5TF2A

Crystal structure of the wd40 domain of the human prolactin regulatory element-binding protein
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
379
structure length
338
Chain Sequence
ELYRAPFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQLELINRLSASLLHSHDTETRATMNLALAGDILAAGQDAHCQLLRFQAHLELRVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIEDLALGPDGKLVTVGRDLKASVWQKDQLVTQLHWQEPTFSSTPYRYQACRFGQVPDQPAGLRLFTVQIPHKRLRQPPPCYLTAWDGSNFLPLRTKSCGHEVVSCLDVSESGTFLGLGTVTGSVAIYIAFSLQCLYYVREAHGIVVTDVAFLPEKGRGPELLGSHETALFSVAVDSRCQLHLLPSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolactin regulatory element-binding protein
publication title CRYSTAL STRUCTURE OF THE WD40 DOMAIN OF THE HUMAN PROLACTIN REGULATORY ELEMENT-BINDING PROTEIN (CASP target)
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 73
structure length 338
sequence length 379
ec nomenclature
pdb deposition date 2016-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5tf2A00
2OVQB 4J79A 2HYEA 1ERJA 3PVWB 3N0DA 2CE8A 3V9FA 2MTAH 1SQ9A 3CIKB 3I7KA 2P9LC 5CXCA 5C9ZB 5TEEA 4QRJA 4YVDA 5IJ7E 4X3EA 2I3TA 3RSEC 3MXXA 1GP2B 2G9AA 4PC0A 3I8EA 3SHFA 3UVKA 4A0BB 1U2VC 1U4CA 2P9UC 3K26A 5A2Qg 3SVWD 2Q7QA 3IIYA 2QXVA 5IJ8E 3A0FA 3NVXA 4N14A 4PBZA 3ODTA 3JB9L 1N6DA 4GZ8A 3NVNA 1FWXA 4ESGA 1B9XA 4L3GD 4O3TB 3I8CA 4K3JB 2XYIA 3MMYA 3ULEC 3RN0D 5H17A 5CYKB 5SXMA 4J86A 4GQ2P 3EI3B 3C75H 4A09B 5EALA 5GXIA 3SJLD 2H13A 3JZGA 2IWFA 3DSMA 4GM3A 4JSVC 4ERYA 3SLED 3I89A 3FGBA 2GNQA 1R5MA 4QL1A 3V7DB 3PSCB 4BUJC 3IJ0A 3L4MD 3E0CA 4FHLA 4J0XA 2PM6B 3J81g 3EU7A 1SHYB 3MKQA 4PNKB 3BG0A 1JMZB 2HKRA 3EG6A 4XEIC 4XYHA 3FM0A 4J78A 3I7LA 1Q47A 2H9PA 3GREA 1PEVA 2YMUA 5EM2B 1P22A 4TZ4A 3C99A 1S4UX 4ZOXA 5TEFA 3AH8B 5FKQA 3OW8A 5HE1B 3OL2A 3CFVA 5EMJB 2HXCA 4D0KA 4FB1D 3MZLA 4FWWA 3IKOA 2H68A 4J87A 5CXBA 4CY5A 4ES0A 2YNPA 2GC4A 3K27A 5KDOB 4X61B 1NR0A 2UZYB 2P9SC 1JOFA 3AFCA 3PSLA 3SFZA 1A0RB 2H3XA 5FKRA 3AL8B 5TF2A 3HFQA 5JWZA 3OKYB 2OK4A 2P9KC 2XU7A 4PBYA 1NEXB 2B5NA 5THAA 3JZHA 5FA5B 1PGUA 5EAPA 3V5WB 5FXYA 1PBYB 4GGAA 3L4OD 4JSXC 4LG9A 4A0AB 4IMMA 4BH6A 4E5ZA 1XIPA 3UVNA 2HESX 2CN2A 2IURA 2YNOA 2H9MA 2OIZA 3EI1A 4UI9R 3F3FA 3GFCA 4X63B 4J77A 4JSPC 4O3UB 4A11B 1N6EA 3F3GA 4D6VA 2BBKH 3DXKC 1L0QA 4PSXB 3SWSD 3IJ1A 4CY3A 2BCJB 4O9DA 2CE9A 2PM9A 3EI2B 3ORVD 3IJCA 3SBRA 4GMBA 3PXTD 4QQEA 1RI6A 3I7OA 2EBSA 4GGCA 4X60B 3JPXA 3BG1A 3PXSD 4FAND 3RFHA 3KRWB 3C9CA 4JD2C 4GGDA 4ZN4A 5IGQA 2IAAA 2IUQA 5EARA 4J82A 2HJBA 3OTTA 4NSXA 5K19A 4GQBB 5IGOA 4LG8A 2P9NC 4A08A 2Z2NA 4QT8A 4CI3A 3EI4A 5CXCB 5I5IA 1MG2A 2IUVA 4G56B 5GSAA 3OKWA 3UVOA 2IWKA 3OKYA 5EMMB 5HYNB 2B5LA 4L3HD 3U4YA 4PXWA 4ZOVA 3IIWA 3C5MA 2CN3A 3EMHA 2I0RA 2OJYA 2H6NA 3PE7A 4Z8LA 2QC5A 1VYHC 4GM8A 4KFMB 3JAMg 4A0BA 4O45A 1OLZA 5H1MA 2J55H 5FKTA 4FAVD 1JMXB 3B7FA 2B4EA 4O1QD 5FQDA 2O9KA 4OWRA 4CZVA 5HE3B 3SBQA 2I3SA 4A7JA 4OZUA 4A2LA 4I79A 3UKRC 3EWEA 2PBIB 4GM9A 4GQ1A 4PSWB 5B4WA 3ZWLB 1GG2B 4ERQA 4ZOYA 3VGZA 4JXMA 4IA9A 3P4FA 4E54B 5C2VB 5AMSA 1MG3A 3W15A 4Y7RA 2H9NA 1OMWB 3JZNA 2CNXA 3PVUB 2CO0C 3SMRA 4CI8A 4CZXA 4J8GA 2G99A 4BL0A 2H14A 4CY1A 5CYKA 2I0TA 1YFQA 3EI3A 4A09A 5C2WB 5I5MA 3J80g 2YNNA 3KRXB 3MZKA 4JT6C 4EWRA 1K8KC 4J73A 4MK0B 2AGLA 3JROA 1XHMA 2Z2PA 4FA4D 3SBPA 5HQGA 2AGZA 3UKUC 3UVMA 2AH0A 3OL2B 4CC9A 1SQJA 5AJAA 4A2MA 1GXRA 2H6QA 5CXBB 1TYQC 4CI2A 2H9LA 2GC7A 2OVRB 2AGXA 3VA6A 5AFU3 5EM2A 5I5JA 5HE2B 3I7HA 4CZYA 5IC7A 3BWSA 3PXWD 3I7PA 4AEZA 2W18A 3DM0A 2AQ5A 3RLMD 1K32A 4FA9D 3RMZD 3UR4A 4CI1A 3OKTA 2OK6A 2YB8B 2H47A 4JT5C 5K1CC 2CO0A 4R7AB 2Z2OA 2HKMA 2XL3A 5EMKB 1TBGA 3NVQA 4CY2A 4E5ZB 3AL8A 2OVPB 4H5IA 2I0SA 3RN1D 4J84A 4J0WA 1JJUB 4ZOZA 4AOWA 4E54A 2PM7B 3N0EA 3RFGA 2UZXB 4LGNA 4FA5D 3EI1B 5FKSA 4J8BA 2XL2A 4U7AA 3I7NA 4U1EI 2P9IC 2IUPA 2J57G 1MDAH 3MKSB 4HDJA 1QNIA 4L9OA 4FA1D 4A0AA 2YBAA 3UVLA 3DWLC 1N6FA 2PM9B 3JRPA 3FRXA 4K3ID 1B9YA 3RRMC 1XKSA 3I2NA 2HJ4A 3SXTD 3VH0A 2TRCB 4L1QD 5IT9g 5GXHA 2H6KA 4A11A 5GMKn 1GOTB 2AGWA 4ERZA 2B5MA 2AH1A 3F3PA 5H14A 5HE0B 4H5JA 3AL9A 3SCYA 4J81A 5EMLB 3SN6B 4XYIA 1PI6A 3EI2A 4A08B 3EI4B 3CFSB 2J56H 2AGYA 4JSNC 4Y5RD 5FLXg 5EAMA 2P9PC 3DXMC 5TDHB
chains in the Genus database with same CATH superfamily
5C86A 2OVQB 4J79A 2HYEA 1ERJA 3PVWB 3MVDK 2QZPA 3N0DA 1VE6A 2CE8A 1H2YA 3O4HA 2MTAH 3V9FA 1SQ9A 3CIKB 3I7KA 1TYEA 5E6RA 1C9LA 4WK4A 3K6SA 2P9LC 5CXCA 5C9ZB 5TEEA 4QRJA 4YVDA 5FFGA 5IJ7E 4X3EA 2I3TA 3RSEC 3MXXA 1GP2B 2G9AA 4AX4A 4PC0A 3I8EA 3SHFA 3UVKA 4A0BB 1U2VC 1U4CA 2P9UC 3K26A 5A2Qg 3SVWD 2Q7QA 3IIYA 2QXVA 5IJ8E 2VZ1A 3A0FA 3NVXA 4N14A 4PBZA 3ODTA 3JB9L 1N6DA 4UM8A 1UOOA 4GZ8A 3NVNA 1FWXA 4ESGA 1E8NA 4NENA 2VDOA 1B9XA 4L3GD 4O3TB 2EIBA 4BP8A 3I8CA 4K3JB 2XYIA 3MMYA 3ULEC 3RN0D 2HU5A 4WK0A 1VZ2A 5H17A 5CYKB 5SXMA 4J86A 4GQ2P 3ZDZA 3EI3B 3C75H 3T3MA 4A09B 3ZDXA 5EALA 5GXIA 3SJLD 2H13A 2VDNA 3ZE1A 4O2WA 3JZGA 4G1EA 2IWFA 3DSMA 4GM3A 4JSVC 4ERYA 3SLED 3I89A 3FGBA 2GNQA 1R5MA 4QL1A 3V7DB 3PSCB 4BUJC 4BCBA 1U8CA 1UOQA 3IJ0A 3L4MD 3E0CA 4FHLA 4J0XA 2PM6B 3J81g 1VE7A 2JKXA 1SHYB 3EU7A 3MKQA 4PNKB 3BG0A 1JMZB 2HKRA 3EG6A 4XEIC 4XYHA 3FM0A 1H2XA 4J78A 3I7LA 1Q47A 2H9PA 3GREA 1PEVA 2YMUA 5EM2B 1P22A 5M61A 3EQ9A 3MUOA 4TZ4A 3V4PA 3C99A 1S4UX 3IJEA 4ZOXA 5TEFA 3AH8B 5FKQA 3OW8A 5HE1B 3OL2A 2BKLA 3CFVA 5EMJB 2HXCA 4D0KA 4FB1D 3MZLA 4FWWA 3IKOA 2H68A 4J87A 5CXBA 4CY5A 4ES0A 2HU8A 3EQ7A 2EIEA 3K71A 2YNPA 2GC4A 3VI3A 3K27A 5KDOB 4X61B 2VDPA 3OF7A 1NR0A 2UZYB 2P9SC 3O4GA 1JOFA 3AFCA 3QI0A 5M5VA 3PSLA 3SFZA 1A0RB 2H3XA 5FKRA 3AL8B 5TF2A 1I2MB 3HFQA 3GC3B 5JWZA 3OKYB 2OK4A 2P9KC 3IVMA 2XU7A 4PBYA 1NEXB 2B5NA 5THAA 3JZHA 5FA5B 1PGUA 5EAPA 3V5WB 5FXYA 4G55A 3T3PA 1PBYB 4GGAA 4DNVA 3L4OD 4JSXC 4RE6A 4LG9A 4A0AB 4IMMA 4O02A 4BH6A 4JHPC 4E5ZA 1XIPA 4RE5A 3ZDYA 3UVNA 4G1MA 2HESX 1UTCA 2CN2A 2IURA 2YNOA 4WK2A 1E5TA 2H9MA 2OIZA 3EI1A 4UI9R 3F3FA 3GFCA 4X63B 4J77A 5C92A 3IULA 4JSPC 3VI4A 4O3UB 4A11B 3F3GA 1N6EA 4D6VA 2BBKH 1C9IA 3DXKC 2VDRA 1H2ZA 1L0QA 4PSXB 3SWSD 3IJ1A 4CY3A 2BCJB 4O9DA 2CE9A 3GD1I 2PM9A 5FFOA 3QHYB 1BPOA 3EI2B 3ORVD 3IJCA 3SBRA 4GMBA 3PXTD 4QQEA 1RI6A 4QAMA 4NBMA 3I7OA 2EBSA 4GGCA 4X60B 3JPXA 3BG1A 3PXSD 4FAND 3RFHA 3IUQA 3K72A 1K3IA 3KRWB 1QFMA 3C9CA 1QFSA 4JD2C 5HDBA 4GGDA 3FCUA 4ZN4A 3ZE2A 5IGQA 2IAAA 2IUQA 5EARA 4J82A 2HJBA 3OTTA 4NSXA 5K19A 4GQBB 5IGOA 4LG8A 2VDKA 4AMZA 2P9NC 4A08A 2Z2NA 2XZGA 4QT8A 4CI3A 3EI4A 5CXCB 5I5IA 1T2XA 3NIDA 4NC4A 5E6SA 3ZE0A 4Z7OA 3O4IA 4MMYA 1MG2A 2IUVA 4G56B 5GSAA 3OKWA 3UVOA 2IWKA 3OKYA 5EMMB 5HYNB 2B5LA 4L3HD 3U4YA 3IUJA 4PXWA 4IRZA 4ZOVA 3IIWA 3C5MA 2CN3A 3EMHA 2I0RA 1O6GA 2OJYA 2H6NA 3PE7A 4Z8LA 2QC5A 1VYHC 2QR5A 4GM8A 4KFMB 3JAMg 4AN0A 4A0BA 1GOGA 4O45A 2VC2A 4BCDA 1OLZA 5H1MA 2J55H 5FKTA 4FAVD 1GOFA 1A12A 1JMXB 3B7FA 2VZ3A 2B4EA 4Z7NA 4O1QD 5FQDA 1JV2A 2O9KA 4OWRA 4L1MA 4CZVA 5M5UA 5HE3B 3SBQA 2I3SA 4A7JA 4OZUA 4A2LA 4I79A 5E6UA 3UKRC 3EWEA 2PBIB 2VDLA 4GM9A 4GQ1A 4PSWB 5B4WA 3ZWLB 1GG2B 4ERQA 4ZOYA 3VGZA 4JXMA 4IA9A 3P4FA 4E54B 1H2WA 5C2VB 5AMSA 1MG3A 3W15A 4Y7RA 2H9NA 1OMWB 3JZNA 2CNXA 3PVUB 2CO0C 3SMRA 4CI8A 4CZXA 4J8GA 2G99A 4BL0A 2H14A 4CY1A 5CYKA 2I0TA 1YFQA 3IUNA 3EI3A 4A09A 5C2WB 5I5MA 3J80g 3FCSA 1JTDB 2WQ8A 2YNNA 3KRXB 3MZKA 4JT6C 4EWRA 1K8KC 3NIFA 2EIDA 4BCCA 4J73A 4MK0B 2AGLA 3JROA 4MMZA 1XHMA 2Z2PA 4FA4D 3SBPA 5HQGA 2AGZA 3UKUC 3UVMA 2AH0A 3V4VA 4MMXA 3OL2B 4CC9A 1SQJA 5AJAA 4A2MA 1GXRA 4DNUA 4UM9A 2H6QA 5CXBB 1TYQC 1GOHA 4CI2A 2H9LA 5M5TA 2GC7A 2OVRB 2AGXA 3VA6A 5AFU3 5EM2A 5I5JA 5HE2B 3I7HA 4CZYA 5IC7A 3BWSA 3PXWD 3I7PA 4AEZA 2W18A 3DM0A 2AQ5A 3RLMD 1K32A 4FA9D 3RMZD 1M1XA 3UR4A 1E8MA 4CI1A 2VDQA 3OKTA 2OK6A 4BP9A 1L5GA 2YB8B 2H47A 4JT5C 5K1CC 2CO0A 4R7AB 2Z2OA 1VZ3A 2HKMA 2XL3A 5EMKB 1TBGA 3NVQA 4CY2A 4E5ZB 3AL8A 2OVPB 4H5IA 2I0SA 2XE4A 4J84A 3RN1D 4J0WA 1JJUB 3IURA 4ZOZA 4AOWA 4E54A 2PM7B 3N0EA 3RFGA 2UZXB 4LGNA 2HU7A 4FA5D 3EI1B 3O4JA 1YR2A 5FKSA 4J8BA 2XL2A 4U7AA 3I7NA 4U1EI 2P9IC 3NIGA 2IUPA 4WJKA 2J57G 1MDAH 3MKSB 4HDJA 1QNIA 4L9OA 4FA1D 4A0AA 2YBAA 3UVLA 3DWLC 1N6FA 2PM9B 2XDWA 3JRPA 3FRXA 4K3ID 1B9YA 3RRMC 4DNWA 1XKSA 3I2NA 3MUNA 2HJ4A 3SXTD 4Z7QA 5M5SA 2EICA 3VH0A 3DDUA 2TRCB 4L1QD 5IT9g 4JHNA 5GXHA 2H6KA 4A11A 5GMKn 1GOTB 2AGWA 4ERZA 4D9SA 2B5MA 2AH1A 1UOPA 3F3PA 5H14A 5HE0B 4H5JA 3AL9A 3SCYA 2VDMA 4NAAA 4J81A 5EMLB 1O6FA 3IUMA 3SN6B 4XYIA 4AMYA 1PI6A 3EQ8A 3EI2A 4A08B 3EI4B 5M5RA 3CFSB 2J56H 2AGYA 4JSNC 4Y5RD 5FLXg 5EAMA 2P9PC 3DXMC 3KCIA 4AN1A 5TDHB
chains in the Genus database with same CATH topology
2OVQB 4J79A 2HYEA 1ERJA 3PVWB 3N0DA 2CE8A 3V9FA 2MTAH 1SQ9A 3CIKB 3I7KA 2P9LC 5CXCA 5C9ZB 5TEEA 4QRJA 4YVDA 5IJ7E 4X3EA 2I3TA 3RSEC 3MXXA 1GP2B 2G9AA 4PC0A 3I8EA 3SHFA 3UVKA 4A0BB 1U2VC 1U4CA 2P9UC 3K26A 5A2Qg 3SVWD 2Q7QA 3IIYA 2QXVA 5IJ8E 3A0FA 3NVXA 4N14A 4PBZA 3ODTA 3JB9L 1N6DA 4GZ8A 3NVNA 1FWXA 4ESGA 1B9XA 4L3GD 4O3TB 3I8CA 4K3JB 2XYIA 3MMYA 3ULEC 3RN0D 5H17A 5CYKB 5SXMA 4J86A 4GQ2P 3EI3B 3C75H 4A09B 5EALA 5GXIA 3SJLD 2H13A 3JZGA 2IWFA 3DSMA 4GM3A 4JSVC 4ERYA 3SLED 3I89A 3FGBA 2GNQA 1R5MA 4QL1A 3V7DB 3PSCB 4BUJC 3IJ0A 3L4MD 3E0CA 4FHLA 4J0XA 2PM6B 3J81g 3EU7A 1SHYB 3MKQA 4PNKB 3BG0A 1JMZB 2HKRA 3EG6A 4XEIC 4XYHA 3FM0A 4J78A 3I7LA 1Q47A 2H9PA 3GREA 1PEVA 2YMUA 5EM2B 1P22A 4TZ4A 3C99A 1S4UX 4ZOXA 5TEFA 3AH8B 5FKQA 3OW8A 5HE1B 3OL2A 3CFVA 5EMJB 2HXCA 4D0KA 4FB1D 3MZLA 4FWWA 3IKOA 2H68A 4J87A 5CXBA 4CY5A 4ES0A 2YNPA 2GC4A 3K27A 5KDOB 4X61B 1NR0A 2UZYB 2P9SC 1JOFA 3AFCA 3PSLA 3SFZA 1A0RB 2H3XA 5FKRA 3AL8B 5TF2A 3HFQA 5JWZA 3OKYB 2OK4A 2P9KC 2XU7A 4PBYA 1NEXB 2B5NA 5THAA 3JZHA 5FA5B 1PGUA 5EAPA 3V5WB 5FXYA 1PBYB 4GGAA 3L4OD 4JSXC 4LG9A 4A0AB 4IMMA 4BH6A 4E5ZA 1XIPA 3UVNA 2HESX 2CN2A 2IURA 2YNOA 2H9MA 2OIZA 3EI1A 4UI9R 3F3FA 3GFCA 4X63B 4J77A 4JSPC 4O3UB 4A11B 1N6EA 3F3GA 4D6VA 2BBKH 3DXKC 1L0QA 4PSXB 3SWSD 3IJ1A 4CY3A 2BCJB 4O9DA 2CE9A 2PM9A 3EI2B 3ORVD 3IJCA 3SBRA 4GMBA 3PXTD 4QQEA 1RI6A 3I7OA 2EBSA 4GGCA 4X60B 3JPXA 3BG1A 3PXSD 4FAND 3RFHA 3KRWB 3C9CA 4JD2C 4GGDA 4ZN4A 5IGQA 2IAAA 2IUQA 5EARA 4J82A 2HJBA 3OTTA 4NSXA 5K19A 4GQBB 5IGOA 4LG8A 2P9NC 4A08A 2Z2NA 4QT8A 4CI3A 3EI4A 5CXCB 5I5IA 1MG2A 2IUVA 4G56B 5GSAA 3OKWA 3UVOA 2IWKA 3OKYA 5EMMB 5HYNB 2B5LA 4L3HD 3U4YA 4PXWA 4ZOVA 3IIWA 3C5MA 2CN3A 3EMHA 2I0RA 2OJYA 2H6NA 3PE7A 4Z8LA 2QC5A 1VYHC 4GM8A 4KFMB 3JAMg 4A0BA 4O45A 1OLZA 5H1MA 2J55H 5FKTA 4FAVD 1JMXB 3B7FA 2B4EA 4O1QD 5FQDA 2O9KA 4OWRA 4CZVA 5HE3B 3SBQA 2I3SA 4A7JA 4OZUA 4A2LA 4I79A 3UKRC 3EWEA 2PBIB 4GM9A 4GQ1A 4PSWB 5B4WA 3ZWLB 1GG2B 4ERQA 4ZOYA 3VGZA 4JXMA 4IA9A 3P4FA 4E54B 5C2VB 5AMSA 1MG3A 3W15A 4Y7RA 2H9NA 1OMWB 3JZNA 2CNXA 3PVUB 2CO0C 3SMRA 4CI8A 4CZXA 4J8GA 2G99A 4BL0A 2H14A 4CY1A 5CYKA 2I0TA 1YFQA 3EI3A 4A09A 5C2WB 5I5MA 3J80g 2YNNA 3KRXB 3MZKA 4JT6C 4EWRA 1K8KC 4J73A 4MK0B 2AGLA 3JROA 1XHMA 2Z2PA 4FA4D 3SBPA 5HQGA 2AGZA 3UKUC 3UVMA 2AH0A 3OL2B 4CC9A 1SQJA 5AJAA 4A2MA 1GXRA 2H6QA 5CXBB 1TYQC 4CI2A 2H9LA 2GC7A 2OVRB 2AGXA 3VA6A 5AFU3 5EM2A 5I5JA 5HE2B 3I7HA 4CZYA 5IC7A 3BWSA 3PXWD 3I7PA 4AEZA 2W18A 3DM0A 2AQ5A 3RLMD 1K32A 4FA9D 3RMZD 3UR4A 4CI1A 3OKTA 2OK6A 2YB8B 2H47A 4JT5C 5K1CC 2CO0A 4R7AB 2Z2OA 2HKMA 2XL3A 5EMKB 1TBGA 3NVQA 4CY2A 4E5ZB 3AL8A 2OVPB 4H5IA 2I0SA 3RN1D 4J84A 4J0WA 1JJUB 4ZOZA 4AOWA 4E54A 2PM7B 3N0EA 3RFGA 2UZXB 4LGNA 4FA5D 3EI1B 5FKSA 4J8BA 2XL2A 4U7AA 3I7NA 4U1EI 2P9IC 2IUPA 2J57G 1MDAH 3MKSB 4HDJA 1QNIA 4L9OA 4FA1D 4A0AA 2YBAA 3UVLA 3DWLC 1N6FA 2PM9B 3JRPA 3FRXA 4K3ID 1B9YA 3RRMC 1XKSA 3I2NA 2HJ4A 3SXTD 3VH0A 2TRCB 4L1QD 5IT9g 5GXHA 2H6KA 4A11A 5GMKn 1GOTB 2AGWA 4ERZA 2B5MA 2AH1A 3F3PA 5H14A 5HE0B 4H5JA 3AL9A 3SCYA 4J81A 5EMLB 3SN6B 4XYIA 1PI6A 3EI2A 4A08B 3EI4B 3CFSB 2J56H 2AGYA 4JSNC 4Y5RD 5FLXg 5EAMA 2P9PC 3DXMC 5TDHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OVQ B;  4J79 A;  2HYE A;  1ERJ A;  3PVW B;  3N0D A;  2CE8 A;  3V9F A;  2MTA H;  1SQ9 A;  3CIK B;  3I7K A;  2P9L C;  5CXC A;  5C9Z B;  5TEE A;  4QRJ A;  4YVD A;  5IJ7 E;  4X3E A;  2I3T A;  3RSE C;  3MXX A;  1GP2 B;  2G9A A;  4PC0 A;  3I8E A;  3SHF A;  3UVK A;  4A0B B;  1U2V C;  1U4C A;  2P9U C;  3K26 A;  5A2Q g;  3SVW D;  2Q7Q A;  3IIY A;  2QXV A;  5IJ8 E;  3A0F A;  3NVX A;  4N14 A;  4PBZ A;  3ODT A;  3JB9 L;  1N6D A;  4GZ8 A;  3NVN A;  1FWX A;  4ESG A;  1B9X A;  4L3G D;  4O3T B;  3I8C A;  4K3J B;  2XYI A;  3MMY A;  3ULE C;  3RN0 D;  5H17 A;  5CYK B;  5SXM A;  4J86 A;  4GQ2 P;  3EI3 B;  3C75 H;  4A09 B;  5EAL A;  5GXI A;  3SJL D;  2H13 A;  3JZG A;  2IWF A;  3DSM A;  4GM3 A;  4JSV C;  4ERY A;  3SLE D;  3I89 A;  3FGB A;  2GNQ A;  1R5M A;  4QL1 A;  3V7D B;  3PSC B;  4BUJ C;  3IJ0 A;  3L4M D;  3E0C A;  4FHL A;  4J0X A;  2PM6 B;  3J81 g;  3EU7 A;  1SHY B;  3MKQ A;  4PNK B;  3BG0 A;  1JMZ B;  2HKR A;  3EG6 A;  4XEI C;  4XYH A;  3FM0 A;  4J78 A;  3I7L A;  1Q47 A;  2H9P A;  3GRE A;  1PEV A;  2YMU A;  5EM2 B;  1P22 A;  4TZ4 A;  3C99 A;  1S4U X;  4ZOX A;  5TEF A;  3AH8 B;  5FKQ A;  3OW8 A;  5HE1 B;  3OL2 A;  3CFV A;  5EMJ B;  2HXC A;  4D0K A;  4FB1 D;  3MZL A;  4FWW A;  3IKO A;  2H68 A;  4J87 A;  5CXB A;  4CY5 A;  4ES0 A;  2YNP A;  2GC4 A;  3K27 A;  5KDO B;  4X61 B;  1NR0 A;  2UZY B;  2P9S C;  1JOF A;  3AFC A;  3PSL A;  3SFZ A;  1A0R B;  2H3X A;  5FKR A;  3AL8 B;  5TF2 A;  3HFQ A;  5JWZ A;  3OKY B;  2OK4 A;  2P9K C;  2XU7 A;  4PBY A;  1NEX B;  2B5N A;  5THA A;  3JZH A;  5FA5 B;  1PGU A;  5EAP A;  3V5W B;  5FXY A;  1PBY B;  4GGA A;  3L4O D;  4JSX C;  4LG9 A;  4A0A B;  4IMM A;  4BH6 A;  4E5Z A;  1XIP A;  3UVN A;  2HES X;  2CN2 A;  2IUR A;  2YNO A;  2H9M A;  2OIZ A;  3EI1 A;  4UI9 R;  3F3F A;  3GFC A;  4X63 B;  4J77 A;  4JSP C;  4O3U B;  4A11 B;  1N6E A;  3F3G A;  4D6V A;  2BBK H;  3DXK C;  1L0Q A;  4PSX B;  3SWS D;  3IJ1 A;  4CY3 A;  2BCJ B;  4O9D A;  2CE9 A;  2PM9 A;  3EI2 B;  3ORV D;  3IJC A;  3SBR A;  4GMB A;  3PXT D;  4QQE A;  1RI6 A;  3I7O A;  2EBS A;  4GGC A;  4X60 B;  3JPX A;  3BG1 A;  3PXS D;  4FAN D;  3RFH A;  3KRW B;  3C9C A;  4JD2 C;  4GGD A;  4ZN4 A;  5IGQ A;  2IAA A;  2IUQ A;  5EAR A;  4J82 A;  2HJB A;  3OTT A;  4NSX A;  5K19 A;  4GQB B;  5IGO A;  4LG8 A;  2P9N C;  4A08 A;  2Z2N A;  4QT8 A;  4CI3 A;  3EI4 A;  5CXC B;  5I5I A;  1MG2 A;  2IUV A;  4G56 B;  5GSA A;  3OKW A;  3UVO A;  2IWK A;  3OKY A;  5EMM B;  5HYN B;  2B5L A;  4L3H D;  3U4Y A;  4PXW A;  4ZOV A;  3IIW A;  3C5M A;  2CN3 A;  3EMH A;  2I0R A;  2OJY A;  2H6N A;  3PE7 A;  4Z8L A;  2QC5 A;  1VYH C;  4GM8 A;  4KFM B;  3JAM g;  4A0B A;  4O45 A;  1OLZ A;  5H1M A;  2J55 H;  5FKT A;  4FAV D;  1JMX B;  3B7F A;  2B4E A;  4O1Q D;  5FQD A;  2O9K A;  4OWR A;  4CZV A;  5HE3 B;  3SBQ A;  2I3S A;  4A7J A;  4OZU A;  4A2L A;  4I79 A;  3UKR C;  3EWE A;  2PBI B;  4GM9 A;  4GQ1 A;  4PSW B;  5B4W A;  3ZWL B;  1GG2 B;  4ERQ A;  4ZOY A;  3VGZ A;  4JXM A;  4IA9 A;  3P4F A;  4E54 B;  5C2V B;  5AMS A;  1MG3 A;  3W15 A;  4Y7R A;  2H9N A;  1OMW B;  3JZN A;  2CNX A;  3PVU B;  2CO0 C;  3SMR A;  4CI8 A;  4CZX A;  4J8G A;  2G99 A;  4BL0 A;  2H14 A;  4CY1 A;  5CYK A;  2I0T A;  1YFQ A;  3EI3 A;  4A09 A;  5C2W B;  5I5M A;  3J80 g;  2YNN A;  3KRX B;  3MZK A;  4JT6 C;  4EWR A;  1K8K C;  4J73 A;  4MK0 B;  2AGL A;  3JRO A;  1XHM A;  2Z2P A;  4FA4 D;  3SBP A;  5HQG A;  2AGZ A;  3UKU C;  3UVM A;  2AH0 A;  3OL2 B;  4CC9 A;  1SQJ A;  5AJA A;  4A2M A;  1GXR A;  2H6Q A;  5CXB B;  1TYQ C;  4CI2 A;  2H9L A;  2GC7 A;  2OVR B;  2AGX A;  3VA6 A;  5AFU 3;  5EM2 A;  5I5J A;  5HE2 B;  3I7H A;  4CZY A;  5IC7 A;  3BWS A;  3PXW D;  3I7P A;  4AEZ A;  2W18 A;  3DM0 A;  2AQ5 A;  3RLM D;  1K32 A;  4FA9 D;  3RMZ D;  3UR4 A;  4CI1 A;  3OKT A;  2OK6 A;  2YB8 B;  2H47 A;  4JT5 C;  5K1C C;  2CO0 A;  4R7A B;  2Z2O A;  2HKM A;  2XL3 A;  5EMK B;  1TBG A;  3NVQ A;  4CY2 A;  4E5Z B;  3AL8 A;  2OVP B;  4H5I A;  2I0S A;  3RN1 D;  4J84 A;  4J0W A;  1JJU B;  4ZOZ A;  4AOW A;  4E54 A;  2PM7 B;  3N0E A;  3RFG A;  2UZX B;  4LGN A;  4FA5 D;  3EI1 B;  5FKS A;  4J8B A;  2XL2 A;  4U7A A;  3I7N A;  4U1E I;  2P9I C;  2IUP A;  2J57 G;  1MDA H;  3MKS B;  4HDJ A;  1QNI A;  4L9O A;  4FA1 D;  4A0A A;  2YBA A;  3UVL A;  3DWL C;  1N6F A;  2PM9 B;  3JRP A;  3FRX A;  4K3I D;  1B9Y A;  3RRM C;  1XKS A;  3I2N A;  2HJ4 A;  3SXT D;  3VH0 A;  2TRC B;  4L1Q D;  5IT9 g;  5GXH A;  2H6K A;  4A11 A;  5GMK n;  1GOT B;  2AGW A;  4ERZ A;  2B5M A;  2AH1 A;  3F3P A;  5H14 A;  5HE0 B;  4H5J A;  3AL9 A;  3SCY A;  4J81 A;  5EML B;  3SN6 B;  4XYI A;  1PI6 A;  3EI2 A;  4A08 B;  3EI4 B;  3CFS B;  2J56 H;  2AGY A;  4JSN C;  4Y5R D;  5FLX g;  5EAM A;  2P9P C;  3DXM C;  5TDH B; 
#chains in the Genus database with same CATH topology
 5C86 A;  2OVQ B;  4J79 A;  2HYE A;  1ERJ A;  3PVW B;  3MVD K;  2QZP A;  3N0D A;  1VE6 A;  2CE8 A;  1H2Y A;  3O4H A;  2MTA H;  3V9F A;  1SQ9 A;  3CIK B;  3I7K A;  1TYE A;  5E6R A;  1C9L A;  4WK4 A;  3K6S A;  2P9L C;  5CXC A;  5C9Z B;  5TEE A;  4QRJ A;  4YVD A;  5FFG A;  5IJ7 E;  4X3E A;  2I3T A;  3RSE C;  3MXX A;  1GP2 B;  2G9A A;  4AX4 A;  4PC0 A;  3I8E A;  3SHF A;  3UVK A;  4A0B B;  1U2V C;  1U4C A;  2P9U C;  3K26 A;  5A2Q g;  3SVW D;  2Q7Q A;  3IIY A;  2QXV A;  5IJ8 E;  2VZ1 A;  3A0F A;  3NVX A;  4N14 A;  4PBZ A;  3ODT A;  3JB9 L;  1N6D A;  4UM8 A;  1UOO A;  4GZ8 A;  3NVN A;  1FWX A;  4ESG A;  1E8N A;  4NEN A;  2VDO A;  1B9X A;  4L3G D;  4O3T B;  2EIB A;  4BP8 A;  3I8C A;  4K3J B;  2XYI A;  3MMY A;  3ULE C;  3RN0 D;  2HU5 A;  4WK0 A;  1VZ2 A;  5H17 A;  5CYK B;  5SXM A;  4J86 A;  4GQ2 P;  3ZDZ A;  3EI3 B;  3C75 H;  3T3M A;  4A09 B;  3ZDX A;  5EAL A;  5GXI A;  3SJL D;  2H13 A;  2VDN A;  3ZE1 A;  4O2W A;  3JZG A;  4G1E A;  2IWF A;  3DSM A;  4GM3 A;  4JSV C;  4ERY A;  3SLE D;  3I89 A;  3FGB A;  2GNQ A;  1R5M A;  4QL1 A;  3V7D B;  3PSC B;  4BUJ C;  4BCB A;  1U8C A;  1UOQ A;  3IJ0 A;  3L4M D;  3E0C A;  4FHL A;  4J0X A;  2PM6 B;  3J81 g;  1VE7 A;  2JKX A;  1SHY B;  3EU7 A;  3MKQ A;  4PNK B;  3BG0 A;  1JMZ B;  2HKR A;  3EG6 A;  4XEI C;  4XYH A;  3FM0 A;  1H2X A;  4J78 A;  3I7L A;  1Q47 A;  2H9P A;  3GRE A;  1PEV A;  2YMU A;  5EM2 B;  1P22 A;  5M61 A;  3EQ9 A;  3MUO A;  4TZ4 A;  3V4P A;  3C99 A;  1S4U X;  3IJE A;  4ZOX A;  5TEF A;  3AH8 B;  5FKQ A;  3OW8 A;  5HE1 B;  3OL2 A;  2BKL A;  3CFV A;  5EMJ B;  2HXC A;  4D0K A;  4FB1 D;  3MZL A;  4FWW A;  3IKO A;  2H68 A;  4J87 A;  5CXB A;  4CY5 A;  4ES0 A;  2HU8 A;  3EQ7 A;  2EIE A;  3K71 A;  2YNP A;  2GC4 A;  3VI3 A;  3K27 A;  5KDO B;  4X61 B;  2VDP A;  3OF7 A;  1NR0 A;  2UZY B;  2P9S C;  3O4G A;  1JOF A;  3AFC A;  3QI0 A;  5M5V A;  3PSL A;  3SFZ A;  1A0R B;  2H3X A;  5FKR A;  3AL8 B;  5TF2 A;  1I2M B;  3HFQ A;  3GC3 B;  5JWZ A;  3OKY B;  2OK4 A;  2P9K C;  3IVM A;  2XU7 A;  4PBY A;  1NEX B;  2B5N A;  5THA A;  3JZH A;  5FA5 B;  1PGU A;  5EAP A;  3V5W B;  5FXY A;  4G55 A;  3T3P A;  1PBY B;  4GGA A;  4DNV A;  3L4O D;  4JSX C;  4RE6 A;  4LG9 A;  4A0A B;  4IMM A;  4O02 A;  4BH6 A;  4JHP C;  4E5Z A;  1XIP A;  4RE5 A;  3ZDY A;  3UVN A;  4G1M A;  2HES X;  1UTC A;  2CN2 A;  2IUR A;  2YNO A;  4WK2 A;  1E5T A;  2H9M A;  2OIZ A;  3EI1 A;  4UI9 R;  3F3F A;  3GFC A;  4X63 B;  4J77 A;  5C92 A;  3IUL A;  4JSP C;  3VI4 A;  4O3U B;  4A11 B;  3F3G A;  1N6E A;  4D6V A;  2BBK H;  1C9I A;  3DXK C;  2VDR A;  1H2Z A;  1L0Q A;  4PSX B;  3SWS D;  3IJ1 A;  4CY3 A;  2BCJ B;  4O9D A;  2CE9 A;  3GD1 I;  2PM9 A;  5FFO A;  3QHY B;  1BPO A;  3EI2 B;  3ORV D;  3IJC A;  3SBR A;  4GMB A;  3PXT D;  4QQE A;  1RI6 A;  4QAM A;  4NBM A;  3I7O A;  2EBS A;  4GGC A;  4X60 B;  3JPX A;  3BG1 A;  3PXS D;  4FAN D;  3RFH A;  3IUQ A;  3K72 A;  1K3I A;  3KRW B;  1QFM A;  3C9C A;  1QFS A;  4JD2 C;  5HDB A;  4GGD A;  3FCU A;  4ZN4 A;  3ZE2 A;  5IGQ A;  2IAA A;  2IUQ A;  5EAR A;  4J82 A;  2HJB A;  3OTT A;  4NSX A;  5K19 A;  4GQB B;  5IGO A;  4LG8 A;  2VDK A;  4AMZ A;  2P9N C;  4A08 A;  2Z2N A;  2XZG A;  4QT8 A;  4CI3 A;  3EI4 A;  5CXC B;  5I5I A;  1T2X A;  3NID A;  4NC4 A;  5E6S A;  3ZE0 A;  4Z7O A;  3O4I A;  4MMY A;  1MG2 A;  2IUV A;  4G56 B;  5GSA A;  3OKW A;  3UVO A;  2IWK A;  3OKY A;  5EMM B;  5HYN B;  2B5L A;  4L3H D;  3U4Y A;  3IUJ A;  4PXW A;  4IRZ A;  4ZOV A;  3IIW A;  3C5M A;  2CN3 A;  3EMH A;  2I0R A;  1O6G A;  2OJY A;  2H6N A;  3PE7 A;  4Z8L A;  2QC5 A;  1VYH C;  2QR5 A;  4GM8 A;  4KFM B;  3JAM g;  4AN0 A;  4A0B A;  1GOG A;  4O45 A;  2VC2 A;  4BCD A;  1OLZ A;  5H1M A;  2J55 H;  5FKT A;  4FAV D;  1GOF A;  1A12 A;  1JMX B;  3B7F A;  2VZ3 A;  2B4E A;  4Z7N A;  4O1Q D;  5FQD A;  1JV2 A;  2O9K A;  4OWR A;  4L1M A;  4CZV A;  5M5U A;  5HE3 B;  3SBQ A;  2I3S A;  4A7J A;  4OZU A;  4A2L A;  4I79 A;  5E6U A;  3UKR C;  3EWE A;  2PBI B;  2VDL A;  4GM9 A;  4GQ1 A;  4PSW B;  5B4W A;  3ZWL B;  1GG2 B;  4ERQ A;  4ZOY A;  3VGZ A;  4JXM A;  4IA9 A;  3P4F A;  4E54 B;  1H2W A;  5C2V B;  5AMS A;  1MG3 A;  3W15 A;  4Y7R A;  2H9N A;  1OMW B;  3JZN A;  2CNX A;  3PVU B;  2CO0 C;  3SMR A;  4CI8 A;  4CZX A;  4J8G A;  2G99 A;  4BL0 A;  2H14 A;  4CY1 A;  5CYK A;  2I0T A;  1YFQ A;  3IUN A;  3EI3 A;  4A09 A;  5C2W B;  5I5M A;  3J80 g;  3FCS A;  1JTD B;  2WQ8 A;  2YNN A;  3KRX B;  3MZK A;  4JT6 C;  4EWR A;  1K8K C;  3NIF A;  2EID A;  4BCC A;  4J73 A;  4MK0 B;  2AGL A;  3JRO A;  4MMZ A;  1XHM A;  2Z2P A;  4FA4 D;  3SBP A;  5HQG A;  2AGZ A;  3UKU C;  3UVM A;  2AH0 A;  3V4V A;  4MMX A;  3OL2 B;  4CC9 A;  1SQJ A;  5AJA A;  4A2M A;  1GXR A;  4DNU A;  4UM9 A;  2H6Q A;  5CXB B;  1TYQ C;  1GOH A;  4CI2 A;  2H9L A;  5M5T A;  2GC7 A;  2OVR B;  2AGX A;  3VA6 A;  5AFU 3;  5EM2 A;  5I5J A;  5HE2 B;  3I7H A;  4CZY A;  5IC7 A;  3BWS A;  3PXW D;  3I7P A;  4AEZ A;  2W18 A;  3DM0 A;  2AQ5 A;  3RLM D;  1K32 A;  4FA9 D;  3RMZ D;  1M1X A;  3UR4 A;  1E8M A;  4CI1 A;  2VDQ A;  3OKT A;  2OK6 A;  4BP9 A;  1L5G A;  2YB8 B;  2H47 A;  4JT5 C;  5K1C C;  2CO0 A;  4R7A B;  2Z2O A;  1VZ3 A;  2HKM A;  2XL3 A;  5EMK B;  1TBG A;  3NVQ A;  4CY2 A;  4E5Z B;  3AL8 A;  2OVP B;  4H5I A;  2I0S A;  2XE4 A;  4J84 A;  3RN1 D;  4J0W A;  1JJU B;  3IUR A;  4ZOZ A;  4AOW A;  4E54 A;  2PM7 B;  3N0E A;  3RFG A;  2UZX B;  4LGN A;  2HU7 A;  4FA5 D;  3EI1 B;  3O4J A;  1YR2 A;  5FKS A;  4J8B A;  2XL2 A;  4U7A A;  3I7N A;  4U1E I;  2P9I C;  3NIG A;  2IUP A;  4WJK A;  2J57 G;  1MDA H;  3MKS B;  4HDJ A;  1QNI A;  4L9O A;  4FA1 D;  4A0A A;  2YBA A;  3UVL A;  3DWL C;  1N6F A;  2PM9 B;  2XDW A;  3JRP A;  3FRX A;  4K3I D;  1B9Y A;  3RRM C;  4DNW A;  1XKS A;  3I2N A;  3MUN A;  2HJ4 A;  3SXT D;  4Z7Q A;  5M5S A;  2EIC A;  3VH0 A;  3DDU A;  2TRC B;  4L1Q D;  5IT9 g;  4JHN A;  5GXH A;  2H6K A;  4A11 A;  5GMK n;  1GOT B;  2AGW A;  4ERZ A;  4D9S A;  2B5M A;  2AH1 A;  1UOP A;  3F3P A;  5H14 A;  5HE0 B;  4H5J A;  3AL9 A;  3SCY A;  2VDM A;  4NAA A;  4J81 A;  5EML B;  1O6F A;  3IUM A;  3SN6 B;  4XYI A;  4AMY A;  1PI6 A;  3EQ8 A;  3EI2 A;  4A08 B;  3EI4 B;  5M5R A;  3CFS B;  2J56 H;  2AGY A;  4JSN C;  4Y5R D;  5FLX g;  5EAM A;  2P9P C;  3DXM C;  3KCI A;  4AN1 A;  5TDH B; 
#chains in the Genus database with same CATH homology
 2OVQ B;  4J79 A;  2HYE A;  1ERJ A;  3PVW B;  3N0D A;  2CE8 A;  3V9F A;  2MTA H;  1SQ9 A;  3CIK B;  3I7K A;  2P9L C;  5CXC A;  5C9Z B;  5TEE A;  4QRJ A;  4YVD A;  5IJ7 E;  4X3E A;  2I3T A;  3RSE C;  3MXX A;  1GP2 B;  2G9A A;  4PC0 A;  3I8E A;  3SHF A;  3UVK A;  4A0B B;  1U2V C;  1U4C A;  2P9U C;  3K26 A;  5A2Q g;  3SVW D;  2Q7Q A;  3IIY A;  2QXV A;  5IJ8 E;  3A0F A;  3NVX A;  4N14 A;  4PBZ A;  3ODT A;  3JB9 L;  1N6D A;  4GZ8 A;  3NVN A;  1FWX A;  4ESG A;  1B9X A;  4L3G D;  4O3T B;  3I8C A;  4K3J B;  2XYI A;  3MMY A;  3ULE C;  3RN0 D;  5H17 A;  5CYK B;  5SXM A;  4J86 A;  4GQ2 P;  3EI3 B;  3C75 H;  4A09 B;  5EAL A;  5GXI A;  3SJL D;  2H13 A;  3JZG A;  2IWF A;  3DSM A;  4GM3 A;  4JSV C;  4ERY A;  3SLE D;  3I89 A;  3FGB A;  2GNQ A;  1R5M A;  4QL1 A;  3V7D B;  3PSC B;  4BUJ C;  3IJ0 A;  3L4M D;  3E0C A;  4FHL A;  4J0X A;  2PM6 B;  3J81 g;  3EU7 A;  1SHY B;  3MKQ A;  4PNK B;  3BG0 A;  1JMZ B;  2HKR A;  3EG6 A;  4XEI C;  4XYH A;  3FM0 A;  4J78 A;  3I7L A;  1Q47 A;  2H9P A;  3GRE A;  1PEV A;  2YMU A;  5EM2 B;  1P22 A;  4TZ4 A;  3C99 A;  1S4U X;  4ZOX A;  5TEF A;  3AH8 B;  5FKQ A;  3OW8 A;  5HE1 B;  3OL2 A;  3CFV A;  5EMJ B;  2HXC A;  4D0K A;  4FB1 D;  3MZL A;  4FWW A;  3IKO A;  2H68 A;  4J87 A;  5CXB A;  4CY5 A;  4ES0 A;  2YNP A;  2GC4 A;  3K27 A;  5KDO B;  4X61 B;  1NR0 A;  2UZY B;  2P9S C;  1JOF A;  3AFC A;  3PSL A;  3SFZ A;  1A0R B;  2H3X A;  5FKR A;  3AL8 B;  5TF2 A;  3HFQ A;  5JWZ A;  3OKY B;  2OK4 A;  2P9K C;  2XU7 A;  4PBY A;  1NEX B;  2B5N A;  5THA A;  3JZH A;  5FA5 B;  1PGU A;  5EAP A;  3V5W B;  5FXY A;  1PBY B;  4GGA A;  3L4O D;  4JSX C;  4LG9 A;  4A0A B;  4IMM A;  4BH6 A;  4E5Z A;  1XIP A;  3UVN A;  2HES X;  2CN2 A;  2IUR A;  2YNO A;  2H9M A;  2OIZ A;  3EI1 A;  4UI9 R;  3F3F A;  3GFC A;  4X63 B;  4J77 A;  4JSP C;  4O3U B;  4A11 B;  1N6E A;  3F3G A;  4D6V A;  2BBK H;  3DXK C;  1L0Q A;  4PSX B;  3SWS D;  3IJ1 A;  4CY3 A;  2BCJ B;  4O9D A;  2CE9 A;  2PM9 A;  3EI2 B;  3ORV D;  3IJC A;  3SBR A;  4GMB A;  3PXT D;  4QQE A;  1RI6 A;  3I7O A;  2EBS A;  4GGC A;  4X60 B;  3JPX A;  3BG1 A;  3PXS D;  4FAN D;  3RFH A;  3KRW B;  3C9C A;  4JD2 C;  4GGD A;  4ZN4 A;  5IGQ A;  2IAA A;  2IUQ A;  5EAR A;  4J82 A;  2HJB A;  3OTT A;  4NSX A;  5K19 A;  4GQB B;  5IGO A;  4LG8 A;  2P9N C;  4A08 A;  2Z2N A;  4QT8 A;  4CI3 A;  3EI4 A;  5CXC B;  5I5I A;  1MG2 A;  2IUV A;  4G56 B;  5GSA A;  3OKW A;  3UVO A;  2IWK A;  3OKY A;  5EMM B;  5HYN B;  2B5L A;  4L3H D;  3U4Y A;  4PXW A;  4ZOV A;  3IIW A;  3C5M A;  2CN3 A;  3EMH A;  2I0R A;  2OJY A;  2H6N A;  3PE7 A;  4Z8L A;  2QC5 A;  1VYH C;  4GM8 A;  4KFM B;  3JAM g;  4A0B A;  4O45 A;  1OLZ A;  5H1M A;  2J55 H;  5FKT A;  4FAV D;  1JMX B;  3B7F A;  2B4E A;  4O1Q D;  5FQD A;  2O9K A;  4OWR A;  4CZV A;  5HE3 B;  3SBQ A;  2I3S A;  4A7J A;  4OZU A;  4A2L A;  4I79 A;  3UKR C;  3EWE A;  2PBI B;  4GM9 A;  4GQ1 A;  4PSW B;  5B4W A;  3ZWL B;  1GG2 B;  4ERQ A;  4ZOY A;  3VGZ A;  4JXM A;  4IA9 A;  3P4F A;  4E54 B;  5C2V B;  5AMS A;  1MG3 A;  3W15 A;  4Y7R A;  2H9N A;  1OMW B;  3JZN A;  2CNX A;  3PVU B;  2CO0 C;  3SMR A;  4CI8 A;  4CZX A;  4J8G A;  2G99 A;  4BL0 A;  2H14 A;  4CY1 A;  5CYK A;  2I0T A;  1YFQ A;  3EI3 A;  4A09 A;  5C2W B;  5I5M A;  3J80 g;  2YNN A;  3KRX B;  3MZK A;  4JT6 C;  4EWR A;  1K8K C;  4J73 A;  4MK0 B;  2AGL A;  3JRO A;  1XHM A;  2Z2P A;  4FA4 D;  3SBP A;  5HQG A;  2AGZ A;  3UKU C;  3UVM A;  2AH0 A;  3OL2 B;  4CC9 A;  1SQJ A;  5AJA A;  4A2M A;  1GXR A;  2H6Q A;  5CXB B;  1TYQ C;  4CI2 A;  2H9L A;  2GC7 A;  2OVR B;  2AGX A;  3VA6 A;  5AFU 3;  5EM2 A;  5I5J A;  5HE2 B;  3I7H A;  4CZY A;  5IC7 A;  3BWS A;  3PXW D;  3I7P A;  4AEZ A;  2W18 A;  3DM0 A;  2AQ5 A;  3RLM D;  1K32 A;  4FA9 D;  3RMZ D;  3UR4 A;  4CI1 A;  3OKT A;  2OK6 A;  2YB8 B;  2H47 A;  4JT5 C;  5K1C C;  2CO0 A;  4R7A B;  2Z2O A;  2HKM A;  2XL3 A;  5EMK B;  1TBG A;  3NVQ A;  4CY2 A;  4E5Z B;  3AL8 A;  2OVP B;  4H5I A;  2I0S A;  3RN1 D;  4J84 A;  4J0W A;  1JJU B;  4ZOZ A;  4AOW A;  4E54 A;  2PM7 B;  3N0E A;  3RFG A;  2UZX B;  4LGN A;  4FA5 D;  3EI1 B;  5FKS A;  4J8B A;  2XL2 A;  4U7A A;  3I7N A;  4U1E I;  2P9I C;  2IUP A;  2J57 G;  1MDA H;  3MKS B;  4HDJ A;  1QNI A;  4L9O A;  4FA1 D;  4A0A A;  2YBA A;  3UVL A;  3DWL C;  1N6F A;  2PM9 B;  3JRP A;  3FRX A;  4K3I D;  1B9Y A;  3RRM C;  1XKS A;  3I2N A;  2HJ4 A;  3SXT D;  3VH0 A;  2TRC B;  4L1Q D;  5IT9 g;  5GXH A;  2H6K A;  4A11 A;  5GMK n;  1GOT B;  2AGW A;  4ERZ A;  2B5M A;  2AH1 A;  3F3P A;  5H14 A;  5HE0 B;  4H5J A;  3AL9 A;  3SCY A;  4J81 A;  5EML B;  3SN6 B;  4XYI A;  1PI6 A;  3EI2 A;  4A08 B;  3EI4 B;  3CFS B;  2J56 H;  2AGY A;  4JSN C;  4Y5R D;  5FLX g;  5EAM A;  2P9P C;  3DXM C;  5TDH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...