5TEGA

Crystal structure of hsetd8 in complex with histone h4k20 norleucine mutant peptide and s-adenosylmethionine
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Turning a Substrate Peptide into a Potent Inhibitor for the Histone Methyltransferase SETD8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase KMT5A
total genus 46
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5tegA00
2F69A 3CBOA 3VUZA 3QWVA 3M56A 2BQZA 3OPEA 3RIBA 3OXFA 5EX3A 3QWWA 5AYFA 5KJKA 3MEKA 4QEOA 3F9ZA 3M53A 1N6AA 2W5ZA 3QWPA 4NVQA 5F6LA 5KJNA 2IGQA 3SWCA 3CBMA 3EP0A 5TH7A 4RZ0A 3M55A 4C1QA 3KMTA 5F5EA 4E47A 3DALA 5HQ8A 4YPUA 4MI0A 3OOIA 3OS5A 3RQ4A 5JIYA 3F9YA 5CCLA 2RFIA 1MUFA 5JJ0A 3OXLA 4IJ8A 2R3AA 5T0KA 1MVXA 3M57A 3MO5A 1O9SA 4YPEA 1N6CA 5EG2A 4YNPA 2G46A 3SW9A 4LDGA 4I51A 4JDSA 5TTFA 4QENA 3MO2A 5F59A 5T5GA 3CBPA 3RJWA 4FMUA 3M54A 3TG4A 1MVHA 4H12A 4J8OA 2W5YA 3FPDA 4IJDA 5KJLA 4YNMA 1ML9A 2JV0A 5JINA 1MT6A 3PDNA 4QEPA 3M58A 3BO5A 4JLGA 3RU0A 5TEGA 3RAYA 3S7BA 1PEGA 3N71A 3VV0A 3S8PA 3F9XA 4O6FA 3TG5A 4BUPA 2QPWA 3K5KA 5LSXA 4O30A 3OXGA 4J83A 5T0MA 2O8JA 3DB5A 3S7JA 3M59A 5HI7A 4Z4PA 3S7FA 3IHXA 3F9WA 3S7DA 3KMAA 5CCMA 4YNDA 4NJ5A 5KJMA 3M5AA 1N3JA 5LSZA 4AU7A 3MO0A 5EX0A 5F6KC 5JHNA 4WUYA 4J7FA 1XQHA 5ARFA 4MI5A 1H3IA 3HNAA 4YPAA 3KMJA 4J7IA 5ARGA 5CPRB 1ZKKA
chains in the Genus database with same CATH superfamily
2F69A 3CBOA 3VUZA 3QWVA 3M56A 2BQZA 3OPEA 3RIBA 3OXFA 5EX3A 3QWWA 5AYFA 5KJKA 3MEKA 4QEOA 3F9ZA 3M53A 1N6AA 2W5ZA 3QWPA 4NVQA 5F6LA 5KJNA 2IGQA 3SWCA 3CBMA 3EP0A 5TH7A 4RZ0A 3M55A 4C1QA 3KMTA 5F5EA 4E47A 3DALA 5HQ8A 4YPUA 4MI0A 3OOIA 3OS5A 3RQ4A 5JIYA 3F9YA 5CCLA 2RFIA 1MUFA 5JJ0A 3OXLA 4IJ8A 2R3AA 5T0KA 1MVXA 3M57A 3MO5A 1O9SA 4YPEA 1N6CA 5EG2A 4YNPA 2G46A 3SW9A 4LDGA 4I51A 4JDSA 5TTFA 4QENA 3MO2A 5F59A 5T5GA 3CBPA 3RJWA 4FMUA 3M54A 3TG4A 1MVHA 4H12A 4J8OA 2W5YA 3FPDA 4IJDA 5KJLA 4YNMA 1ML9A 2JV0A 5JINA 1MT6A 3PDNA 4QEPA 3M58A 3BO5A 4JLGA 3RU0A 5TEGA 3RAYA 3S7BA 1PEGA 3N71A 3VV0A 3S8PA 3F9XA 4O6FA 3TG5A 4BUPA 2QPWA 3K5KA 5LSXA 4O30A 3OXGA 4J83A 5T0MA 2O8JA 3DB5A 3S7JA 3M59A 5HI7A 4Z4PA 3S7FA 3IHXA 3F9WA 3S7DA 3KMAA 5CCMA 4YNDA 4NJ5A 5KJMA 3M5AA 1N3JA 5LSZA 4AU7A 3MO0A 5EX0A 5F6KC 5JHNA 4WUYA 4J7FA 1XQHA 5ARFA 4MI5A 1H3IA 3HNAA 4YPAA 3KMJA 4J7IA 5ARGA 5CPRB 1ZKKA
chains in the Genus database with same CATH topology
2F69A 3CBOA 3VUZA 3QWVA 3M56A 2BQZA 3OPEA 3RIBA 3OXFA 5EX3A 3QWWA 5AYFA 5KJKA 3MEKA 4QEOA 3F9ZA 3M53A 1N6AA 2W5ZA 3QWPA 4NVQA 5F6LA 5KJNA 2IGQA 3SWCA 3CBMA 3EP0A 5TH7A 4RZ0A 3M55A 4C1QA 3KMTA 5F5EA 4E47A 3DALA 5HQ8A 4YPUA 4MI0A 3OOIA 3OS5A 3RQ4A 5JIYA 3F9YA 5CCLA 2RFIA 1MUFA 5JJ0A 3OXLA 4IJ8A 2R3AA 5T0KA 1MVXA 3M57A 3MO5A 1O9SA 4YPEA 1N6CA 5EG2A 4YNPA 2G46A 3SW9A 4LDGA 4I51A 4JDSA 5TTFA 4QENA 3MO2A 5F59A 5T5GA 3CBPA 3RJWA 4FMUA 3M54A 3TG4A 1MVHA 4H12A 4J8OA 2W5YA 3FPDA 4IJDA 5KJLA 4YNMA 1ML9A 2JV0A 5JINA 1MT6A 3PDNA 4QEPA 3M58A 3BO5A 4JLGA 3RU0A 5TEGA 3RAYA 3S7BA 1PEGA 3N71A 3VV0A 3S8PA 3F9XA 4O6FA 3TG5A 4BUPA 2QPWA 3K5KA 5LSXA 4O30A 3OXGA 4J83A 5T0MA 2O8JA 3DB5A 3S7JA 3M59A 5HI7A 4Z4PA 3S7FA 3IHXA 3F9WA 3S7DA 3KMAA 5CCMA 4YNDA 4NJ5A 5KJMA 3M5AA 1N3JA 5LSZA 4AU7A 3MO0A 5EX0A 5F6KC 5JHNA 4WUYA 4J7FA 1XQHA 5ARFA 4MI5A 1H3IA 3HNAA 4YPAA 3KMJA 4J7IA 5ARGA 5CPRB 1ZKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F69 A;  3CBO A;  3VUZ A;  3QWV A;  3M56 A;  2BQZ A;  3OPE A;  3RIB A;  3OXF A;  5EX3 A;  3QWW A;  5AYF A;  5KJK A;  3MEK A;  4QEO A;  3F9Z A;  3M53 A;  1N6A A;  2W5Z A;  3QWP A;  4NVQ A;  5F6L A;  5KJN A;  2IGQ A;  3SWC A;  3CBM A;  3EP0 A;  5TH7 A;  4RZ0 A;  3M55 A;  4C1Q A;  3KMT A;  5F5E A;  4E47 A;  3DAL A;  5HQ8 A;  4YPU A;  4MI0 A;  3OOI A;  3OS5 A;  3RQ4 A;  5JIY A;  3F9Y A;  5CCL A;  2RFI A;  1MUF A;  5JJ0 A;  3OXL A;  4IJ8 A;  2R3A A;  5T0K A;  1MVX A;  3M57 A;  3MO5 A;  1O9S A;  4YPE A;  1N6C A;  5EG2 A;  4YNP A;  2G46 A;  3SW9 A;  4LDG A;  4I51 A;  4JDS A;  5TTF A;  4QEN A;  3MO2 A;  5F59 A;  5T5G A;  3CBP A;  3RJW A;  4FMU A;  3M54 A;  3TG4 A;  1MVH A;  4H12 A;  4J8O A;  2W5Y A;  3FPD A;  4IJD A;  5KJL A;  4YNM A;  1ML9 A;  2JV0 A;  5JIN A;  1MT6 A;  3PDN A;  4QEP A;  3M58 A;  3BO5 A;  4JLG A;  3RU0 A;  5TEG A;  3RAY A;  3S7B A;  1PEG A;  3N71 A;  3VV0 A;  3S8P A;  3F9X A;  4O6F A;  3TG5 A;  4BUP A;  2QPW A;  3K5K A;  5LSX A;  4O30 A;  3OXG A;  4J83 A;  5T0M A;  2O8J A;  3DB5 A;  3S7J A;  3M59 A;  5HI7 A;  4Z4P A;  3S7F A;  3IHX A;  3F9W A;  3S7D A;  3KMA A;  5CCM A;  4YND A;  4NJ5 A;  5KJM A;  3M5A A;  1N3J A;  5LSZ A;  4AU7 A;  3MO0 A;  5EX0 A;  5F6K C;  5JHN A;  4WUY A;  4J7F A;  1XQH A;  5ARF A;  4MI5 A;  1H3I A;  3HNA A;  4YPA A;  3KMJ A;  4J7I A;  5ARG A;  5CPR B;  1ZKK A; 
#chains in the Genus database with same CATH topology
 2F69 A;  3CBO A;  3VUZ A;  3QWV A;  3M56 A;  2BQZ A;  3OPE A;  3RIB A;  3OXF A;  5EX3 A;  3QWW A;  5AYF A;  5KJK A;  3MEK A;  4QEO A;  3F9Z A;  3M53 A;  1N6A A;  2W5Z A;  3QWP A;  4NVQ A;  5F6L A;  5KJN A;  2IGQ A;  3SWC A;  3CBM A;  3EP0 A;  5TH7 A;  4RZ0 A;  3M55 A;  4C1Q A;  3KMT A;  5F5E A;  4E47 A;  3DAL A;  5HQ8 A;  4YPU A;  4MI0 A;  3OOI A;  3OS5 A;  3RQ4 A;  5JIY A;  3F9Y A;  5CCL A;  2RFI A;  1MUF A;  5JJ0 A;  3OXL A;  4IJ8 A;  2R3A A;  5T0K A;  1MVX A;  3M57 A;  3MO5 A;  1O9S A;  4YPE A;  1N6C A;  5EG2 A;  4YNP A;  2G46 A;  3SW9 A;  4LDG A;  4I51 A;  4JDS A;  5TTF A;  4QEN A;  3MO2 A;  5F59 A;  5T5G A;  3CBP A;  3RJW A;  4FMU A;  3M54 A;  3TG4 A;  1MVH A;  4H12 A;  4J8O A;  2W5Y A;  3FPD A;  4IJD A;  5KJL A;  4YNM A;  1ML9 A;  2JV0 A;  5JIN A;  1MT6 A;  3PDN A;  4QEP A;  3M58 A;  3BO5 A;  4JLG A;  3RU0 A;  5TEG A;  3RAY A;  3S7B A;  1PEG A;  3N71 A;  3VV0 A;  3S8P A;  3F9X A;  4O6F A;  3TG5 A;  4BUP A;  2QPW A;  3K5K A;  5LSX A;  4O30 A;  3OXG A;  4J83 A;  5T0M A;  2O8J A;  3DB5 A;  3S7J A;  3M59 A;  5HI7 A;  4Z4P A;  3S7F A;  3IHX A;  3F9W A;  3S7D A;  3KMA A;  5CCM A;  4YND A;  4NJ5 A;  5KJM A;  3M5A A;  1N3J A;  5LSZ A;  4AU7 A;  3MO0 A;  5EX0 A;  5F6K C;  5JHN A;  4WUY A;  4J7F A;  1XQH A;  5ARF A;  4MI5 A;  1H3I A;  3HNA A;  4YPA A;  3KMJ A;  4J7I A;  5ARG A;  5CPR B;  1ZKK A; 
#chains in the Genus database with same CATH homology
 2F69 A;  3CBO A;  3VUZ A;  3QWV A;  3M56 A;  2BQZ A;  3OPE A;  3RIB A;  3OXF A;  5EX3 A;  3QWW A;  5AYF A;  5KJK A;  3MEK A;  4QEO A;  3F9Z A;  3M53 A;  1N6A A;  2W5Z A;  3QWP A;  4NVQ A;  5F6L A;  5KJN A;  2IGQ A;  3SWC A;  3CBM A;  3EP0 A;  5TH7 A;  4RZ0 A;  3M55 A;  4C1Q A;  3KMT A;  5F5E A;  4E47 A;  3DAL A;  5HQ8 A;  4YPU A;  4MI0 A;  3OOI A;  3OS5 A;  3RQ4 A;  5JIY A;  3F9Y A;  5CCL A;  2RFI A;  1MUF A;  5JJ0 A;  3OXL A;  4IJ8 A;  2R3A A;  5T0K A;  1MVX A;  3M57 A;  3MO5 A;  1O9S A;  4YPE A;  1N6C A;  5EG2 A;  4YNP A;  2G46 A;  3SW9 A;  4LDG A;  4I51 A;  4JDS A;  5TTF A;  4QEN A;  3MO2 A;  5F59 A;  5T5G A;  3CBP A;  3RJW A;  4FMU A;  3M54 A;  3TG4 A;  1MVH A;  4H12 A;  4J8O A;  2W5Y A;  3FPD A;  4IJD A;  5KJL A;  4YNM A;  1ML9 A;  2JV0 A;  5JIN A;  1MT6 A;  3PDN A;  4QEP A;  3M58 A;  3BO5 A;  4JLG A;  3RU0 A;  5TEG A;  3RAY A;  3S7B A;  1PEG A;  3N71 A;  3VV0 A;  3S8P A;  3F9X A;  4O6F A;  3TG5 A;  4BUP A;  2QPW A;  3K5K A;  5LSX A;  4O30 A;  3OXG A;  4J83 A;  5T0M A;  2O8J A;  3DB5 A;  3S7J A;  3M59 A;  5HI7 A;  4Z4P A;  3S7F A;  3IHX A;  3F9W A;  3S7D A;  3KMA A;  5CCM A;  4YND A;  4NJ5 A;  5KJM A;  3M5A A;  1N3J A;  5LSZ A;  4AU7 A;  3MO0 A;  5EX0 A;  5F6K C;  5JHN A;  4WUY A;  4J7F A;  1XQH A;  5ARF A;  4MI5 A;  1H3I A;  3HNA A;  4YPA A;  3KMJ A;  4J7I A;  5ARG A;  5CPR B;  1ZKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...