5TEGA

Crystal structure of hsetd8 in complex with histone h4k20 norleucine mutant peptide and s-adenosylmethionine
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
b'KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-lysine methyltransferase KMT5A
molecule tags Transferase
source organism Homo sapiens
publication title Turning a Substrate Peptide into a Potent Inhibitor for the Histone Methyltransferase SETD8.
pubmed doi rcsb
total genus 46
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5tegA00
3VV0A 5F6LA 3RJWA 4J83A 2O8JA 4JDSA 2RFIA 4I51A 4C1QA 4IJDA 3KMAA 1N6CA 3F9WA 2JV0A 3RIBA 3RU0A 3OS5A 3S7DA 2BQZA 3F9YA 3BO5A 3PDNA 5KJMA 5HI7A 3RQ4A 4BUPA 3K5KA 3M55A 3CBPA 3S7JA 4O30A 4QENA 4RZ0A 3HNAA 3KMJA 1MVHA 1N3JA 3M57A 4Z4PA 4QEOA 3CBMA 3OXFA 3TG5A 4AU7A 3SWCA 5ARGA 1N6AA 5TTFA 5KJLA 5EG2A 1ZKKA 5T0MA 3S8PA 5KJNA 3M53A 3EP0A 5HQ8A 2R3AA 4H12A 4O6FA 3M54A 3SW9A 4LDGA 3IHXA 1ML9A 3FPDA 3F9XA 3F9ZA 5KJKA 3QWWA 5CCLA 4NVQA 3MO2A 3RAYA 5CPRB 4J7IA 5AYFA 4YNDA 3OOIA 5TH7A 3OPEA 3M56A 4NJ5A 3M5AA 1PEGA 5F6KC 4YPAA 4E47A 3CBOA 4JLGA 1MUFA 1O9SA 3OXLA 3QWVA 3M59A 3S7BA 4YPEA 5T5GA 5LSZA 3QWPA 4QEPA 4FMUA 2W5ZA 4YNMA 3M58A 3MEKA 3MO0A 1MVXA 5EX3A 3N71A 5CCMA 5JIYA 3DALA 2F69A 4MI5A 3TG4A 2QPWA 5TEGA 5F59A 4YPUA 4WUYA 4YNPA 5T0KA 5F5EA 1MT6A 3VUZA 1H3IA 3DB5A 4MI0A 2W5YA 5JINA 2G46A 5ARFA 5JJ0A 5LSXA 2IGQA 4IJ8A 3KMTA 3MO5A 3S7FA 1XQHA 5EX0A 4J8OA 5JHNA 3OXGA 4J7FA
chains in the Genus database with same CATH superfamily
3VV0A 5F6LA 3RJWA 4J83A 2O8JA 4JDSA 2RFIA 4I51A 4C1QA 4IJDA 3KMAA 1N6CA 3F9WA 2JV0A 3RIBA 3RU0A 3OS5A 3S7DA 2BQZA 3F9YA 3BO5A 3PDNA 5KJMA 5HI7A 3RQ4A 4BUPA 3K5KA 3M55A 3CBPA 3S7JA 4O30A 4QENA 4RZ0A 3HNAA 3KMJA 1MVHA 1N3JA 3M57A 4Z4PA 4QEOA 3CBMA 3OXFA 3TG5A 4AU7A 3SWCA 5ARGA 1N6AA 5TTFA 5KJLA 5EG2A 1ZKKA 5T0MA 3S8PA 5KJNA 3M53A 3EP0A 5HQ8A 2R3AA 4H12A 4O6FA 3M54A 3SW9A 4LDGA 3IHXA 1ML9A 3FPDA 3F9XA 3F9ZA 5KJKA 3QWWA 5CCLA 4NVQA 3MO2A 3RAYA 5CPRB 4J7IA 5AYFA 4YNDA 3OOIA 5TH7A 3OPEA 3M56A 4NJ5A 3M5AA 1PEGA 5F6KC 4YPAA 4E47A 3CBOA 4JLGA 1MUFA 1O9SA 3OXLA 3QWVA 3M59A 3S7BA 4YPEA 5T5GA 5LSZA 3QWPA 4QEPA 4FMUA 2W5ZA 4YNMA 3M58A 3MEKA 3MO0A 1MVXA 5EX3A 3N71A 5CCMA 5JIYA 3DALA 2F69A 4MI5A 3TG4A 2QPWA 5TEGA 5F59A 4YPUA 4WUYA 4YNPA 5T0KA 5F5EA 1MT6A 3VUZA 1H3IA 3DB5A 4MI0A 2W5YA 5JINA 2G46A 5ARFA 5JJ0A 5LSXA 2IGQA 4IJ8A 3KMTA 3MO5A 3S7FA 1XQHA 5EX0A 4J8OA 5JHNA 3OXGA 4J7FA
chains in the Genus database with same CATH topology
3VV0A 5F6LA 3RJWA 4J83A 2O8JA 4JDSA 2RFIA 4I51A 4C1QA 4IJDA 3KMAA 1N6CA 3F9WA 2JV0A 3RIBA 3RU0A 3OS5A 3S7DA 2BQZA 3F9YA 3BO5A 3PDNA 5KJMA 5HI7A 3RQ4A 4BUPA 3K5KA 3M55A 3CBPA 3S7JA 4O30A 4QENA 4RZ0A 3HNAA 3KMJA 1MVHA 1N3JA 3M57A 4Z4PA 4QEOA 3CBMA 3OXFA 3TG5A 4AU7A 3SWCA 5ARGA 1N6AA 5TTFA 5KJLA 5EG2A 1ZKKA 5T0MA 3S8PA 5KJNA 3M53A 3EP0A 5HQ8A 2R3AA 4H12A 4O6FA 3M54A 3SW9A 4LDGA 3IHXA 1ML9A 3FPDA 3F9XA 3F9ZA 5KJKA 3QWWA 5CCLA 4NVQA 3MO2A 3RAYA 5CPRB 4J7IA 5AYFA 4YNDA 3OOIA 5TH7A 3OPEA 3M56A 4NJ5A 3M5AA 1PEGA 5F6KC 4YPAA 4E47A 3CBOA 4JLGA 1MUFA 1O9SA 3OXLA 3QWVA 3M59A 3S7BA 4YPEA 5T5GA 5LSZA 3QWPA 4QEPA 4FMUA 2W5ZA 4YNMA 3M58A 3MEKA 3MO0A 1MVXA 5EX3A 3N71A 5CCMA 5JIYA 3DALA 2F69A 4MI5A 3TG4A 2QPWA 5TEGA 5F59A 4YPUA 4WUYA 4YNPA 5T0KA 5F5EA 1MT6A 3VUZA 1H3IA 3DB5A 4MI0A 2W5YA 5JINA 2G46A 5ARFA 5JJ0A 5LSXA 2IGQA 4IJ8A 3KMTA 3MO5A 3S7FA 1XQHA 5EX0A 4J8OA 5JHNA 3OXGA 4J7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VV0 A;  5F6L A;  3RJW A;  4J83 A;  2O8J A;  4JDS A;  2RFI A;  4I51 A;  4C1Q A;  4IJD A;  3KMA A;  1N6C A;  3F9W A;  2JV0 A;  3RIB A;  3RU0 A;  3OS5 A;  3S7D A;  2BQZ A;  3F9Y A;  3BO5 A;  3PDN A;  5KJM A;  5HI7 A;  3RQ4 A;  4BUP A;  3K5K A;  3M55 A;  3CBP A;  3S7J A;  4O30 A;  4QEN A;  4RZ0 A;  3HNA A;  3KMJ A;  1MVH A;  1N3J A;  3M57 A;  4Z4P A;  4QEO A;  3CBM A;  3OXF A;  3TG5 A;  4AU7 A;  3SWC A;  5ARG A;  1N6A A;  5TTF A;  5KJL A;  5EG2 A;  1ZKK A;  5T0M A;  3S8P A;  5KJN A;  3M53 A;  3EP0 A;  5HQ8 A;  2R3A A;  4H12 A;  4O6F A;  3M54 A;  3SW9 A;  4LDG A;  3IHX A;  1ML9 A;  3FPD A;  3F9X A;  3F9Z A;  5KJK A;  3QWW A;  5CCL A;  4NVQ A;  3MO2 A;  3RAY A;  5CPR B;  4J7I A;  5AYF A;  4YND A;  3OOI A;  5TH7 A;  3OPE A;  3M56 A;  4NJ5 A;  3M5A A;  1PEG A;  5F6K C;  4YPA A;  4E47 A;  3CBO A;  4JLG A;  1MUF A;  1O9S A;  3OXL A;  3QWV A;  3M59 A;  3S7B A;  4YPE A;  5T5G A;  5LSZ A;  3QWP A;  4QEP A;  4FMU A;  2W5Z A;  4YNM A;  3M58 A;  3MEK A;  3MO0 A;  1MVX A;  5EX3 A;  3N71 A;  5CCM A;  5JIY A;  3DAL A;  2F69 A;  4MI5 A;  3TG4 A;  2QPW A;  5TEG A;  5F59 A;  4YPU A;  4WUY A;  4YNP A;  5T0K A;  5F5E A;  1MT6 A;  3VUZ A;  1H3I A;  3DB5 A;  4MI0 A;  2W5Y A;  5JIN A;  2G46 A;  5ARF A;  5JJ0 A;  5LSX A;  2IGQ A;  4IJ8 A;  3KMT A;  3MO5 A;  3S7F A;  1XQH A;  5EX0 A;  4J8O A;  5JHN A;  3OXG A;  4J7F A; 
#chains in the Genus database with same CATH topology
 3VV0 A;  5F6L A;  3RJW A;  4J83 A;  2O8J A;  4JDS A;  2RFI A;  4I51 A;  4C1Q A;  4IJD A;  3KMA A;  1N6C A;  3F9W A;  2JV0 A;  3RIB A;  3RU0 A;  3OS5 A;  3S7D A;  2BQZ A;  3F9Y A;  3BO5 A;  3PDN A;  5KJM A;  5HI7 A;  3RQ4 A;  4BUP A;  3K5K A;  3M55 A;  3CBP A;  3S7J A;  4O30 A;  4QEN A;  4RZ0 A;  3HNA A;  3KMJ A;  1MVH A;  1N3J A;  3M57 A;  4Z4P A;  4QEO A;  3CBM A;  3OXF A;  3TG5 A;  4AU7 A;  3SWC A;  5ARG A;  1N6A A;  5TTF A;  5KJL A;  5EG2 A;  1ZKK A;  5T0M A;  3S8P A;  5KJN A;  3M53 A;  3EP0 A;  5HQ8 A;  2R3A A;  4H12 A;  4O6F A;  3M54 A;  3SW9 A;  4LDG A;  3IHX A;  1ML9 A;  3FPD A;  3F9X A;  3F9Z A;  5KJK A;  3QWW A;  5CCL A;  4NVQ A;  3MO2 A;  3RAY A;  5CPR B;  4J7I A;  5AYF A;  4YND A;  3OOI A;  5TH7 A;  3OPE A;  3M56 A;  4NJ5 A;  3M5A A;  1PEG A;  5F6K C;  4YPA A;  4E47 A;  3CBO A;  4JLG A;  1MUF A;  1O9S A;  3OXL A;  3QWV A;  3M59 A;  3S7B A;  4YPE A;  5T5G A;  5LSZ A;  3QWP A;  4QEP A;  4FMU A;  2W5Z A;  4YNM A;  3M58 A;  3MEK A;  3MO0 A;  1MVX A;  5EX3 A;  3N71 A;  5CCM A;  5JIY A;  3DAL A;  2F69 A;  4MI5 A;  3TG4 A;  2QPW A;  5TEG A;  5F59 A;  4YPU A;  4WUY A;  4YNP A;  5T0K A;  5F5E A;  1MT6 A;  3VUZ A;  1H3I A;  3DB5 A;  4MI0 A;  2W5Y A;  5JIN A;  2G46 A;  5ARF A;  5JJ0 A;  5LSX A;  2IGQ A;  4IJ8 A;  3KMT A;  3MO5 A;  3S7F A;  1XQH A;  5EX0 A;  4J8O A;  5JHN A;  3OXG A;  4J7F A; 
#chains in the Genus database with same CATH homology
 3VV0 A;  5F6L A;  3RJW A;  4J83 A;  2O8J A;  4JDS A;  2RFI A;  4I51 A;  4C1Q A;  4IJD A;  3KMA A;  1N6C A;  3F9W A;  2JV0 A;  3RIB A;  3RU0 A;  3OS5 A;  3S7D A;  2BQZ A;  3F9Y A;  3BO5 A;  3PDN A;  5KJM A;  5HI7 A;  3RQ4 A;  4BUP A;  3K5K A;  3M55 A;  3CBP A;  3S7J A;  4O30 A;  4QEN A;  4RZ0 A;  3HNA A;  3KMJ A;  1MVH A;  1N3J A;  3M57 A;  4Z4P A;  4QEO A;  3CBM A;  3OXF A;  3TG5 A;  4AU7 A;  3SWC A;  5ARG A;  1N6A A;  5TTF A;  5KJL A;  5EG2 A;  1ZKK A;  5T0M A;  3S8P A;  5KJN A;  3M53 A;  3EP0 A;  5HQ8 A;  2R3A A;  4H12 A;  4O6F A;  3M54 A;  3SW9 A;  4LDG A;  3IHX A;  1ML9 A;  3FPD A;  3F9X A;  3F9Z A;  5KJK A;  3QWW A;  5CCL A;  4NVQ A;  3MO2 A;  3RAY A;  5CPR B;  4J7I A;  5AYF A;  4YND A;  3OOI A;  5TH7 A;  3OPE A;  3M56 A;  4NJ5 A;  3M5A A;  1PEG A;  5F6K C;  4YPA A;  4E47 A;  3CBO A;  4JLG A;  1MUF A;  1O9S A;  3OXL A;  3QWV A;  3M59 A;  3S7B A;  4YPE A;  5T5G A;  5LSZ A;  3QWP A;  4QEP A;  4FMU A;  2W5Z A;  4YNM A;  3M58 A;  3MEK A;  3MO0 A;  1MVX A;  5EX3 A;  3N71 A;  5CCM A;  5JIY A;  3DAL A;  2F69 A;  4MI5 A;  3TG4 A;  2QPW A;  5TEG A;  5F59 A;  4YPU A;  4WUY A;  4YNP A;  5T0K A;  5F5E A;  1MT6 A;  3VUZ A;  1H3I A;  3DB5 A;  4MI0 A;  2W5Y A;  5JIN A;  2G46 A;  5ARF A;  5JJ0 A;  5LSX A;  2IGQ A;  4IJ8 A;  3KMT A;  3MO5 A;  3S7F A;  1XQH A;  5EX0 A;  4J8O A;  5JHN A;  3OXG A;  4J7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...