5TEGA

Crystal structure of hsetd8 in complex with histone h4k20 norleucine mutant peptide and s-adenosylmethionine
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Turning a Substrate Peptide into a Potent Inhibitor for the Histone Methyltransferase SETD8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase KMT5A
total genus 46
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5tegA00
1PEGA 5TH7A 3DALA 1H3IA 4FMUA 5KJMA 4Z4PA 4JDSA 3DB5A 3K5KA 4YNDA 5EX0A 3PDNA 3SWCA 1N6CA 5EX3A 2W5YA 3MO2A 4J7FA 5CCLA 4O6FA 5ARGA 4IJDA 5T5GA 5CCMA 2BQZA 3CBMA 3CBOA 3CBPA 4JLGA 4QEPA 3QWVA 1MVHA 3F9ZA 5HQ8A 3F9WA 5JIYA 2JV0A 4MI5A 3QWPA 3TG5A 4NVQA 3IHXA 1MVXA 5JJ0A 3M58A 3OOIA 4YPAA 4YNPA 5KJKA 3QWWA 3S7DA 3M5AA 4MI0A 5F5EA 5HI7A 3MEKA 2R3AA 1MT6A 3S7BA 3KMTA 4LDGA 5T0KA 3M55A 5CPRB 1O9SA 4H12A 5LSZA 4QENA 5ARFA 3RU0A 3F9XA 3M57A 5JINA 3VV0A 2W5ZA 3OXGA 5F6LA 5EG2A 1N3JA 4WUYA 3RAYA 5F59A 5AYFA 3M56A 3F9YA 4RZ0A 3RJWA 4AU7A 3S8PA 4I51A 4C1QA 3M54A 4YNMA 4QEOA 3S7FA 1MUFA 3MO0A 3N71A 5LSXA 5KJNA 3M53A 4E47A 2G46A 4IJ8A 4O30A 5KJLA 4YPUA 1ML9A 3BO5A 1XQHA 2QPWA 1N6AA 2O8JA 3TG4A 4J7IA 2RFIA 3M59A 5F6KC 3RQ4A 5TEGA 1ZKKA 3OS5A 3SW9A 5TTFA 3S7JA 4YPEA 3EP0A 4J8OA 3OXFA 3OXLA 3RIBA 2F69A 3VUZA 2IGQA 5T0MA 4BUPA 4J83A 3OPEA 3HNAA 3FPDA 5JHNA 3KMJA 3KMAA 3MO5A 4NJ5A
chains in the Genus database with same CATH superfamily
1PEGA 5TH7A 3DALA 1H3IA 4FMUA 5KJMA 4Z4PA 4JDSA 3DB5A 3K5KA 4YNDA 5EX0A 3PDNA 3SWCA 1N6CA 5EX3A 2W5YA 3MO2A 4J7FA 5CCLA 4O6FA 5ARGA 4IJDA 5T5GA 5CCMA 2BQZA 3CBMA 3CBOA 3CBPA 4JLGA 4QEPA 3QWVA 1MVHA 3F9ZA 5HQ8A 3F9WA 5JIYA 2JV0A 4MI5A 3QWPA 3TG5A 4NVQA 3IHXA 1MVXA 5JJ0A 3M58A 3OOIA 4YPAA 4YNPA 5KJKA 3QWWA 3S7DA 3M5AA 4MI0A 5F5EA 5HI7A 3MEKA 2R3AA 1MT6A 3S7BA 3KMTA 4LDGA 5T0KA 3M55A 5CPRB 1O9SA 4H12A 5LSZA 4QENA 5ARFA 3RU0A 3F9XA 3M57A 5JINA 3VV0A 2W5ZA 3OXGA 5F6LA 5EG2A 1N3JA 4WUYA 3RAYA 5F59A 5AYFA 3M56A 3F9YA 4RZ0A 3RJWA 4AU7A 3S8PA 4I51A 4C1QA 3M54A 4YNMA 4QEOA 3S7FA 1MUFA 3MO0A 3N71A 5LSXA 5KJNA 3M53A 4E47A 2G46A 4IJ8A 4O30A 5KJLA 4YPUA 1ML9A 3BO5A 1XQHA 2QPWA 1N6AA 2O8JA 3TG4A 4J7IA 2RFIA 3M59A 5F6KC 3RQ4A 5TEGA 1ZKKA 3OS5A 3SW9A 5TTFA 3S7JA 4YPEA 3EP0A 4J8OA 3OXFA 3OXLA 3RIBA 2F69A 3VUZA 2IGQA 5T0MA 4BUPA 4J83A 3OPEA 3HNAA 3FPDA 5JHNA 3KMJA 3KMAA 3MO5A 4NJ5A
chains in the Genus database with same CATH topology
1PEGA 5TH7A 3DALA 1H3IA 4FMUA 5KJMA 4Z4PA 4JDSA 3DB5A 3K5KA 4YNDA 5EX0A 3PDNA 3SWCA 1N6CA 5EX3A 2W5YA 3MO2A 4J7FA 5CCLA 4O6FA 5ARGA 4IJDA 5T5GA 5CCMA 2BQZA 3CBMA 3CBOA 3CBPA 4JLGA 4QEPA 3QWVA 1MVHA 3F9ZA 5HQ8A 3F9WA 5JIYA 2JV0A 4MI5A 3QWPA 3TG5A 4NVQA 3IHXA 1MVXA 5JJ0A 3M58A 3OOIA 4YPAA 4YNPA 5KJKA 3QWWA 3S7DA 3M5AA 4MI0A 5F5EA 5HI7A 3MEKA 2R3AA 1MT6A 3S7BA 3KMTA 4LDGA 5T0KA 3M55A 5CPRB 1O9SA 4H12A 5LSZA 4QENA 5ARFA 3RU0A 3F9XA 3M57A 5JINA 3VV0A 2W5ZA 3OXGA 5F6LA 5EG2A 1N3JA 4WUYA 3RAYA 5F59A 5AYFA 3M56A 3F9YA 4RZ0A 3RJWA 4AU7A 3S8PA 4I51A 4C1QA 3M54A 4YNMA 4QEOA 3S7FA 1MUFA 3MO0A 3N71A 5LSXA 5KJNA 3M53A 4E47A 2G46A 4IJ8A 4O30A 5KJLA 4YPUA 1ML9A 3BO5A 1XQHA 2QPWA 1N6AA 2O8JA 3TG4A 4J7IA 2RFIA 3M59A 5F6KC 3RQ4A 5TEGA 1ZKKA 3OS5A 3SW9A 5TTFA 3S7JA 4YPEA 3EP0A 4J8OA 3OXFA 3OXLA 3RIBA 2F69A 3VUZA 2IGQA 5T0MA 4BUPA 4J83A 3OPEA 3HNAA 3FPDA 5JHNA 3KMJA 3KMAA 3MO5A 4NJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PEG A;  5TH7 A;  3DAL A;  1H3I A;  4FMU A;  5KJM A;  4Z4P A;  4JDS A;  3DB5 A;  3K5K A;  4YND A;  5EX0 A;  3PDN A;  3SWC A;  1N6C A;  5EX3 A;  2W5Y A;  3MO2 A;  4J7F A;  5CCL A;  4O6F A;  5ARG A;  4IJD A;  5T5G A;  5CCM A;  2BQZ A;  3CBM A;  3CBO A;  3CBP A;  4JLG A;  4QEP A;  3QWV A;  1MVH A;  3F9Z A;  5HQ8 A;  3F9W A;  5JIY A;  2JV0 A;  4MI5 A;  3QWP A;  3TG5 A;  4NVQ A;  3IHX A;  1MVX A;  5JJ0 A;  3M58 A;  3OOI A;  4YPA A;  4YNP A;  5KJK A;  3QWW A;  3S7D A;  3M5A A;  4MI0 A;  5F5E A;  5HI7 A;  3MEK A;  2R3A A;  1MT6 A;  3S7B A;  3KMT A;  4LDG A;  5T0K A;  3M55 A;  5CPR B;  1O9S A;  4H12 A;  5LSZ A;  4QEN A;  5ARF A;  3RU0 A;  3F9X A;  3M57 A;  5JIN A;  3VV0 A;  2W5Z A;  3OXG A;  5F6L A;  5EG2 A;  1N3J A;  4WUY A;  3RAY A;  5F59 A;  5AYF A;  3M56 A;  3F9Y A;  4RZ0 A;  3RJW A;  4AU7 A;  3S8P A;  4I51 A;  4C1Q A;  3M54 A;  4YNM A;  4QEO A;  3S7F A;  1MUF A;  3MO0 A;  3N71 A;  5LSX A;  5KJN A;  3M53 A;  4E47 A;  2G46 A;  4IJ8 A;  4O30 A;  5KJL A;  4YPU A;  1ML9 A;  3BO5 A;  1XQH A;  2QPW A;  1N6A A;  2O8J A;  3TG4 A;  4J7I A;  2RFI A;  3M59 A;  5F6K C;  3RQ4 A;  5TEG A;  1ZKK A;  3OS5 A;  3SW9 A;  5TTF A;  3S7J A;  4YPE A;  3EP0 A;  4J8O A;  3OXF A;  3OXL A;  3RIB A;  2F69 A;  3VUZ A;  2IGQ A;  5T0M A;  4BUP A;  4J83 A;  3OPE A;  3HNA A;  3FPD A;  5JHN A;  3KMJ A;  3KMA A;  3MO5 A;  4NJ5 A; 
#chains in the Genus database with same CATH topology
 1PEG A;  5TH7 A;  3DAL A;  1H3I A;  4FMU A;  5KJM A;  4Z4P A;  4JDS A;  3DB5 A;  3K5K A;  4YND A;  5EX0 A;  3PDN A;  3SWC A;  1N6C A;  5EX3 A;  2W5Y A;  3MO2 A;  4J7F A;  5CCL A;  4O6F A;  5ARG A;  4IJD A;  5T5G A;  5CCM A;  2BQZ A;  3CBM A;  3CBO A;  3CBP A;  4JLG A;  4QEP A;  3QWV A;  1MVH A;  3F9Z A;  5HQ8 A;  3F9W A;  5JIY A;  2JV0 A;  4MI5 A;  3QWP A;  3TG5 A;  4NVQ A;  3IHX A;  1MVX A;  5JJ0 A;  3M58 A;  3OOI A;  4YPA A;  4YNP A;  5KJK A;  3QWW A;  3S7D A;  3M5A A;  4MI0 A;  5F5E A;  5HI7 A;  3MEK A;  2R3A A;  1MT6 A;  3S7B A;  3KMT A;  4LDG A;  5T0K A;  3M55 A;  5CPR B;  1O9S A;  4H12 A;  5LSZ A;  4QEN A;  5ARF A;  3RU0 A;  3F9X A;  3M57 A;  5JIN A;  3VV0 A;  2W5Z A;  3OXG A;  5F6L A;  5EG2 A;  1N3J A;  4WUY A;  3RAY A;  5F59 A;  5AYF A;  3M56 A;  3F9Y A;  4RZ0 A;  3RJW A;  4AU7 A;  3S8P A;  4I51 A;  4C1Q A;  3M54 A;  4YNM A;  4QEO A;  3S7F A;  1MUF A;  3MO0 A;  3N71 A;  5LSX A;  5KJN A;  3M53 A;  4E47 A;  2G46 A;  4IJ8 A;  4O30 A;  5KJL A;  4YPU A;  1ML9 A;  3BO5 A;  1XQH A;  2QPW A;  1N6A A;  2O8J A;  3TG4 A;  4J7I A;  2RFI A;  3M59 A;  5F6K C;  3RQ4 A;  5TEG A;  1ZKK A;  3OS5 A;  3SW9 A;  5TTF A;  3S7J A;  4YPE A;  3EP0 A;  4J8O A;  3OXF A;  3OXL A;  3RIB A;  2F69 A;  3VUZ A;  2IGQ A;  5T0M A;  4BUP A;  4J83 A;  3OPE A;  3HNA A;  3FPD A;  5JHN A;  3KMJ A;  3KMA A;  3MO5 A;  4NJ5 A; 
#chains in the Genus database with same CATH homology
 1PEG A;  5TH7 A;  3DAL A;  1H3I A;  4FMU A;  5KJM A;  4Z4P A;  4JDS A;  3DB5 A;  3K5K A;  4YND A;  5EX0 A;  3PDN A;  3SWC A;  1N6C A;  5EX3 A;  2W5Y A;  3MO2 A;  4J7F A;  5CCL A;  4O6F A;  5ARG A;  4IJD A;  5T5G A;  5CCM A;  2BQZ A;  3CBM A;  3CBO A;  3CBP A;  4JLG A;  4QEP A;  3QWV A;  1MVH A;  3F9Z A;  5HQ8 A;  3F9W A;  5JIY A;  2JV0 A;  4MI5 A;  3QWP A;  3TG5 A;  4NVQ A;  3IHX A;  1MVX A;  5JJ0 A;  3M58 A;  3OOI A;  4YPA A;  4YNP A;  5KJK A;  3QWW A;  3S7D A;  3M5A A;  4MI0 A;  5F5E A;  5HI7 A;  3MEK A;  2R3A A;  1MT6 A;  3S7B A;  3KMT A;  4LDG A;  5T0K A;  3M55 A;  5CPR B;  1O9S A;  4H12 A;  5LSZ A;  4QEN A;  5ARF A;  3RU0 A;  3F9X A;  3M57 A;  5JIN A;  3VV0 A;  2W5Z A;  3OXG A;  5F6L A;  5EG2 A;  1N3J A;  4WUY A;  3RAY A;  5F59 A;  5AYF A;  3M56 A;  3F9Y A;  4RZ0 A;  3RJW A;  4AU7 A;  3S8P A;  4I51 A;  4C1Q A;  3M54 A;  4YNM A;  4QEO A;  3S7F A;  1MUF A;  3MO0 A;  3N71 A;  5LSX A;  5KJN A;  3M53 A;  4E47 A;  2G46 A;  4IJ8 A;  4O30 A;  5KJL A;  4YPU A;  1ML9 A;  3BO5 A;  1XQH A;  2QPW A;  1N6A A;  2O8J A;  3TG4 A;  4J7I A;  2RFI A;  3M59 A;  5F6K C;  3RQ4 A;  5TEG A;  1ZKK A;  3OS5 A;  3SW9 A;  5TTF A;  3S7J A;  4YPE A;  3EP0 A;  4J8O A;  3OXF A;  3OXL A;  3RIB A;  2F69 A;  3VUZ A;  2IGQ A;  5T0M A;  4BUP A;  4J83 A;  3OPE A;  3HNA A;  3FPD A;  5JHN A;  3KMJ A;  3KMA A;  3MO5 A;  4NJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...