1KTLA 1J0IA 5JDJA 4J8RA 1C5CH 3GKZA 1BREA 3CFDB 1MFAH 3CFEA 3OKKB 1MJ8L 1AIFA 5FGSA 4X7SL 1RUML 4WW2A 5D72L 4KQ4H 4HWUA 4JFXA 4PLOB 1TETH 3U4AA 1HI6A 3S3JA 2EEAA 1YEJH 5KVFH 3QIBC 2X7LA 5GJSH 3C60D 2RBLA 1LO0H 1LP9F 5DLML 5EBGA 3GUTB 4OCMC 1D5BB 3KPLB 1G1YA 5ESQA 1DP0A 4LKXA 4M6OL 5JR1L 2PO6A 2UY7A 4ZYKB 2FECI 4N0YL 5DJAA 3WMSA 1D5MB 3TYFB 4XNYL 1CR9H 4PJ5B 3SDCA 1F8TH 1WAAF 3BT2L 5BXFA 4CADA 4NNYA 4FFYH 4E41E 4X9GA 4MDIB 1U3HD 3ULSA 2DM2A 5HVHB 1S78D 1SM3H 1KIUA 4KK6C 1A5FL 2D4FA 3K2MC 3KHOA 5I16A 1ZT7A 3HMXL 4EI5B 2V2WB 4G8GB 1FBIL 4U6TA 3EJJX 5I6XB 2YD6A 2GCYA 5E99H 1SEBB 4ZS7L 3OPZH 1INQA 3QXUA 4GKSA 3I3EA 4IDLA 4QTHB 1AGEB 3ALPA 2DD8H 2O61A 1VFAB 5GRVL 2YD2A 1A6TB 1P4LB 4CMMB 4F7PA 2UYLA 4M48L 3T0BA 1JFQL 5CKAA 5HHQB 5I15H 4WDIA 4YUEH 2A73A 3QPQC 4PJCF 1AD9A 2EYTB 2LU7A 4QRRE 3LKRA 3RQ3A 3QIWD 2E27L 3TJHC 1CE6A 3DVNB 4Y5XB 2YUVA 4ZAKC 3D9AH 1ADQH 4M9OA 5HHNB 5ABDE 4GXUM 3C09B 4R0LB 4PY8I 4LAJH 3QWOB 3E2HB 1EO5A 1A6VL 2HLAA 5I66B 4FQXB 4OFVA 4XGZB 3NCBB 5E2WH 1XF2A 4PJDE 4XPFL 1YECL 3VFUA 3LB6D 1QSFB 4QRSA 2LFGA 5J89A 3FAWA 1C1EH 5T1KD 4BFIA 1UCBH 2EDRA 2QSQA 2NY2D 4PGDA 1QD0A 2JCCE 1ZEAH 3MLSL 4R2GD 1IRAY 4ZUVA 1WIPA 3OJVC 1ETZB 2P1YA 3THMH 3IDUA 4MLIA 2E9WA 1G7LB 2E7BA 2IQ9H 4PRAA 1T7WA 4BQCA 5DGQA 4X98A 5TE6H 1MQKL 3EIFA 1X44A 3P77B 4MNHB 4MJ6B 3X3GL 2V9RA 2XQBL 2AEQH 2F58H 1P69B 4K3GA 4R4FH 1P7KA 3FB6B 3EYUL 3K8KA 4KZDH 2NYYD 3VGFA 4U6VH 3KR3L 5DC0A 4ZQKA 5EU4B 1PD6A 1L6XA 2D7TH 4XMLL 5AWNL 2GUOA 4P2RE 3HZVA 3SGDI 4GSDH 3HLAA 4OTXL 1OQOA 1VEPA 1CS6A 1DQML 2VKWA 1E0OB 1FRGL 1KELL 1NSNH 4G6KL 4X9HA 3T65A 3NIGE 3DX7A 3MODH 2I9TB 4PJBA 2NY0B 1LO2H 1QSEA 1WTGT 2CD0A 4N0CC 4PJGA 4OF6A 2HRLA 1WFTA 3UTOA 5KANG 4LIQL 43CAB 2P5EA 1AQDB 2AABH 2Y06L 3GRWL 4Z7WA 3EDJA 4JZJB 4LRIA 4JRXA 3MJ8A 2QQNH 3U7AA 3MRNA 2PN5A 3G5XA 4JM4L 5JIPA 4GKNA 5DJ8A 4PJAB 4EEEA 2XY1A 3AMLA 4I3RH 5DMYA 4Q6YA 4N8CH 5FYKD 1QFWH 1GPOH 2Q6WA 4WTWA 1PG7H 3O3AA 1J8HB 1DVFA 4DGIL 4TSCH 5GGRA 4QTIL 5F7LB 1JGDB 1Z3GH 3HE6C 4O51A 2FWOB 4PP1D 5FKAB 3D39D 3GKWH 3KLAB 3QUMB 4JAMA 3UTSB 1DSFH 2YPLE 5BS0B 2ZOKB 4LASL 1QG3A 1TITA 3AB0C 4TNVK 3L5XL 1LEIA 1JGUH 5KAQG 3QJHB 1QBLH 5BO1H 4OLVL 5CEZH 1HNGA 4PYHA 1NMBH 1OAQH 4WY7L 4XXCA 4OCYH 3UTZA 2F9BT 1F97A 3KJ6L 3FO0H 1CDJA 3D69A 4N90D 4MVBC 4UQ3B 1EBAA 4QT5B 2H41A 1RPQA 4G7VL 4J7RA 5INCB 2GJZA 5IESL 2X1WL 3G5YB 1RJZB 3ZT7A 2E8ZA 4OD1H 3N1PC 3WFCL 4KXZI 3UJTH 3VXOB 4WNQA 1C08B 4YNYB 4CN6A 3HZMB 5H35A 3SDAD 5DVMA 4ODHH 3VE0B 3V4PH 1OAYH 2X4PA 2YC1B 3UPRA 4HC1L 3REVB 1QZ1A 5DMGD 1AP2B 4PB9H 5D1QA 4LSRH 3ABZA 2DQJL 3WIFB 4OI9A 3RWEB 1R5IA 4LGRB 1M7IB 1UWGL 4LP4A 1T1ZB 3TF7C 3FQUB 4EXPX 1T2QH 2AK4A 5JPMB 3HI5L 3JBG7 1SBBA 5DQDH 4XAWH 1AO7E 5DJYB 1AGBA 2DIJA 1G9MC 3JWDL 5B3JF 4K3DL 4X6DF 5DJDB 1MCLA 1IKFH 5EUOE 3RPKA 5JQHC 2NZ9C 2DWEA 4LSSH 4NJ9H 4OLXH 3IDYB 4XH2A 3QEUA 4Y89A 3ZDYF 2D7QA 5J8OA 3OR7B 3DUUA 5C0AA 4L3EB 4HUNB 5E4IA 5AG8A 1AKJD 1DBML 4BM7A 4JRYA 2F5BH 3BYTA 3SKMB 4OLWH 3EW3B 1ED3A 2R15A 4RFOL 5ID1A 1U95B 3PP4L 1T5WA 4PFEA 1IAIH 4N8PA 4TTDC 1JWSB 1NFDA 1YYML 3PWLA 4MQXD 4S1RH 3RVVC 3C6LC 3N9GL 5HYSA 4OCNC 3VWJB 3C8KA 3VJ6B 2IADA 4Y4KC 2NNAA 1WZMA 3QEQB 4QY8B 5T3ZH 4HUXA 2Q8AL 4KV5F 3OAUH 4P0DA 3QO1A 5F7DB 1PYWA 4M6NH 4I48B 1JPGB 1I1YA 3X3FH 1U3JA 4D9RD 3QUXA 1DQJB 1KCKA 5C0CA 5IW1A 5E24E 4H8WL 4LF3B 4CAGA 1KENL 1YQ2A 1XCQB 1T80A 3P11L 2DMKA 5CSBA 1XGQA 3L7FA 3ZHDA 1CF8L 3O8XC 3DRTA 4PJ5D 4ZNEE 1S5HA 1NLDH 3CSYA 3MNVB 1OVZA 2NTSP 3UO1H 1C5BL 4AYFA 1AC6A 1G7HA 4OZIB 1KCVL 1J1XL 2AW2A 2Y9RT 4HFWA 2Z8RA 3TN0A 3KAAA 4YQXH 3CH1A 2YZ1A 2OJEA 4X5WB 1DE4B 1Q94B 3MLTA 1SJXA 4G8GD 5JA8B 1CGSL 2AV7A 5IW6B 3H6JA 1F5WA 3B5HA 3PQYB 3VGGA 1VADB 1QLRA 3LS4L 2O5XL 4YHNB 3W82A 3FB5A 4MSWA 4D0CB 1H8NA 3WJLC 3CDYA 3MLYL 4JVPA 5TDPB 1Z6JT 4A2MA 1G0DA 5I1JL 3UTTA 3H7BA 2YPKB 3ZKNC 4NN7B 4HUUA 2DYPB 2XWTB 1NFKA 2ZCLH 3O3EB 3CLEH 3U7YL 1RULL 4POZC 5C7XH 4ZOBA 3BPLB 4KHXH 1F2QA 1NGYB 5E08L 5D2NE 3AS3A 4CRPA 3F7VB 3V2AR 2R1WA 3FHAA 4KRPB 3ETBF 1T1WA 5DHXB 1CYGA 5F9JB 1MLBB 2IGFL 3ROLB 3IJYA 1KPUA 1YEHL 4NQSA 3PWUB 3F8UB 1MHCA 4FQXD 4OB5H 4DGYH 1CLYH 4L1DA 4HUVA 2YA1A 3C60C 5KN5B 3GO1L 3QJFA 2AS5M 1OGTA 1QSFD 3FO9A 2A6KB 4HLZH 4AK1A 3S34L 1GGCH 4PRHA 4UU9A 4OAWB 1CXHA 3MRCA 3SOBH 4LSQH 1XF3B 3JV4A 5DI8A 3LKPA 3HR6A 2MPAL 1GIGL 2AXGA 2C7UB 3MLZH 3RWDA 1GGUA 3TNMB 1ZVSA 4E0RB 4Z0BL 4OGYL 4S1DC 4UT9H 1ITBB 1LVEA 1FIGL 5C6TL 1RK0B 4IRZH 1LO3L 3RZCA 1TZIA 3BGMB 2K7QA 2E7CA 1L7TH 3GSRA 3V5DA 3O6KH 5K9OA 2VL5B 1MCHA 3VXUD 3HMWL 2JJSA 3RU8H 3PNWA 1X5IA 2DQUL 5KSBA 5IFHH 4ZUUB 5K9KA 2GITB 5D1ZA 1LDPL 4EOWH 1BJ1J 1CGVA 1TLKA 2VDQH 3ROOA 4XCNA 3T3PE 4GW1B 3VH8G 1C5DB 5ANMA 1G0XA 3WDIA 4GG8A 4WFGE 3PXHA 3QCUH 4O4YH 4L4JA 2WBKA 3VXSD 5DJZA 2ATKB 5CCKH 1J7VR 1KIRB 3U46A 3QIWC 2A9ML 4TUKH 5GISH 2HT3D 4KGLA 4XX1E 4F58H 2KQNA 3DSNA 4L4TE 5EU3B 5FYJH 4RMSA 1QHOA 3PHQA 1ORSB 2CDEA 4M7LL 4TULH 5H94A 5KS9F 2EYRA 4LHUA 1OF2B 2FYYB 4NQEA 3LB6C 4CW1B 1UEMA 2MQ3A 1CE1L 3FQXB 4HKXA 1MF2H 5C8JA 1B3JA 5FYLE 4RMUA 4F7TA 4HF5H 4JREB 3UZQA 1KLGA 3P9LA 4R97C 4WIQA 1OP5K 5CD5D 3UTPE 3BHBB 1WQVT 1J8HD 3C2AH 4MCZB 5FUZL 4Y8DC 4RFNC 5DURD 5DSCA 5MEQB 5SX4H 4N9GA 3QZWA 1FVCB 4WI3A 4POYA 4AM0A 3PUCA 1OW0C 2X9XA 3V0AC 1S9VA 5DMKB 4G6JH 4I0KA 2SEBA 1RZGA 4M3KB 3MLXL 3ULVC 4DOHB 4UOW1 3SKNA 1U8NB 2PUQT 3P4NB 1IGIH 4B50A 4XAKE 1VFBA 5DJ0A 2VXVL 3G6DL 4G6ML 4KTEL 1MIMH 1IEAA 2YUZA 3DX9B 2VXQH 3O4LB 4YHKH 3T3ME 1XCTA 1S9WB 2BXZA 3X14B 2CQVA 4OF7A 1FL5B 1I7RB 4WV1B 4ZDHB 5AAMA 3FRUB 3W81A 1QEWA 2QSTA 1NGZA 3IDNA 1X7QB 3LKQA 2VITB 5C0RL 1UYWL 1MCQA 1TNNA 1HQRA 4IRJB 1A9EA 2FRGP 5HYJB 3RHWK 3S5LB 3F5WB 5IIEA 1KPVB 4K23H 3IF1A 1KCUH 4E41A 5LQBH 1DLHB 3DXAD 3DVIA 3MV7E 1U6AH 5FUOL 3U30C 2OSLB 1NCTA 1IAII 4ZUWB 4Y1AE 5EOCL 5FEBA 4FQJL 5H37H 2ORBH 4GRWE 1ZANH 4D8PA 3ARGB 2WP3O 4X6CE 3WIIL 5FECB 4X5XB 2XG4A 1AQKH 1MY7A 5FHAH 5IJVA 1G7MB 3OWEA 5D7JC 1RSFA 3IJHA 3OKEA 1OPGL 1F6LL 4WEBH 1KV3A 3ESVF 4I4WB 3M17B 4M8QA 5D7LE 3W39B 3O81A 3BAEH 5ENWA 2VDLL 5MENE 4L3ED 5D9SB 4QXGH 1UZ6E 4PJ7F 1IM3B 3HTLX 3QDGB 5I9QC 1FLTX 4XHJC 1DDHB 4QRRA 5EBMB 5E7BA 5LGKA 2ZUQB 5ETUB 4NRXA 1OGAE 4N8VA 1U58B 5IG7A 2ADFH 5DJXA 2XZAL 4JG0H 3ULUE 3IXAA 4K71B 3NFPA 4BSVB 5FO8A 2NZIA 3PWPA 3K7UA 1A64A 2CGRH 2XA3A 4PJDA 5IEHA 1F3DH 2Y36H 5J3HD 3O6FB 1U8MA 1E4XL 1I7UB 5ILTH 3SDAC 3X11A 5C9JA 4QWWC 4YXLL 2ERJC 3RWGA 4MS8D 5J12B 1CLZH 2EIZB 2JCCA 2FGWH 3GHBL 1WZ1H 4IBLT 3GI9L 4U1NB 3QNXB 2WP3T 4LPYA 3HHRB 1SJEB 2PYEB 2NY3C 5ITFB 5D1XB 1YN7A 3F6IA 4G9FE 1BOGA 2X40A 4JM2F 5JXAL 1RU9L 5CGMA 4HPYL 4I77H 2HFFA 2GKIA 1QLEL 4MA3A 3PWJB 3KPOB 3S96B 4RA3A 1S7UB 3QCVL 1RHHB 2HH0H 5F3BA 3QG6B 2ICES 2DWDB 4I0PB 1CT8A 5EORH 4IS6A 3C8HA 3O2DA 2Q1EA 2WINB 3DYMA 3WO3B 2W65A 4CKVX 5LVEA 3GSXB 1CVRA 2YD9A 4P2RA 3L3DA 1UG9A 3MACL 2DYPD 1EZVY 4JZNA 3MYJA 3QT2A 1VGKA 2IAMB 4HJJH 1D9KC 4KUZH 1A6AA 5DHYB 1I8KA 3VH8B 4ODXB 2OR9L 5DVKA 3ZHKA 2VUOA 1JHKH 3QUYB 4X6BA 2HFGH 5C6PB 3VGEA 3MXWH 3RY6C 1WBYB 2HYMA 2NY7H 3QXDB 5IF0A 1FLRL 5TQ0L 3RUGF 3TVMB 1JZ5A 3BKJH 2CDFA 4J3TA 5IKCA 5HY9A 1CFTA 4LGSB 1A7OL 2FB4L 2FBJL 4P4RA 3RVTC 2WV3A 2NW3A 3PL6A 5DJCB 1KJMB 4P48A 2X41A 2Q8BL 1RIHL 1MLCA 2DQGH 1X5GA 2MTPA 1DUZB 4K8RH 1MAML 2FL5A 5EOTB 4XVTH 5IVXE 5E5RB 5CZXD 1NGWA 4EDXA 1WWAX 2DKUA 4IRSA 1CLOH 1MCNA 3KPSE 4GXVL 1E4KC 5I71B 4YWGL 3L3JB 5HHPA 4R3SB 4X0KA 1QPPA 5HVHC 3KPRE 2YPLA 3MV8D 5E9DB 5F8QC 1ZHKB 5DDHB 3BZEB 3DTXB 4UIKL 2D31B 5GSVB 5E2UH 1ZGLA 4YDVA 1R6VA 5D5MF 4EI5C 3GSOA 2F8OA 1MJJB 4R7DA 4NKOB 5I6XC 4QYOA 5BV7H 4DFIA 1BAFL 4X80H 5JOEA 4RSVA 4XMPH 4RWYL 2VLKE 4AT6B 3WE6B 3SPVB 4K3JH 2ZCKL 4BZ1L 5GS0L 4O2FB 4C56B 1AR1D 5E6ZA 1XFPA 5HGGS 3NAAH 3FKUS 4M1CC 3RGVB 3D85A 1GGIL 4GBXA 4PPTA 2I07A 1BFOB 5TE4H 4DN3H 3B2VL 4FNLL 3AC0A 3QXTA 1H8SA 4Y4HA 5I8OL 1NJ9A 3B9KB 1HDMA 3CK0H 1NUGA 3BEVA 4NIKB 4Y5XC 3SKOA 4BYHA 4IJ3B 2HKHH 2IF7A 3C09C 4R0LC 4G8IA 3VXPA 5JNYB 4NRYA 4ZUSA 4QHUA 4AEHH 4ZPVA 3E2HC 3I6LE 4KKBD 3RVXD 1EEQA 4G80A 4M9PA 2Z91B 4FQXC 4F9LA 4R9HA 4XPTL 1LHZA 4HBCH 2UWEE 4YHIA 3ARFB 3OJ2C 1V3LA 1B90A 3DV6B 5D2LF 2B4CH 5FDWA 1AO7A 3KPMB 5CJXA 3LDBB 2Y23A 1T20B 1S7WA 3DLQR 2YKLL 5EUOA 1YNTA 3L9RA 3CVIH 1LD9B 2DI7A 3UXFA 4U3XA 4GRLA 1JGLH 1UFUA 2BMKB 3TPUB 3REWA 1CFQA 1YQVL 2X7LB 1LWRA 3A6CL 1KN2L 2HG5A 5MHSD 2J8UF 2JF1A 4MQTB 4KTDH 2CIIA 1KXTB 4S11A 3H9HB 5ESQB 1FN4B 4LKXB 4H26A 1E4XI 3RWIA 1N0XL 5DC4B 3MO1A 4LSVH 4L29B 5IB3A 1A7RH 1IJ9A 3P40A 2D7MA 4EIZC 5JIIA 4WUUD 4CADB 1KNOA 5EIIA 3LN4A 2BVUA 4NM4H 1EV2E 3ULSB 5ACLA 3O4LD 1REIA 1EO7A 5EU7C 2XICA 3VXME 5FM5M 1FYTD 1W0VA 3IU4L 1DN0A 1DQLL 3G5VA 1HWHB 2NY0C 4F57L 4NO3B 4TOYH 1TIUA 3HZYA 3VRIA 4LQ1A 1WIUA 3EO9L 4UT7H 5JHLH 2GCYB 3QRGL 1FZJB 5CBAB 5L7XH 1JWUB 1HXMA 2O61B 3MLUH 4ZNEA 5HYJD 2YPVH 1EXUB 3P9MA 4JZJC 2EH8L 1UM5L 2PYFB 3RDTB 5JO5A 4F7PB 3P4OB 5C0DA 3TO4B 5GRUL 1DQQA 1PLGL 4FXKB 1UZ8B 1EERB 1FNSL 4WWKB 3GK8H 2PTUA 3ARGD 2FO1A 3BKCH 4WI2A 5DEZA 4DZBA 3VMNA 4K55A 1XR9B 5HYSG 1IE5A 4YXKL 4AEEA 1INEL 5HDLA 5AYQA 4TNWF 4UNUA 5JA9A 2LABA 4WFFD 3LKSA 4MNQD 1E4WH 4AIOA 3KLHC 1XF2B 2IPKA 4WUKL 2ZPKH 3WBDA 3ZDZE 3HFMH 5D7KD 6CGTA 3B43A 1R24A 3QDJE 2BNRE 4IOIA 4XWGH 5D2NA 5I0DA 2UZYB 4OZHF 4PGDB 3AS0A 4MAUL 2C1PA 5FB8A 1QA9A 2HJLA 4ZUVB 3BX7C 1WSST 5KSAB 3VMPA 5FUCC 4IMLB 2OMBA 5C09E 2R4RH 4PRAB 1INDH 3PABA 1OTUD 4OCSH 5IMMA 3S35L 3O6FD 4UTAL 2DDQL 4HCRH 1IQWH 4XNMA 1S9XB 2W0LA 1SMOA 3GBNH 1KTRL 2NLJA 4ORGA 2ED9A 4ZQKB 4PGBB 1D5XB 3SDDA 2X70A 3L5JA 5F6HI 1OSPH 3VMOA 1KT2B 2GUOB 1CK0L 4KMQA 3R0MA 2PYED 3MJ7A 5T3ZD 1T0NA 12E8H 1A1NB 4P46A 5D1XD 4JKPL 2C4FU 3TH4T 5C0FB 3ARRA 5IGXL 4MJIA 3T65B 4JPVL 3CDGB 4G6FD 1ZV5A 4S0TD 3GM0A 2ZUWA 1HWGB 4S1SL 4P23D 4U2YA 1KEGH 3X13A 1V3MA 4I0PD 3C9NA 5EZJB 1EAPA 5C08D 3BI9X 3IDYC 4Z7VF 2EC9U 4TVPL 1K6QH 1DN2A 2Z0BA 4QRPE 3D25A 1OWRM 1S5IL 1JHTA 4CU8A 3VFTB 5FKPB 4DVBA 5DJ8B 4FOMA 4PRIE 1MNUH 2IAMD 3BP6A 4OQTH 1XEDA 5F9AC 3SHSA 4HUMB 2Q6WB 1IEBA 4KPHL 2FX9H 2H2PD 1CDBA 1EK3A 4MXWL 4JFDE 4YPGA 5F1KC 5FYJU 5GGRB 1F11A 3TVMD 4I2XE 4L4TA 4O5LL 3VWJC 4YGVA 5J1AA 3VFGH 1JV5A 4XVJH 1MAJA 4DVRL 4U1KA 5DVNA 2P48B 5HYQA 2J6EA 1FCCA 1VPOH 2WIIA 3ZTJH 5K9QG 4YFLF 5E00A 3LMJH 1LDSA 1PZ5A 3I9GL 2CR6A 3BOVA 4JJ5A 3HG1E 2A0LD 2GTWB 1ACYL 3G08A 4OD2A 3D69B 4WFED 2HTKD 4PUBL 5BZDB 3U0PA 2R2BB 4KRLB 5CUSH 4J4PC 4LBEA 2GJZB 3FHQA 4J2XA 4CNIA 2R0LH 3ME0A 1JGVH 5E9DD 5INDA 1IC7L 1EMTL 5C6WH 5IV2A 1B2WH 3RY5A 4ODVL 3MRFB 1UH3A 4W6WB 3WSQH 2FD6H 1FORL 3P0GB 4U1GC 4M62H 4MLSA 2Z93A 3QXWA 2FEDC 5EBWA 4F80A 1AJ7L 1FVEA 5F71A 3AUVA 4L1HA 1MJ7H 4LHUG 4LEXL 4LNVA 4UINL 5KSUA 2JJWA 4NP4L 4YDKL 3KPPB 4Q6IA 5A2LH 4NN7C 2AK4B 1IGTA 1UB6A 2GW5A 1CWVA 1AGBB 1EHLL 3BPLC 2PXYB 3B9KD 4NO2B 5EU5B 1C5CL 2CLZB 3BP4A 3MROA 4KRPC 4XP5L 4HWBH 1WICA 4NUJA 1CL7L 1FC2D 2DWEB 5I8CB 1M1SA 3QEUB 5ISZD 3VRLE 4YHLL 4Y2DA 2IANE 4LAQH 4NQCA 5B3JE 3FRPA 4OUUA 5C0AB 3MV7A 3EBAA 4LP5A 3UPAA 3FFCD 4X6DE 1AFVH 3Q3GA 3EFFB 5IBTL 4Y1AA 1NAML 3MUJA 3WDHA 3FN0L 1FG2A 4XB7A 2DBLL 1ED3B 3ZDYE 2NX5B 4KDWA 4X6CA 5CZXC 2GSGA 5E8OA 2AJXL 3TYGH 5ID1B 1QFPA 3I02A 5T1MA 2HJFA 5C0ND 5F89B 5L6YH 5DEGB 2WZPD 1D3CA 3C8KB 1PX4A 4FN0A 3ZTJG 4HUXB 1IL1A 1SY6A 4LSPH 5D7LA 3QO1B 1XGUA 4U6XA 4W4OC 5HDQH 5MENA 4ELKA 4DTGL 2BVPB 5IVZA 1G9NL 4H88H 3RNQA 5GGTA 4PJIF 3P73A 5TF1H 3FCTA 2YOCA 4F37K 1RJLA 3LOWA 5IR1B 5IW1B 3V4UH 3J7HA 2PNDA 1VDGA 5L2KE 3CZFB 3STLA 5E99L 4ERSH 1XGQB 3L7FB 3OPZL 4Z5RA 5C0BE 3QXAB 4KV5E 1OGAA 3DRTB 3T0EE 1S5HB 3SDCD 5J57B 1WBZB 2DQTH 3IT8D 3CSYB 2XTLA 1IVLA 5T3XE 4FZEL 3K2UH 2QR0B 4WTXA 4EUPH 5KW9L 1BLNA 7FABL 1RIUL 3MRDB 4XXDB 1EJOH 2GK0B 3ARVA 3L6FB 4Z78B 3IDMA 1I4FA 2DJSA 1OAUL 4FFWD 2EXWD 5SWZB 1H5BB 2DL2A 3HPJB 5EN2A 3C87A 3WXWL 2VTFA 1GJIA 2W60A 4R7NA 2EC8A 2G60H 4PTTB 5K9QI 2D7PA 3PJSB 2VH5L 2YBRA 1FHGA 5MP6H 4LEOA 3EAKA 2N56A 3OF6A 4J1UA 4NGHH 3TWCL 1A4KB 3HUJF 1C1EL 4DK6A 5IFJA 4R26L 1DBKH 4N8VG 4WWKD 5HGAA 5JHDE 4JREC 4L4VB 3WLBB 3TIDB 1ZEAL 3LKNA 4JLRB 4L3AA 3NIDF 1DUYA 3IDIA 4URTB 1HH9B 3IJYB 1KPUB 2VLLA 1SEQL 1KPRB 2X05A 4HS3A 4J3OC 1G0YR 4WGVB 3TH3T 1HYSD 4JPIA 4TSAL 4BJLA 3L1OL 3O2DL 3VRJA 1A6PA 4GG6B 3IRPX 5TJWK 1CD0A 4PRHB 4UU9B 1J0ZA 4ETYA 5F1NA 1T6WA 3JV4B 3LKPB 5DI8B 3VD3A 1BMGA 4NC2B 2AXGB 2RAMA 1OLLA 2CIKA 1Q0XH 2R69L 3GBMH 3BH8A 5KSAD 5FO9A 4YX2L 3MV9E 4DUWA 3BN9C 3AREB 3RBGA 1QQDA 2HRPH 3ARDA 4BSWA 3IDXL 3GSRB 1RMFL 3M8OL 3MJ9H 5ICYA 2W0PA 1OT2A 2GFBB 2KZWA 5IVXA 4IRJC 5JOPD 4U3HA 5K9KB 2Y7QA 1MIEL 4Z8FL 1EUUA 4QGTA 4QNPF 3QUZA 1ZA3B 2AABL 4HEPG 1MJUL 4RMWA 3CFBA 4GAJH 4LKCA 3RIAF 3SCMB 4PJEF 2B20A 1YEEL 2XTJD 2R1XA 1EBPA 2QKIB 3IKCA 4XCNB 3KPRA 3I2CL 5F7EL<