5TF2A

Crystal structure of the wd40 domain of the human prolactin regulatory element-binding protein
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
379
structure length
338
Chain Sequence
ELYRAPFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQLELINRLSASLLHSHDTETRATMNLALAGDILAAGQDAHCQLLRFQAHLELRVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIEDLALGPDGKLVTVGRDLKASVWQKDQLVTQLHWQEPTFSSTPYRYQACRFGQVPDQPAGLRLFTVQIPHKRLRQPPPCYLTAWDGSNFLPLRTKSCGHEVVSCLDVSESGTFLGLGTVTGSVAIYIAFSLQCLYYVREAHGIVVTDVAFLPEKGRGPELLGSHETALFSVAVDSRCQLHLLPSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolactin regulatory element-binding protein
publication title CRYSTAL STRUCTURE OF THE WD40 DOMAIN OF THE HUMAN PROLACTIN REGULATORY ELEMENT-BINDING PROTEIN (CASP target)
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 73
structure length 338
sequence length 379
ec nomenclature
pdb deposition date 2016-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5tf2A00
1N6EA 4UI9R 4ES0A 3ZWLB 1ERJA 3I8CA 2H68A 3EI2A 4JT5C 2PM9A 4TZ4A 1GG2B 5H14A 5TEEA 3FGBA 4J87A 2CNXA 1B9YA 5GXHA 3I89A 3JAMg 5THAA 1K8KC 2IUPA 4A11A 2H3XA 5IJ8E 3KRWB 3EI1A 2IURA 3IIYA 1A0RB 3P4FA 4L1QD 3DSMA 3BG0A 4JD2C 4ERYA 2O9KA 4XEIC 5AJAA 2P9SC 1U4CA 4H5IA 4X3EA 3FM0A 1XHMA 2HKMA 3ODTA 4L3HD 4L9OA 5C2VB 4A09A 3PVWB 1PI6A 3EI2B 3MKQA 2H9MA 2H6QA 3K26A 4GQ2P 3AL8A 2PBIB 3OKYA 4ERZA 2Z2OA 4J0XA 4HDJA 4A11B 3UVKA 4E5ZA 2PM7B 4GZ8A 3RFGA 4D0KA 3SBQA 3EI1B 5CXCB 4EWRA 2Q7QA 2MTAH 3I7PA 3MMYA 4CY3A 2HESX 3SMRA 3C99A 2HJBA 4A09B 4J8GA 2QXVA 4H5JA 2P9PC 1SHYB 3AL8B 5CXBB 5FKSA 2B5LA 3CFSB 3OKYB 3ORVD 4CZYA 4FA9D 3KRXB 1SQJA 2H6NA 5K1CC 3U4YA 3SWSD 3SBPA 4D6VA 4R7AB 3FRXA 5GXIA 5HYNB 2GC7A 3VH0A 3DXMC 4NSXA 2AGWA 2I3SA 3UVLA 5I5MA 4OZUA 4ESGA 4LGNA 1SQ9A 4QL1A 3SHFA 3OW8A 5EM2A 3EI4A 5GMKn 2B4EA 2YNOA 4PSWB 3I7HA 3JPXA 4PXWA 3RN0D 3PXWD 4FAND 2I0SA 5FKTA 2IWKA 4JSNC 4X61B 4A2MA 5CYKA 5EARA 2Z2NA 4A7JA 1GOTB 1MG2A 5FKRA 3JZHA 4XYHA 4CI1A 4N14A 5HE2B 3N0DA 2HYEA 1MDAH 5IGQA 4ZOZA 4A0AA 5HQGA 2AGXA 2I0TA 4J0WA 5C9ZB 3UR4A 3UKUC 4GGCA 3A0FA 5EAPA 3EI4B 4ZOYA 2HKRA 2AGZA 4GQ1A 1VYHC 4GQBB 2OJYA 3J81g 4Y5RD 1NEXB 4J8BA 3N0EA 2UZYB 3PVUB 3L4MD 5CYKB 5TF2A 2BBKH 1S4UX 4AOWA 2P9NC 4CZXA 3V9FA 4GM3A 4IA9A 4O45A 4O3UB 3I7OA 4K3ID 3MZLA 4A0AB 4FA1D 4QT8A 3DXKC 2PM9B 3V7DB 2H9PA 2Z2PA 4BH6A 3JRPA 1B9XA 1Q47A 2CO0C 2XU7A 4BL0A 2J57G 4LG8A 3PE7A 2OVPB 2XL2A 1XKSA 2H6KA 4CC9A 5JWZA 4CY5A 2HJ4A 4O3TB 3L4OD 3MXXA 1N6FA 4PSXB 2J56H 3NVXA 4FWWA 5IGOA 1JOFA 2EBSA 5HE1B 1OMWB 3SCYA 4PBYA 5I5JA 4IMMA 4FA4D 3EMHA 4FA5D 2YNPA 3OL2A 4CY2A 5FQDA 4FHLA 4E5ZB 5FXYA 4J73A 5FA5B 5EMLB 1TYQC 2OIZA 1N6DA 3RLMD 5FLXg 2I3TA 4QQEA 4X60B 3I2NA 4J82A 3W15A 5TEFA 4J78A 2HXCA 4Y7RA 4O1QD 4QRJA 2AGLA 2UZXB 5K19A 2P9UC 5AMSA 3GREA 3I7KA 4GM8A 3NVNA 3NVQA 4J77A 4ERQA 3IJCA 1XIPA 5I5IA 3OL2B 3IJ1A 1L0QA 3SVWD 4Z8LA 4LG9A 2CE8A 3IIWA 2GNQA 4O9DA 3EWEA 3OKWA 3BG1A 3SN6B 3MKSB 3RN1D 5EAMA 5SXMA 4GGAA 4FB1D 2TRCB 4GMBA 3UVMA 4J84A 4I79A 4JSXC 3SJLD 3PSCB 1MG3A 2AH1A 4CI3A 3SFZA 3B7FA 1TBGA 3SXTD 4PC0A 4GGDA 2OK6A 4J79A 4CI8A 3E0CA 5EM2B 4GM9A 5KDOB 3RSEC 2CN3A 5H1MA 3EG6A 1RI6A 2OK4A 1GXRA 3V5WB 3RFHA 5IJ7E 3IJ0A 4YVDA 3I7LA 4ZOXA 4A08A 1K32A 2G99A 3C9CA 3UVOA 2AGYA 3AH8B 4E54A 1QNIA 2P9KC 2IAAA 5AFU3 3C75H 5CXCA 4J81A 2I0RA 4OWRA 3PXSD 2XL3A 5IC7A 1FWXA 3SLED 4CY1A 1P22A 4JXMA 5A2Qg 2H14A 2YMUA 4A08B 5HE0B 4JSPC 2G9AA 3CIKB 2P9LC 3JROA 3OTTA 4JT6C 2B5MA 4PBZA 5GSAA 5EMKB 5CXBA 4CZVA 3I8EA 4CI2A 4E54B 1U2VC 5EMMB 5H17A 3RRMC 2B5NA 2QC5A 5FKQA 2BCJB 4U1EI 3RMZD 1JJUB 2AH0A 3HFQA 4ZN4A 4A0BA 3GFCA 5HE3B 1PEVA 2IUQA 5EMJB 2H47A 3F3PA 2CN2A 5IT9g 2CO0A 2H9NA 3AFCA 3IKOA 2YB8B 3JZGA 4X63B 4KFMB 1PGUA 4BUJC 2YNNA 3UVNA 1JMXB 4G56B 3AL9A 3EI3A 4JSVC 2AQ5A 3K27A 5B4WA 3JZNA 4ZOVA 3UKRC 4AEZA 2H13A 3PSLA 4A0BB 3VA6A 4MK0B 3C5MA 2YBAA 3JB9L 1JMZB 1NR0A 3PXTD 2OVQB 3J80g 4K3JB 2W18A 3I7NA 4J86A 5EALA 2PM6B 3SBRA 3BWSA 2CE9A 3DM0A 2IWFA 3EU7A 2J55H 1YFQA 1R5MA 2XYIA 4XYIA 2IUVA 3CFVA 3MZKA 2H9LA 3OKTA 4L3GD 3EI3B 4A2LA 5C2WB 1PBYB 1OLZA 3VGZA 1GP2B 3DWLC 5TDHB 4PNKB 3F3FA 3ULEC 4FAVD 4U7AA 2P9IC 2GC4A 2OVRB 3F3GA
chains in the Genus database with same CATH superfamily
1N6EA 4UI9R 4ES0A 3ZWLB 1ERJA 3I8CA 2H68A 3EI2A 4JT5C 2PM9A 4TZ4A 1GG2B 5H14A 3OF7A 5TEEA 3FGBA 4J87A 2CNXA 1H2ZA 1B9YA 5GXHA 3I89A 3JAMg 5THAA 1K8KC 1E5TA 2IUPA 4A11A 2H3XA 3EQ7A 5IJ8E 3KRWB 3EI1A 2IURA 3IIYA 1A0RB 3P4FA 4L1QD 3DSMA 3BG0A 4JD2C 4ERYA 4NBMA 2O9KA 4XEIC 5AJAA 2P9SC 4WJKA 1U4CA 4H5IA 4X3EA 3FM0A 1C9IA 3K72A 4G1MA 1XHMA 2HKMA 3ODTA 4L3HD 4L9OA 5C2VB 4A09A 1UOPA 4Z7OA 3PVWB 1PI6A 3EI2B 3MKQA 2H9MA 2H6QA 4WK4A 3K26A 4GQ2P 3AL8A 1H2WA 2PBIB 3OKYA 4ERZA 2Z2OA 4J0XA 4HDJA 4A11B 3UVKA 4E5ZA 2PM7B 2EIEA 3MUOA 4GZ8A 1QFSA 3RFGA 4D0KA 3SBQA 3EI1B 5CXCB 4EWRA 4DNVA 2Q7QA 2MTAH 5E6RA 3I7PA 2VDQA 3MMYA 4NAAA 4CY3A 2HESX 3ZE0A 3SMRA 3IJEA 3C99A 4QAMA 2HJBA 4A09B 4WK0A 1C9LA 2VDKA 4J8GA 2QXVA 4H5JA 4BCDA 2P9PC 1SHYB 1UOOA 3AL8B 5CXBB 5FKSA 2VZ1A 2B5LA 1M1XA 3CFSB 3OKYB 3ORVD 4CZYA 4FA9D 3KRXB 1SQJA 2VDPA 2H6NA 5K1CC 3U4YA 3SWSD 3SBPA 1A12A 4D6VA 4R7AB 2VZ3A 1U8CA 4NC4A 3FRXA 3V4PA 3V4VA 1H2YA 5GXIA 5HYNB 2GC7A 3VH0A 3DXMC 4NSXA 2XZGA 2AGWA 2I3SA 3UVLA 5I5MA 4OZUA 4ESGA 4LGNA 1SQ9A 4QL1A 3SHFA 3OW8A 5EM2A 3EI4A 5GMKn 2B4EA 2YNOA 4DNUA 5M5SA 4PSWB 4RE5A 3I7HA 3JPXA 4PXWA 3RN0D 3PXWD 4FAND 4D9SA 2I0SA 5FKTA 1O6FA 2HU8A 1JTDB 2IWKA 4AMYA 4JSNC 4X61B 4A2MA 5CYKA 5EARA 2Z2NA 4A7JA 1GOTB 1MG2A 5FKRA 3JZHA 4XYHA 4CI1A 3IUMA 3T3MA 4N14A 5HE2B 3N0DA 2HYEA 1MDAH 5IGQA 4ZOZA 4A0AA 4AN0A 4BP8A 5HQGA 2AGXA 2I0TA 4J0WA 5C9ZB 3UR4A 3UKUC 4GGCA 1K3IA 3A0FA 5EAPA 2VDNA 3EI4B 4ZOYA 2HKRA 2AGZA 3IUJA 2VDLA 4GQ1A 1VYHC 4GQBB 2OJYA 3J81g 2VDRA 4Y5RD 4G55A 5M61A 1NEXB 4J8BA 3N0EA 4O2WA 2UZYB 3IULA 3PVUB 4UM9A 3FCUA 3L4MD 5CYKB 5TF2A 1YR2A 2BBKH 1S4UX 5C92A 4AOWA 2P9NC 4CZXA 3V9FA 4GM3A 4IA9A 4O45A 4MMXA 4O3UB 3I7OA 3ZDZA 4K3ID 3MZLA 4A0AB 4FA1D 4QT8A 3DXKC 3EQ8A 2PM9B 3V7DB 2H9PA 2Z2PA 3ZE1A 4BH6A 3QI0A 3JRPA 1B9XA 1Q47A 3ZDXA 2CO0C 2XU7A 4BL0A 2J57G 4LG8A 3PE7A 2OVPB 2XL2A 1XKSA 3T3PA 2H6KA 4CC9A 5JWZA 4CY5A 2HJ4A 4O3TB 2WQ8A 3L4OD 3MXXA 1N6FA 4PSXB 4AN1A 2J56H 3GD1I 3NVXA 2XE4A 2QR5A 3MVDK 4FWWA 5IGOA 1JOFA 1JV2A 2EBSA 5HE1B 1OMWB 3SCYA 4PBYA 5I5JA 4IMMA 4FA4D 3EMHA 4FA5D 2YNPA 3OL2A 4CY2A 5FQDA 4FHLA 2BKLA 4E5ZB 5FXYA 4J73A 5FA5B 1GOHA 5EMLB 2EIBA 5M5VA 1TYQC 2OIZA 1N6DA 3RLMD 5FLXg 2I3TA 4QQEA 2VC2A 4X60B 3I2NA 4J82A 3W15A 5TEFA 4J78A 2HXCA 4Y7RA 4O1QD 4QRJA 2AGLA 2UZXB 5K19A 3NIGA 3QHYB 4BCBA 2P9UC 5AMSA 3GREA 3I7KA 1VE7A 4GM8A 4MMYA 3NVNA 3NVQA 4J77A 4ERQA 3IJCA 1XIPA 5I5IA 3OL2B 1H2XA 3IJ1A 1L0QA 4O02A 3SVWD 2EICA 4Z8LA 3IURA 2XDWA 2CE8A 3IIWA 4LG9A 2GNQA 4BCCA 3O4GA 4O9DA 5C86A 3EWEA 3OKWA 3BG1A 3SN6B 3MKSB 3RN1D 5EAMA 5SXMA 4GGAA 5HDBA 4FB1D 2TRCB 4GMBA 3UVMA 2EIDA 3GC3B 4J84A 4I79A 4JSXC 3SJLD 4Z7QA 2VDMA 3PSCB 1MG3A 1UOQA 2AH1A 4CI3A 3SFZA 3ZE2A 3B7FA 1TBGA 3SXTD 4AMZA 4PC0A 4GGDA 2OK6A 3IUQA 4J79A 1TYEA 4CI8A 3E0CA 5EM2B 4GM9A 3VI4A 3IVMA 5KDOB 3RSEC 2CN3A 2HU7A 5H1MA 3EG6A 1RI6A 3IUNA 2OK4A 1GXRA 3V5WB 3RFHA 5IJ7E 4G1EA 3IJ0A 4YVDA 4UM8A 3I7LA 4ZOXA 4A08A 1K32A 1VZ3A 1QFMA 2G99A 5M5UA 1BPOA 1VZ2A 3MUNA 3C9CA 3NIFA 3UVOA 2AGYA 3AH8B 4L1MA 4E54A 1QNIA 2P9KC 2IAAA 4AX4A 3K71A 5AFU3 3C75H 5CXCA 4J81A 2I0RA 1GOFA 4OWRA 2QZPA 3PXSD 3KCIA 2XL3A 5IC7A 2HU5A 1FWXA 3SLED 4CY1A 1P22A 4JXMA 5A2Qg 2H14A 2YMUA 4IRZA 4A08B 5HE0B 4JSPC 1UTCA 2G9AA 3CIKB 2P9LC 3JROA 3OTTA 4JT6C 2B5MA 4PBZA 5GSAA 5EMKB 3O4HA 5CXBA 4CZVA 1I2MB 3I8EA 4CI2A 4E54B 1U2VC 5EMMB 5H17A 3RRMC 2B5NA 2QC5A 5E6SA 5FKQA 1T2XA 2BCJB 4U1EI 3RMZD 1JJUB 2AH0A 3HFQA 4ZN4A 4A0BA 3GFCA 5HE3B 4BP9A 1PEVA 4JHNA 2IUQA 5EMJB 2H47A 3F3PA 5FFGA 4Z7NA 1E8NA 1O6GA 2CN2A 1GOGA 5IT9g 2CO0A 2H9NA 2VDOA 3AFCA 3IKOA 2YB8B 1VE6A 3JZGA 4NENA 4WK2A 4X63B 5M5RA 4KFMB 1PGUA 4BUJC 2YNNA 3UVNA 1JMXB 4MMZA 5M5TA 3NIDA 4G56B 3AL9A 3EI3A 4JSVC 2AQ5A 3K27A 5B4WA 3JZNA 4ZOVA 3UKRC 4AEZA 2H13A 3O4JA 1E8MA 4JHPC 3PSLA 3EQ9A 4DNWA 4A0BB 3VA6A 4MK0B 2JKXA 3C5MA 2YBAA 3JB9L 1JMZB 1NR0A 3PXTD 2OVQB 3J80g 4K3JB 5FFOA 2W18A 3I7NA 4J86A 5EALA 2PM6B 3SBRA 3O4IA 3VI3A 3BWSA 2CE9A 3DM0A 5E6UA 2IWFA 3EU7A 2J55H 1YFQA 1R5MA 2XYIA 4XYIA 2IUVA 3CFVA 3MZKA 2H9LA 3OKTA 4L3GD 3EI3B 4A2LA 5C2WB 1PBYB 1OLZA 3ZDYA 3FCSA 3VGZA 1L5GA 1GP2B 4RE6A 3DWLC 5TDHB 4PNKB 3F3FA 3ULEC 4FAVD 4U7AA 2P9IC 3DDUA 2GC4A 2OVRB 3K6SA 3F3GA
chains in the Genus database with same CATH topology
1N6EA 4UI9R 4ES0A 3ZWLB 1ERJA 3I8CA 2H68A 3EI2A 4JT5C 2PM9A 4TZ4A 1GG2B 5H14A 5TEEA 3FGBA 4J87A 2CNXA 1B9YA 5GXHA 3I89A 3JAMg 5THAA 1K8KC 2IUPA 4A11A 2H3XA 5IJ8E 3KRWB 3EI1A 2IURA 3IIYA 1A0RB 3P4FA 4L1QD 3DSMA 3BG0A 4JD2C 4ERYA 2O9KA 4XEIC 5AJAA 2P9SC 1U4CA 4H5IA 4X3EA 3FM0A 1XHMA 2HKMA 3ODTA 4L3HD 4L9OA 5C2VB 4A09A 3PVWB 1PI6A 3EI2B 3MKQA 2H9MA 2H6QA 3K26A 4GQ2P 3AL8A 2PBIB 3OKYA 4ERZA 2Z2OA 4J0XA 4HDJA 4A11B 3UVKA 4E5ZA 2PM7B 4GZ8A 3RFGA 4D0KA 3SBQA 3EI1B 5CXCB 4EWRA 2Q7QA 2MTAH 3I7PA 3MMYA 4CY3A 2HESX 3SMRA 3C99A 2HJBA 4A09B 4J8GA 2QXVA 4H5JA 2P9PC 1SHYB 3AL8B 5CXBB 5FKSA 2B5LA 3CFSB 3OKYB 3ORVD 4CZYA 4FA9D 3KRXB 1SQJA 2H6NA 5K1CC 3U4YA 3SWSD 3SBPA 4D6VA 4R7AB 3FRXA 5GXIA 5HYNB 2GC7A 3VH0A 3DXMC 4NSXA 2AGWA 2I3SA 3UVLA 5I5MA 4OZUA 4ESGA 4LGNA 1SQ9A 4QL1A 3SHFA 3OW8A 5EM2A 3EI4A 5GMKn 2B4EA 2YNOA 4PSWB 3I7HA 3JPXA 4PXWA 3RN0D 3PXWD 4FAND 2I0SA 5FKTA 2IWKA 4JSNC 4X61B 4A2MA 5CYKA 5EARA 2Z2NA 4A7JA 1GOTB 1MG2A 5FKRA 3JZHA 4XYHA 4CI1A 4N14A 5HE2B 3N0DA 2HYEA 1MDAH 5IGQA 4ZOZA 4A0AA 5HQGA 2AGXA 2I0TA 4J0WA 5C9ZB 3UR4A 3UKUC 4GGCA 3A0FA 5EAPA 3EI4B 4ZOYA 2HKRA 2AGZA 4GQ1A 1VYHC 4GQBB 2OJYA 3J81g 4Y5RD 1NEXB 4J8BA 3N0EA 2UZYB 3PVUB 3L4MD 5CYKB 5TF2A 2BBKH 1S4UX 4AOWA 2P9NC 4CZXA 3V9FA 4GM3A 4IA9A 4O45A 4O3UB 3I7OA 4K3ID 3MZLA 4A0AB 4FA1D 4QT8A 3DXKC 2PM9B 3V7DB 2H9PA 2Z2PA 4BH6A 3JRPA 1B9XA 1Q47A 2CO0C 2XU7A 4BL0A 2J57G 4LG8A 3PE7A 2OVPB 2XL2A 1XKSA 2H6KA 4CC9A 5JWZA 4CY5A 2HJ4A 4O3TB 3L4OD 3MXXA 1N6FA 4PSXB 2J56H 3NVXA 4FWWA 5IGOA 1JOFA 2EBSA 5HE1B 1OMWB 3SCYA 4PBYA 5I5JA 4IMMA 4FA4D 3EMHA 4FA5D 2YNPA 3OL2A 4CY2A 5FQDA 4FHLA 4E5ZB 5FXYA 4J73A 5FA5B 5EMLB 1TYQC 2OIZA 1N6DA 3RLMD 5FLXg 2I3TA 4QQEA 4X60B 3I2NA 4J82A 3W15A 5TEFA 4J78A 2HXCA 4Y7RA 4O1QD 4QRJA 2AGLA 2UZXB 5K19A 2P9UC 5AMSA 3GREA 3I7KA 4GM8A 3NVNA 3NVQA 4J77A 4ERQA 3IJCA 1XIPA 5I5IA 3OL2B 3IJ1A 1L0QA 3SVWD 4Z8LA 4LG9A 2CE8A 3IIWA 2GNQA 4O9DA 3EWEA 3OKWA 3BG1A 3SN6B 3MKSB 3RN1D 5EAMA 5SXMA 4GGAA 4FB1D 2TRCB 4GMBA 3UVMA 4J84A 4I79A 4JSXC 3SJLD 3PSCB 1MG3A 2AH1A 4CI3A 3SFZA 3B7FA 1TBGA 3SXTD 4PC0A 4GGDA 2OK6A 4J79A 4CI8A 3E0CA 5EM2B 4GM9A 5KDOB 3RSEC 2CN3A 5H1MA 3EG6A 1RI6A 2OK4A 1GXRA 3V5WB 3RFHA 5IJ7E 3IJ0A 4YVDA 3I7LA 4ZOXA 4A08A 1K32A 2G99A 3C9CA 3UVOA 2AGYA 3AH8B 4E54A 1QNIA 2P9KC 2IAAA 5AFU3 3C75H 5CXCA 4J81A 2I0RA 4OWRA 3PXSD 2XL3A 5IC7A 1FWXA 3SLED 4CY1A 1P22A 4JXMA 5A2Qg 2H14A 2YMUA 4A08B 5HE0B 4JSPC 2G9AA 3CIKB 2P9LC 3JROA 3OTTA 4JT6C 2B5MA 4PBZA 5GSAA 5EMKB 5CXBA 4CZVA 3I8EA 4CI2A 4E54B 1U2VC 5EMMB 5H17A 3RRMC 2B5NA 2QC5A 5FKQA 2BCJB 4U1EI 3RMZD 1JJUB 2AH0A 3HFQA 4ZN4A 4A0BA 3GFCA 5HE3B 1PEVA 2IUQA 5EMJB 2H47A 3F3PA 2CN2A 5IT9g 2CO0A 2H9NA 3AFCA 3IKOA 2YB8B 3JZGA 4X63B 4KFMB 1PGUA 4BUJC 2YNNA 3UVNA 1JMXB 4G56B 3AL9A 3EI3A 4JSVC 2AQ5A 3K27A 5B4WA 3JZNA 4ZOVA 3UKRC 4AEZA 2H13A 3PSLA 4A0BB 3VA6A 4MK0B 3C5MA 2YBAA 3JB9L 1JMZB 1NR0A 3PXTD 2OVQB 3J80g 4K3JB 2W18A 3I7NA 4J86A 5EALA 2PM6B 3SBRA 3BWSA 2CE9A 3DM0A 2IWFA 3EU7A 2J55H 1YFQA 1R5MA 2XYIA 4XYIA 2IUVA 3CFVA 3MZKA 2H9LA 3OKTA 4L3GD 3EI3B 4A2LA 5C2WB 1PBYB 1OLZA 3VGZA 1GP2B 3DWLC 5TDHB 4PNKB 3F3FA 3ULEC 4FAVD 4U7AA 2P9IC 2GC4A 2OVRB 3F3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N6E A;  4UI9 R;  4ES0 A;  3ZWL B;  1ERJ A;  3I8C A;  2H68 A;  3EI2 A;  4JT5 C;  2PM9 A;  4TZ4 A;  1GG2 B;  5H14 A;  5TEE A;  3FGB A;  4J87 A;  2CNX A;  1B9Y A;  5GXH A;  3I89 A;  3JAM g;  5THA A;  1K8K C;  2IUP A;  4A11 A;  2H3X A;  5IJ8 E;  3KRW B;  3EI1 A;  2IUR A;  3IIY A;  1A0R B;  3P4F A;  4L1Q D;  3DSM A;  3BG0 A;  4JD2 C;  4ERY A;  2O9K A;  4XEI C;  5AJA A;  2P9S C;  1U4C A;  4H5I A;  4X3E A;  3FM0 A;  1XHM A;  2HKM A;  3ODT A;  4L3H D;  4L9O A;  5C2V B;  4A09 A;  3PVW B;  1PI6 A;  3EI2 B;  3MKQ A;  2H9M A;  2H6Q A;  3K26 A;  4GQ2 P;  3AL8 A;  2PBI B;  3OKY A;  4ERZ A;  2Z2O A;  4J0X A;  4HDJ A;  4A11 B;  3UVK A;  4E5Z A;  2PM7 B;  4GZ8 A;  3RFG A;  4D0K A;  3SBQ A;  3EI1 B;  5CXC B;  4EWR A;  2Q7Q A;  2MTA H;  3I7P A;  3MMY A;  4CY3 A;  2HES X;  3SMR A;  3C99 A;  2HJB A;  4A09 B;  4J8G A;  2QXV A;  4H5J A;  2P9P C;  1SHY B;  3AL8 B;  5CXB B;  5FKS A;  2B5L A;  3CFS B;  3OKY B;  3ORV D;  4CZY A;  4FA9 D;  3KRX B;  1SQJ A;  2H6N A;  5K1C C;  3U4Y A;  3SWS D;  3SBP A;  4D6V A;  4R7A B;  3FRX A;  5GXI A;  5HYN B;  2GC7 A;  3VH0 A;  3DXM C;  4NSX A;  2AGW A;  2I3S A;  3UVL A;  5I5M A;  4OZU A;  4ESG A;  4LGN A;  1SQ9 A;  4QL1 A;  3SHF A;  3OW8 A;  5EM2 A;  3EI4 A;  5GMK n;  2B4E A;  2YNO A;  4PSW B;  3I7H A;  3JPX A;  4PXW A;  3RN0 D;  3PXW D;  4FAN D;  2I0S A;  5FKT A;  2IWK A;  4JSN C;  4X61 B;  4A2M A;  5CYK A;  5EAR A;  2Z2N A;  4A7J A;  1GOT B;  1MG2 A;  5FKR A;  3JZH A;  4XYH A;  4CI1 A;  4N14 A;  5HE2 B;  3N0D A;  2HYE A;  1MDA H;  5IGQ A;  4ZOZ A;  4A0A A;  5HQG A;  2AGX A;  2I0T A;  4J0W A;  5C9Z B;  3UR4 A;  3UKU C;  4GGC A;  3A0F A;  5EAP A;  3EI4 B;  4ZOY A;  2HKR A;  2AGZ A;  4GQ1 A;  1VYH C;  4GQB B;  2OJY A;  3J81 g;  4Y5R D;  1NEX B;  4J8B A;  3N0E A;  2UZY B;  3PVU B;  3L4M D;  5CYK B;  5TF2 A;  2BBK H;  1S4U X;  4AOW A;  2P9N C;  4CZX A;  3V9F A;  4GM3 A;  4IA9 A;  4O45 A;  4O3U B;  3I7O A;  4K3I D;  3MZL A;  4A0A B;  4FA1 D;  4QT8 A;  3DXK C;  2PM9 B;  3V7D B;  2H9P A;  2Z2P A;  4BH6 A;  3JRP A;  1B9X A;  1Q47 A;  2CO0 C;  2XU7 A;  4BL0 A;  2J57 G;  4LG8 A;  3PE7 A;  2OVP B;  2XL2 A;  1XKS A;  2H6K A;  4CC9 A;  5JWZ A;  4CY5 A;  2HJ4 A;  4O3T B;  3L4O D;  3MXX A;  1N6F A;  4PSX B;  2J56 H;  3NVX A;  4FWW A;  5IGO A;  1JOF A;  2EBS A;  5HE1 B;  1OMW B;  3SCY A;  4PBY A;  5I5J A;  4IMM A;  4FA4 D;  3EMH A;  4FA5 D;  2YNP A;  3OL2 A;  4CY2 A;  5FQD A;  4FHL A;  4E5Z B;  5FXY A;  4J73 A;  5FA5 B;  5EML B;  1TYQ C;  2OIZ A;  1N6D A;  3RLM D;  5FLX g;  2I3T A;  4QQE A;  4X60 B;  3I2N A;  4J82 A;  3W15 A;  5TEF A;  4J78 A;  2HXC A;  4Y7R A;  4O1Q D;  4QRJ A;  2AGL A;  2UZX B;  5K19 A;  2P9U C;  5AMS A;  3GRE A;  3I7K A;  4GM8 A;  3NVN A;  3NVQ A;  4J77 A;  4ERQ A;  3IJC A;  1XIP A;  5I5I A;  3OL2 B;  3IJ1 A;  1L0Q A;  3SVW D;  4Z8L A;  4LG9 A;  2CE8 A;  3IIW A;  2GNQ A;  4O9D A;  3EWE A;  3OKW A;  3BG1 A;  3SN6 B;  3MKS B;  3RN1 D;  5EAM A;  5SXM A;  4GGA A;  4FB1 D;  2TRC B;  4GMB A;  3UVM A;  4J84 A;  4I79 A;  4JSX C;  3SJL D;  3PSC B;  1MG3 A;  2AH1 A;  4CI3 A;  3SFZ A;  3B7F A;  1TBG A;  3SXT D;  4PC0 A;  4GGD A;  2OK6 A;  4J79 A;  4CI8 A;  3E0C A;  5EM2 B;  4GM9 A;  5KDO B;  3RSE C;  2CN3 A;  5H1M A;  3EG6 A;  1RI6 A;  2OK4 A;  1GXR A;  3V5W B;  3RFH A;  5IJ7 E;  3IJ0 A;  4YVD A;  3I7L A;  4ZOX A;  4A08 A;  1K32 A;  2G99 A;  3C9C A;  3UVO A;  2AGY A;  3AH8 B;  4E54 A;  1QNI A;  2P9K C;  2IAA A;  5AFU 3;  3C75 H;  5CXC A;  4J81 A;  2I0R A;  4OWR A;  3PXS D;  2XL3 A;  5IC7 A;  1FWX A;  3SLE D;  4CY1 A;  1P22 A;  4JXM A;  5A2Q g;  2H14 A;  2YMU A;  4A08 B;  5HE0 B;  4JSP C;  2G9A A;  3CIK B;  2P9L C;  3JRO A;  3OTT A;  4JT6 C;  2B5M A;  4PBZ A;  5GSA A;  5EMK B;  5CXB A;  4CZV A;  3I8E A;  4CI2 A;  4E54 B;  1U2V C;  5EMM B;  5H17 A;  3RRM C;  2B5N A;  2QC5 A;  5FKQ A;  2BCJ B;  4U1E I;  3RMZ D;  1JJU B;  2AH0 A;  3HFQ A;  4ZN4 A;  4A0B A;  3GFC A;  5HE3 B;  1PEV A;  2IUQ A;  5EMJ B;  2H47 A;  3F3P A;  2CN2 A;  5IT9 g;  2CO0 A;  2H9N A;  3AFC A;  3IKO A;  2YB8 B;  3JZG A;  4X63 B;  4KFM B;  1PGU A;  4BUJ C;  2YNN A;  3UVN A;  1JMX B;  4G56 B;  3AL9 A;  3EI3 A;  4JSV C;  2AQ5 A;  3K27 A;  5B4W A;  3JZN A;  4ZOV A;  3UKR C;  4AEZ A;  2H13 A;  3PSL A;  4A0B B;  3VA6 A;  4MK0 B;  3C5M A;  2YBA A;  3JB9 L;  1JMZ B;  1NR0 A;  3PXT D;  2OVQ B;  3J80 g;  4K3J B;  2W18 A;  3I7N A;  4J86 A;  5EAL A;  2PM6 B;  3SBR A;  3BWS A;  2CE9 A;  3DM0 A;  2IWF A;  3EU7 A;  2J55 H;  1YFQ A;  1R5M A;  2XYI A;  4XYI A;  2IUV A;  3CFV A;  3MZK A;  2H9L A;  3OKT A;  4L3G D;  3EI3 B;  4A2L A;  5C2W B;  1PBY B;  1OLZ A;  3VGZ A;  1GP2 B;  3DWL C;  5TDH B;  4PNK B;  3F3F A;  3ULE C;  4FAV D;  4U7A A;  2P9I C;  2GC4 A;  2OVR B;  3F3G A; 
#chains in the Genus database with same CATH topology
 1N6E A;  4UI9 R;  4ES0 A;  3ZWL B;  1ERJ A;  3I8C A;  2H68 A;  3EI2 A;  4JT5 C;  2PM9 A;  4TZ4 A;  1GG2 B;  5H14 A;  3OF7 A;  5TEE A;  3FGB A;  4J87 A;  2CNX A;  1H2Z A;  1B9Y A;  5GXH A;  3I89 A;  3JAM g;  5THA A;  1K8K C;  1E5T A;  2IUP A;  4A11 A;  2H3X A;  3EQ7 A;  5IJ8 E;  3KRW B;  3EI1 A;  2IUR A;  3IIY A;  1A0R B;  3P4F A;  4L1Q D;  3DSM A;  3BG0 A;  4JD2 C;  4ERY A;  4NBM A;  2O9K A;  4XEI C;  5AJA A;  2P9S C;  4WJK A;  1U4C A;  4H5I A;  4X3E A;  3FM0 A;  1C9I A;  3K72 A;  4G1M A;  1XHM A;  2HKM A;  3ODT A;  4L3H D;  4L9O A;  5C2V B;  4A09 A;  1UOP A;  4Z7O A;  3PVW B;  1PI6 A;  3EI2 B;  3MKQ A;  2H9M A;  2H6Q A;  4WK4 A;  3K26 A;  4GQ2 P;  3AL8 A;  1H2W A;  2PBI B;  3OKY A;  4ERZ A;  2Z2O A;  4J0X A;  4HDJ A;  4A11 B;  3UVK A;  4E5Z A;  2PM7 B;  2EIE A;  3MUO A;  4GZ8 A;  1QFS A;  3RFG A;  4D0K A;  3SBQ A;  3EI1 B;  5CXC B;  4EWR A;  4DNV A;  2Q7Q A;  2MTA H;  5E6R A;  3I7P A;  2VDQ A;  3MMY A;  4NAA A;  4CY3 A;  2HES X;  3ZE0 A;  3SMR A;  3IJE A;  3C99 A;  4QAM A;  2HJB A;  4A09 B;  4WK0 A;  1C9L A;  2VDK A;  4J8G A;  2QXV A;  4H5J A;  4BCD A;  2P9P C;  1SHY B;  1UOO A;  3AL8 B;  5CXB B;  5FKS A;  2VZ1 A;  2B5L A;  1M1X A;  3CFS B;  3OKY B;  3ORV D;  4CZY A;  4FA9 D;  3KRX B;  1SQJ A;  2VDP A;  2H6N A;  5K1C C;  3U4Y A;  3SWS D;  3SBP A;  1A12 A;  4D6V A;  4R7A B;  2VZ3 A;  1U8C A;  4NC4 A;  3FRX A;  3V4P A;  3V4V A;  1H2Y A;  5GXI A;  5HYN B;  2GC7 A;  3VH0 A;  3DXM C;  4NSX A;  2XZG A;  2AGW A;  2I3S A;  3UVL A;  5I5M A;  4OZU A;  4ESG A;  4LGN A;  1SQ9 A;  4QL1 A;  3SHF A;  3OW8 A;  5EM2 A;  3EI4 A;  5GMK n;  2B4E A;  2YNO A;  4DNU A;  5M5S A;  4PSW B;  4RE5 A;  3I7H A;  3JPX A;  4PXW A;  3RN0 D;  3PXW D;  4FAN D;  4D9S A;  2I0S A;  5FKT A;  1O6F A;  2HU8 A;  1JTD B;  2IWK A;  4AMY A;  4JSN C;  4X61 B;  4A2M A;  5CYK A;  5EAR A;  2Z2N A;  4A7J A;  1GOT B;  1MG2 A;  5FKR A;  3JZH A;  4XYH A;  4CI1 A;  3IUM A;  3T3M A;  4N14 A;  5HE2 B;  3N0D A;  2HYE A;  1MDA H;  5IGQ A;  4ZOZ A;  4A0A A;  4AN0 A;  4BP8 A;  5HQG A;  2AGX A;  2I0T A;  4J0W A;  5C9Z B;  3UR4 A;  3UKU C;  4GGC A;  1K3I A;  3A0F A;  5EAP A;  2VDN A;  3EI4 B;  4ZOY A;  2HKR A;  2AGZ A;  3IUJ A;  2VDL A;  4GQ1 A;  1VYH C;  4GQB B;  2OJY A;  3J81 g;  2VDR A;  4Y5R D;  4G55 A;  5M61 A;  1NEX B;  4J8B A;  3N0E A;  4O2W A;  2UZY B;  3IUL A;  3PVU B;  4UM9 A;  3FCU A;  3L4M D;  5CYK B;  5TF2 A;  1YR2 A;  2BBK H;  1S4U X;  5C92 A;  4AOW A;  2P9N C;  4CZX A;  3V9F A;  4GM3 A;  4IA9 A;  4O45 A;  4MMX A;  4O3U B;  3I7O A;  3ZDZ A;  4K3I D;  3MZL A;  4A0A B;  4FA1 D;  4QT8 A;  3DXK C;  3EQ8 A;  2PM9 B;  3V7D B;  2H9P A;  2Z2P A;  3ZE1 A;  4BH6 A;  3QI0 A;  3JRP A;  1B9X A;  1Q47 A;  3ZDX A;  2CO0 C;  2XU7 A;  4BL0 A;  2J57 G;  4LG8 A;  3PE7 A;  2OVP B;  2XL2 A;  1XKS A;  3T3P A;  2H6K A;  4CC9 A;  5JWZ A;  4CY5 A;  2HJ4 A;  4O3T B;  2WQ8 A;  3L4O D;  3MXX A;  1N6F A;  4PSX B;  4AN1 A;  2J56 H;  3GD1 I;  3NVX A;  2XE4 A;  2QR5 A;  3MVD K;  4FWW A;  5IGO A;  1JOF A;  1JV2 A;  2EBS A;  5HE1 B;  1OMW B;  3SCY A;  4PBY A;  5I5J A;  4IMM A;  4FA4 D;  3EMH A;  4FA5 D;  2YNP A;  3OL2 A;  4CY2 A;  5FQD A;  4FHL A;  2BKL A;  4E5Z B;  5FXY A;  4J73 A;  5FA5 B;  1GOH A;  5EML B;  2EIB A;  5M5V A;  1TYQ C;  2OIZ A;  1N6D A;  3RLM D;  5FLX g;  2I3T A;  4QQE A;  2VC2 A;  4X60 B;  3I2N A;  4J82 A;  3W15 A;  5TEF A;  4J78 A;  2HXC A;  4Y7R A;  4O1Q D;  4QRJ A;  2AGL A;  2UZX B;  5K19 A;  3NIG A;  3QHY B;  4BCB A;  2P9U C;  5AMS A;  3GRE A;  3I7K A;  1VE7 A;  4GM8 A;  4MMY A;  3NVN A;  3NVQ A;  4J77 A;  4ERQ A;  3IJC A;  1XIP A;  5I5I A;  3OL2 B;  1H2X A;  3IJ1 A;  1L0Q A;  4O02 A;  3SVW D;  2EIC A;  4Z8L A;  3IUR A;  2XDW A;  2CE8 A;  3IIW A;  4LG9 A;  2GNQ A;  4BCC A;  3O4G A;  4O9D A;  5C86 A;  3EWE A;  3OKW A;  3BG1 A;  3SN6 B;  3MKS B;  3RN1 D;  5EAM A;  5SXM A;  4GGA A;  5HDB A;  4FB1 D;  2TRC B;  4GMB A;  3UVM A;  2EID A;  3GC3 B;  4J84 A;  4I79 A;  4JSX C;  3SJL D;  4Z7Q A;  2VDM A;  3PSC B;  1MG3 A;  1UOQ A;  2AH1 A;  4CI3 A;  3SFZ A;  3ZE2 A;  3B7F A;  1TBG A;  3SXT D;  4AMZ A;  4PC0 A;  4GGD A;  2OK6 A;  3IUQ A;  4J79 A;  1TYE A;  4CI8 A;  3E0C A;  5EM2 B;  4GM9 A;  3VI4 A;  3IVM A;  5KDO B;  3RSE C;  2CN3 A;  2HU7 A;  5H1M A;  3EG6 A;  1RI6 A;  3IUN A;  2OK4 A;  1GXR A;  3V5W B;  3RFH A;  5IJ7 E;  4G1E A;  3IJ0 A;  4YVD A;  4UM8 A;  3I7L A;  4ZOX A;  4A08 A;  1K32 A;  1VZ3 A;  1QFM A;  2G99 A;  5M5U A;  1BPO A;  1VZ2 A;  3MUN A;  3C9C A;  3NIF A;  3UVO A;  2AGY A;  3AH8 B;  4L1M A;  4E54 A;  1QNI A;  2P9K C;  2IAA A;  4AX4 A;  3K71 A;  5AFU 3;  3C75 H;  5CXC A;  4J81 A;  2I0R A;  1GOF A;  4OWR A;  2QZP A;  3PXS D;  3KCI A;  2XL3 A;  5IC7 A;  2HU5 A;  1FWX A;  3SLE D;  4CY1 A;  1P22 A;  4JXM A;  5A2Q g;  2H14 A;  2YMU A;  4IRZ A;  4A08 B;  5HE0 B;  4JSP C;  1UTC A;  2G9A A;  3CIK B;  2P9L C;  3JRO A;  3OTT A;  4JT6 C;  2B5M A;  4PBZ A;  5GSA A;  5EMK B;  3O4H A;  5CXB A;  4CZV A;  1I2M B;  3I8E A;  4CI2 A;  4E54 B;  1U2V C;  5EMM B;  5H17 A;  3RRM C;  2B5N A;  2QC5 A;  5E6S A;  5FKQ A;  1T2X A;  2BCJ B;  4U1E I;  3RMZ D;  1JJU B;  2AH0 A;  3HFQ A;  4ZN4 A;  4A0B A;  3GFC A;  5HE3 B;  4BP9 A;  1PEV A;  4JHN A;  2IUQ A;  5EMJ B;  2H47 A;  3F3P A;  5FFG A;  4Z7N A;  1E8N A;  1O6G A;  2CN2 A;  1GOG A;  5IT9 g;  2CO0 A;  2H9N A;  2VDO A;  3AFC A;  3IKO A;  2YB8 B;  1VE6 A;  3JZG A;  4NEN A;  4WK2 A;  4X63 B;  5M5R A;  4KFM B;  1PGU A;  4BUJ C;  2YNN A;  3UVN A;  1JMX B;  4MMZ A;  5M5T A;  3NID A;  4G56 B;  3AL9 A;  3EI3 A;  4JSV C;  2AQ5 A;  3K27 A;  5B4W A;  3JZN A;  4ZOV A;  3UKR C;  4AEZ A;  2H13 A;  3O4J A;  1E8M A;  4JHP C;  3PSL A;  3EQ9 A;  4DNW A;  4A0B B;  3VA6 A;  4MK0 B;  2JKX A;  3C5M A;  2YBA A;  3JB9 L;  1JMZ B;  1NR0 A;  3PXT D;  2OVQ B;  3J80 g;  4K3J B;  5FFO A;  2W18 A;  3I7N A;  4J86 A;  5EAL A;  2PM6 B;  3SBR A;  3O4I A;  3VI3 A;  3BWS A;  2CE9 A;  3DM0 A;  5E6U A;  2IWF A;  3EU7 A;  2J55 H;  1YFQ A;  1R5M A;  2XYI A;  4XYI A;  2IUV A;  3CFV A;  3MZK A;  2H9L A;  3OKT A;  4L3G D;  3EI3 B;  4A2L A;  5C2W B;  1PBY B;  1OLZ A;  3ZDY A;  3FCS A;  3VGZ A;  1L5G A;  1GP2 B;  4RE6 A;  3DWL C;  5TDH B;  4PNK B;  3F3F A;  3ULE C;  4FAV D;  4U7A A;  2P9I C;  3DDU A;  2GC4 A;  2OVR B;  3K6S A;  3F3G A; 
#chains in the Genus database with same CATH homology
 1N6E A;  4UI9 R;  4ES0 A;  3ZWL B;  1ERJ A;  3I8C A;  2H68 A;  3EI2 A;  4JT5 C;  2PM9 A;  4TZ4 A;  1GG2 B;  5H14 A;  5TEE A;  3FGB A;  4J87 A;  2CNX A;  1B9Y A;  5GXH A;  3I89 A;  3JAM g;  5THA A;  1K8K C;  2IUP A;  4A11 A;  2H3X A;  5IJ8 E;  3KRW B;  3EI1 A;  2IUR A;  3IIY A;  1A0R B;  3P4F A;  4L1Q D;  3DSM A;  3BG0 A;  4JD2 C;  4ERY A;  2O9K A;  4XEI C;  5AJA A;  2P9S C;  1U4C A;  4H5I A;  4X3E A;  3FM0 A;  1XHM A;  2HKM A;  3ODT A;  4L3H D;  4L9O A;  5C2V B;  4A09 A;  3PVW B;  1PI6 A;  3EI2 B;  3MKQ A;  2H9M A;  2H6Q A;  3K26 A;  4GQ2 P;  3AL8 A;  2PBI B;  3OKY A;  4ERZ A;  2Z2O A;  4J0X A;  4HDJ A;  4A11 B;  3UVK A;  4E5Z A;  2PM7 B;  4GZ8 A;  3RFG A;  4D0K A;  3SBQ A;  3EI1 B;  5CXC B;  4EWR A;  2Q7Q A;  2MTA H;  3I7P A;  3MMY A;  4CY3 A;  2HES X;  3SMR A;  3C99 A;  2HJB A;  4A09 B;  4J8G A;  2QXV A;  4H5J A;  2P9P C;  1SHY B;  3AL8 B;  5CXB B;  5FKS A;  2B5L A;  3CFS B;  3OKY B;  3ORV D;  4CZY A;  4FA9 D;  3KRX B;  1SQJ A;  2H6N A;  5K1C C;  3U4Y A;  3SWS D;  3SBP A;  4D6V A;  4R7A B;  3FRX A;  5GXI A;  5HYN B;  2GC7 A;  3VH0 A;  3DXM C;  4NSX A;  2AGW A;  2I3S A;  3UVL A;  5I5M A;  4OZU A;  4ESG A;  4LGN A;  1SQ9 A;  4QL1 A;  3SHF A;  3OW8 A;  5EM2 A;  3EI4 A;  5GMK n;  2B4E A;  2YNO A;  4PSW B;  3I7H A;  3JPX A;  4PXW A;  3RN0 D;  3PXW D;  4FAN D;  2I0S A;  5FKT A;  2IWK A;  4JSN C;  4X61 B;  4A2M A;  5CYK A;  5EAR A;  2Z2N A;  4A7J A;  1GOT B;  1MG2 A;  5FKR A;  3JZH A;  4XYH A;  4CI1 A;  4N14 A;  5HE2 B;  3N0D A;  2HYE A;  1MDA H;  5IGQ A;  4ZOZ A;  4A0A A;  5HQG A;  2AGX A;  2I0T A;  4J0W A;  5C9Z B;  3UR4 A;  3UKU C;  4GGC A;  3A0F A;  5EAP A;  3EI4 B;  4ZOY A;  2HKR A;  2AGZ A;  4GQ1 A;  1VYH C;  4GQB B;  2OJY A;  3J81 g;  4Y5R D;  1NEX B;  4J8B A;  3N0E A;  2UZY B;  3PVU B;  3L4M D;  5CYK B;  5TF2 A;  2BBK H;  1S4U X;  4AOW A;  2P9N C;  4CZX A;  3V9F A;  4GM3 A;  4IA9 A;  4O45 A;  4O3U B;  3I7O A;  4K3I D;  3MZL A;  4A0A B;  4FA1 D;  4QT8 A;  3DXK C;  2PM9 B;  3V7D B;  2H9P A;  2Z2P A;  4BH6 A;  3JRP A;  1B9X A;  1Q47 A;  2CO0 C;  2XU7 A;  4BL0 A;  2J57 G;  4LG8 A;  3PE7 A;  2OVP B;  2XL2 A;  1XKS A;  2H6K A;  4CC9 A;  5JWZ A;  4CY5 A;  2HJ4 A;  4O3T B;  3L4O D;  3MXX A;  1N6F A;  4PSX B;  2J56 H;  3NVX A;  4FWW A;  5IGO A;  1JOF A;  2EBS A;  5HE1 B;  1OMW B;  3SCY A;  4PBY A;  5I5J A;  4IMM A;  4FA4 D;  3EMH A;  4FA5 D;  2YNP A;  3OL2 A;  4CY2 A;  5FQD A;  4FHL A;  4E5Z B;  5FXY A;  4J73 A;  5FA5 B;  5EML B;  1TYQ C;  2OIZ A;  1N6D A;  3RLM D;  5FLX g;  2I3T A;  4QQE A;  4X60 B;  3I2N A;  4J82 A;  3W15 A;  5TEF A;  4J78 A;  2HXC A;  4Y7R A;  4O1Q D;  4QRJ A;  2AGL A;  2UZX B;  5K19 A;  2P9U C;  5AMS A;  3GRE A;  3I7K A;  4GM8 A;  3NVN A;  3NVQ A;  4J77 A;  4ERQ A;  3IJC A;  1XIP A;  5I5I A;  3OL2 B;  3IJ1 A;  1L0Q A;  3SVW D;  4Z8L A;  4LG9 A;  2CE8 A;  3IIW A;  2GNQ A;  4O9D A;  3EWE A;  3OKW A;  3BG1 A;  3SN6 B;  3MKS B;  3RN1 D;  5EAM A;  5SXM A;  4GGA A;  4FB1 D;  2TRC B;  4GMB A;  3UVM A;  4J84 A;  4I79 A;  4JSX C;  3SJL D;  3PSC B;  1MG3 A;  2AH1 A;  4CI3 A;  3SFZ A;  3B7F A;  1TBG A;  3SXT D;  4PC0 A;  4GGD A;  2OK6 A;  4J79 A;  4CI8 A;  3E0C A;  5EM2 B;  4GM9 A;  5KDO B;  3RSE C;  2CN3 A;  5H1M A;  3EG6 A;  1RI6 A;  2OK4 A;  1GXR A;  3V5W B;  3RFH A;  5IJ7 E;  3IJ0 A;  4YVD A;  3I7L A;  4ZOX A;  4A08 A;  1K32 A;  2G99 A;  3C9C A;  3UVO A;  2AGY A;  3AH8 B;  4E54 A;  1QNI A;  2P9K C;  2IAA A;  5AFU 3;  3C75 H;  5CXC A;  4J81 A;  2I0R A;  4OWR A;  3PXS D;  2XL3 A;  5IC7 A;  1FWX A;  3SLE D;  4CY1 A;  1P22 A;  4JXM A;  5A2Q g;  2H14 A;  2YMU A;  4A08 B;  5HE0 B;  4JSP C;  2G9A A;  3CIK B;  2P9L C;  3JRO A;  3OTT A;  4JT6 C;  2B5M A;  4PBZ A;  5GSA A;  5EMK B;  5CXB A;  4CZV A;  3I8E A;  4CI2 A;  4E54 B;  1U2V C;  5EMM B;  5H17 A;  3RRM C;  2B5N A;  2QC5 A;  5FKQ A;  2BCJ B;  4U1E I;  3RMZ D;  1JJU B;  2AH0 A;  3HFQ A;  4ZN4 A;  4A0B A;  3GFC A;  5HE3 B;  1PEV A;  2IUQ A;  5EMJ B;  2H47 A;  3F3P A;  2CN2 A;  5IT9 g;  2CO0 A;  2H9N A;  3AFC A;  3IKO A;  2YB8 B;  3JZG A;  4X63 B;  4KFM B;  1PGU A;  4BUJ C;  2YNN A;  3UVN A;  1JMX B;  4G56 B;  3AL9 A;  3EI3 A;  4JSV C;  2AQ5 A;  3K27 A;  5B4W A;  3JZN A;  4ZOV A;  3UKR C;  4AEZ A;  2H13 A;  3PSL A;  4A0B B;  3VA6 A;  4MK0 B;  3C5M A;  2YBA A;  3JB9 L;  1JMZ B;  1NR0 A;  3PXT D;  2OVQ B;  3J80 g;  4K3J B;  2W18 A;  3I7N A;  4J86 A;  5EAL A;  2PM6 B;  3SBR A;  3BWS A;  2CE9 A;  3DM0 A;  2IWF A;  3EU7 A;  2J55 H;  1YFQ A;  1R5M A;  2XYI A;  4XYI A;  2IUV A;  3CFV A;  3MZK A;  2H9L A;  3OKT A;  4L3G D;  3EI3 B;  4A2L A;  5C2W B;  1PBY B;  1OLZ A;  3VGZ A;  1GP2 B;  3DWL C;  5TDH B;  4PNK B;  3F3F A;  3ULE C;  4FAV D;  4U7A A;  2P9I C;  2GC4 A;  2OVR B;  3F3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...