5TF4A

Crystal structure of enoyl-(acyl carrier protein) reductase from bartonella henselae in complext with nad
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
264
structure length
264
Chain Sequence
GNGLLYGKRGLILGLANNRSIAWGIAKTASSAGAELAFTYQGEAMKKRVEPLAEEVKGFVCGHCDVSDSASIDAVFNTIEKKWGKLDFLVHAIGFSDKEELSGRYVDISESNFMMTMNISVYSLTALTKRAEKLMSDGGSILTLTYYGAEKVVPNYNVMGVAKAALEASVKYLAVDLGPKHIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLRRTVTIEEVGDSALYLLSDLSRSVTGEVHHVDSGYNIIGMKAVDAPDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of enoyl-(acyl carrier protein) reductase from Bartonella henselae in complext with NAD
rcsb
source organism Bartonella henselae
molecule tags Oxidoreductase
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
total genus 94
structure length 264
sequence length 264
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2016-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tf4A00
1NPTO 3H9QA 3TZ6A 4D79A 2GN6A 4DRYA 1GUYA 2C5EA 1P1RA 1LLDA 2QW8A 1KVSA 1ULSA 3DDNA 1U8XX 1V3TA 1OOEA 5BNTA 4NFYA 3GR6A 3VPHA 1ENYA 4DYDA 4ZN6A 1NPDA 3ZWYA 4HUJA 4AJPA 1LSUA 5F5LA 1SZJG 4GKBA 2ZYGA 1DC3A 1AN9A 1G0NA 3AOEC 3G17A 3KYDB 1HE5A 5G4KA 2X0IA 5L3ZA 5IN5A 2NU9A 1R37A 4NPCA 5AVOA 4BMVA 4A7PA 1NFQA 1L7DA 4AJLA 2GSDA 2BFOA 4DMMA 4PZCA 5CDYA 4IPTA 4FFPA 4B8WA 1AHIA 3G3EA 3I9LA 2TMGA 4EJ0A 3B6ZA 3RCBA 4B7UA 2GF2A 5JLAA 1EVYA 1A7AA 1ONPA 2B83A 2EERA 5A04A 3PK0A 1G0OA 1H2BA 2WE7A 1E3SA 2Q4EA 3C1TA 1YONA 2DPHA 4YRBA 1T2DA 3ANMA 1E7YA 1M76A 1DIHA 3D64A 1U4OA 2BFMA 4U0KA 2YHIA 1LDBA 4RGBA 5L4SA 3AUTA 3OA2A 3PZRA 4E4YA 1WXDA 1H93A 2X8LA 2BRUA 3QWBA 1HT0A 1HZZA 2AW5A 2EP7A 4K28A 4ALJA 1U2GA 4ESOA 4ZQGA 6LDHA 1B3RA 2O3JA 3ZWOA 4XQEA 2UYYA 4WLEA 4PLGA 2H1SA 4YEDA 3R0IA 3QW2A 4JGBA 1Z74A 3OEWA 1XIVA 1PU2A 2DQ4A 4BO8A 4BO3A 4YAJA 2O3RA 2Y1EA 1S7CA 1TI7A 3ZHBA 2O7QA 3JD1A 1YVEI 2H6EA 3PDUA 2NVBA 4TZTA 4E33A 1IOLA 5IAAA 1IZ0A 1X1TA 3WJ7A 3GDFA 4MP8A 2I6TA 4IIVA 1HKUA 3NTOA 3ONFA 2BGMA 5ER6A 1XA0A 1JQBA 2EJWA 1PJCA 4CL8A 4CLRB 1Z73A 4NQZA 3UXYA 4E0BA 2E48A 5FEUA 1JVSA 4CJXA 1ZVMA 4JXKA 2FPIA 4UVEA 4CM5A 3QLJA 1B8VA 1KC3A 3LC1O 2OP0A 2IXAA 3SXPA 1B26A 3ONDA 3RC2A 4BNTA 1FDWA 1KYQA 2HU2A 1X7DA 3ULKA 2CDAA 3FRJA 2O3UA 4M8SA 3AUUA 2Y93A 4NMHA 4NR0A 4RQUA 3FD8A 3JQDA 5BSFA 4YWJA 4A5OA 2NV6A 4FSHA 1DBVO 4RVGA 1EUDA 1YOVA 3M2TA 4NNJA 4DIOA 2JCXA 1PS8A 2V65A 3R3SA 5B12A 3AY7A 1UXJA 2X58A 4MVJF 5K9ZA 3ENKA 1DLIA 4IQ8A 4LW8A 3VZRA 3WYCA 2RBEA 3JYLA 5HS6A 4JK3A 4OMUA 4KUEA 4LISA 2PK3A 2ZYAA 4G2NA 4CQMA 1LLCA 1V8BA 4IS2A 1J6UA 1BVRA 2XF8A 4OO3A 1Q0LA 3RFTA 3VZPA 3OJOA 3EUWA 4Q3CA 4BIIA 5JDIC 5HWSA 4D42A 2R6JA 4JBHA 4NBVA 3GVIA 2J5KA 9LDBA 1K0UA 2C07A 2IZ0A 3AY3A 5ENDA 3WS7A 3E5RA 4OGWA 1SPXA 1DRWA 3W8DA 4YAGA 1FDUA 2VYNA 3GRKA 5DOZA 7ADHA 1GU7A 4UVDA 4EITA 3MEQA 5A5FA 4N7RA 2VHYA 4CL3A 4WCFA 4DVJA 1W6UA 2NVUA 3WOHA 4TRRA 1T1SA 1K6XA 3FPCA 1ADGA 1E7MA 2V6GA 3GK3A 4MIEA 5JE8A 1SB8A 2P9GA 2BGKA 3T7CA 1YOVB 4XGIA 4ND4A 3IJPA 5BSGA 4EYEA 1R12A 2Y66A 4DQVA 3QVXA 3VKUA 2P4HX 3H9GA 4I08A 5JAQA 3E6AA 4IXWA 3PYMA 2EP5A 4II3A 4QO8A 5ENVA 1I10A 1DC4A 3RUFA 4PVDA 1C1XB 3DB2A 4OXYA 3GY0A 4OHUA 3W4IA 1JAYA 5JCJD 1P0CA 3PHHA 5C7OO 2D5CA 2VT2A 3FWZA 3UH1A 2CNBA 1I3KA 3NJ4A 3C7AA 4N5MA 1PQWA 1H6CA 1HLDA 4GX5A 1EFKA 4J4HA 3PQEA 4KP7A 2PH5A 3I4FA 3LZ6A 3NAQA 1H6BA 2PGDA 3B1KA 2AG8A 1UH5A 4IZHA 5L95A 2GCGA 4UAGA 1ZXBA 4CV3A 1SB9A 4MKZA 4B7CA 4I9HA 4F6LA 3K96A 1LSSA 3BMQA 4Q39A 2WMDA 1KETA 1PJ2A 3GZNB 3I9KA 4LSMA 4QX6A 4JNKA 3ZWWA 3KSUA 4KWIA 5KWEA 1PGQA 2DAPA 4WCFC 1GUFA 4UVHA 3FNFA 3GNSA 1DB3A 5G2OA 2NM0A 3DBHB 2R2GA 2HMTA 1XG5A 1RPNA 5TJHA 1RYDA 2VRCA 3HDYA 4J4TA 4WJZA 3AM4A 1KBZA 4GPD1 3GPIA 1I3MA 1XDWA 4RL6A 3BA1A 3U9LA 5A9SA 2DLDA 4L73A 4OAQA 3MOIA 1D3AA 2W2KB 2DC1A 4BMSA 3O4RA 1MP0A 2DUUA 1F8FA 1VKOA 3LF2A 3LT0A 4WLOA 1AE1A 1U28A 2BI7A 4BS9A 1I33A 3UKOA 1DAOA 2YJZA 3JD0A 1BVUA 2BFAA 2NTVA 2P68A 1X7HA 2NTJA 4BO6A 3ZWMA 4DC1A 3L6DA 3JQAA 5CP8A 4E30A 4WECA 3RROA 1PZHA 3K9QO 5L7TA 4PLTA 4DIBA 3DFUA 4NI5A 2PKQP 2C20A 4HP8A 1PGNA 1WZEA 2NTNA 2X9GA 4BKUA 3PHJA 2Q49A 1OBFO 4KTTE 3RD5A 2VZ9A 4RZIA 1ZSNA 3D1LA 1E3LA 3RSHA 3JYOA 3SJ7A 1CQIA 1EMDA 1IHYA 1PIWA 1V0JA 1ENOA 4R51A 4EUEA 3A9WA 1LX6A 3DTTA 3NEPX 2D4AA 1KVTA 4BHTA 1U8FO 4YDRA 1ENZA 3PWSA 3GF4A 4UEKA 3VPSA 5TT0A 4XYBA 4ZRMA 2Y99A 4BNFA 3C1OA 3JQGB 4AJKA 1IE3A 1QXSA 3EAGA 4J90A 1C0PA 4NFHA 4W6ZA 1E1LA 4XZ3A 2E4AA 3NTRA 3OIDA 3RI3A 9LDTA 4TRNA 3AOGA 1Y8RB 3DHYA 3W6UA 3W1VA 4C7JA 2HK8A 1HSZA 1LRKA 1FMCA 1GFSA 1BTOA 4XIYA 3FNHA 1C1DB 1F14A 1YXMA 2EJVA 3JCZA 2C7GA 3INGA 1A7KA 2ZTUA 4KZPA 2VYVD 1ZK1A 1Y5MA 1JKFA 2B4RO 3QY9A 3TZHA 4A26A 3PIDA 1B0AA 4H3VA 4IDDA 4XA8A 5HS4A 2GO1A 3EVTA 1M67A 3U4CA 1R4NA 1QORA 4L4RA 3JQEA 1GADO 3H5NA 3EGOA 4FGWA 4JROA 4MVJI 4NBWA 5I7VA 4FD3A 3I9MA 4J7XA 3NT4A 4NJOA 2NSDA 5ICMA 1HYHA 1WW8A 1SBYA 5JFOA 5AXAA 5KVCA 4IJKA 4ZD6A 3F47A 1JW9B 4FC6A 1UP7A 4OQYA 1I30A 3VPFA 1N1GA 2Q2QA 4DQUA 3B70A 4XR9A 4BO0A 4QTZA 3AU9A 4OIMA 1HWYA 1C0LA 1U5AA 3GZNA 4FFRA 3BHMA 4O59O 1ISGA 3DL2A 3FHLA 3INTA 3NV9A 4MJLA 1B2LA 5DF1A 3U4HA 2X7HA 3BMNB 2IODA 5DOVA 3IIEA 3TN7A 1B8UA 1B15A 4JX8A 4I5EA 4MKRA 1A71A 2BGLA 1Y7TA 1BSVA 4IGEA 5EPOA 4R41A 4RF2A 1E3EA 1TT5A 2P5UA 2Y1OA 1PS9A 4FJ1A 5A3VA 2AEFA 4ALMA 1YO6A 3CMCO 3IKVA 3Q6IA 4UEJA 3U49A 1PL8A 4BGEA 3PLNA 3SVTA 4EI2A 1PJSA 4R9RA 3V8BA 1JKJA 1UAYA 4CMAA 4CQMB 2CF5A 2EW8A 1E7RA 2B69A 3D4PA 3GLQA 3ZGYA 1A9ZA 4CUKA 2JAPA 1I0ZA 1H6AA 3FN4A 4P4GA 3IMFA 4TRJA 3W6ZA 3KEQA 5IN4A 2NVWA 1HDGO 2AA3A 2VHWA 3F1KA 3Q11A 1O8CA 1R4MB 3WNQA 1PJ4A 4MPDA 4CODB 5JC1A 3W4JA 2ZJ0A 4R68A 3GVPA 3BTSA 4R54A 5TGDA 4IBOA 2X1HA 4YRAA 1GYPA 2QYSA 4J4BA 5DNAA 4CUJA 3DXFA 1HYEA 3LLVA 1HF3A 4FC7A 1DJNA 3G1TA 4LN1A 3T7EA 4N18A 4W7IA 3GAZA 1YWGO 2QYTA 1EK6A 3VH2A 2ZTLA 1YQXA 3GFBA 2DPGA 4IGFA 4XDYA 4YA6A 4GSLA 5B37A 1LNQA 2GD1O 3V1UA 2FPGA 1LSJA 1AUPA 3RJ5A 3L77A 5CEJA 1UDBA 4ALNA 4DIFA 2QRJA 1JLLA 3KHUA 2D0IA 3ICCA 4XGKA 1Y8RA 2DBRA 4U6SA 5DZSA 3ZWNA 1YL7A 4CMHA 3D7LA 3R1IA 5TC4A 4FFMA 4HBGA 3VC7A 1N2SA 4BNWA 4GLOA 3FSRA 4WOJA 3QHAA 1I2ZA 3JYNA 1GTMA 3LT4A 1C1XA 3OICA 1M66A 3WGYA 2X0NA 4JJIA 4PG4A 4A27A 4YBZA 5JYDA 3RJ9A 5IFLA 1ORRA 5ITWA 1H0KA 1XCBA 2Q1UA 2VOEA 5TJ9A 5F1KA 1OMOA 4R4JA 4DUPA 3L4SO 3JD3A 3WMWA 3H5RA 3ZNOA 2RHCA 1GYQA 1TVEA 1J5PA 3GNQA 2PGLA 3PWZA 2ZATA 4ZVVA 2FSVA 1KEWA 5CFZA 1I3LA 5JPIA 4RLHA 3MJVA 3FPLA 4IDFA 4HY3A 4WCFB 3MJTA 1W73A 5KOIA 3BIOA 3K92A 4M49A 4O6VA 3QWIA 1LEHA 1BDMA 4XEHA 1PJBA 3WGIA 4W7HA 1ID1A 4CQLA 1DEHA 4XRRA 3ENNA 4I5FA 3O03A 3JQBA 5T64A 3F5SA 3PDJA 3QRWA 4MP3A 1DC6A 2X5OA 2IYPA 3ZI0A 1I01A 1N7HA 1C14A 3H2ZA 4W9NC 3LSYA 1O0SA 1ZH8A 1U2DA 2DFDA 4J1NA 4YR9A 4K26A 1ISIA 4DLAA 5TQVA 1EUCA 3PGXA 4ALLA 4B8ZA 3W4KA 5HRUA 2PZKA 2VN8A 4AG3A 3TSCA 4Y98A 1N9GB 2Y1CA 3F4BA 4PRKA 3ZH2A 1RYEA 2RH8A 3ETEA 5JAZA 3FI9A 4UUPA 1VE9A 3FNGA 5TNXA 3E82A 2ZB8A 1CYDA 2X0RA 3L9XA 3HG7A 4ZU3A 1K3TA 1YJQA 2CVOA 3GHHA 4DYVA 3VPGA 3T4XA 3RFVA 3TZQA 1B7GO 4YJHB 4J7UA 3WXBA 4KDFA 3H9JA 4B3IA 2LDBA 2OMEA 1Q2XA 4J3FA 2IYOA 4B4WA 2Y0DA 4YAEA 5DDIP 1PTJA 1E1MA 2HK9A 1NWCA 4LMPA 3WWZA 1KEUA 3DBHA 2DBQA 4J9UE 2F1KA 4GVLA 3SC4A 4RPHA 3GNTA 2Q3EA 3PGJA 1DPGA 1UXGA 1Y8QB 4J7CA 5COQA 4NG5A 3ZU2A 3D4OA 3I6IA 4DTIA 3E1KA 4LRTB 2GUGA 3HNPA 4AJIA 4J2HA 5KNLA 2WEKA 1YKFA 1PJLA 4D7AA 1W4ZA 2HO5A 3GVHA 3GG2A 4HX5A 1K6IA 3HDJA 3KV3O 4DL9A 2BF7A 3M1LA 4GLLA 3D4NA 3LF1A 4UULA 1JWAB 1SOWA 5ITVA 4FS3A 2UDPA 3KTDA 4J0FA 2C54A 5JY6A 2QG4A 2VWQA 3F46A 2WD8A 4C7KA 3NDIA 2WD7A 4BVAA 2Q1WA 5A3JA 4GGPA 1ZSYA 3JD2A 5AXBA 2VCYA 2Y0CA 3COSA 4BO2A 3VTZA 1XKQA 4OXNA 5TSDA 3WQSB 2O4CA 2WSBA 5COAA 1MXFA 5G0WA 2NU7A 2O3QA 4BKQA 1PGPA 3OP4A 4JP2A 5KIAA 1E5QA 1KIFA 1ZKMA 4E3ZA 2UUOA 3UN1A 4A10A 2VUTA 4KOAA 3RWBA 3I9JA 1ZFNA 3PHLA 2ZB4A 4U0JA 4B7XA 2PA3A 2DTDA 2GN9A 4J91A 4FR5A 3RUIA 3ITKA 1HEUA 3TFQA 1NQTA 2ZK7A 3GPDG 3CZMA 5AYVA 4MIYA 3U0BA 1E3IA 3MJEA 3HWRA 3ZW8A 5LDHA 3CH6A 1Y6JA 4J1QA 4RVSA 1XQ6A 4OM8A 4YAKA 5CG1A 2HMSA 4DPLA 1RM3A 1LDMA 1DFHA 4WASA 1PJQA 1H9AA 3VH3A 4AJ1A 5IXSA 4M86A 1CETA 2POQX 4OJNA 4YAIA 2O3SA 1K6JA 1DSSG 5BR7A 3GN1A 3RC1A 1BWSA 4S1VA 1PGOA 1OC2A 2UV8A 1T2AA 3CTMA 1KVUA 2A9FA 2I66A 4A2CA 3DBLA 1MFPA 3QJ5A 1N1EA 4OKIA 3SEFA 4CR7A 3ANLA 5F5NA 3HADA 3S55A 2Q1TA 2DTXA 3HZZA 1MGOA 2FN7A 5ADHA 2GNAA 3H8VA 3U4IA 3DC2A 4IDBA 4E2YA 1U3UA 5IZCC 2O2SA 3ZW9A 3OJLA 1LU9A 3P2OA 4CV2A 5EMHA 5L9AA 1XQ1A 4FDAA 3O8QB 1WPQA 4IMPA 3RUEA 3ROPA 4Q3DA 2YDXA 4R1SA 3WB9A 3DZHA 1PWXA 3H3JA 3LT2A 3KEOA 3S2GA 1OC4A 3JQAD 1ZZEA 1UXIA 4EDFA 4E21A 1NFRA 1MC4A 3RC9A 4FJ2A 3PEFA 1EZ4A 3ON5A 1ZK0A 2A94A 3I83A 3C24A 4BKRA 2W2LD 3I23A 4BO9A 2DBZA 2EKLA 3K30A 3KVOA 4PN3A 2HJRA 2UAGA 2OGUA 3G1UA 3TF5A 1YJ8A 5THKA 2IEBA 3WDSA 1U9JA 2BI8A 3CINA 4E5PA 4YXFA 5C7LO 1QRRA 3AM5A 4KWHA 1WLYA 5JS6A 3B1FA 1YB1A 1CF2O 4R69A 4CV0A 2W98A 4MINA 1ZK4A 2BKAA 3HHPA 4XDZA 4ZICA 3WBFA 2F00A 3DBRB 2P2SA 3ITDA 3TOZA 4PG6A 2J3KA 3AUSA 4LVCA 1Z75A 3V2HA 3WX0A 3Q2KA 3PLRA 1NASA 1Y9EA 4URFA 4AJOA 1Z7EA 2DUWA 2JFHA 3EK2A 1EVIA 2YUTA 3DBVO 2PZJA 4YT2A 1ZBQA 5IF3A 3ADOA 4OSOA 4RVHA 5KJ1A 3CZRA 3NTQA 1BHSA 1X14A 2DBVO 3AW9A 5GZ3A 4CM9D 1O95A 3P5SA 1H94A 3OQBA 1FDSA 4BNIA 3M2PA 1ISHA 2J6IA 1RWBA 3BMOA 3WGOA 3JYQA 2Q1SA 4CLXA 4CUZA 2YFQA 2X22A 2OZPA 2VQ3A 3KLMX 4WCDA 3H7AA 3OHSX 5CG2A 1MC5A 2I5PO 4PG8A 4HWKA 3GH3A 1DRVA 1OI7A 2OXIA 4IINA 1F17A 1A4UA 3U5TA 4WUVA 1QYXA 1PEDA 2FSSA 4FIZA 4HADA 1DIGA 5L51A 3ZN2A 1HTBA 1EVJA 4TWRA 4XQGA 3IL2A 3PP8A 3GGPA 3BMQB 2V6BA 1PJTA 4E5KA 1E1NA 3EC7A 2AQ8A 4F45A 4NK5A 3F9IA 4DLBA 2HQ1A 3ZWCA 1X7GA 3PHGA 3OIGA 4XWYA 2WWRA 4K9DA 1B16A 3ZU5A 3NX4A 4DMLA 4KQXA 4R01A 2I9PA 4K6FA 4BNUA 1X0XA 3E03A 4IS3A 3OIFA 1YL6A 1JWBB 1GPDG 3JQ8A 2PH3A 4PRLA 3Q9UA 4HNHA 3B20A 3PIIA 4YTEA 2I3GA 5GZ1A 2QHXA 1DFIA 1Q7CA 1V9LA 2O3TA 3IP1A 3IS3A 3WNVA 5TF4A 3UCEA 3DAGA 3JQ9A 4TZKA 1W8DA 4MVJH 5KTKA 5EERA 3QIVA 4P22A 3AY6A 4RO0A 2D8AA 3LC7O 4BV9A 5IXYA 4XGNA 1LDEA 3BMOB 4EJ6A 3PTZA 2XXJA 2D1YA 2HCTA 5DP2A 5FWNA 4Z3KA 1QYDA 3LK7A 4MVJG 2J5RA 4RPJA 3EYWA 5C3MA 4JCOA 2B5WA 4JJGA 4QUKA 4QFDA 4BGVA 2DU8A 5EN4A 2FMUA 4YJHA 1EBFA 1P44A 2A92A 3O26A 4LCJA 4E5YA 3HN7A 2Y0EA 3UAGA 4PGFA 3W8EA 3F5QA 5L7WA 2YZ7A 2ZB3A 3PWKA 4RJTA 1NVTA 4PLZA 4II2A 1PR9A 2QQ5A 4Q9NA 4GWGA 4Z3DA 1UXHA 1NQ5A 2FP4A 3GVXA 5JO9A 4RPGA 4Y67A 1QP8A 1I24A 2LDXA 3M6IA 4P4NA 4YJDA 4YJGA 4TROA 3OJFA 4CM7A 1CJCA 1BMDA 4CM9A 4EUFA 4PZDA 3ZDFA 2NLOA 1CWUA 3I3OA 3FR7A 2PV7A 2WE8A 1N5DA 4QFCA 4XCVA 3JD4A 5EQDA 4XD2A 3D3WB 5CDUA 3I9NA 5KKCA 4C4OA 1GUZA 3DAPA 4AJEA 5B1YA 3O38A 3OM9A 4E13A 2J3JA 1J49A 1ZUD1 3JQAB 1KOLA 4BMNA 2XAAA 4FBGA 5JSFA 3FTNA 4IJUA 3GC6A 1GV0A 1DIBA 1SOVA 4BB5A 4DGSA 2R00C 1QLJA 3V1TC 2CDBA 1U3TA 4GL4A 5L53A 3BZUA 2AMFA 4FGSA 2D2IA 5TLSA 3WWYA 1NR7A 1LXCA 2VHVA 5JNLA 2CY0A 3TDKA 2NADA 3H6KA 1E5LA 3ICPA 3P19A 4UUOA 2VUSA 3FWNA 1V3VA 3OA0A 5BNFA 1X0VA 3RUDA 5C5IA 2VZ0A 4CV1A 4I5GA 1LUAA 2BMAA 1HDRA 5J23A 1P77A 1VI2A 1XYGA 5IDYA 5LCXA 5I8ZA 4L9RA 3TOXA 3MJSA 3C7CB 2D3TA 1HL3A 1VLLA 4WLFA 1G1AA 4CLRA 5A5EA 4J1SA 1E3JA 4R9SA 3AM3A 1I3NA 1ZMOA 4TVOA 3KYBA 3CE6A 3LYLA 3X2EA 4L74A 2QZ9A 2CD9A 3E9MA 3PFWO 4Z0PA 1NNUA 2P5YA 5H81A 3HUDA 3PFFA 3KOUA 5EINA 1H9BA 3DZKA 5JDCA 1VJ0A 4CPDA 3WGTA 3JQ7B 4KUGA 4DBZA 5F1OA 1MLDA 1MXHA 2EF1A 2G1UA 3ZZNA 3WIEA 4XR4A 4PLWA 1K89A 2IE0A 2JAHA 3R3JA 3TQHA 2Y1GA 3JYPA 4B4VA 1WP4A 1IPEA 1P1KA 3JQGA 5F21A 3WIDA 4BL5A 4I1IA 1GCUA 3WBBA 2EW2A 1JDJA 3KRTA 3K5PA 3GOHA 4NBTA 3EMKA 1KY4A 1UXKA 3UCXA 2I65A 1LSOA 2G76A 4LMRA 2BHLA 2P9CA 5JBIA 1XWFA 2A35A 1GDHA 2FZEA 3Q0EA 3QVWA 3WR5A 2EG9A 3NJ8A 3FR8A 1ADFA 3NUGA 4Z9YA 4TKMA 5DT9A 1P3DA 4BUCA 2EHDA 4MP6A 1G6KA 2OHXA 2VOJA 4A73A 1QG6A 1DJQA 4GQAA 4CMJA 3HQ4O 3GZ4A 2P9EA 3TNLA 2HUNA 1ZIDA 1ISMA 1NFFA 3TRIA 3NKLA 3WYBA 2WJPA 4ALKA 4F6CA 4PLHA 4XYMA 1VRWA 2G17A 4BKPA 4OXKA 3CEAA 1V35A 1SCUA 1YH3A 3SC6A 2BLLA 3I6QA 5U1PA 5A4DA 1NQOA 1KEVA 3QVTA 5L4NA 4H16A 4TVBA 1UAGA 2WYWA 1YL5A 2PTGA 2OORA 4INAA 1W0CA 4MVJE 1E1KA 2YY7A 1QLHA 2OUIA 5KJFA 1U1IA 2Z5LA 4IDGA 3S8MA 1NP3A 2ZKLA 5JAIA 4CLOA 5FI5A 1F8GA 3ROKA 1IY8A 2DKNA 5DBFA 4DC0A 1WDMA 2Q2WA 2DM6A 3D5TA 5T8KC 4EGFA 5KJ6A 4L75A 2GZ3A 1R0SA 4EBFA 1O5IA 1PQUA 1BW9A 4L4XA 3WGHA 3ZHZA 3GEMA 1T2EA 3HFGA 2VZ8A 2FRDA 5DN9A 3VKVA 3GEDA 4F3YA 4I9UA 1GZ4A 1C0IA 4CM3A 3P2YA 1WDKA 1BXGA 4ND2A 2ET6A 4UVGA 4JBGA 2VTDA 4BO4A 4RPKA 2E49A 4AVYA 3DEYX 4CQLB 1PX0A 4M87A 2PD6A 2AEJA 4BO7A 5AOVA 4MVJP 1E7SA 1CRWG 4KDEA 4AJJA 4AJNA 4E2WA 2JFGA 3GUYA 4IIUA 4ZQBA 1IYZA 3GVCA 3MWDB 1E7QA 5I9MA 3CKYA 4YPOA 5DBIA 1ZMTA 2EWMA 5A9RA 1H5QA 4E2XA 1ZEMA 5EL0A 2O4UX 1EDOA 1YBAA 2JFFA 3ZWPA 1EQUA 4BNNA 4YJFB 3F1LA 3QWFA 4G5HA 5K6AA 1R66A 3LLSA 2EIHA 4QXMA 4R3WA 4RV9A 2GYYA 3NGXA 4OSPA 1K5HA 3HJAA 5G0VA 3L6EA 4M89A 3ZNPA 5A06A 3ETDA 1HE2A 4Q3AA 1LC3A 2Y67A 1QYVA 1SAYA 1A5ZA 1DOHA 4IM7A 4Y6SA 3JQ6A 5THQA 2P91A 3BXXA 1B3BA 1D7OA 3GDGA 3K2BA 2B4TO 4J2OA 3DONA 4RVDA 5A1TA 4RCVA 3K2EA 1Q7GA 2VWHA 2GGSA 3GT0A 4M54A 2GRAA 5TS3A 4GH5A 3Q2IA 1LBEA 4H15A 3VAZA 5TIIA 3G79A 2AXQA 5C7IO 5ICSA 3WQRA 1GQ2A 2ZQYA 2GR9A 4Z9XA 5ILOA 3W8FA 3OETA 2NACA 3H5AA 2WD7B 4HV4A 3DTYA 4WOKA 1MUUA 1AGNA 3BHIA 4IQ0A 1A9YA 3GMDA 4JIGA 3LU1A 4NFSA 3QA9A 2CFCA 1TB4A 1ZK2A 2X5JO 4CMCA 3MZ0A 4Y6RA 5CDTA 2A4KA 2NU6A 3NGLA 2EKPA 2GDZA 3U62A 4ZRNA 1JVBA 3HB4X 3GUCA 3AI1A 4R16A 1DAPA 4WPGA 4YCAA 4CMEC 1NR1A 3ZV3A 4GMFA 4GX1A 3C8MA 3KYDA 1L1FA 3CPSA 1VL0A 4AICA 3PYXA 1QMGA 4W82A 1YQDA 3EVNA 5L4LA 1PZEA 2VHZA 3ZWXA 1R0KA 5KVSA 2W4QA 1HDXA 1LRJA 4KMSA 1Z45A 3ABIA 3TL3A 2OP1A 4U5QA 3ASVA 3JSAA 3IAHA 1ONNA 2AE2A 2HK7A 3VDRA 5JY1A 1XSEA 4G81A 3VZSA 4PVCA 3MWEB 3ZHYA 1NHGA 1JAXA 3VDQA 1O6ZA 1LQUA 2IDZA 5JMPA 2VYND 1I2BA 1NTOA 4BNHA 3C7DB 4YB8A 2PKQO 2PY6A 1WWKA 3BMCA 3V2GA 3RUAA 3OH8A 1NPYA 4ITUA 2W90A 4WNCA 4WEOA 1I36A 1E7WA 4NIMA 3H4VA 1IUKA 4BOYA 3VHRA 4GWKA 1HDCA 3K73O 1WDLA 1IL0A 5T67A 3UFXA 5B4TA 2JD0A 2TMDA 4QO7A 3C85A 3C3XA 2CDCA 2UUPA 1ML3A 1GQYA 1DC5A 2HRBA 2JJYA 3DZBA 3L9WA 4RPLA 1HZJA 5HM8A 4DQXA 2OFPA 5JXWA 2C2XA 4PCVA 1C3VA 2QIOA 2GASA 3GMSA 3QP9A 3O9ZA 1LRLA 4FFOA 2DT5A 4E32A 1LQTA 4BNVA 1WVGA 2PGJA 1ISFA 1NBOA 1RJWA 2FPPA 5K0ZA 4Q3NA 3AU8A 2YYYA 1SMKA 4RDIA 4D43A 3WYEA 1UP4A 4TKLA 2BELA 4PIVA 3ZWAA 3AJRA 4CMKA 1Z82A 1ZEJA 2VUUA 1YRLA 4PFJA 1UDCA 3A4VA 4JBIA 3WGGA 1PGJA 2VRCD 3MTGA 3SLGA 5BSHA 3A06A 3KYCB 4HXYA 4Y9DA 1E3WA 1R15A 4L4SA 3Q1LA 2Y1DA 2P4QA 3NDJA 5FYDA 2CMDA 1M2WA 3I4CA 3KSZO 4IXTA 2X23A 3RBVA 3PRJA 2W2LA 3ZU3A 1F06A 3UGKA 3NT5A 3RIHA 2BD0A 2FR0A 3U3XA 1B8PA 1ZW1A 2C7VA 2HMVA 1T24A 4RF3A 5BT9A 3RKUA 4GKVA 4ONEA 3D0OA 2AEMA 1LA2A 3WQQA 4EEXA 2AHRA 3QSGA 1D4FA 1NAIA 3A14A 2RAFA 4AFNA 1NWHA 2J8ZA 4M1QA 4EZBA 2CVZA 3DMYA 2HDHA 4EEZA 2YV3A 5HA5A 1XR3A 4LGVA 4RLSA 5IDWA 2ZCUA 2QRKA 1KERA 1YQGA 4BQPA 5L7YA 2H9IA 1R4MA 1QKIA 4IJWA 4JP3A 5H83A 3S2EA 1IULA 5CDGA 3PPIA 3OSUA 2XOXA 5JCJA 4ILKA 4FCCA 3QWHA 5JDCC 3ZCXA 1IPFA 4CLDA 2DTEA 2D5AA 4P4LA 1RM0A 3MJ4A 1T4BA 1DRUA 1FXSA 4RZHA 4ZQFA 3E8XA 5H82A 4A03A 3RFXA 1GD1O 3DWFA 3DMTA 1T1RA 3GQVA 3JQFC 5I7EA 3EZLA 4WLVA 5A9SB 4M55A 1BXZA 3NYWA 1EK5A 3M1AA 3KBOA 4L76A 5F3RA 3EDMA 1YDWA 2FR1A 5CDSA 5HTOA 3E9NA 2PD4A 4MVJA 2G0TA 3GDOA 1V6AA 1IHXA 1HDOA 1QV6A 1WMAA 3GAFA 4P8RA 4BNLA 5BNIA 3OJ0A 1CIVA 3GFGA 5HBRA 1KVQA 1VL8A 2B5VA 1BW9B 4EJMA 1JN0A 1HXHA 1KS9A 3PJDA 2ZYDA 4ND3A 5B4VA 1PWZA 4HFJA 2O23A 4L0QA 4NJMA 1UP6A 4AJHA 4XIJA 3D5QA 4MVJM 4YT4A 8ADHA 2Y68A 1D8AA 1EDZA 2OL4A 3RC7A 4J16A 3GN2A 5KVVA 3U4DA 3WFIA 3VPXA 3E48A 2X9VA 4D0SA 3DFZA 4RVFA 1QYWA 1MB4A 2WM3A 3CSDA 3HB5X 4PLCA 4U7WA 1T4DA 3V5NA 3FNEA 3JQ7A 2ZIZA 1TXGA 3BYZA 1T2CA 1EQ2A 4G65A 5MDHA 4XRGA 2HMWA 2NVUB 2B37A 3IQDB 3WLFA 1Y8QA 1LLUA 2EKQA 2XPCA 2FY8A 5JW6A 2O50A 3KB6A 1PSDA 5TX7A 4UUNA 1LDNA 4BNYA 2QRLA 1TT7A 1YS4A 2ZJ1A 3DR3A 3QV1A 1UZMA 4UUMA 2PWZA 3LVFO 5TRTA 1HLPA 2D59A 4FOSA 4GI2A 4B79A 4ZHSA 3PZBA 4U6QA 3WGQA 2X6TA 5I7SA 2X86A 4CM8B 3X2FA 1R0LA 3RU9A 3HE3A 3GG9A 2YQ5A 3DZFA 1NYTA 1X13A 4NHEA 1FF9A 4Y8VA 1KVRA 1DDOA 2IRWA 1ZCJA 4FOOA 5EJ2A 5G0SA 4ZGWA 3RQSA 1H6DA 1QSGA 2JHFA 2G82A 2PZMA 1UR5A 3INRA 1BRMA 2HAEA 1ONOA 1HE4A 4UREA 4ZA2A 4ND1A 3LC2O 4JQCA 1C0KA 5A9TA 3KM0A 4FFNA 1M6HA 3Q3CA 1E6WA 4RQTA 1TLTA 2NQTA 2ZB7A 4UEOA 2VWGA 4Z6KA 1ZSVA 4NU6A 3V2UA 1DXYA 1P1HA 2PD3A 3WG9A 5K6AC 2HMUA 1LLQA 2GPTA 1VSVA 1I32A 4WGGA 1XEAA 5KKAA 2RIRA 3H9UA 3IC5A 3OEYA 4OQZA 4XB1A 5DCWA 3WSVA 2OOSA 2X4GA 4NDNE 1HDYA 1P1JA 2EXXA 2V6MA 4YQYA 2ILTA 4LK3A 5FFFA 3V1YA 3RBZA 1PR3A 3F3SA 5KCZA 2QZZA 1A4IA 1ULUA 3EZYA 3ZNQA 3DOOA 4GVXA 3D3EA 3ZNNA 3QQPA 1Y5RA 4N5NA 3H9EO 4DLLA 5T5QA 2VWPA 3AI2A 1N9GA 1PL7A 6ADHA 3QWAA 2JCYA 4J1TA 4WLNA 1JA9A 1IB6A 2PZLA 2VTEA 3R6DA 1AHHA 2VT3A 5G0UA 4DPMA 4K1LA 4BNZA 5T6BA 1P1IA 4D44A 5I9NA 1R6DA 2OBYA 2W8ZA 2C2YA 4WNIA 3E9QA 5G4LA 4HFRA 4QEDA 5B4UA 3JQBC 4IMRA 5I9LA 5DP1A 4GAEA 4RDHA 5MGBA 4WLUA 1DIRA 3PI7A 3EW7A 3G49A 1MG0A 4E5NA 1RKXA 3TPCA 1P45A 3FF4A 3UVEA 3S2IA 1CEQA 2X9NA 3IOYA 1PQPA 5ILGA 3ASUA 1T2FA 1GV1A 1VL6A 2I99A 5DCYA 3CIFA 3WJAA 3KZVA 4LRSB 5IG2A 4XJSA 4XYLA 4AJ2A 3EY4A 1K2WA 1BXKA 3DOCA 5KJEA 2YHIB 3LDHA 5GY7A 1PS0A 4O0LA 4WK6A 4FB5A 3N58A 1TT5B 3O8QA 4CM8A 4OYRA 3D3WA 5JAMA 4O63O 5FI3A 2J3HA 3MTJA 4OL9A 1U5CA 2PR2A 2EGGA 1PJ3A 4UVIA 5G0TA 3HDQA 4GX2A 4GSKA 3HFSA 1KEPA 2GN4A 1SC6A 1VPDA 4FN4A 3ANNA 3TWOA 1EBUA 4HFMA 4J49A 4BNMA 4U8GA 3JQCA 1MG5A 2BH9A 1SO8A 1U4SA 3I9OA 3GA0A 1NXQA 4FQ8A 4BGUA 3DQPA 1RM4A 1E92A 3VOSA 1WAMA 2GZ1A 3L0DA 4K6CA 3AOEA 3PJEA 5COBA 3FTPA 3EHEA 4R1TA 4RORA 1XHLA 4OKNA 2Q2VA 3KETA 3JV7A 4LSWA 3L07A 1YBVA 2J3IA 1QYCA 4DA9A 4LCEA 3B1JA 1FDVA 2CSUA 5LDGA 3F6YA 2Q4BA 4IDEA 3IKTA 4O1MA 1Q7BA 1JTVA 1ZXLA 1Y9AA 1CQJA 2YV1A 2JD2A 2YDYA 2Z1NA 3PJFA 3RKRA 4B4UA 4HKTA 4CMEA 4BKOA 1GY8A 3NT2A 1I5RA 4QSMA 3OECA 2FWMX 4XKJA 5CEFA 5BQFA 4LVUA 5I7FA 1YDEA 2E6UX 2VNAA 4NBRA 4NH4A 4BNJA 1GCOA 4TSKA 4J0EA 3BHJA 3TFOA 3ORFA 3ROQA 2E82A 4WEQA 4YRDA 2Q50A 2Y1FA 3OFSA 3VTFA 1SEVA 4PLVA 4NK4A 4KQWA 1GAEO 3VZQA 3UICA 1GPJA 2DVMA 3MOGA 4D3SA 2RHRA 1GQQA 1Y81A 4PLYA 1YB5A 4ND5A 4XYGA 4Z9FA 5EIOA 3UW3A 1OAAA 4CMIA 3ZWBA 3L4BC 4CMIB 1S6YA 1UJMA 1EFLA 2I67A 3GHYA 3VH1A 2OBNA 3KO8A 1O89A 4BNKA 1LDYA 4FPXA 5A05A 4Q3EA 1T26A 3OF2A 3QVOA 4D46A 4EW6A 5A03A 4PLFA 4R1NA 1O94A 3OQ1A 2HJSA 1ARZA 1L7EA 2DFVA 2PKRA 2WYUA 1MFZA 4IZIA 4ZQEA 2YQ4A 4DPKA 2AQHA 4Y6PA 4YJGB 5L45A 3DZJA 4OOFA 1OZAA 4PLPA 4CQMD 4BO1A 2W2KA 5U4QA 4R5HA 1HRDA 3G0OA 3IP3A 1HDZA 2Q45A 1NHWA 4S3MA 5DCUA 5IDXA 2H5LA 1UZLA 2AE1A 4P38A 4J6FA 4YJFA 3BAZA 3RUHA 3TJRA 5C37A 4BQRA 3NDRA 4PG7A 5JO0A 2OO5A 4FFLA 3H65A 1NM5A 3DAFA 5F1PA 3ETGA 1EUZA 2NWQA 3RASA 3PYLA 1Q0HA 4RF4A 4ZJUA 5JMWA 3JTMA 2GZ2A 2PLAA 3N7UA 4PZEA 3DHNA 3SBOA 1WNTA 2I3AA 5JYEA 3IUPA 2O2YA 3KUXA 3AK4A 1NX6A 2YV2A 1J4AA 1ZJZA 3S2FA 2FR8A 3L4BA 1BDBA 1Q1NA 4PG5A 3VVCA 4D3DA 1B14A 4N5LA 5CHEA 3DZGA 3VVBA 3KYCA 4E6PA 3UCFA 1XU9A 1E3WB 1BGVA 3K8ZA 1TEHA 2NUAA 1R4NB 3JQFA 4WE3A 4GX0A 3LQFA 3K31A 2C82A 2VRBA 3OQ6A 5JDIA 1LJ8A 1P0FA 3P7MA 2WTBA 3S1LA 3KXDA 4TRMA 3GEGA 4D0RA 3JQ8B 4YYZA 5G4KB 4DXHA 3DHEA 8LDHA 3PQDA 4B3JA 1MV8A 3AFMA 1YE3A 1UZNA 2I76A 1TA4A 2CVQA 5ER9A 4OOEA 4ID9A 2HSDA 1X1EA 3ZWVA 3CMMA 1E6UA 1GL3A 3I5MA 3MCVA 1FDTA 1PZFA 3NRCA 4W99A 1ZJYA 1WZIA 1J0XO 3WTBA 2Z1MA 3GGOA 3UHAA 2PNFA 4YT8A 3HN2A 4IDAA 3ZV4A 1D1TA 3QE3A 3AI3A 4IUYA 5BSEA 1DIAA 2NU8A 3KSDO 1CERA 1D1SA 4YQZA 4CLOB 2BFPA 2EGHA 3RU7A 2HKIA 2IXBA 4MDHA 4DWVA 2C29D 2X5KO 5AXCA 5DULA 3BMCB 4CMBA 1EEHA 4J9VA 4BO5A 3DBLB 4E12A 4I8XA 1NVMB 4CMGA 4CM4B 4FW8A 3WLEA 4CM6A 4I9NA 3ST7A 2B36A 3ROMA 2NQ8A 3OMLA 4MOWA 1P9LA 3GGGA 3UUWA 1DFGA 1VKNA 2RCYA 7MDHA 1QR6A 2Q99A 4E5MA 2XXBA 2JD1A 3AFNA 3IJRA 4MO2A 3WGZA 2AQKA 2IZ1A 3BTUA 2AG5A 1ZO8A 4W4TA 3ZV6A 2O7SA 2E37A 3A1NA 4MIOA 2VHXA 3LT1A 4R3NA 4TMFA 5CEEA 1T25A 4OH1A 1PL6A 1M6WA 1P33A 1PZGA 3ONEA 1VC2A 3SX2A 5EESA 1P1FA 3PXXA 2AQIA 4B4OA 3BTOA 5IJZA 1EVZA 4KUHA 4TQGA 5ES3A 4IJVA 3AWDA 1I2CA 3GRPA 1ENPA 5IDQA 2FOIA 1RM5A 2VYVA 3PQFA 3IDSA 4IDCA 1ADCA 2IEDA 2Z95A 2X0JA 4QECA 4W9NA 3TL2A 3WMXA 1N7GA 4BV8A 1XLTA 2ZQZA 1VJTA 4R5MA 3JQ9C 3TZKA 4D45A 4CR6A 1ADBA 4YACA 5I8WA 1GR0A 1E77A 4XYEA 4DREA 4GBJA 1I8TA 4XJTA 2CZCA 4IQGA 4NU5A 3T4EA 3HDHA 5CAEA 2CUKA 2J5QA 1MA0A 1GEEA 5KVQA 1P74A 4ALIA 1VM6A 3H3FA 3KLPX 3BTVA 3DBRA 3WTCA 3I52A 4YT5A 5LC1A 2GERA 2O48X 1DHRA 1SEPA 3F4LA 3QVSA 4Z0HO 4CM4A 3OJEA 1NQAO 1GEGA 2FZWA 5GMOA 1F12A 2QX7A 1HE3A 2WYVA 5U9CA 3UOGA 5A02A 4A0SA 4KTVE 1C1DA 1P31A 4JJFA 4FJ0A 3L6OO 4NZ9A 2GN8A 1O9BA 2EEZA 3RBXA 3RVDA 3VH4A 3DOJA 1LI4A 1YB4A 5DBGA 1XGKA 2Y05A 4CR8A 4CLHA 1U3VA 3HSKA 1DHTA 1ZNQO 4XQ9A 3BMNA 2C59A 3RAJA 2B4QA 3H2SA 4NJMB 4DBVO 4Q3BA 2H63A 3Q9NA 1FJHA 4MVJD 2B0JA 5IZCA 1DLJA 3ZU4A 1ISJA 3OBBA 3PHIA 4QT0A 3CXRA 1IZ9A 1A27A 4R1UA 2UVDA 2ZTVA 3A28A 3U09A 2ZCVA 1E0DA 3FBTA 3UF0A 2C5AA 1H2HA 4BB6A 2SCUA 4JN6B 3C1AA 4WKGA 3IUSA 3DMTC 2HRZA 1WMBA 5JCXA 3DZIA 2B35A 2R00A 5T57A 4E2ZA 2ZTMA 1U3WA 1XELA 2GLXA 2G5CA 3N74A 4RF5A 4JLWA 1Y1PA 1YGYA 4XQCA 1BXGB 1QV7A 1FK8A 3CUKA 1VJ1A 3K6JA 1ZK3A 1SNYA 2C0CA 1KY5A 1LDGA 4HFNA 1JKIA 4XX0A 2PFGA 1JU9A 4N54A 1U7HA 5TT1A 1A72A 1GYRA 3ADPA 2NNLD 1UUFA 1CDOA 1LC0A 3RUCA 2YFHA 4B3HA 3SJUA 3AUAA 3FBGA 1N8KA 3PJGA 1M75A 1XU7A 5T8KA 5EQFA 1U7TA 3SLKA 3WICA 4HNGA 4CLEA 1HYGA 2HLPA 2CF6A 1NVGA 3STHA 3E18A 3I1JA 4MKXA 2YHUA 1AXEA 2V6FA 4D3FA 4ROSA 4GGOA 5AXDA 2V7PA 1OFGA 2YW9A 3WFJA 1Z7BA 1X15A 4AJ4A 4Z0TA 1E6EA 1EE2A 1F0YA 1Q0QA 3FCOA 4BGIA 5GZ6A 5IZ4A 4X54A 3DO5A 3E5MA 2RH4A 1MX3A 3WSWA 2JHGA 5KJCA 2JCVA 4XB2A 4NBUA 2JL1A 2FHSA 1GZ3A 4BNGA 4EUHA 3ZV5A 3MJCA 1KC1A 1HSOA 2IZZA 4H7PA 4IY1A 4O5OA 5L40A 1GZ6A 2EV9A 1NAHA 1V3UA 4GMGA 5CPFA 1Z6ZA 1YBMA 1DO8A 4QQRA 2VNSA 1UDAA 3ZHXA 2Q46A 4CM1A 1AXGA 1VSUA 4I5DA 4F46A 3TZCA 5AQ1A 5CPBA 2JKVA 4RVUA 4ZQHA 5JC8A 1R16A 4BNXA 2WDZA 4E31A 1LTHR 1BG6A 1EE9A 4L8VA 4AL4A 4D41A 3PVZA 1N92A 4YVFA 1HETA 5FF9A 4J43A
chains in the Genus database with same CATH superfamily
2EJBA 2XZDA 3GW8A 5KPDA 2R2AA 1FFBA 3MYRA 3O4FA 1KQ3A 3RLFA 1EXNA 2AF4C 5KQPA 4HJRA 1P1RA 1GPMA 1AK9A 1R5BA 3QF4A 4GYWA 4ZODA 4EYSA 4H1VA 1YZKA 3A11A 3PQ5A 1U8XX 2PHZA 2C5FA 4WRRA 1IHPA 2CLIB 4FUTA 3GR6A 2HA3A 3AR5A 4YR7A 1ENYA 1NPDA 3FPKA 1RBMA 3RWMB 4F5YA 1FU8A 4GKJB 3ROTA 1JFVA 2O8NA 4C0KA 4PTZA 4E22A 3OWOA 2N46A 4GKBA 4ISCA 1AU9A 1IJKA 4ZO7A 1SUPA 2J5XA 3G17A 5MFPA 1FRNA 3FMOB 3I05A 3L1JA 3ISTA 2NU9A 3MJHA 4KXNA 5A71A 3IP6A 3PRKE 1Q95A 1GLGA 3K9FC 1NFQA 4IWYA 3HA7A 1CUWA 3L4JA 3ZXUB 4PZCA 3NU1A 4B7ZA 4K81B 4H4EA 1NGSA 1G59A 5BPFA 2TMGA 2ZWOA 3RCBA 2P35A 1BX0A 5ENZA 1VRCA 1XLWA 1VP9A 1P3Y1 1H8EA 2A5DA 2EERA 2HA4A 2QPTA 2WKSA 3CA8A 3DKVA 3PK0A 5A04A 2DEUA 1H2BA 1WXFA 1E3SA 1DDIA 1KBQA 1T2DA 1OHHD 1SCIA 4D9HA 1DIHA 2JZCA 3ICWA 1U4OA 4U0KA 2YHIA 4ABYA 5CW1A 1LDBA 1A95A 1I6MA 3AUTA 3OA2A 1PNRA 1M72A 4YCLA 1U1GA 1H93A 4G23A 2I0FA 2X8LA 1CVLA 2FJUA 5CFPA 2IS4A 3W79A 1V5GA 1J0DA 1QANA 2AW5A 4ESOA 2O3JA 3K0CA 4WLEA 2H51A 4MEJA 4PLGA 2GA8A 2QEQA 3RS3A 3WLJA 4BBPA 4W5QA 3MBKA 4YEDA 3KDSE 3R0IA 4JGBA 2OGTA 1XIVA 1PU2A 2DQ4A 2O3RA 4WI1A 3U4QB 2FRDC 1E2HA 1A04A 2M9MA 2REBA 2J0SA 4XDGA 1TI7A 4FMDF 1QG2A 4ZOBA 3UKDA 3F90A 4F1WA 1JP7A 4XH9B 2NVBA 5IWAB 4IHJA 1JDSA 2XRZA 4CEJB 1IOLA 1HOXA 1K4YA 3PI6A 5FPYA 3U7JA 3NHKA 1BGWA 4RK5A 4MP8A 4NZMA 3QPCA 4KQJA 4M6WB 4MLCA 1CS0B 4X6UA 1KO7A 3L7KA 4FZ5A 1RRCA 2BGMA 3DZDA 5A6SB 4RKWA 4PSKA 1JQBA 2CHVA 4RC9A 2H1HA 4OBXA 4IF4A 4US2R 3TTXA 5KTTA 5K3FB 4HRAA 2Y1WA 3EARA 4E0BA 2E48A 1UMDB 2C9YA 3SJBA 4X20A 1TTHA 1ZVMA 2XUAA 3D3NA 3RRXA 2VT7A 4QQFA 3TZLA 1XAGA 1JXMA 3QLJA 4X92A 3LC1O 1RXWA 1CUYA 2OP0A 3KZ1E 3W34A 3X1YA 5CXUA 1B26A 1ND6A 3ONDA 3RC2A 1KYQA 3ULKA 1KMHB 1SC4A 2O3UA 2XQFA 3O95A 2V54A 1VCIA 1UEXC 2KE5A 2YS7A 3QVVA 3EIXA 3TUZC 1L5WA 3MXTA 4KAJA 4LQDA 4B7AA 3OFND 3R3YA 2JRCA 4P32A 3AHFA 5F2KA 1COWA 4Q37A 3U7HB 1PR5A 3JQDA 1ICIA 4RTLA 1M6YA 5AW0A 2HPHA 1RJDA 4TSFD 2NV6A 2WF7A 2OYCA 3M2TA 5HMLA 2QTBA 1Z0JA 4G8JA 1Z2PX 2WWWA 4LNUA 4NNJA 4IG4A 4D3XA 2Z5FA 4LZWA 4EG5A 1P1BA 3EGWA 3CVVA 1DG9A 1IIBA 5J2TA 4C4SA 2C8LA 4LW8A 4ZRDA 3HCRA 3WYCA 1XUOA 5DIZA 4CHGA 3BSSA 1QVAA 1UC5B 3KQVA 4PC3A 4LDPA 4DARA 2I33A 3AVVA 4PGHA 4EQ6B 4JUBA 2ZYAA 4G2NA 1P4HA 2M2IA 1H5NA 1NXPA 4YGXB 4XJVA 1J6UA 2A3NA 3VKHA 4DR3B 3RADC 2X40A 4RA6B 1P7CA 4BNDB 3C6MA 4ZI7F 1TTTA 5K3FA 5JDIC 3FFAA 4D42A 2JHCA 5DWDA 4JBHA 4NBVA 4KH0A 2J5KA 2CNNA 4K3VA 4FEYA 2ZBRA 2C07A 2RGYA 3LHDA 4D9NA 3SVTA 3WS7A 1K75A 2YXDA 1N4AA 4G0WA 1RE1A 1RI2A 4TMTA 3W8DA 4ZI3A 5LDDC 4HDKA 5LQJA 4JWKA 2HPZA 1YE8A 3ZD8A 2HA0A 3LUDA 5F51A 5KNCH 3MEQA 2UYCA 2AKEA 4ZVNA 2UVPB 2DGDA 4QBKA 4U63A 4WCFA 3I3SR 4DCUA 4HQOA 3QXXA 1ND5A 2XUZA 1T1SA 3FDZB 4DFDA 1TMKA 3FPCA 4JLJA 1C3OB 2V6GA 1NC3A 1P9RA 5IT9A 1SN7A 4MRVA 4K9PA 1VE3A 3CF4A 1YOVB 4XGIA 2JGRA 1Z28A 3HDGA 2FX5A 4EYEA 4HGZA 5FPPA 2OK8A 1Z6GA 1R12A 1O95D 3HDVA 3NOVA 3QVXA 5KDLA 3RSQA 3WB2A 3MFQA 3ZE1B 4AG6A 5AFSA 2P4HX 5JJ5A 3I8SA 3H9GA 3T7SA 4DR4B 1Y33E 2GILA 2DJIA 5ES4B 4N3NA 2EP5A 1XPRA 3G0HA 4BPBA 4A9AA 1IC6A 1G66A 2GYVA 2IIBA 1DC4A 4RFSA 4V2UA 1G7RA 3T5CA 2PX5A 3OURA 3IB3A 3GY0A 3L5KA 4AUKA 3PICA 2IBMA 2VCHA 4GXNA 4OHUA 2YINC 4XLTA 2BMVA 5EMMA 3S81A 4HDAA 4BFZA 1XC7A 5ADVA 5I7HA 5C7OO 4TSRA 3JPWA 1QVWA 4OBBA 4G0VA 2CNBA 3KWFA 3C7AA 3R8XA 4Q9IA 4CF5A 1LF5A 4DG8A 1DQZA 3EQ7A 1JV2B 3BSFA 3O1HB 3MFYA 1WKCA 3I4FA 1O96A 3K35A 2PGDA 5K0NA 5TPWA 3SF8A 3WYFA 1EP3B 1P4AA 1UH5A 3ET4A 1Q12A 3LI2A 2WJIA 3CLSD 1SB9A 1Q1ZA 2WINI 4IHKA 4NWIA 2OFOA 3DFIA 4I9HA 4AAYA 3K96A 2GZAA 1V48A 4C7MA 3GJ8A 1N25A 3L05A 4PQGA 4WVLA 3EEFA 1QVZA 3EVBA 2HCJB 4KWIA 2O2DA 1A9OA 1L5QA 1PGQA 3N8IA 4RQAA 4DSAA 3EH2A 5H9VA 4QTUB 1K2VN 3HU5A 3O8CA 5IKPA 2NM0A 2ZDGA 1G5IA 2OGSA 1HLFA 3DBHB 4HH3C 4C4TA 2AW3A 2HMTA 1B0ZA 1XG5A 3QPVA 5TJHA 1RYDA 2VRCA 4UAVA 4F3CA 2I4TA 4WZAB 1QYRA 5A9SA 3BCHA 4L73A 4I1PA 1OBVA 4OLBA 1Y7IA 5AW7A 1IM5A 3KTAB 4JT9A 3PFHA 3W78A 3ZE9A 5EXDA 1ZDMA 4BMSA 2P79A 3GWZA 2DUUA 2IZ5A 3H4IA 3AJDA 4JEMA 4TWBA 3LT0A 3VNUA 1KI6B 5ALLA 2H4YA 5J5CA 2A8YA 1R2QA 3HR4A 2BI7A 3OVMA 2C83A 2UZAA 1RT9A 3FJ1A 1DAOA 4QAJA 1HMYA 4EG6A 2ZSIA 1KKLA 2NTVA 1ZOPA 5DTEA 3BIXA 1X7HA 2GXSA 2QX4A 4U2GA 3L6DA 4P81A 5CP8A 4YLEA 4AKHA 5CB4F 1FQKA 3B9PA 4DIBA 3TCXB 4P36A 2C9MA 2R5WA 4EDHA 2C20A 1TF7A 1WZEA 1QRDA 2VRNA 1P72A 2GAJA 3RD5A 4XPIA 4RZIA 5BUZA 1E3LA 3QVUA 3JYOA 4IKEA 2DHQA 4FYWA 4OF4A 3SHTA 1V0JA 1ENOA 3RYHB 4U5XA 1ORIA 1H3EA 1OLXB 3NEPX 3DTTA 6GPBA 1KVTA 2A5JA 4ZOLA 1U8FO 5CCBA 3R7BA 3KKLA 4UEKA 2XIJA 2JB9A 5DXAA 4BNFA 2Y99A 3GT3A 1IU9A 3ILVA 2I2DA 3JQGB 1T1IA 4ARAA 1MNAA 3EAGA 1UPXA 2ZWMA 3RK0A 4NFHA 3LP8A 1TJ5A 2COUA 4Q15A 2P62A 2E4AA 4XZ3A 4OV6B 4DM7A 3HCCA 3NWJA 9LDTA 3DHYA 3C3DA 1HSZA 1I0IA 2IXEA 4BMDA 2YWGA 4L9AA 4OJMX 2H85A 3R5JA 2Q6IA 4Y1EA 1WHTA 3T0FA 1C1DB 4Z3OA 4KK3A 1ULBA 1F14A 2RGUA 4KV9A 5T3UA 3T94A 3EUFA 4HAOA 4RANA 4MRMA 2ZUTA 2EZ9A 4KN6A 2J08A 2B4RO 4OH7A 3GJ6A 4G5YA 3TZHA 4JD5A 1B0AA 1KI6A 1U1CA 3CM0A 4YC7A 5HS4A 1R4NA 2CC2A 5J2UA 5AICA 5HGJA 3F5FA 3WRWA 3AEZA 4H1TA 3E5NA 4YP6A 1IXRC 1FFXA 1KXJA 2XRFA 5KNCD 4L3WA 3I9MA 4NJOA 3NT4A 5CD9A 2NSDA 5ICMA 2G9RA 1Z2AA 1J09A 1QX4A 3QJYA 1HE8B 1XTSA 3KXPA 4MCAA 3TQOA 1YT5A 2QZ4A 3DZ8A 5KVCA 1WMDA 3H2IA 3L8ZA 1JU4A 2HA6A 2WKQA 1XI2A 3FF1A 4FC6A 4RH3A 1I30A 2SCUB 3B70A 1TRHA 4JQYA 2F9MA 1WXIA 4QTZA 3V9AA 1IY0A 3TRFA 4BO0A 2JEZA 1J90A 5F33A 3ILHA 5F23A 1Z68A 4YRPA 2IPOA 1VSBA 3HZRA 3BHMA 2A58A 1T9GS 2AH5A 3GEEA 3AERB 5CB0A 1DCKA 1M9NA 2IQ5A 4AUEA 3BMNB 1N2CA 3TLAA 5DOVA 4GPAA 4R9VA 3TN7A 3EASA 5CFNA 4JX8A 5HG0A 5B5SA 1LPNA 4MKRA 3TLYA 4HN4B 4MDFA 2VJBA 4I2VA 2VDPB 1E6LA 2R6ZA 3FSJX 1TT5A 2GZDA 2P5UA 3GJZA 4FJ1A 2CLMB 4R41A 2DG2A 2C04A 1CZOA 5A3VA 1YO6A 3EQ6A 3MMXA 3Q6IA 4RX1A 5JS2A 3RIYA 3SS8A 2BFCB 1NVFA 3WSTA 3FXAA 4EG7A 2E4ZA 2W48A 3QNUA 3SZUA 3J7AC 1PJSA 3IHLA 4OI2A 4Q9KA 2YRWA 4RGVA 4E3WA 1JHRA 3GUZA 3NVMB 3GCZA 4UQPA 4X1KB 2VJOA 3KZCA 4QUAA 3WLOA 4BRZA 5BN4A 2WV9A 4KN9S 2B69A 3HKEA 3D4PA 3ZGYA 5JCPA 3MYYA 4D9CA 1H6AA 3FN4A 4P4GA 2H1WA 2O1EA 3KEQA 2HOQA 2JF0A 3GUUA 5H16A 1T35A 1KZ1A 1FMTA 1U0HC 5AKYA 2PUFA 4EF6A 1LPPA 4P83A 1JEAA 2VHWA 4WQMA 3TQIA 3F1KA 3Q11A 1GGJA 2WSYB 3D8BA 2GJAA 5LQSA 4A2WA 1KK0A 4MPDA 3HZOA 3UANA 2EJUA 1YJXA 3BTSA 4R54A 5KX5F 5TGDA 1JBQA 2O1SA 3N2ZB 1T15A 4X61A 2X1HA 3EC2A 5FAXA 1P80A 1EXWA 2YJGA 2ZYRA 3LY5A 3IELA 1B1AA 4Y9TA 1G291 3TVDA 4D8XA 1HF3A 3EGXA 3P2JA 2NX2A 4DA0A 1BE1A 1KQFA 4G1FA 2X7JA 4N18A 3GAZA 3VH2A 1EK6A 4MS4B 2ZTLA 4Y7DA 5BW8A 2FPLA 2DPGA 2ID9A 4J0QA 2FPGA 1AUPA 2Z2YA 2C3YA 3KWJA 1SUWA 1ZIPA 3AC0A 1Y8RA 1RXEA 3ABRB 1WR8A 3H19A 3H4MA 3OJCA 3QYPA 4CMHA 4CNBA 1GDTA 1J22A 4RIHA 3W5VA 4E7OA 3QVGA 5TC4A 1Q14A 4BEVA 2R47A 4GR5A 5CU7A 5F7JA 3SEZA 4BNWA 2MINA 4WOJA 1I2ZA 3I12A 3JYNA 2XMQA 4WVFA 2P4UA 3HRHA 1U9YA 3LT4A 5FUBA 3OLXA 4CNQA 3S8EA 1UKBA 2LVBA 1VE1A 3ZJUA 3OICA 4ZHQF 4UPVA 1PHPA 1A4RA 1I2MA 3HUUA 5ALXA 4GBED 1X74A 1QONA 2VA9A 4PS1A 2GT1A 3D2BA 4YBZA 3RG8A 4A27A 1ZCAA 3KSAC 5BMVF 4KIUA 2OCLA 1U28C 3F8WA 1ORRA 3IRUA 1FTQA 3MMPA 1H0KA 1XCBA 2Q1UA 2VOEA 5JNUA 5F1KA 4Q7EA 4RA9B 4RHUA 1XU4A 4DUPA 3L4SO 4IKPA 3AF0A 3H5RA 4MW1A 1GYQA 2I4IA 2FK8A 3KKOA 1RIFA 2D3WA 5HF8A 5CFZA 2FSVA 4D26A 3OKCA 4X44A 3B7GA 4AS1A 5MHTA 1ODTC 1XK6A 3FPLA 4QJIA 3MUFA 3G0DA 3PD0A 2F4VB 1JBKA 2LE0A 4RTOA 3CTPA 1JTFA 4LQCA 4RJLA 3V2IA 1W73A 1ZUNB 3PXAA 5KOIA 3WL8A 4IIJA 1ID8A 2FPUA 3REQB 1HFWA 1UKYA 4QOGA 4TTAA 1OFTA 4BUJA 5AKHA 2SNIE 2ZEJA 3WGIA 1DV2A 3FWHA 5HW0A 1DEHA 1GNLA 3ENNA 3JWJA 4LNUB 4XRRA 1CJSA 1RYBA 3B5EA 5DHUA 2BF4A 3NALA 5DFAA 4UD6A 1U0TA 1VG1A 2VSNA 3D2CA 1RPAA 1QH8A 2IYPA 2X5OA 4I1OA 1JQLB 2QTTA 4HF7A 1I01A 1N7HA 3R44A 4C0HA 1RD4A 2BFFB 3DXXA 4RM3A 4W9NC 1LVGA 2IVZA 2J1LA 4X62B 1O0SA 2PL1A 4FYIA 3R74A 1ISIA 2BM0A 2Q5CA 4ICIA 4QUIA 4QLBA 1V4BA 2I1VB 4L3OA 4UAUA 3USZA 4ALLA 5EZ5A 2VN8A 4B8ZA 4BCCA 1A7UA 4DMHA 5IUKC 3TSCA 4Y98A 5EQTA 2ISCA 3E4DA 1N9GB 2Y1CA 3F4BA 3KPVA 1T1JA 2VT6A 1RYEA 1ZUIA 4L2IA 2WFLA 1G7SA 1S3FA 3N5KA 1E96A 4BZXA 4OHRA 2XCQA 4UUPA 3L40A 4KX3A 2ZRCA 1TMGE 2LWIA 2MR6A 5KYYB 1Q74A 2XKJE 3OOEA 1Y8CA 2B2NA 4GPTA 5TNXA 3VPAA 4DM4A 3J80A 2JIZD 1EDEA 1CYDA 4CETA 4F92B 5TB5A 3U4QA 5FWAA 5FTKA 2F62A 4QYIB 4U7GA 1BA3A 2VHCA 4JC0A 2OBFA 1BA2A 5AIBA 3T4XA 1KF0A 1EXDA 4D0GA 1EX6A 1XRRA 2ON6A 4OLFA 3CCFA 3MRSA 4UEQA 5JZ9A 4A0QA 2OYSA 1XO1A 1MO2A 2HFJA 2IYOA 3CZCA 2VSOA 4B4WA 5BVHA 4OLHA 1PTJA 4YMLA 3KQPA 5BYAA 2HK9A 4NAHA 5CFQA 4LMPA 2H9YA 3DBHA 3EVEA 4JP5A 4J9UE 4PPGA 1UDWA 3SC2B 1UK9A 3SC4A 2COKA 5KOJB 1CZRA 5BUSA 1UPAA 3SX4A 2Q3EA 3ED1A 2YICA 4MYUA 3R5XA 1Y8QB 1WZ2A 4IO0A 3VYTB 2H1OA 4J7CA 5K3AA 4FYJA 5CDFE 4JGIA 3D4OA 3I6IA 1HTWA 3ZU2A 3WB1A 1CZUA 4PYJA 4JJ7A 1D04A 3HNPA 2I4NA 2PUWA 2WEKA 4QFMA 3ZVNA 4BQFA 4M7PA 2ZIUB 2XE7A 1NW9B 2BFDA 5CRIA 4YO8A 5IFKA 2NO6A 2JJ2D 5HNKA 1EIZA 1QVVA 3DL7A 4GGMX 4PU0A 4E2XA 4EARA 4LV8B 3QELA 5IUNC 3SZMA 4DL9A 3M1LA 4JBNA 4FZRA 3TJZA 2B7LA 4U7TB 5FBRB 1S3IA 1RYZA 1V5FA 1DTWA 2WTAA 4LF6B 3SBXA 1Z37A 1FQWA 3HY3A 1R18A 2GKSA 3EOZA 3HKEB 1Y4DE 2UYHA 2O8DA 1PWYE 2RAUA 3PUJA 1QRSA 1FZTA 2QG4A 4EW2A 3VKGA 1U1EA 2BEVB 3GX1A 2QJOA 2Q5HA 2Q5QA 3C3MA 5LJIA 3CJQA 1YRAA 3GCWA 1JG7A 4C0WA 4YRQA 3GLIA 2A3RA 3MM4A 1WSBA 4PF1A 4WKPA 5JT1A 4LV6A 4E1BA 3TRHA 1P75A 2Q1WA 4RKFA 1LTKA 3KFVA 2W2OA 3W5AA 1YZ3A 2FG5A 2R66A 4D56A 4C6HA 2V7TA 4RMIA 3COSA 1O94C 2G28A 2C92A 3I1YA 2V03A 1OYWA 3BEOA 3HY6A 4HWGA 4Q4HA 4PGAA 2NU7A 2P90A 4I99A 5KIAA 1E5QA 3BK1A 3HJFA 4L4YA 1G3MA 2QPOA 4C6TB 2IU0A 2PLRA 3PQ6A 4A10A 3MMZA 2CYCA 3EZ2A 4TXMA 4Y0NA 3EA0A 2J48A 3LQRA 1H3NA 4MW5A 4D4JA 4M0DA 1ZFNA 2Z9BA 4MWGA 4DR1B 3D0KA 2IZ7A 1UFOA 2QX6A 1E3QA 1V16B 2DTDA 3IT1A 1RQNA 3L92A 2EQAA 3IAS1 4J91A 4S0XA 4ERNA 2VTBA 1E1RD 1Q6YA 5JUWA 3ITKA 3IE2A 2AZMA 1U2EA 3EXHC 1B43A 4J07A 4MIYA 3BFPA 3U0BA 4ZIRB 1R6TA 1PR1A 4R1QA 1SJ9A 2GH1A 3MJEA 1BJRE 1RP7A 3NB0A 3UB3A 1AZWA 3HVUA 5C5CA 1JSCA 2LD4A 3CG4A 2CL5A 3QPBA 4FNAA 3QHPA 1A2OA 4S35A 4YAKA 4AO7A 3JAWA 4RU1A 5TE9A 4JMLA 2HU5A 4IMJB 3A1CA 4OA8A 1PJQA 1H9AA 1NYLA 2ST1A 3VH3A 4BZZA 2EEPA 1NJ6A 3CLTD 4TXHA 1E79A 4F8JA 3T38A 3K5IA 1UFRA 4QYWA 3GN1A 5EE1A 3RC1A 3AYXB 1OC2A 1W5AA 2SKCA 1KSJA 3T95A 2QIPA 4HDQB 5A7HA 1LJLA 2UV8A 4KFCA 3OY7A 4RSGA 3N75A 1H2YA 4CIAA 3IQWA 3IPCA 3KB8A 5DW3A 4H3SA 5F7ZA 5FJJA 2FPRA 3R75A 3ZNNA 3QJ5A 1CJKC 1J2YA 1N1EA 4OKIA 4CR7A 3ANLA 1AURA 2PU7A 5K7SA 1O57A 3GFTA 3LT5A 1FCJA 3U3MA 1J9GA 1I7PA 1IG0A 1OYOA 2IYFA 3DTVA 1U7UA 4TWZA 2CE2X 3S55A 4AJ9A 4PC6A 3OU2A 1IHDA 4R7TA 4NQRA 1MGOA 3ZYCA 1GGNA 4WK4B 5ADHA 1BVHA 2ZSHA 4FYXA 3URMA 3X1WA 1PVOA 1JB1A 3FY4A 3G8YA 1BFKA 3QGMA 1J07A 1MH9A 3EF3A 5LZ4A 1Y89A 2ZJBA 1HT1E 4JP8A 4ZDIA 4KO4S 5ERXA 4CF7A 3OJLA 2K87A 2XB8A 3L0YA 3P2OA 1G60A 3PRYA 3SVZA 1Z06A 2XF2A 5L9AA 1TMOA 1XQ1A 3E9ZA 3N8DA 2HSWA 3RIGA 3ZV7A 1Q84A 1NP6A 1EU1A 1EVLA 1KFJB 1UKZA 4R1SA 4X1YA 2QTVA 3DZHA 5B12A 2ECFA 1XD8A 3KEOA 3JQAD 1ZZEA 2RG1A 1VPVA 1UZUA 1NFRA 1LD3A 5EIBD 4E21A 5B1IA 2DHDA 4RABA 3RVNA 2WVHA 3DT9A 3F73A 1L5OA 3PEFA 4P2GA 1G8YA 2A94A 5FOQA 4O2BB 1QB7A 1UJNA 3D2LA 1XEWX 3LX5A 1L5HA 2A59A 1CG6A 3K30A 2PDAA 3AV0B 4N6GA 4QE3A 2O9JA 4EWLA 4PN3A 2FSVC 5C5DA 3TQFA 3S27A 1ZGGA 1BC5A 1YJ8A 5THKA 2OAGA 3WDSA 1QFJA 1QIJA 2BI8A 2LR0A 3HH8A 1KK3A 2A30A 3AM5A 3ONVA 3UJDA 1WLYA 3TXXA 1ZK4A 2XTJA 3FH0A 1DG1G 4HCJA 1GFIA 3HHPA 4FI3F 4DDHA 3O21A 4XDZA 5HCIA 1W0JD 3FCUB 4D9KA 2B4AA 2GLTA 3KEFA 4LQ4A 2Y1KA 5E2IA 2VJAA 4IEEA 1GUDA 4MS4A 3DF9A 4OXQA 2FSIA 2B7CA 4BFUA 3GLFE 4LVCA 2OWDA 4LOKA 1JSXA 1NASA 3HUFA 3GFOA 2PRKA 4YT2A 2PUBA 3ADOA 1XRMA 4P35A 3GMIA 4LBYA 4ADSG 2DFKB 1S0UA 4G5XA 1XZKA 1W30A 3OIYA 3L7CA 5FWXB 1CU1A 5FT9A 2CMFA 1Z4JA 3FFTA 4MUMA 1KYYA 5T4EA 1H94A 2G04A 3A6JA 3S4YA 4BNIA 2G83A 5HJ2A 5BN5A 3L4EA 1KI1A 2J6IA 4JWTA 5AJTA 3WGOA 4E5SA 4CLXA 5LQMA 4CE6A 1EK2A 2YFQA 4PPYA 4ZAYA 2OZPA 5AK4A 3OX1A 5I01A 1H42A 2CCKA 1L7QA 3PEEA 3OHSX 3C4JA 4PG8A 1JXAA 1Z36A 2I5PO 3UA3A 3IAFA 4M1WA 4EGQA 3OPNA 1OI7A 3QQ5A 3H2HA 2F6RA 5KTRA 2KJQA 3NM5A 2JGIA 2XMDA 4PX9A 3MHTA 1QYXA 2B4KA 2FSSA 2HA2A 3DXZA 3FYDA 2A9QA 1SQSA 2HF7A 2REOA 3A04A 3ZCTA 3AR6A 4C07A 3EA4A 5FJIA 4EI7A 1D9ZA 2EBHX 4LI3X 4GR9A 5L51A 3IGFA 4R8KA 3K70D 4BVHA 2R6FA 3PB3A 5J59A 5CB6A 4Y3UA 3BMQB 3QMWA 4MYTA 4B47A 1FJGB 1PJTA 1E1NA 2ZBPA 2AQ8A 2C2HA 4MV3A 4R1LA 4ZPJA 3F9IA 4G5GA 4F45A 2HQ1A 3ZWCA 4L5IA 1AQYA 1SVKA 4FNMA 1MRNA 3PHGA 4QREA 1OE0A 3OIGA 4CWAA 2REXB 5K3OA 3ZU5A 3P9ZA 4EATA 2ZJ8A 3HCWA 2ODTX 2G5PA 4PGGA 3T3PB 4GLBA 4KAAA 1I5EA 2CXRA 4QSHA 4FGJA 4B5KA 3DQQA 1E18A 1O3YA 3E03A 3M6XA 3OCZA 4UMEA 5BO5A 1W29A 4EHBA 1GPDG 3H04A 2N3ZA 4J0IA 3UJHA 2X9LA 4G4JA 4PRLA 3Q9UA 3LCVB 4IVQA 2I3GA 4Z8YA 4MJ7A 4M99A 4MWOA 3FWPA 3QFSA 5AHOA 1JDTA 1UBEA 2BE9A 2QHXA 1Q7CA 3IP1A 4NVRA 2O3TA 1N0UA 2QV0A 1LVHA 2Z8ZA 3WNVA 3UCEA 1Y4AE 4ARBA 3QIVA 4P22A 1JR3E 4PZLA 4RO0A 2F8SA 3LC7O 4PSAA 3TW0A 3GJ3A 1HLGA 4ZCIA 2I9KA 2C2KA 4EJ6A 2HJGA 3PTZA 4OFBA 2Y1XA 2Y4OA 1W94A 4L7QA 2JFOA 4YRMA 2CBZA 1Q3KA 3KQOA 5DP2A 1TW2A 4X7PA 2LCQA 2Z8XA 2BR3A 4F04A 4GLFA 2XMSA 1FB5A 1D2RA 1QYDA 3Q7TA 2NU8B 2ZPUA 3OQMA 1JLSA 4RPJA 1N7JA 4KRYA 2QL9A 4YRIA 4JCOA 1NULA 2B5WA 2NYVA 4YIHA 1KNQA 4MUJA 4QFDA 1VSTA 2PPLA 2PUDA 3K8YA 1F0NA 1QRUA 1T4CB 1N2ZA 1DINA 4UASA 3AUJB 4ZT3A 3HN7A 3VJLA 3FDIA 3F8SA 2Y0EA 3UAGA 4PGFA 3W7AA 4GOMD 3W8EA 2EARA 2PO7A 2QSUA 3HXLA 1JAIA 3IP7A 4II2A 2FPXA 4RSMA 1A4XA 1XEWY 5DBOA 1Z83A 2FP4A 3OC0A 5KSZA 4CDNA 3SHVA 1I24A 2GCOB 3QUCA 2WIBA 1SU8A 4LF8B 1INLA 4NCJA 5AR1A 3HWWA 1TTQB 1SXJB 1SELA 2P1RA 3D5EA 3CH5A 3OJFA 4DE5A 1X6VA 2VVTA 2Q5JA 4KXVA 4MMXB 4CM7A 1XQVA 4ENTA 3IV6A 1CE8B 3WZLA 4BTVA 1XZBA 4KQ1A 3RC8A 3EVDA 3E23A 4C30A 2GETA 4XPIB 3PX2A 5DX1A 5AKIA 1L7OA 2BUBA 3I3OA 3FR7A 1WL8A 2NYRA 4HGQA 4TKVB 3N8NA 4UNNA 1NI4A 4GO1A 5FPTA 3WY9A 4XCVA 5JFGA 3OT4A 3JD4A 4ID3A 2E1PA 2KI5A 1N3YA 4O4JB 2MHCA 5EQDA 4ZV7A 5CDUA 3I9NA 4J0JA 1RRPA 2B21A 1MR3F 3DAPA 4M9XA 3W05A 4AJEA 5KEIA 3ABSB 1GTJ1 2J3JA 1J49A 3GEHA 4EGSA 3KOZA 1CB0A 2W0MA 2XAAA 1GTL1 3T5BA 4BMNA 1EWKA 2QD4A 3BGOS 4B32A 1FP4A 2HIHA 2WIKA 3W9UA 4BB5A 1ORWA 4PYQA 4D9JA 3B6JA 2I87A 1OF1A 3W77A 5TLSA 2D2IA 1C3XA 4N9QA 5HZKA 1TJPB 2CKDA 1HFEL 2IHJA 2IHNA 3A05A 4TKUA 2GZSA 1HRKA 4NMWA 3H6KA 1Z6YA 1IXZA 3KLOA 3TQSA 3Q7PA 4N1AA 2TYSB 1X0VA 2SKEA 1N78A 4I1YA 4CV1A 1BCRB 1KHHA 1YZFA 1YMQA 4ZCQA 4E14A 1P77A 1VHLA 2FWAA 4RVCA 4BP3A 2YWCA 1O6BA 4Q00A 1G17A 1JMVA 1ZH0A 3A2MA 1Y3BE 1FMLA 4GRDA 7GPBA 2OD2A 4CKBA 3C7CB 5FOVA 3R6LA 4AP6A 1OBOA 1YDFA 2FCRA 1ZNXA 2VATA 4JLVA 4YRSA 4C6TA 4CLRA 3M49A 1BKSB 1W44A 2NT4A 2YV4A 4DMUB 3RREA 1KMCA 3KEGA 5LP1A 2IUTA 1H2XA 2ERCA 5EGNA 2PVSA 3KYBA 2E18A 3LYLA 3MQ2A 3ORQA 4NYIR 1VIMA 1KI9A 3K0KA 3Q3IA 4C4ZA 2CD9A 3G7UA 4LZNA 3Q12A 4Z0PA 2C3PA 4HNQA 1Z12A 1K8QA 4AT1A 2YC2C 3HM9A 1M7GA 5EMLA 4LPKA 5HQTA 1CUUA 3OT1A 3UPUA 1KE1A 4DVGA 2XUJA 1T91A 2I1WA 1EPUA 2X4DA 3L93A 4DLNA 2RH9B 1ECLA 2KM1A 1ZHHA 1MLDA 3CN7A 3TTYA 4BFYA 3ZDAA 5KQLA 3RYIB 1G21A 1SR8A 1W46A 3LZCA 1W85A 3DLCA 1SBHA 3IXQA 3K1ZA 3HYNA 3OJWA 3MILA 1WP4A 1P1KA 3JQGA 3HJRA 3QUQA 1EUYA 3I9FA 2KB0A 1GCUA 2JBAA 4I1IA 4IGKA 5EJ6A 3KRTA 4BLPA 2DY1A 2PQ2A 3GOHA 1QTQA 4Y0VA 3UBTA 3LX6A 3UCXA 1BMTA 2LTAA 1L3IA 3E3LA 2RI6A 3MS2A 3IIKA 4FFSA 3ZKWA 4EFLA 4XWOA 3CV3A 3KOYA 1RHJA 3CB2A 5JBIA 3W3AD 1RKQA 3TI9A 4QHSA 4L22A 4K46A 3FR8A 1ADFA 5HP4A 1GL9B 1XVAA 2O0JA 2OHXA 2YHBA 1G1MA 3AEKB 1QG6A 5HCUA 1V1RA 3DE2X 4ZREA 4CMJA 8GPBA 3HQ4O 3CSUA 4MQEA 3GZ4A 4OUDA 5EJMA 4AMUA 3PUHA 1ZIDA 2H1IA 3CX7A 1ZW6A 3NKLA 3SC3A 4ALKA 3G2QA 1QUEA 1D5CA 1X80A 3CLHA 1MABA 1VRWA 3TMKA 2FZVA 2G17A 4I50A 1V35A 3SC6A 3WE7A 2OA0A 3DDOA 2AC2A 2W6CX 4G37A 2MIIA 5ALKA 5F2EA 3L8EA 1ZQ1A 1AK1A 1N75A 2CJWA 4G41A 1SU4A 2ZUBA 4NULA 5KWSA 2M6LA 5L4NA 4H16A 1NJFA 1BE0A 4D4KA 1RMQA 1C3EA 3K0FB 3L1VA 3P9YA 4X60A 1MRZA 2D8MA 3U40A 4J8PA 5J5AA 3WAGA 3GPLA 2GAFA 1BD3A 1ITZA 3R0QA 1M2OA 4QARA 1NRWA 1FVXA 1U1IA 4LDAA 4IO1A 4IDGA 4TTTS 3UMYA 5JAIA 5FI5A 1F8GA 3WK4A 1UWLA 1IIRA 4NMLA 2H57A 2ZRAA 5GADl 1H2WA 2ZSBA 1ZC3A 3QBVA 4DC0A 1VIYA 1NBEA 2KLHA 2XI4A 5A4MS 2O5CA 1E79D 2VDVE 5KS2A 5JJKA 1BOFA 5KJ6A 2ECOA 3GRFA 4NKRA 2XNDD 2CNOA 2NO5A 4KU4A 3A9CA 1PQUA 1IJBA 2ODAA 2OQ2A 4ZZIA 5EUCA 1NE2A 1T2EA 2B1JA 2FRDA 1AG9A 2P9TA 2CHQA 1RWKA 2VL7A 3GEDA 3L8MA 4I9UA 2IQIA 3VKVA 5C8DA 4FMCB 3QE9Y 2H4HA 1F7UA 3GEIA 2CMKA 4RPKA 2WT9A 3SE7A 1PX0A 2MSKA 3L1IA 4OATA 1GA1A 5D1HA 4BN0A 4G84A 3NBUA 1W36B 3IXLA 3P9QA 2WJJA 3VNSA 4MVJP 1I2AA 1Y48E 3ZYZA 3HI6A 3N8HA 2FTKE 2YXBA 1Q1BA 4O2RA 2E2WA 3GUYA 3DOHA 2WFZA 1EFDN 3MWDB 1E7QA 4JLMA 4O8CA 4P80A 5DBIA 3ROFA 2IH5A 2QBYB 4GI5A 1VLJA 2AWOA 1MZVA 3CX3A 5CLGA 1ZEMA 3E61A 3OCWA 1TFUA 4EAAA 2Z04A 3A1FA 1DEXA 3UJCA 2QG6A 3ZBTA 1BROA 2JA2A 4DSTA 4YJFB 5CM2Z 4TT8A 1F4PA 3PC7A 4M9RA 3PNVA 4CKYA 5BV0A 2C0QA 1XKTA 3VO9A 4MUFA 3ZE8A 3H5IA 4BZPA 4RV9A 3PVCA 3GJ5A 4RD1A 5IJ0A 3HJAA 2O8EB 3UT5A 3L6EA 2F1IA 2CJXA 2GPJA 3CLRC 3E3OA 4M89A 4FCTA 3WIOA 3ZNPA 3A9SA 4X1IB 3OKFA 3MUEA 1LC3A 5JCZA 1R9MA 3BHNA 4KLZA 4MRRA 4LKRA 1QYVA 3LCCA 4BVLA 2XHEA 1KIMA 1VE6A 2YW2A 3GP3A 4IM7A 4P7KA 2PL5A 2WYIA 5FQOA 4DQ0A 3HYLA 5IYZB 5E4YA 1E0JA 2GVDC 4INZA 3EY9A 4URHA 4BAGA 3R9XA 1JAHA 1PTKA 2QVXX 1HH4A 3LHFA 3DONA 2OLEA 4RVDA 1BS1A 4JKIA 5AD1A 1Q7GA 2VWHA 3GT0A 5K1ZA 2ZPAA 4NTZA 5D3MA 2VKQA 1T34A 2IOYA 3KEMA 5FL7A 4ZEXA 5TIIA 5AW8A 1W581 4LC9A 2AXQA 5C7IO 2Q3BA 4KR6A 2GCEA 3QKSB 1I4DD 1MENA 5CJPA 1V1MA 3O82A 4D8WA 2NACA 3H5AA 3R2JA 4YMSA 2FW6A 1CY1A 4F8EA 5KYWA 1UKAA 1XNGA 1TA9A 3OZCA 4UHBA 2XMGA 1V45E 1SU7A 3PSHA 3IFSA 1VI6A 2A9VA 3I8OA 1ULAA 2R87A 3JATA 3KKMA 1K7FB 1HYQA 2JJ8A 3LU1A 4MLDA 4NFSA 4Q4DA 4QM7A 3CF4G 3WLTA 4EG8A 2WAOA 1DAGA 4ARVA 3MZ0A 5K45A 2O8DB 3HJTA 3ZIAA 3KHSA 5CDTA 2A4KA 5FX2A 5HQ3B 1ODIA 4PAMA 2NU6A 2VEOA 3NGLA 2IF0A 4M1ZA 4HB2A 2EKPA 3KG2A 4N01A 1HA3A 2Z98A 4I81A 1E58A 4OHVA 5FL3A 5EHXA 2YYZA 4WPGA 1N77A 4C3ZA 4H9GA 4WNYA 1VHDA 1NR1A 1VRVA 4N6NA 5AMXA 4GX1A 5GM1A 4ZGBA 3CPSA 4DA4A 4AICA 2FZ5A 4E6EA 5E4FA 1OLSB 3LQKA 3WL4A 1QMGA 1YQDA 4B45A 5L4LA 1KA9H 2PJRA 1XDUA 1CLUA 4GMKA 5LVAA 3SZGA 2ZYUX 3GEBA 1Z45A 3AJ8A 3NHYA 4FWIB 2GBPA 4RVNA 2OP1A 2PRZA 5EJIA 4PYIA 3SNHA 4BIMA 4ETMA 5DHFA 5CB8A 4U5QA 4TUYF 3KCNA 1ONNA 2G63A 3PE3A 5DXFA 2D0DA 3VDRA 1DUIA 2ONKA 4G81A 2Y9MB 4PVCA 3NETA 3T1NA 4K6OA 1T0BA 1O6ZA 1SVWA 1N2HA 4Q9DA 4C0XA 1NRXA 1FFHA 3OZGA 4WXYB 5FPSA 4CGYA 1MOQA 2VYND 1I2BA 5FR1A 4EGCB 4YB8A 1MJGA 1TC2A 4D99A 3ACBA 5L3SA 2WIDA 4MGIR 3OQNA 3T12A 4YX9A 4HEJA 3BBLA 2CW5A 2GTHA 3WO1A 2GQ0A 3UMJA 4LJAA 2RKOA 4FUQA 4WNCA 4WEOA 1BDHA 1I36A 1JEQA 3RT1A 4EG4A 4MWTA 3M5CA 3V46A 5G1OA 2C1EA 2JK0A 4JENA 5LQRA 2GJSA 1DRKA 4UCXA 5T67A 5KSWB 5LM3A 1WDLA 3UFXA 1FYFA 1BWQA 2TMDA 1A98A 4B44A 4EHHA 4NMXB 4B9EA 3JAKB 1S8NA 2BUCA 3VX3A 1SBIA 2CDCA 1E9AA 2QRQA 2V7XA 1ML3A 1GQYA 2HRBA 4JYBA 3RG2A 3L9WA 5IAOA 5IHPA 5JQWA 4KDRA 4RPLA 3Q7RA 5E0OA 1VDMA 3SHQA 2CHFA 4BLTA 4D92A 2OFPA 1RFGE 4I3HA 4CDRA 1PJRA 4POAA 4QYMA 2QIOA 2NAFA 3FZQA 3NVDA 4M8KA 4FS8A 2YVLA 3GELA 4G8DA 1OIVA 2RKWA 1Z5WA 1ZQ9A 1OILA 2XCLA 1P4RA 1LQTA 1F3LA 2H4WA 3NHUA 4KSBA 3NIGB 2FMIA 5EXEA 3SYNA 4EUNA 4XD7D 4DIUA 5DK4A 4ZXFA 4FEEA 1JECA 2YZKA 3RQIA 3MS7A 3FHCB 5K0ZA 4TLDA 4UMVA 3L5OA 5LQAA 3BULA 1AB6A 2QMUA 1N5OX 1P2UA 2QUAA 2P2NA 2YYYA 5AK3A 5EIEA 2XCSB 2C5LA 1HX7A 2QN9A 3CPEA 4RDIA 4KPFC 5JPCA 3HLKA 1E1YA 1T9AA 1FXWF 3HSYA 3GFSA 4M8IA 1E99A 3WYEA 1M73E 2K2QB 4A92A 1UP4A 1KDPA 4DT1B 4AK9A 3RJTA 4QVIA 1N2CE