5TF5A

Crystal structure of human kat-2 in complex with a reversible inhibitor
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
425
structure length
424
Chain Sequence
b'MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kynurenine/alpha-aminoadipate aminotransferase, mitochondria
publication title Crystal structure and mechanistic analysis of a novel human kynurenine aminotransferase-2 reversible inhibitor
doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 137
structure length 424
sequence length 425
chains with identical sequence B
ec nomenclature ec 2.6.1.39: 2-aminoadipate transaminase.
pdb deposition date 2016-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 5tf5A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5tf5A03
4F5MA 1E5EA 3EIBA 1KL1A 4TN4A 3HBXA 2FNIA 3FVUA 4OTLA 2W8UA 3ATHA 2QA3A 2VIBA 4XJMA 1W7LA 5D5SA 3LVMA 1SZUA 4N0WA 3NU8A 1AJSA 4MSOA 2OKKA 3WGCA 1BJ4A 2Z20A 3A9YA 3BN1A 3Q8NA 4JEVA 4ZDPA 5HDMA 1GC0A 2QB3A 3FZ6A 1QIRA 3WY7A 1I43A 1I29A 1SPAA 1ASNA 2C81A 4WYCA 1ASDA 3WCOA 4RM1A 1V2DA 1B9HA 1SVVA 1TOEA 4ZM3A 2D7YA 2O0RA 1JS6A 2HORA 1EQBA 4BMKA 1T3IA 2Z9VA 1AKAA 3JU7A 4F5IA 1CL2A 2CY8A 1BQDA 5G2PA 3RBLA 4E3RA 1IBJA 1AHYA 3WGBA 1OXOA 1M7YA 4HVKA 3VK3A 2VLHA 4KXKA 1RVYA 2BI2A 3TQXA 4ZSYA 5G09A 4OYTA 3FD0A 3JZLA 3DXWA 4OBUA 1C7GA 1YJZA 2G6WA 1AMAA 1LC5A 1YAAA 2O7CA 2VGVA 3NRAA 4GE4A 3LVJA 1B5PA 3JW9A 1PG8A 1WKGA 2GMUA 5FT4A 1D2FA 1H1CA 1X29A 2VLFA 3EI7A 3QHXA 1KMKA 1C9CA 1Z7DA 2OGEA 1GD9A 3BCXA 1TOJA 4ATPA 3AENB 3G0TA 2YOBA 3B1EA 3NYUA 1ASFA 4Q76A 4XQ2A 3AEMA 3NU7A 3CQ5A 2YKVA 3AELA 3RQ1A 1ARIA 4WBTA 1M0PA 3WLXA 5M49A 4I8AA 1OHVA 2V0YA 4UQVA 2JJHA 4WP0A 1CL1A 2W8VA 1AICA 1X0MA 3PA9A 1EG5A 1C7NA 3NX3A 3MAFA 4F5LA 4M2MA 2D5YA 4RKDA 3FVSA 5TF5A 1AKBA 3MBBA 3TCMA 5EQCA 1AY4A 1QJ5A 4B98A 1AMRA 1AHGA 2DKJA 3BWNA 4WXFA 1G7WA 2ORDA 4CBRA 4E3QA 1ASBA 2VMOA 3GSBA 3WZFA 4ZWVA 1IX8A 1DGEA 1MLYA 4OCAA 1DTYA 3FDBA 5EUNA 4A6UA 4WXGA 4F5HA 1GC4A 1W3UA 1SZKA 2O1BA 1ZC9A 3QN6A 2YRIA 4MY5A 4GDYA 1TOIA 4PVFA 2DKBA 2R0TA 4ZASA 5FT8A 3ELEA 3RI6A 5DX5A 3AEJA 3H7FA 4ITGA 4A0HA 2PB0A 2YKXA 3PIUA 4J8LA 1WYTB 2CINA 4NOGA 3BS8A 3EI9A 2CJDA 3OKSA 2WK7A 5FT6A 1WSTA 3NYSA 4UHMA 4XJLA 1OXPA 1IVRA 2ZJGA 3E77A 4H51A 2TPLA 4XAUA 1O62A 2W7GA 4EU1A 2AY4A 1MGVA 3QM2A 3HVYA 1SZSA 2VMPA 4XJPA 3QPGA 1O4SA 2ZSMA 2Z1ZA 4F5GA 3DU4A 4WYFA 1YOOA 3EI5A 1B9IA 2CJGA 2BYJA 2QB2A 1IJIA 3CQ6A 4LNMA 4CVQA 1PFFA 1C4KA 1UU1A 1S06A 4WXBA 4Y0HA 1TATA 3PDXA 4MQQA 1ARSA 1AKCA 1D7SA 1UU2A 3GZCA 4M2JA 2ZP7A 1M4NA 4MKJA 4U2HA 4Y0IA 3G8MA 1BQAA 4DGTA 1AIAA 4JEYA 4K2IA 1GDEA 1Y4IA 1CS1A 2HOXA 2W8TA 3I4JA 4GEBA 4K2BA 4OMAA 2Q7WA 3RCHB 2FYFA 5F8VA 3BC8A 2JGTA 3BV0A 2WK9A 3VAXA 2ZY4A 3DODA 2Z9UA 2Z67A 1CZCA 4P3MA 4F5KA 1AMQA 2BI5A 1ARHA 3L44A 4RJ0A 3WX9A 4Y0DA 4A6RA 5K8BA 4W1VA 3PD6B 1B4XA 3FCRA 4OC9A 1AJRA 2BIAA 1LS3A 4GSAA 1ELQA 1KKPA 5F9SA 3LVKA 1ORDA 1ASEA 1AAMA 2WKAA 3FFHA 2JJFA 2W8JA 1VJOA 2BYLA 2PB2A 1MAQA 3PDBB 3R9AA 4ADEA 2CH2A 5J8QA 5D95A 3ASAA 4ZLVA 4F4EA 5G2QA 5HXXA 5M46A 1LW4A 2VGWA 3COGA 3H14A 3QBOA 4JEZA 3FQ7A 3LWSA 4IW7A 4OT8A 2HUIA 5BJ3A 1DFOA 2AY6A 3CQ4A 1S0AA 3RCHA 5LH9A 2BWPA 5G0AA 1FG3A 1ELUA 5E5IA 3EI6A 2ZY5A 2D61A 3GR9A 1WYUA 9AATA 3QGUA 3PD6A 4LNLA 4W1WA 2D63A 5EIGB 2OKJA 1S09A 2VIAA 4E1OA 3TATA 3K7YA 4MQPA 2AEVA 3NUBA 4WLJA 3ZRRA 3D6KA 1AY8A 2V1PA 3B1DA 3PDBA 4IXOA 4WLHA 4CBSA 3AEMC 3HL2A 1DJ9A 3L8AA 1CZEA 3A8UX 2ZSLA 3BWOA 1I48A 4WD2A 1TPLA 4LW4A 3RBFA 1LKCA 2BI1A 2GB3A 1AHEA 1QGNA 5EFSA 1J04A 2VI8A 5E3KA 1AHXA 5EAVA 2Z9WA 3BWNC 2FQ6A 1I41A 3CAIA 4ZWMA 3GZDA 4A6TA 3IF2A 1M0NA 2AY1A 2VMZA 5I92A 1VEFA 1MDXA 5EIGA 2HOYA 3KE3A 3G7QA 1AHFA 2CH1A 4RAEA 1ASMA 3DZZA 3T32A 3AEOA 2VMXA 2E54A 3AEJC 3JWBA 2HOZA 3B46A 4LNJA 4M2KA 4BHDA 4BQ0A 1IAXA 1CJ0A 3DYDA 4WYGA 4JE5D 1LK9A 2EPJA 4ISYA 3AOVA 2BHXA 1BJNA 3FTBA 4AO9A 3GBXA 4WB0B 1AIBA 4BA5A 4W5KA 3N75A 1W7NA 2W7EA 4PFNA 3PPLA 3GJUA 4WYDA 4AH3A 3P6KA 3PAAA 5IWQA 4IY7A 1TOGA 3E2FA 3AOWA 1RV3A 3ISLA 5AX8A 2AY7A 1TOKA 3AENA 4DBCA 1MLZA 4W1XA 1O69A 5HHYA 4ADCA 1IUGA 1QJ3A 2W7KA 1D7VA 1RVUA 1PMOA 4AZKA 3A2BA 5M4DA 2R5CB 3FQ8A 3ACZA 5JAYA 2VYCA 1H0CA 2Z9XA 4XJOA 3HMUA 4IYOB 2HUUA 3FVXA 3W1HA 3PJ0A 1DJUA 1KMJA 3NTJA 4QGRA 2BWNA 3ZZJA 2Z1YA 3EZSA 4JF1A 2HP2A 3AATA 2CANA 1BW0A 4IX8A 2QBTA 4MGRA 4F5FA 1E5FA 3EUCA 5EUDA 2AY9A 4A0RA 1YJYA 4ZM4A 2HUFA 3UWCA 4LW2A 3E2ZB 2AY2A 3ECDA 3WKRA 2JG2A 4JF0A 4UHOA 5DJ1A 1ASAA 3AEPA 5G4JA 1WYTA 1B8GA 1J32A 2VMNA 1JG8A 4P7YA 4ATQA 3TFUA 1V2FA 3N5MA 1S07A 1P3WA 3DXVA 2EH6A 3DR7A 4A0FA 2EZ2A 1M0OA 1ZODA 3EIAA 1JF9A 1LC8A 4IYOA 4GE9A 2R2NA 1BKGA 2DGKA 3USFA 1QZ9A 3EZ1A 1M6SA 2DGMA 3E2YA 4R2NA 3E9KA 3I5TA 1N8PA 3R4TA 2C7TA 3NNKA 1GEYA 2F8JA 3VP6A 2JJEA 2FN6A 1G4VA 1G4XA 4IXSA 4PFFA 2WK8A 3HT4A 3E2ZA 3FDDA 2D7ZA 1B5OA 1FC4A 4ITXA 4R8DA 4L0OA 4ZDLA 2BI9A 1QISA 1CQ7A 4A72A 4AO4A 2YKUA 3K40A 4TMRA 5C6UA 4AOAA 3PGYA 4ZDOA 2X5FA 1BJOB 1M0QA 3M5UA 1UKJA 4O6ZA 3DRDA 1OATA 4UOYA 2DGLA 3FKDA 5DJ9A 1BJWA 4E77A 3BCAA 1XI9A 1G7XA 4U1TA 2ZC0A 4WYAA 3MC6A 4A00A 3MEBA 1GC3A 4FFCA 3WKSA 2GSAA 2AY5A 1YJSA 2QMAA 4A0GA 3EI8A 1N31A 4OBVA 2EO5A 1ARGA 3BCBA 2AATA 1BS0A 4W8IA 5EAAA 5FT5A 2E7JA 3LVLB 3ELPA 1AX4A 3FZ7A 1SF2A 1Z3ZA 3GZDC 2EZ1A 3A9ZA 3VK4A 1WYVB 1DKAA 2D65A 2VGSA 1MDOA 1ARTA 3FSLA 3KGXA 2NMPA 4EB7A 3ZRPA 2W7HA 1BJOA 2GMSA 4R5ZA 1N2TA 1AAWA 2HP1A 2PO3A 2CSTA 3NUIA 1ASGA 5BJ4A 3CBFA 2AY8A 2JISA 4RIZA 1BT4A 5LHAA 2XH1A 3A9XA 3AV7A 1YNUA 3WCNA 1JS3A 4RJYA 4R5FA 3MAFB 3I16A 3HLMA 3F6TA 4KYOA 1GBNA 2DR1A 2OQXA 2RFVA 4GRXA 4KAMA 1D7RA 1C7OA 3II0A 2X8UA 2BKWA 2VGUA 3FQAA 2JJGA 2YHKA 1DJEA 1SFFA 2Z61A 1ECXA 1WYVA 1X2AA 2XBNA 3OP7A 2FM1A 3LG0A 3GETA 2VMUA 4AZJA 4JE5A 4BA4A 1LW5A 4DQ6A 2VGZA 3KKIA 2VMSA 4MKKA 2YCTA 1V2EA 1W7MA 5M4BA 2CFBA 1AY5A 2W7MA 2VMYA 3MAUA 1PMMA 3NYTA 1LC7A 4K2MA 2BWOA 1W23A 3HQTA 4ZAHA 3IHJA 1RV4A 4EMYA 3F0HA 3E6GA 1UU0A 4B9BA 2DOUA 2AEUA 2R5EA 2VMQA 2W7FA 4N0BA 2X3LA 1MDZA 3ASBA 1KL2A 3FRKA 2W7IA 1ASLA 2YCPA 3JTXA 1OHYA 4TV7A 2VMTA 4RKCA 2VI9A 4HF8A 2ZY2A 5E4ZA 3RUYA 2BIGA 3W1IA 4MQRA 2QLRA 4ADDA 1X28A 2YRRA 3GWPA 4J5UA 2YKYA 5G4IA 2FNUA 4WB0A 3MADA 3BB8A 1EJIA 3ZZKA 3MKJA 3TFTA 1YIZA 1IX6A 2D64A 2OATA 2BI3A 3FFRA 2W8WA 4CXQA 3B8XA 1WKHA 1FG7A 4XEWA 4FL0A 4GE7A 2VMVA 4W91A 1MAPA 2GQNA 1GEXA 3B1CA 4PIWA 3KGWA 1KKJA 4F5JA 2R5CA 3LY1A 3DR4A 3VK2A 2CB1A 2ZUKA 3HDOA 1D7UA 4WYEA 3N0LA 2X5DA 2VGTA 1C0NA 1IAYA 2E7UA 4XK1A 1GEWA 1QITA 3NDNA 3W1JA 4RLGA 3LV2A 2ZYJA 2CTZA 2VMWA 2W7JA 2VMRA 3UAKA 1IX7A 4ZSWA 7AATA 3P1TA 2CJHA 1CQ6A 3MC6C 1GCKA 2D66A 1DGDA 1AMSA 1YIYA 3FZ8A 1OHWA 1U08A 5EUEA 4EB5A 1AJSB 3DC1A 1CQ8A 2BIEA 1ZOBA 3F9TA 2ZY3A 1TARA 4LC3A 4RITA 2EGYA 3VOMA 4Q6RA 3K28A 1M32A 3UE8A 4JEXA 4JEWA 1V72A 2W7LA 4CXRA 1ASCA 1XEYA 3QI6A 1WYUB 2C44A 2W7DA 2C0RA 2HZPA 1VP4A 5DB5A 4Q31A 2E7IA 4ADBA 1GC2A 2YCNA 4EFFA 3JWAA 1TASA 4Q75A 2OGAA 1S08A 3ZRQA 8AATA 1O61A 4IXZA 4UHNA 2AY3A
chains in the Genus database with same CATH superfamily
4F5MA 1E5EA 3EIBA 1KL1A 4TN4A 3HBXA 2FNIA 3FVUA 4OTLA 2W8UA 3ATHA 2QA3A 2VIBA 4XJMA 1W7LA 5D5SA 3LVMA 1SZUA 4N0WA 3NU8A 1AJSA 4MSOA 2OKKA 3WGCA 1BJ4A 2Z20A 3A9YA 3BN1A 3Q8NA 4JEVA 4ZDPA 5HDMA 1GC0A 2QB3A 3FZ6A 1QIRA 3WY7A 1I43A 1I29A 1SPAA 1ASNA 2C81A 2QSRA 4WYCA 1ASDA 3WCOA 4RM1A 1V2DA 1B9HA 1SVVA 1TOEA 4ZM3A 2D7YA 2O0RA 1JS6A 2HORA 1EQBA 4BMKA 1T3IA 2Z9VA 1AKAA 3JU7A 4F5IA 1CL2A 2CY8A 1BQDA 5G2PA 3RBLA 4E3RA 1IBJA 1AHYA 3WGBA 1OXOA 1M7YA 4HVKA 3VK3A 2VLHA 4KXKA 1RVYA 2BI2A 3TQXA 4ZSYA 5G09A 4OYTA 3FD0A 3JZLA 3DXWA 4OBUA 1C7GA 1YJZA 2G6WA 1AMAA 1LC5A 1YAAA 2O7CA 2VGVA 3NRAA 4GE4A 3LVJA 1B5PA 3JW9A 1PG8A 1WKGA 2GMUA 5FT4A 1D2FA 1H1CA 1X29A 2VLFA 3EI7A 3QHXA 1KMKA 1C9CA 1Z7DA 2OGEA 1GD9A 3BCXA 1TOJA 4ATPA 3AENB 3G0TA 2YOBA 3B1EA 3NYUA 1ASFA 4Q76A 4XQ2A 3AEMA 3NU7A 3CQ5A 2YKVA 3AELA 3RQ1A 1ARIA 4WBTA 1M0PA 3WLXA 5M49A 4I8AA 1OHVA 2V0YA 4UQVA 2JJHA 4WP0A 1CL1A 2W8VA 1AICA 1X0MA 3PA9A 1EG5A 1C7NA 3NX3A 3MAFA 4F5LA 2A1VA 4M2MA 2D5YA 4RKDA 3FVSA 5TF5A 2WB6A 1AKBA 3MBBA 3TCMA 5EQCA 1AY4A 1QJ5A 4B98A 1AMRA 1AHGA 2DKJA 3BWNA 4WXFA 1G7WA 2ORDA 4CBRA 4E3QA 1ASBA 3N4RA 2VMOA 3GSBA 3WZFA 4ZWVA 1IX8A 1DGEA 1MLYA 4OCAA 1DTYA 3FDBA 5EUNA 4A6UA 4WXGA 4F5HA 1GC4A 1W3UA 1SZKA 2O1BA 1ZC9A 3QN6A 2YRIA 4MY5A 4GDYA 1TOIA 4PVFA 2DKBA 2R0TA 4ZASA 5FT8A 3ELEA 3RI6A 5DX5A 3AEJA 3H7FA 4ITGA 4A0HA 2PB0A 2YKXA 3PIUA 4J8LA 1WYTB 2CINA 4NOGA 3BS8A 3EI9A 2CJDA 3OKSA 2WK7A 5FT6A 1WSTA 3NYSA 4UHMA 4XJLA 1OXPA 1IVRA 2ZJGA 3E77A 4H51A 2TPLA 4XAUA 1O62A 2W7GA 4EU1A 2AY4A 1MGVA 3QM2A 3HVYA 1SZSA 2VMPA 4XJPA 3QPGA 1O4SA 2ZSMA 2Z1ZA 4F5GA 3DU4A 4WYFA 1YOOA 3EI5A 5KTBA 1B9IA 2CJGA 2BYJA 2QB2A 1IJIA 3CQ6A 4LNMA 4CVQA 1PFFA 1C4KA 1UU1A 1S06A 4WXBA 4Y0HA 1TATA 3PDXA 4MQQA 1ARSA 1AKCA 1D7SA 1UU2A 3GZCA 4M2JA 2ZP7A 1M4NA 4MKJA 4U2HA 4Y0IA 3G8MA 1BQAA 4DGTA 1AIAA 4JEYA 4K2IA 1GDEA 1Y4IA 1CS1A 2HOXA 2W8TA 3I4JA 4GEBA 4K2BA 4OMAA 2Q7WA 3RCHB 2FYFA 5F8VA 3BC8A 2JGTA 3BV0A 2WK9A 3VAXA 2ZY4A 3DODA 2Z9UA 2Z67A 1CZCA 4P3MA 4F5KA 1AMQA 2BI5A 1ARHA 3L44A 4RJ0A 3WX9A 4Y0DA 4A6RA 5K8BA 4W1VA 3PD6B 1B4XA 3FCRA 4OC9A 1AJRA 2BIAA 1LS3A 4GSAA 1ELQA 1KKPA 5F9SA 3LVKA 1ORDA 1ASEA 1AAMA 2WKAA 3FFHA 2JJFA 2W8JA 1VJOA 2BYLA 2PB2A 1MAQA 3PDBB 3R9AA 4ADEA 2CH2A 5J8QA 5D95A 3ASAA 4ZLVA 4F4EA 5G2QA 5HXXA 5M46A 1LW4A 2VGWA 3COGA 3H14A 3QBOA 4JEZA 3FQ7A 3LWSA 4IW7A 4OT8A 2HUIA 5BJ3A 1DFOA 2AY6A 3CQ4A 1S0AA 3RCHA 5LH9A 2BWPA 5G0AA 1FG3A 1ELUA 5E5IA 3EI6A 2ZY5A 2D61A 3GR9A 1WYUA 9AATA 3QGUA 3PD6A 4LNLA 4W1WA 2D63A 5EIGB 2OKJA 1S09A 2VIAA 4E1OA 3TATA 3K7YA 4MQPA 2AEVA 3NUBA 4WLJA 3ZRRA 3D6KA 1AY8A 2V1PA 3B1DA 3PDBA 4IXOA 4WLHA 4CBSA 3AEMC 3HL2A 1DJ9A 3L8AA 1CZEA 3A8UX 2ZSLA 3BWOA 1I48A 4WD2A 1TPLA 4LW4A 3RBFA 1LKCA 2BI1A 2GB3A 1AHEA 1QGNA 5EFSA 1J04A 2VI8A 5E3KA 1AHXA 5EAVA 2Z9WA 3BWNC 2FQ6A 1I41A 3CAIA 4ZWMA 3GZDA 4A6TA 3IF2A 1M0NA 2AY1A 2VMZA 5I92A 1VEFA 1MDXA 5EIGA 2HOYA 3KE3A 3G7QA 1AHFA 2CH1A 4RAEA 1ASMA 3DZZA 3T32A 3AEOA 2VMXA 2E54A 3AEJC 3JWBA 2HOZA 3B46A 4LNJA 4M2KA 4BHDA 4BQ0A 1IAXA 1CJ0A 3DYDA 4WYGA 4JE5D 1LK9A 2EPJA 4ISYA 3AOVA 2BHXA 1BJNA 3FTBA 4AO9A 3GBXA 4WB0B 1AIBA 4BA5A 4W5KA 3N75A 1W7NA 2W7EA 4PFNA 3PPLA 3GJUA 4WYDA 4AH3A 3P6KA 3PAAA 5IWQA 4IY7A 1TOGA 3E2FA 3AOWA 1RV3A 3ISLA 5AX8A 2AY7A 1TOKA 3AENA 4DBCA 1MLZA 4W1XA 1O69A 5HHYA 4ADCA 1IUGA 1QJ3A 2W7KA 1D7VA 1RVUA 1PMOA 4AZKA 3A2BA 5M4DA 2R5CB 3FQ8A 3ACZA 5JAYA 2VYCA 1H0CA 2Z9XA 4XJOA 3HMUA 4IYOB 2HUUA 3FVXA 3W1HA 3PJ0A 1DJUA 1KMJA 3NTJA 4QGRA 2BWNA 3ZZJA 2Z1YA 3EZSA 4JF1A 2HP2A 3AATA 2CANA 1BW0A 4IX8A 2QBTA 4MGRA 4F5FA 1E5FA 3EUCA 5EUDA 2AY9A 4A0RA 1YJYA 4ZM4A 2HUFA 3UWCA 4LW2A 3E2ZB 2AY2A 3ECDA 3WKRA 2JG2A 4JF0A 4UHOA 5DJ1A 1ASAA 3AEPA 5G4JA 1WYTA 1B8GA 1J32A 2VMNA 1JG8A 4P7YA 4ATQA 3TFUA 1V2FA 3N5MA 1S07A 1P3WA 3DXVA 2EH6A 3DR7A 4A0FA 2EZ2A 1M0OA 1ZODA 3EIAA 1JF9A 1LC8A 4IYOA 4GE9A 2R2NA 1BKGA 2DGKA 3USFA 1QZ9A 3EZ1A 3N4XA 1M6SA 2DGMA 3E2YA 4R2NA 4H63Q 3E9KA 3I5TA 1N8PA 3R4TA 2C7TA 3NNKA 1GEYA 2F8JA 3VP6A 2JJEA 2FN6A 1G4VA 1G4XA 4IXSA 4PFFA 2WK8A 3HT4A 3E2ZA 3FDDA 2D7ZA 1B5OA 1FC4A 4ITXA 4R8DA 4L0OA 4ZDLA 2BI9A 1QISA 1CQ7A 4A72A 4AO4A 3N7NA 2YKUA 3K40A 4TMRA 5C6UA 4AOAA 3PGYA 4ZDOA 2X5FA 1BJOB 1M0QA 3M5UA 1UKJA 4O6ZA 3DRDA 1OATA 4UOYA 2DGLA 3FKDA 5DJ9A 1BJWA 4E77A 3BCAA 1XI9A 1G7XA 4U1TA 2ZC0A 4WYAA 3MC6A 4A00A 3MEBA 1GC3A 4FFCA 3WKSA 2GSAA 2KFPA 2AY5A 1YJSA 2QMAA 4A0GA 3EI8A 1N31A 4OBVA 4K05A 2EO5A 1ARGA 3BCBA 2AATA 1BS0A 4W8IA 5EAAA 5FT5A 2E7JA 3LVLB 3ELPA 1AX4A 3FZ7A 1SF2A 1Z3ZA 3GZDC 2EZ1A 3A9ZA 3VK4A 1WYVB 1DKAA 2D65A 2VGSA 1MDOA 1ARTA 3FSLA 3KGXA 2NMPA 4EB7A 3ZRPA 2W7HA 1BJOA 2GMSA 4R5ZA 1N2TA 1AAWA 2HP1A 2PO3A 2CSTA 3NUIA 1ASGA 2EYQA 5BJ4A 3CBFA 2AY8A 2JISA 4RIZA 1BT4A 5LHAA 2XH1A 3A9XA 3AV7A 1YNUA 3WCNA 1JS3A 4RJYA 4R5FA 3MAFB 3I16A 3HLMA 3F6TA 4KYOA 1GBNA 2DR1A 2OQXA 3H9XA 2RFVA 4GRXA 4KAMA 1D7RA 1C7OA 3II0A 2X8UA 2BKWA 2VGUA 3FQAA 2JJGA 2YHKA 1DJEA 1SFFA 2Z61A 1ECXA 1WYVA 1X2AA 2XBNA 3OP7A 2FM1A 3LG0A 3GETA 2VMUA 4AZJA 4JE5A 4BA4A 2G7JA 1LW5A 4DQ6A 2VGZA 3KKIA 2VMSA 4MKKA 2YCTA 1V2EA 1W7MA 5M4BA 2CFBA 1AY5A 2W7MA 2VMYA 3MAUA 1PMMA 3NYTA 1LC7A 4K2MA 2BWOA 1W23A 3HQTA 4ZAHA 3IHJA 1RV4A 4EMYA 2FKIA 3F0HA 3E6GA 1UU0A 4B9BA 2DOUA 2AEUA 2R5EA 2VMQA 2W7FA 4N0BA 2X3LA 1MDZA 3ASBA 1KL2A 3FRKA 2W7IA 1ASLA 2YCPA 3JTXA 1OHYA 4TV7A 2VMTA 4RKCA 3N4SA 2VI9A 4HF8A 2ZY2A 5E4ZA 3RUYA 2BIGA 3W1IA 4MQRA 2QLRA 4ADDA 1X28A 2YRRA 3GWPA 4J5UA 2YKYA 5G4IA 2FNUA 4WB0A 3MADA 3BB8A 1EJIA 3ZZKA 3MKJA 3TFTA 1YIZA 1IX6A 2D64A 2OATA 2BI3A 3FFRA 2W8WA 4CXQA 3B8XA 1WKHA 1FG7A 4XEWA 4FL0A 4GE7A 2VMVA 4W91A 1MAPA 2GQNA 1GEXA 3B1CA 4PIWA 3KGWA 1KKJA 4F5JA 2R5CA 3LY1A 3DR4A 3VK2A 2CB1A 2ZUKA 3HDOA 1D7UA 4WYEA 3N0LA 2X5DA 2VGTA 1C0NA 1IAYA 2E7UA 4XK1A 1GEWA 1QITA 3NDNA 3W1JA 4RLGA 3LV2A 2ZYJA 2CTZA 2VMWA 2W7JA 2VMRA 3UAKA 1IX7A 4ZSWA 7AATA 3P1TA 2CJHA 1CQ6A 3MC6C 1GCKA 2D66A 1DGDA 1AMSA 1YIYA 3FZ8A 1OHWA 1U08A 5EUEA 4EB5A 1AJSB 3DC1A 1CQ8A 2BIEA 1ZOBA 3F9TA 2ZY3A 1TARA 4LC3A 4RITA 2EGYA 3VOMA 4Q6RA 3K28A 1M32A 3UE8A 1KAFA 4JEXA 4JEWA 1V72A 2W7LA 4CXRA 1ASCA 1XEYA 3QI6A 1WYUB 2C44A 2W7DA 2C0RA 2HZPA 1VP4A 5DB5A 4Q31A 2E7IA 4ADBA 1GC2A 2YCNA 4EFFA 3JWAA 1TASA 4Q75A 2OGAA 1S08A 3ZRQA 8AATA 1O61A 4IXZA 4UHNA 2AY3A
chains in the Genus database with same CATH topology
4F5MA 1E5EA 3EIBA 1KL1A 4TN4A 3HBXA 2FNIA 3FVUA 4OTLA 2W8UA 3ATHA 2QA3A 2VIBA 4XJMA 1W7LA 5D5SA 3LVMA 1SZUA 4N0WA 3NU8A 1AJSA 4MSOA 2OKKA 3WGCA 1BJ4A 2Z20A 3A9YA 3BN1A 3Q8NA 4JEVA 4ZDPA 5HDMA 1GC0A 2QB3A 3FZ6A 1QIRA 3WY7A 1I43A 1I29A 1SPAA 1ASNA 2C81A 2QSRA 4WYCA 1ASDA 3WCOA 4RM1A 1V2DA 1B9HA 1SVVA 1TOEA 4ZM3A 2D7YA 2O0RA 1JS6A 2HORA 1EQBA 4BMKA 1T3IA 2Z9VA 1AKAA 3JU7A 4F5IA 1CL2A 2CY8A 1BQDA 5G2PA 3RBLA 4E3RA 1IBJA 1AHYA 3WGBA 1OXOA 1M7YA 4HVKA 3VK3A 2VLHA 4KXKA 1RVYA 2BI2A 3TQXA 4ZSYA 5G09A 4OYTA 3FD0A 3JZLA 3DXWA 4OBUA 1C7GA 1YJZA 2G6WA 1AMAA 1LC5A 1YAAA 2O7CA 2VGVA 3NRAA 4GE4A 3LVJA 1B5PA 3JW9A 1PG8A 1WKGA 2GMUA 5FT4A 1D2FA 1H1CA 1X29A 2VLFA 3EI7A 3QHXA 1KMKA 1C9CA 1Z7DA 2OGEA 1GD9A 3BCXA 1TOJA 4ATPA 3AENB 3G0TA 2YOBA 3B1EA 3NYUA 1ASFA 4Q76A 4XQ2A 3AEMA 3NU7A 3CQ5A 2YKVA 3AELA 3RQ1A 1ARIA 4WBTA 1M0PA 3WLXA 5M49A 4I8AA 1OHVA 2V0YA 4UQVA 2JJHA 4WP0A 1CL1A 2W8VA 1AICA 1X0MA 3PA9A 1EG5A 1C7NA 3NX3A 3MAFA 4F5LA 2A1VA 4M2MA 2D5YA 4RKDA 3FVSA 5TF5A 2WB6A 1AKBA 3MBBA 3TCMA 5EQCA 1AY4A 1QJ5A 4B98A 1AMRA 1AHGA 2DKJA 3BWNA 4WXFA 1G7WA 2ORDA 4CBRA 4E3QA 1ASBA 3N4RA 2VMOA 3GSBA 3WZFA 4ZWVA 1IX8A 1DGEA 1MLYA 4OCAA 1DTYA 3FDBA 5EUNA 4A6UA 4WXGA 4F5HA 1GC4A 1W3UA 1SZKA 2O1BA 1ZC9A 3QN6A 2YRIA 4MY5A 4GDYA 1TOIA 4PVFA 2DKBA 2R0TA 4ZASA 5FT8A 3ELEA 3RI6A 5DX5A 3AEJA 3H7FA 4ITGA 4A0HA 2PB0A 2YKXA 3PIUA 4J8LA 1WYTB 2CINA 4NOGA 3BS8A 3EI9A 2CJDA 3OKSA 2WK7A 5FT6A 1WSTA 3NYSA 4UHMA 4XJLA 1OXPA 1IVRA 2ZJGA 3E77A 4H51A 2TPLA 4XAUA 1O62A 2W7GA 4EU1A 2AY4A 1MGVA 3QM2A 3HVYA 1SZSA 2VMPA 4XJPA 3QPGA 1O4SA 2ZSMA 2Z1ZA 4F5GA 3DU4A 4WYFA 1YOOA 3EI5A 5KTBA 1B9IA 2CJGA 2BYJA 2QB2A 1IJIA 3CQ6A 4LNMA 4CVQA 1PFFA 1C4KA 1UU1A 1S06A 4WXBA 4Y0HA 1TATA 3PDXA 4MQQA 1ARSA 1AKCA 1D7SA 1UU2A 3GZCA 4M2JA 2ZP7A 1M4NA 4MKJA 4U2HA 4Y0IA 3G8MA 1BQAA 4DGTA 1AIAA 4JEYA 4K2IA 1GDEA 1Y4IA 1CS1A 2HOXA 2W8TA 3I4JA 4GEBA 4K2BA 4OMAA 2Q7WA 3RCHB 2FYFA 5F8VA 3BC8A 2JGTA 3BV0A 2WK9A 3VAXA 2ZY4A 3DODA 2Z9UA 2Z67A 1CZCA 4P3MA 4F5KA 1AMQA 2BI5A 1ARHA 3L44A 4RJ0A 3WX9A 4Y0DA 4A6RA 5K8BA 4W1VA 3PD6B 1B4XA 3FCRA 4OC9A 1AJRA 2BIAA 1LS3A 4GSAA 1ELQA 1KKPA 5F9SA 3LVKA 1ORDA 1ASEA 1AAMA 2WKAA 3FFHA 2JJFA 2W8JA 1VJOA 2BYLA 2PB2A 1MAQA 3PDBB 3R9AA 4ADEA 2CH2A 5J8QA 5D95A 3ASAA 4ZLVA 4F4EA 5G2QA 5HXXA 5M46A 1LW4A 2VGWA 3COGA 3H14A 3QBOA 4JEZA 3FQ7A 3LWSA 4IW7A 4OT8A 2HUIA 5BJ3A 1DFOA 2AY6A 3CQ4A 1S0AA 3RCHA 5LH9A 2BWPA 5G0AA 1FG3A 1ELUA 5E5IA 3EI6A 2ZY5A 2D61A 3GR9A 1WYUA 9AATA 3QGUA 3PD6A 4LNLA 4W1WA 2D63A 5EIGB 2OKJA 1S09A 2VIAA 4E1OA 3TATA 3K7YA 4MQPA 2AEVA 3NUBA 4WLJA 3ZRRA 3D6KA 1AY8A 2V1PA 3B1DA 3PDBA 4IXOA 4WLHA 4CBSA 3AEMC 3HL2A 1DJ9A 3L8AA 1CZEA 3A8UX 2ZSLA 3BWOA 1I48A 4WD2A 1TPLA 4LW4A 3RBFA 1LKCA 2BI1A 2GB3A 1AHEA 1QGNA 5EFSA 1J04A 2VI8A 5E3KA 1AHXA 5EAVA 2Z9WA 3BWNC 2FQ6A 1I41A 3CAIA 4ZWMA 3GZDA 4A6TA 3IF2A 1M0NA 2AY1A 2VMZA 5I92A 1VEFA 1MDXA 5EIGA 2HOYA 3KE3A 3G7QA 1AHFA 2CH1A 4RAEA 1ASMA 3DZZA 3T32A 3AEOA 2VMXA 2E54A 3AEJC 3JWBA 2HOZA 3B46A 4LNJA 4M2KA 4BHDA 4BQ0A 1IAXA 1CJ0A 3DYDA 4WYGA 4JE5D 1LK9A 2EPJA 4ISYA 3AOVA 2BHXA 1BJNA 3FTBA 4AO9A 3GBXA 4WB0B 1AIBA 4BA5A 4W5KA 3N75A 1W7NA 2W7EA 4PFNA 3PPLA 3GJUA 4WYDA 4AH3A 3P6KA 3PAAA 5IWQA 4IY7A 1TOGA 3E2FA 3AOWA 1RV3A 3ISLA 5AX8A 2AY7A 1TOKA 3AENA 4DBCA 1MLZA 4W1XA 1O69A 5HHYA 4ADCA 1IUGA 1QJ3A 2W7KA 1D7VA 1RVUA 1PMOA 4AZKA 3A2BA 5M4DA 2R5CB 3FQ8A 3ACZA 5JAYA 2VYCA 1H0CA 2Z9XA 4XJOA 3HMUA 4IYOB 2HUUA 3FVXA 3W1HA 3PJ0A 1DJUA 1KMJA 3NTJA 4QGRA 2BWNA 3ZZJA 2Z1YA 3EZSA 4JF1A 2HP2A 3AATA 2CANA 1BW0A 4IX8A 2QBTA 4MGRA 4F5FA 1E5FA 3EUCA 5EUDA 2AY9A 4A0RA 1YJYA 4ZM4A 2HUFA 3UWCA 4LW2A 3E2ZB 2AY2A 3ECDA 3WKRA 2JG2A 4JF0A 4UHOA 5DJ1A 1ASAA 3AEPA 5G4JA 1WYTA 1B8GA 1J32A 2VMNA 1JG8A 4P7YA 4ATQA 3TFUA 1V2FA 3N5MA 1S07A 1P3WA 3DXVA 2EH6A 3DR7A 4A0FA 2EZ2A 1M0OA 1ZODA 3EIAA 1JF9A 1LC8A 4IYOA 4GE9A 2R2NA 1BKGA 2DGKA 3USFA 1QZ9A 3EZ1A 3N4XA 1M6SA 2DGMA 3E2YA 4R2NA 4H63Q 3E9KA 3I5TA 1N8PA 3R4TA 2C7TA 3NNKA 1GEYA 2F8JA 3VP6A 2JJEA 2FN6A 1G4VA 1G4XA 4IXSA 4PFFA 2WK8A 3HT4A 3E2ZA 3FDDA 2D7ZA 1B5OA 1FC4A 4ITXA 4R8DA 4L0OA 4ZDLA 2BI9A 1QISA 1CQ7A 4A72A 4AO4A 3N7NA 2YKUA 3K40A 4TMRA 5C6UA 4AOAA 3PGYA 4ZDOA 2X5FA 1BJOB 1M0QA 3M5UA 1UKJA 4O6ZA 3DRDA 1OATA 4UOYA 2DGLA 3FKDA 5DJ9A 1BJWA 4E77A 3BCAA 1XI9A 1G7XA 4U1TA 2ZC0A 4WYAA 3MC6A 4A00A 3MEBA 1GC3A 4FFCA 3WKSA 2GSAA 2KFPA 2AY5A 1YJSA 2QMAA 4A0GA 3EI8A 1N31A 4OBVA 4K05A 2EO5A 1ARGA 3BCBA 2AATA 1BS0A 4W8IA 5EAAA 5FT5A 2E7JA 3LVLB 3ELPA 1AX4A 3FZ7A 1SF2A 1Z3ZA 3GZDC 2EZ1A 3A9ZA 3VK4A 1WYVB 1DKAA 2D65A 2VGSA 1MDOA 1ARTA 3FSLA 3KGXA 2NMPA 4EB7A 3ZRPA 2W7HA 1BJOA 2GMSA 4R5ZA 1N2TA 1AAWA 2HP1A 2PO3A 2CSTA 3NUIA 1ASGA 2EYQA 5BJ4A 3CBFA 2AY8A 2JISA 4RIZA 1BT4A 5LHAA 2XH1A 3A9XA 3AV7A 1YNUA 3WCNA 1JS3A 4RJYA 4R5FA 3MAFB 3I16A 3HLMA 3F6TA 4KYOA 1GBNA 2DR1A 2OQXA 3H9XA 2RFVA 4GRXA 4KAMA 1D7RA 1C7OA 3II0A 2X8UA 2BKWA 2VGUA 3FQAA 2JJGA 2YHKA 1DJEA 1SFFA 2Z61A 1ECXA 1WYVA 1X2AA 2XBNA 3OP7A 2FM1A 3LG0A 3GETA 2VMUA 4AZJA 4JE5A 4BA4A 2G7JA 1LW5A 4DQ6A 2VGZA 3KKIA 2VMSA 4MKKA 2YCTA 1V2EA 1W7MA 5M4BA 2CFBA 1AY5A 2W7MA 2VMYA 3MAUA 1PMMA 3NYTA 1LC7A 4K2MA 2BWOA 1W23A 3HQTA 4ZAHA 3IHJA 1RV4A 4EMYA 2FKIA 3F0HA 3E6GA 1UU0A 4B9BA 2DOUA 2AEUA 2R5EA 2VMQA 2W7FA 4N0BA 2X3LA 1MDZA 3ASBA 1KL2A 3FRKA 2W7IA 1ASLA 2YCPA 3JTXA 1OHYA 4TV7A 2VMTA 4RKCA 3N4SA 2VI9A 4HF8A 2ZY2A 5E4ZA 3RUYA 2BIGA 3W1IA 4MQRA 2QLRA 4ADDA 1X28A 2YRRA 3GWPA 4J5UA 2YKYA 5G4IA 2FNUA 4WB0A 3MADA 3BB8A 1EJIA 3ZZKA 3MKJA 3TFTA 1YIZA 1IX6A 2D64A 2OATA 2BI3A 3FFRA 2W8WA 4CXQA 3B8XA 1WKHA 1FG7A 4XEWA 4FL0A 4GE7A 2VMVA 4W91A 1MAPA 2GQNA 1GEXA 3B1CA 4PIWA 3KGWA 1KKJA 4F5JA 2R5CA 3LY1A 3DR4A 3VK2A 2CB1A 2ZUKA 3HDOA 1D7UA 4WYEA 3N0LA 2X5DA 2VGTA 1C0NA 1IAYA 2E7UA 4XK1A 1GEWA 1QITA 3NDNA 3W1JA 4RLGA 3LV2A 2ZYJA 2CTZA 2VMWA 2W7JA 2VMRA 3UAKA 1IX7A 4ZSWA 7AATA 3P1TA 2CJHA 1CQ6A 3MC6C 1GCKA 2D66A 1DGDA 1AMSA 1YIYA 3FZ8A 1OHWA 1U08A 5EUEA 4EB5A 1AJSB 3DC1A 1CQ8A 2BIEA 1ZOBA 3F9TA 2ZY3A 1TARA 4LC3A 4RITA 2EGYA 3VOMA 4Q6RA 3K28A 1M32A 3UE8A 4JEXA 4JEWA 1V72A 2W7LA 4CXRA 1ASCA 1XEYA 3QI6A 1WYUB 2C44A 2W7DA 2C0RA 2HZPA 1VP4A 5DB5A 4Q31A 2E7IA 4ADBA 1GC2A 2YCNA 4EFFA 3JWAA 1TASA 4Q75A 2OGAA 1S08A 3ZRQA 8AATA 1O61A 4IXZA 4UHNA 2AY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F5M A;  1E5E A;  3EIB A;  1KL1 A;  4TN4 A;  3HBX A;  2FNI A;  3FVU A;  4OTL A;  2W8U A;  3ATH A;  2QA3 A;  2VIB A;  4XJM A;  1W7L A;  5D5S A;  3LVM A;  1SZU A;  4N0W A;  3NU8 A;  1AJS A;  4MSO A;  2OKK A;  3WGC A;  1BJ4 A;  2Z20 A;  3A9Y A;  3BN1 A;  3Q8N A;  4JEV A;  4ZDP A;  5HDM A;  1GC0 A;  2QB3 A;  3FZ6 A;  1QIR A;  3WY7 A;  1I43 A;  1I29 A;  1SPA A;  1ASN A;  2C81 A;  4WYC A;  1ASD A;  3WCO A;  4RM1 A;  1V2D A;  1B9H A;  1SVV A;  1TOE A;  4ZM3 A;  2D7Y A;  2O0R A;  1JS6 A;  2HOR A;  1EQB A;  4BMK A;  1T3I A;  2Z9V A;  1AKA A;  3JU7 A;  4F5I A;  1CL2 A;  2CY8 A;  1BQD A;  5G2P A;  3RBL A;  4E3R A;  1IBJ A;  1AHY A;  3WGB A;  1OXO A;  1M7Y A;  4HVK A;  3VK3 A;  2VLH A;  4KXK A;  1RVY A;  2BI2 A;  3TQX A;  4ZSY A;  5G09 A;  4OYT A;  3FD0 A;  3JZL A;  3DXW A;  4OBU A;  1C7G A;  1YJZ A;  2G6W A;  1AMA A;  1LC5 A;  1YAA A;  2O7C A;  2VGV A;  3NRA A;  4GE4 A;  3LVJ A;  1B5P A;  3JW9 A;  1PG8 A;  1WKG A;  2GMU A;  5FT4 A;  1D2F A;  1H1C A;  1X29 A;  2VLF A;  3EI7 A;  3QHX A;  1KMK A;  1C9C A;  1Z7D A;  2OGE A;  1GD9 A;  3BCX A;  1TOJ A;  4ATP A;  3AEN B;  3G0T A;  2YOB A;  3B1E A;  3NYU A;  1ASF A;  4Q76 A;  4XQ2 A;  3AEM A;  3NU7 A;  3CQ5 A;  2YKV A;  3AEL A;  3RQ1 A;  1ARI A;  4WBT A;  1M0P A;  3WLX A;  5M49 A;  4I8A A;  1OHV A;  2V0Y A;  4UQV A;  2JJH A;  4WP0 A;  1CL1 A;  2W8V A;  1AIC A;  1X0M A;  3PA9 A;  1EG5 A;  1C7N A;  3NX3 A;  3MAF A;  4F5L A;  4M2M A;  2D5Y A;  4RKD A;  3FVS A;  5TF5 A;  1AKB A;  3MBB A;  3TCM A;  5EQC A;  1AY4 A;  1QJ5 A;  4B98 A;  1AMR A;  1AHG A;  2DKJ A;  3BWN A;  4WXF A;  1G7W A;  2ORD A;  4CBR A;  4E3Q A;  1ASB A;  2VMO A;  3GSB A;  3WZF A;  4ZWV A;  1IX8 A;  1DGE A;  1MLY A;  4OCA A;  1DTY A;  3FDB A;  5EUN A;  4A6U A;  4WXG A;  4F5H A;  1GC4 A;  1W3U A;  1SZK A;  2O1B A;  1ZC9 A;  3QN6 A;  2YRI A;  4MY5 A;  4GDY A;  1TOI A;  4PVF A;  2DKB A;  2R0T A;  4ZAS A;  5FT8 A;  3ELE A;  3RI6 A;  5DX5 A;  3AEJ A;  3H7F A;  4ITG A;  4A0H A;  2PB0 A;  2YKX A;  3PIU A;  4J8L A;  1WYT B;  2CIN A;  4NOG A;  3BS8 A;  3EI9 A;  2CJD A;  3OKS A;  2WK7 A;  5FT6 A;  1WST A;  3NYS A;  4UHM A;  4XJL A;  1OXP A;  1IVR A;  2ZJG A;  3E77 A;  4H51 A;  2TPL A;  4XAU A;  1O62 A;  2W7G A;  4EU1 A;  2AY4 A;  1MGV A;  3QM2 A;  3HVY A;  1SZS A;  2VMP A;  4XJP A;  3QPG A;  1O4S A;  2ZSM A;  2Z1Z A;  4F5G A;  3DU4 A;  4WYF A;  1YOO A;  3EI5 A;  1B9I A;  2CJG A;  2BYJ A;  2QB2 A;  1IJI A;  3CQ6 A;  4LNM A;  4CVQ A;  1PFF A;  1C4K A;  1UU1 A;  1S06 A;  4WXB A;  4Y0H A;  1TAT A;  3PDX A;  4MQQ A;  1ARS A;  1AKC A;  1D7S A;  1UU2 A;  3GZC A;  4M2J A;  2ZP7 A;  1M4N A;  4MKJ A;  4U2H A;  4Y0I A;  3G8M A;  1BQA A;  4DGT A;  1AIA A;  4JEY A;  4K2I A;  1GDE A;  1Y4I A;  1CS1 A;  2HOX A;  2W8T A;  3I4J A;  4GEB A;  4K2B A;  4OMA A;  2Q7W A;  3RCH B;  2FYF A;  5F8V A;  3BC8 A;  2JGT A;  3BV0 A;  2WK9 A;  3VAX A;  2ZY4 A;  3DOD A;  2Z9U A;  2Z67 A;  1CZC A;  4P3M A;  4F5K A;  1AMQ A;  2BI5 A;  1ARH A;  3L44 A;  4RJ0 A;  3WX9 A;  4Y0D A;  4A6R A;  5K8B A;  4W1V A;  3PD6 B;  1B4X A;  3FCR A;  4OC9 A;  1AJR A;  2BIA A;  1LS3 A;  4GSA A;  1ELQ A;  1KKP A;  5F9S A;  3LVK A;  1ORD A;  1ASE A;  1AAM A;  2WKA A;  3FFH A;  2JJF A;  2W8J A;  1VJO A;  2BYL A;  2PB2 A;  1MAQ A;  3PDB B;  3R9A A;  4ADE A;  2CH2 A;  5J8Q A;  5D95 A;  3ASA A;  4ZLV A;  4F4E A;  5G2Q A;  5HXX A;  5M46 A;  1LW4 A;  2VGW A;  3COG A;  3H14 A;  3QBO A;  4JEZ A;  3FQ7 A;  3LWS A;  4IW7 A;  4OT8 A;  2HUI A;  5BJ3 A;  1DFO A;  2AY6 A;  3CQ4 A;  1S0A A;  3RCH A;  5LH9 A;  2BWP A;  5G0A A;  1FG3 A;  1ELU A;  5E5I A;  3EI6 A;  2ZY5 A;  2D61 A;  3GR9 A;  1WYU A;  9AAT A;  3QGU A;  3PD6 A;  4LNL A;  4W1W A;  2D63 A;  5EIG B;  2OKJ A;  1S09 A;  2VIA A;  4E1O A;  3TAT A;  3K7Y A;  4MQP A;  2AEV A;  3NUB A;  4WLJ A;  3ZRR A;  3D6K A;  1AY8 A;  2V1P A;  3B1D A;  3PDB A;  4IXO A;  4WLH A;  4CBS A;  3AEM C;  3HL2 A;  1DJ9 A;  3L8A A;  1CZE A;  3A8U X;  2ZSL A;  3BWO A;  1I48 A;  4WD2 A;  1TPL A;  4LW4 A;  3RBF A;  1LKC A;  2BI1 A;  2GB3 A;  1AHE A;  1QGN A;  5EFS A;  1J04 A;  2VI8 A;  5E3K A;  1AHX A;  5EAV A;  2Z9W A;  3BWN C;  2FQ6 A;  1I41 A;  3CAI A;  4ZWM A;  3GZD A;  4A6T A;  3IF2 A;  1M0N A;  2AY1 A;  2VMZ A;  5I92 A;  1VEF A;  1MDX A;  5EIG A;  2HOY A;  3KE3 A;  3G7Q A;  1AHF A;  2CH1 A;  4RAE A;  1ASM A;  3DZZ A;  3T32 A;  3AEO A;  2VMX A;  2E54 A;  3AEJ C;  3JWB A;  2HOZ A;  3B46 A;  4LNJ A;  4M2K A;  4BHD A;  4BQ0 A;  1IAX A;  1CJ0 A;  3DYD A;  4WYG A;  4JE5 D;  1LK9 A;  2EPJ A;  4ISY A;  3AOV A;  2BHX A;  1BJN A;  3FTB A;  4AO9 A;  3GBX A;  4WB0 B;  1AIB A;  4BA5 A;  4W5K A;  3N75 A;  1W7N A;  2W7E A;  4PFN A;  3PPL A;  3GJU A;  4WYD A;  4AH3 A;  3P6K A;  3PAA A;  5IWQ A;  4IY7 A;  1TOG A;  3E2F A;  3AOW A;  1RV3 A;  3ISL A;  5AX8 A;  2AY7 A;  1TOK A;  3AEN A;  4DBC A;  1MLZ A;  4W1X A;  1O69 A;  5HHY A;  4ADC A;  1IUG A;  1QJ3 A;  2W7K A;  1D7V A;  1RVU A;  1PMO A;  4AZK A;  3A2B A;  5M4D A;  2R5C B;  3FQ8 A;  3ACZ A;  5JAY A;  2VYC A;  1H0C A;  2Z9X A;  4XJO A;  3HMU A;  4IYO B;  2HUU A;  3FVX A;  3W1H A;  3PJ0 A;  1DJU A;  1KMJ A;  3NTJ A;  4QGR A;  2BWN A;  3ZZJ A;  2Z1Y A;  3EZS A;  4JF1 A;  2HP2 A;  3AAT A;  2CAN A;  1BW0 A;  4IX8 A;  2QBT A;  4MGR A;  4F5F A;  1E5F A;  3EUC A;  5EUD A;  2AY9 A;  4A0R A;  1YJY A;  4ZM4 A;  2HUF A;  3UWC A;  4LW2 A;  3E2Z B;  2AY2 A;  3ECD A;  3WKR A;  2JG2 A;  4JF0 A;  4UHO A;  5DJ1 A;  1ASA A;  3AEP A;  5G4J A;  1WYT A;  1B8G A;  1J32 A;  2VMN A;  1JG8 A;  4P7Y A;  4ATQ A;  3TFU A;  1V2F A;  3N5M A;  1S07 A;  1P3W A;  3DXV A;  2EH6 A;  3DR7 A;  4A0F A;  2EZ2 A;  1M0O A;  1ZOD A;  3EIA A;  1JF9 A;  1LC8 A;  4IYO A;  4GE9 A;  2R2N A;  1BKG A;  2DGK A;  3USF A;  1QZ9 A;  3EZ1 A;  1M6S A;  2DGM A;  3E2Y A;  4R2N A;  3E9K A;  3I5T A;  1N8P A;  3R4T A;  2C7T A;  3NNK A;  1GEY A;  2F8J A;  3VP6 A;  2JJE A;  2FN6 A;  1G4V A;  1G4X A;  4IXS A;  4PFF A;  2WK8 A;  3HT4 A;  3E2Z A;  3FDD A;  2D7Z A;  1B5O A;  1FC4 A;  4ITX A;  4R8D A;  4L0O A;  4ZDL A;  2BI9 A;  1QIS A;  1CQ7 A;  4A72 A;  4AO4 A;  2YKU A;  3K40 A;  4TMR A;  5C6U A;  4AOA A;  3PGY A;  4ZDO A;  2X5F A;  1BJO B;  1M0Q A;  3M5U A;  1UKJ A;  4O6Z A;  3DRD A;  1OAT A;  4UOY A;  2DGL A;  3FKD A;  5DJ9 A;  1BJW A;  4E77 A;  3BCA A;  1XI9 A;  1G7X A;  4U1T A;  2ZC0 A;  4WYA A;  3MC6 A;  4A00 A;  3MEB A;  1GC3 A;  4FFC A;  3WKS A;  2GSA A;  2AY5 A;  1YJS A;  2QMA A;  4A0G A;  3EI8 A;  1N31 A;  4OBV A;  2EO5 A;  1ARG A;  3BCB A;  2AAT A;  1BS0 A;  4W8I A;  5EAA A;  5FT5 A;  2E7J A;  3LVL B;  3ELP A;  1AX4 A;  3FZ7 A;  1SF2 A;  1Z3Z A;  3GZD C;  2EZ1 A;  3A9Z A;  3VK4 A;  1WYV B;  1DKA A;  2D65 A;  2VGS A;  1MDO A;  1ART A;  3FSL A;  3KGX A;  2NMP A;  4EB7 A;  3ZRP A;  2W7H A;  1BJO A;  2GMS A;  4R5Z A;  1N2T A;  1AAW A;  2HP1 A;  2PO3 A;  2CST A;  3NUI A;  1ASG A;  5BJ4 A;  3CBF A;  2AY8 A;  2JIS A;  4RIZ A;  1BT4 A;  5LHA A;  2XH1 A;  3A9X A;  3AV7 A;  1YNU A;  3WCN A;  1JS3 A;  4RJY A;  4R5F A;  3MAF B;  3I16 A;  3HLM A;  3F6T A;  4KYO A;  1GBN A;  2DR1 A;  2OQX A;  2RFV A;  4GRX A;  4KAM A;  1D7R A;  1C7O A;  3II0 A;  2X8U A;  2BKW A;  2VGU A;  3FQA A;  2JJG A;  2YHK A;  1DJE A;  1SFF A;  2Z61 A;  1ECX A;  1WYV A;  1X2A A;  2XBN A;  3OP7 A;  2FM1 A;  3LG0 A;  3GET A;  2VMU A;  4AZJ A;  4JE5 A;  4BA4 A;  1LW5 A;  4DQ6 A;  2VGZ A;  3KKI A;  2VMS A;  4MKK A;  2YCT A;  1V2E A;  1W7M A;  5M4B A;  2CFB A;  1AY5 A;  2W7M A;  2VMY A;  3MAU A;  1PMM A;  3NYT A;  1LC7 A;  4K2M A;  2BWO A;  1W23 A;  3HQT A;  4ZAH A;  3IHJ A;  1RV4 A;  4EMY A;  3F0H A;  3E6G A;  1UU0 A;  4B9B A;  2DOU A;  2AEU A;  2R5E A;  2VMQ A;  2W7F A;  4N0B A;  2X3L A;  1MDZ A;  3ASB A;  1KL2 A;  3FRK A;  2W7I A;  1ASL A;  2YCP A;  3JTX A;  1OHY A;  4TV7 A;  2VMT A;  4RKC A;  2VI9 A;  4HF8 A;  2ZY2 A;  5E4Z A;  3RUY A;  2BIG A;  3W1I A;  4MQR A;  2QLR A;  4ADD A;  1X28 A;  2YRR A;  3GWP A;  4J5U A;  2YKY A;  5G4I A;  2FNU A;  4WB0 A;  3MAD A;  3BB8 A;  1EJI A;  3ZZK A;  3MKJ A;  3TFT A;  1YIZ A;  1IX6 A;  2D64 A;  2OAT A;  2BI3 A;  3FFR A;  2W8W A;  4CXQ A;  3B8X A;  1WKH A;  1FG7 A;  4XEW A;  4FL0 A;  4GE7 A;  2VMV A;  4W91 A;  1MAP A;  2GQN A;  1GEX A;  3B1C A;  4PIW A;  3KGW A;  1KKJ A;  4F5J A;  2R5C A;  3LY1 A;  3DR4 A;  3VK2 A;  2CB1 A;  2ZUK A;  3HDO A;  1D7U A;  4WYE A;  3N0L A;  2X5D A;  2VGT A;  1C0N A;  1IAY A;  2E7U A;  4XK1 A;  1GEW A;  1QIT A;  3NDN A;  3W1J A;  4RLG A;  3LV2 A;  2ZYJ A;  2CTZ A;  2VMW A;  2W7J A;  2VMR A;  3UAK A;  1IX7 A;  4ZSW A;  7AAT A;  3P1T A;  2CJH A;  1CQ6 A;  3MC6 C;  1GCK A;  2D66 A;  1DGD A;  1AMS A;  1YIY A;  3FZ8 A;  1OHW A;  1U08 A;  5EUE A;  4EB5 A;  1AJS B;  3DC1 A;  1CQ8 A;  2BIE A;  1ZOB A;  3F9T A;  2ZY3 A;  1TAR A;  4LC3 A;  4RIT A;  2EGY A;  3VOM A;  4Q6R A;  3K28 A;  1M32 A;  3UE8 A;  4JEX A;  4JEW A;  1V72 A;  2W7L A;  4CXR A;  1ASC A;  1XEY A;  3QI6 A;  1WYU B;  2C44 A;  2W7D A;  2C0R A;  2HZP A;  1VP4 A;  5DB5 A;  4Q31 A;  2E7I A;  4ADB A;  1GC2 A;  2YCN A;  4EFF A;  3JWA A;  1TAS A;  4Q75 A;  2OGA A;  1S08 A;  3ZRQ A;  8AAT A;  1O61 A;  4IXZ A;  4UHN A;  2AY3 A; 
#chains in the Genus database with same CATH topology
 4F5M A;  1E5E A;  3EIB A;  1KL1 A;  4TN4 A;  3HBX A;  2FNI A;  3FVU A;  4OTL A;  2W8U A;  3ATH A;  2QA3 A;  2VIB A;  4XJM A;  1W7L A;  5D5S A;  3LVM A;  1SZU A;  4N0W A;  3NU8 A;  1AJS A;  4MSO A;  2OKK A;  3WGC A;  1BJ4 A;  2Z20 A;  3A9Y A;  3BN1 A;  3Q8N A;  4JEV A;  4ZDP A;  5HDM A;  1GC0 A;  2QB3 A;  3FZ6 A;  1QIR A;  3WY7 A;  1I43 A;  1I29 A;  1SPA A;  1ASN A;  2C81 A;  2QSR A;  4WYC A;  1ASD A;  3WCO A;  4RM1 A;  1V2D A;  1B9H A;  1SVV A;  1TOE A;  4ZM3 A;  2D7Y A;  2O0R A;  1JS6 A;  2HOR A;  1EQB A;  4BMK A;  1T3I A;  2Z9V A;  1AKA A;  3JU7 A;  4F5I A;  1CL2 A;  2CY8 A;  1BQD A;  5G2P A;  3RBL A;  4E3R A;  1IBJ A;  1AHY A;  3WGB A;  1OXO A;  1M7Y A;  4HVK A;  3VK3 A;  2VLH A;  4KXK A;  1RVY A;  2BI2 A;  3TQX A;  4ZSY A;  5G09 A;  4OYT A;  3FD0 A;  3JZL A;  3DXW A;  4OBU A;  1C7G A;  1YJZ A;  2G6W A;  1AMA A;  1LC5 A;  1YAA A;  2O7C A;  2VGV A;  3NRA A;  4GE4 A;  3LVJ A;  1B5P A;  3JW9 A;  1PG8 A;  1WKG A;  2GMU A;  5FT4 A;  1D2F A;  1H1C A;  1X29 A;  2VLF A;  3EI7 A;  3QHX A;  1KMK A;  1C9C A;  1Z7D A;  2OGE A;  1GD9 A;  3BCX A;  1TOJ A;  4ATP A;  3AEN B;  3G0T A;  2YOB A;  3B1E A;  3NYU A;  1ASF A;  4Q76 A;  4XQ2 A;  3AEM A;  3NU7 A;  3CQ5 A;  2YKV A;  3AEL A;  3RQ1 A;  1ARI A;  4WBT A;  1M0P A;  3WLX A;  5M49 A;  4I8A A;  1OHV A;  2V0Y A;  4UQV A;  2JJH A;  4WP0 A;  1CL1 A;  2W8V A;  1AIC A;  1X0M A;  3PA9 A;  1EG5 A;  1C7N A;  3NX3 A;  3MAF A;  4F5L A;  2A1V A;  4M2M A;  2D5Y A;  4RKD A;  3FVS A;  5TF5 A;  2WB6 A;  1AKB A;  3MBB A;  3TCM A;  5EQC A;  1AY4 A;  1QJ5 A;  4B98 A;  1AMR A;  1AHG A;  2DKJ A;  3BWN A;  4WXF A;  1G7W A;  2ORD A;  4CBR A;  4E3Q A;  1ASB A;  3N4R A;  2VMO A;  3GSB A;  3WZF A;  4ZWV A;  1IX8 A;  1DGE A;  1MLY A;  4OCA A;  1DTY A;  3FDB A;  5EUN A;  4A6U A;  4WXG A;  4F5H A;  1GC4 A;  1W3U A;  1SZK A;  2O1B A;  1ZC9 A;  3QN6 A;  2YRI A;  4MY5 A;  4GDY A;  1TOI A;  4PVF A;  2DKB A;  2R0T A;  4ZAS A;  5FT8 A;  3ELE A;  3RI6 A;  5DX5 A;  3AEJ A;  3H7F A;  4ITG A;  4A0H A;  2PB0 A;  2YKX A;  3PIU A;  4J8L A;  1WYT B;  2CIN A;  4NOG A;  3BS8 A;  3EI9 A;  2CJD A;  3OKS A;  2WK7 A;  5FT6 A;  1WST A;  3NYS A;  4UHM A;  4XJL A;  1OXP A;  1IVR A;  2ZJG A;  3E77 A;  4H51 A;  2TPL A;  4XAU A;  1O62 A;  2W7G A;  4EU1 A;  2AY4 A;  1MGV A;  3QM2 A;  3HVY A;  1SZS A;  2VMP A;  4XJP A;  3QPG A;  1O4S A;  2ZSM A;  2Z1Z A;  4F5G A;  3DU4 A;  4WYF A;  1YOO A;  3EI5 A;  5KTB A;  1B9I A;  2CJG A;  2BYJ A;  2QB2 A;  1IJI A;  3CQ6 A;  4LNM A;  4CVQ A;  1PFF A;  1C4K A;  1UU1 A;  1S06 A;  4WXB A;  4Y0H A;  1TAT A;  3PDX A;  4MQQ A;  1ARS A;  1AKC A;  1D7S A;  1UU2 A;  3GZC A;  4M2J A;  2ZP7 A;  1M4N A;  4MKJ A;  4U2H A;  4Y0I A;  3G8M A;  1BQA A;  4DGT A;  1AIA A;  4JEY A;  4K2I A;  1GDE A;  1Y4I A;  1CS1 A;  2HOX A;  2W8T A;  3I4J A;  4GEB A;  4K2B A;  4OMA A;  2Q7W A;  3RCH B;  2FYF A;  5F8V A;  3BC8 A;  2JGT A;  3BV0 A;  2WK9 A;  3VAX A;  2ZY4 A;  3DOD A;  2Z9U A;  2Z67 A;  1CZC A;  4P3M A;  4F5K A;  1AMQ A;  2BI5 A;  1ARH A;  3L44 A;  4RJ0 A;  3WX9 A;  4Y0D A;  4A6R A;  5K8B A;  4W1V A;  3PD6 B;  1B4X A;  3FCR A;  4OC9 A;  1AJR A;  2BIA A;  1LS3 A;  4GSA A;  1ELQ A;  1KKP A;  5F9S A;  3LVK A;  1ORD A;  1ASE A;  1AAM A;  2WKA A;  3FFH A;  2JJF A;  2W8J A;  1VJO A;  2BYL A;  2PB2 A;  1MAQ A;  3PDB B;  3R9A A;  4ADE A;  2CH2 A;  5J8Q A;  5D95 A;  3ASA A;  4ZLV A;  4F4E A;  5G2Q A;  5HXX A;  5M46 A;  1LW4 A;  2VGW A;  3COG A;  3H14 A;  3QBO A;  4JEZ A;  3FQ7 A;  3LWS A;  4IW7 A;  4OT8 A;  2HUI A;  5BJ3 A;  1DFO A;  2AY6 A;  3CQ4 A;  1S0A A;  3RCH A;  5LH9 A;  2BWP A;  5G0A A;  1FG3 A;  1ELU A;  5E5I A;  3EI6 A;  2ZY5 A;  2D61 A;  3GR9 A;  1WYU A;  9AAT A;  3QGU A;  3PD6 A;  4LNL A;  4W1W A;  2D63 A;  5EIG B;  2OKJ A;  1S09 A;  2VIA A;  4E1O A;  3TAT A;  3K7Y A;  4MQP A;  2AEV A;  3NUB A;  4WLJ A;  3ZRR A;  3D6K A;  1AY8 A;  2V1P A;  3B1D A;  3PDB A;  4IXO A;  4WLH A;  4CBS A;  3AEM C;  3HL2 A;  1DJ9 A;  3L8A A;  1CZE A;  3A8U X;  2ZSL A;  3BWO A;  1I48 A;  4WD2 A;  1TPL A;  4LW4 A;  3RBF A;  1LKC A;  2BI1 A;  2GB3 A;  1AHE A;  1QGN A;  5EFS A;  1J04 A;  2VI8 A;  5E3K A;  1AHX A;  5EAV A;  2Z9W A;  3BWN C;  2FQ6 A;  1I41 A;  3CAI A;  4ZWM A;  3GZD A;  4A6T A;  3IF2 A;  1M0N A;  2AY1 A;  2VMZ A;  5I92 A;  1VEF A;  1MDX A;  5EIG A;  2HOY A;  3KE3 A;  3G7Q A;  1AHF A;  2CH1 A;  4RAE A;  1ASM A;  3DZZ A;  3T32 A;  3AEO A;  2VMX A;  2E54 A;  3AEJ C;  3JWB A;  2HOZ A;  3B46 A;  4LNJ A;  4M2K A;  4BHD A;  4BQ0 A;  1IAX A;  1CJ0 A;  3DYD A;  4WYG A;  4JE5 D;  1LK9 A;  2EPJ A;  4ISY A;  3AOV A;  2BHX A;  1BJN A;  3FTB A;  4AO9 A;  3GBX A;  4WB0 B;  1AIB A;  4BA5 A;  4W5K A;  3N75 A;  1W7N A;  2W7E A;  4PFN A;  3PPL A;  3GJU A;  4WYD A;  4AH3 A;  3P6K A;  3PAA A;  5IWQ A;  4IY7 A;  1TOG A;  3E2F A;  3AOW A;  1RV3 A;  3ISL A;  5AX8 A;  2AY7 A;  1TOK A;  3AEN A;  4DBC A;  1MLZ A;  4W1X A;  1O69 A;  5HHY A;  4ADC A;  1IUG A;  1QJ3 A;  2W7K A;  1D7V A;  1RVU A;  1PMO A;  4AZK A;  3A2B A;  5M4D A;  2R5C B;  3FQ8 A;  3ACZ A;  5JAY A;  2VYC A;  1H0C A;  2Z9X A;  4XJO A;  3HMU A;  4IYO B;  2HUU A;  3FVX A;  3W1H A;  3PJ0 A;  1DJU A;  1KMJ A;  3NTJ A;  4QGR A;  2BWN A;  3ZZJ A;  2Z1Y A;  3EZS A;  4JF1 A;  2HP2 A;  3AAT A;  2CAN A;  1BW0 A;  4IX8 A;  2QBT A;  4MGR A;  4F5F A;  1E5F A;  3EUC A;  5EUD A;  2AY9 A;  4A0R A;  1YJY A;  4ZM4 A;  2HUF A;  3UWC A;  4LW2 A;  3E2Z B;  2AY2 A;  3ECD A;  3WKR A;  2JG2 A;  4JF0 A;  4UHO A;  5DJ1 A;  1ASA A;  3AEP A;  5G4J A;  1WYT A;  1B8G A;  1J32 A;  2VMN A;  1JG8 A;  4P7Y A;  4ATQ A;  3TFU A;  1V2F A;  3N5M A;  1S07 A;  1P3W A;  3DXV A;  2EH6 A;  3DR7 A;  4A0F A;  2EZ2 A;  1M0O A;  1ZOD A;  3EIA A;  1JF9 A;  1LC8 A;  4IYO A;  4GE9 A;  2R2N A;  1BKG A;  2DGK A;  3USF A;  1QZ9 A;  3EZ1 A;  3N4X A;  1M6S A;  2DGM A;  3E2Y A;  4R2N A;  4H63 Q;  3E9K A;  3I5T A;  1N8P A;  3R4T A;  2C7T A;  3NNK A;  1GEY A;  2F8J A;  3VP6 A;  2JJE A;  2FN6 A;  1G4V A;  1G4X A;  4IXS A;  4PFF A;  2WK8 A;  3HT4 A;  3E2Z A;  3FDD A;  2D7Z A;  1B5O A;  1FC4 A;  4ITX A;  4R8D A;  4L0O A;  4ZDL A;  2BI9 A;  1QIS A;  1CQ7 A;  4A72 A;  4AO4 A;  3N7N A;  2YKU A;  3K40 A;  4TMR A;  5C6U A;  4AOA A;  3PGY A;  4ZDO A;  2X5F A;  1BJO B;  1M0Q A;  3M5U A;  1UKJ A;  4O6Z A;  3DRD A;  1OAT A;  4UOY A;  2DGL A;  3FKD A;  5DJ9 A;  1BJW A;  4E77 A;  3BCA A;  1XI9 A;  1G7X A;  4U1T A;  2ZC0 A;  4WYA A;  3MC6 A;  4A00 A;  3MEB A;  1GC3 A;  4FFC A;  3WKS A;  2GSA A;  2KFP A;  2AY5 A;  1YJS A;  2QMA A;  4A0G A;  3EI8 A;  1N31 A;  4OBV A;  4K05 A;  2EO5 A;  1ARG A;  3BCB A;  2AAT A;  1BS0 A;  4W8I A;  5EAA A;  5FT5 A;  2E7J A;  3LVL B;  3ELP A;  1AX4 A;  3FZ7 A;  1SF2 A;  1Z3Z A;  3GZD C;  2EZ1 A;  3A9Z A;  3VK4 A;  1WYV B;  1DKA A;  2D65 A;  2VGS A;  1MDO A;  1ART A;  3FSL A;  3KGX A;  2NMP A;  4EB7 A;  3ZRP A;  2W7H A;  1BJO A;  2GMS A;  4R5Z A;  1N2T A;  1AAW A;  2HP1 A;  2PO3 A;  2CST A;  3NUI A;  1ASG A;  2EYQ A;  5BJ4 A;  3CBF A;  2AY8 A;  2JIS A;  4RIZ A;  1BT4 A;  5LHA A;  2XH1 A;  3A9X A;  3AV7 A;  1YNU A;  3WCN A;  1JS3 A;  4RJY A;  4R5F A;  3MAF B;  3I16 A;  3HLM A;  3F6T A;  4KYO A;  1GBN A;  2DR1 A;  2OQX A;  3H9X A;  2RFV A;  4GRX A;  4KAM A;  1D7R A;  1C7O A;  3II0 A;  2X8U A;  2BKW A;  2VGU A;  3FQA A;  2JJG A;  2YHK A;  1DJE A;  1SFF A;  2Z61 A;  1ECX A;  1WYV A;  1X2A A;  2XBN A;  3OP7 A;  2FM1 A;  3LG0 A;  3GET A;  2VMU A;  4AZJ A;  4JE5 A;  4BA4 A;  2G7J A;  1LW5 A;  4DQ6 A;  2VGZ A;  3KKI A;  2VMS A;  4MKK A;  2YCT A;  1V2E A;  1W7M A;  5M4B A;  2CFB A;  1AY5 A;  2W7M A;  2VMY A;  3MAU A;  1PMM A;  3NYT A;  1LC7 A;  4K2M A;  2BWO A;  1W23 A;  3HQT A;  4ZAH A;  3IHJ A;  1RV4 A;  4EMY A;  2FKI A;  3F0H A;  3E6G A;  1UU0 A;  4B9B A;  2DOU A;  2AEU A;  2R5E A;  2VMQ A;  2W7F A;  4N0B A;  2X3L A;  1MDZ A;  3ASB A;  1KL2 A;  3FRK A;  2W7I A;  1ASL A;  2YCP A;  3JTX A;  1OHY A;  4TV7 A;  2VMT A;  4RKC A;  3N4S A;  2VI9 A;  4HF8 A;  2ZY2 A;  5E4Z A;  3RUY A;  2BIG A;  3W1I A;  4MQR A;  2QLR A;  4ADD A;  1X28 A;  2YRR A;  3GWP A;  4J5U A;  2YKY A;  5G4I A;  2FNU A;  4WB0 A;  3MAD A;  3BB8 A;  1EJI A;  3ZZK A;  3MKJ A;  3TFT A;  1YIZ A;  1IX6 A;  2D64 A;  2OAT A;  2BI3 A;  3FFR A;  2W8W A;  4CXQ A;  3B8X A;  1WKH A;  1FG7 A;  4XEW A;  4FL0 A;  4GE7 A;  2VMV A;  4W91 A;  1MAP A;  2GQN A;  1GEX A;  3B1C A;  4PIW A;  3KGW A;  1KKJ A;  4F5J A;  2R5C A;  3LY1 A;  3DR4 A;  3VK2 A;  2CB1 A;  2ZUK A;  3HDO A;  1D7U A;  4WYE A;  3N0L A;  2X5D A;  2VGT A;  1C0N A;  1IAY A;  2E7U A;  4XK1 A;  1GEW A;  1QIT A;  3NDN A;  3W1J A;  4RLG A;  3LV2 A;  2ZYJ A;  2CTZ A;  2VMW A;  2W7J A;  2VMR A;  3UAK A;  1IX7 A;  4ZSW A;  7AAT A;  3P1T A;  2CJH A;  1CQ6 A;  3MC6 C;  1GCK A;  2D66 A;  1DGD A;  1AMS A;  1YIY A;  3FZ8 A;  1OHW A;  1U08 A;  5EUE A;  4EB5 A;  1AJS B;  3DC1 A;  1CQ8 A;  2BIE A;  1ZOB A;  3F9T A;  2ZY3 A;  1TAR A;  4LC3 A;  4RIT A;  2EGY A;  3VOM A;  4Q6R A;  3K28 A;  1M32 A;  3UE8 A;  1KAF A;  4JEX A;  4JEW A;  1V72 A;  2W7L A;  4CXR A;  1ASC A;  1XEY A;  3QI6 A;  1WYU B;  2C44 A;  2W7D A;  2C0R A;  2HZP A;  1VP4 A;  5DB5 A;  4Q31 A;  2E7I A;  4ADB A;  1GC2 A;  2YCN A;  4EFF A;  3JWA A;  1TAS A;  4Q75 A;  2OGA A;  1S08 A;  3ZRQ A;  8AAT A;  1O61 A;  4IXZ A;  4UHN A;  2AY3 A; 
#chains in the Genus database with same CATH homology
 4F5M A;  1E5E A;  3EIB A;  1KL1 A;  4TN4 A;  3HBX A;  2FNI A;  3FVU A;  4OTL A;  2W8U A;  3ATH A;  2QA3 A;  2VIB A;  4XJM A;  1W7L A;  5D5S A;  3LVM A;  1SZU A;  4N0W A;  3NU8 A;  1AJS A;  4MSO A;  2OKK A;  3WGC A;  1BJ4 A;  2Z20 A;  3A9Y A;  3BN1 A;  3Q8N A;  4JEV A;  4ZDP A;  5HDM A;  1GC0 A;  2QB3 A;  3FZ6 A;  1QIR A;  3WY7 A;  1I43 A;  1I29 A;  1SPA A;  1ASN A;  2C81 A;  2QSR A;  4WYC A;  1ASD A;  3WCO A;  4RM1 A;  1V2D A;  1B9H A;  1SVV A;  1TOE A;  4ZM3 A;  2D7Y A;  2O0R A;  1JS6 A;  2HOR A;  1EQB A;  4BMK A;  1T3I A;  2Z9V A;  1AKA A;  3JU7 A;  4F5I A;  1CL2 A;  2CY8 A;  1BQD A;  5G2P A;  3RBL A;  4E3R A;  1IBJ A;  1AHY A;  3WGB A;  1OXO A;  1M7Y A;  4HVK A;  3VK3 A;  2VLH A;  4KXK A;  1RVY A;  2BI2 A;  3TQX A;  4ZSY A;  5G09 A;  4OYT A;  3FD0 A;  3JZL A;  3DXW A;  4OBU A;  1C7G A;  1YJZ A;  2G6W A;  1AMA A;  1LC5 A;  1YAA A;  2O7C A;  2VGV A;  3NRA A;  4GE4 A;  3LVJ A;  1B5P A;  3JW9 A;  1PG8 A;  1WKG A;  2GMU A;  5FT4 A;  1D2F A;  1H1C A;  1X29 A;  2VLF A;  3EI7 A;  3QHX A;  1KMK A;  1C9C A;  1Z7D A;  2OGE A;  1GD9 A;  3BCX A;  1TOJ A;  4ATP A;  3AEN B;  3G0T A;  2YOB A;  3B1E A;  3NYU A;  1ASF A;  4Q76 A;  4XQ2 A;  3AEM A;  3NU7 A;  3CQ5 A;  2YKV A;  3AEL A;  3RQ1 A;  1ARI A;  4WBT A;  1M0P A;  3WLX A;  5M49 A;  4I8A A;  1OHV A;  2V0Y A;  4UQV A;  2JJH A;  4WP0 A;  1CL1 A;  2W8V A;  1AIC A;  1X0M A;  3PA9 A;  1EG5 A;  1C7N A;  3NX3 A;  3MAF A;  4F5L A;  2A1V A;  4M2M A;  2D5Y A;  4RKD A;  3FVS A;  5TF5 A;  2WB6 A;  1AKB A;  3MBB A;  3TCM A;  5EQC A;  1AY4 A;  1QJ5 A;  4B98 A;  1AMR A;  1AHG A;  2DKJ A;  3BWN A;  4WXF A;  1G7W A;  2ORD A;  4CBR A;  4E3Q A;  1ASB A;  3N4R A;  2VMO A;  3GSB A;  3WZF A;  4ZWV A;  1IX8 A;  1DGE A;  1MLY A;  4OCA A;  1DTY A;  3FDB A;  5EUN A;  4A6U A;  4WXG A;  4F5H A;  1GC4 A;  1W3U A;  1SZK A;  2O1B A;  1ZC9 A;  3QN6 A;  2YRI A;  4MY5 A;  4GDY A;  1TOI A;  4PVF A;  2DKB A;  2R0T A;  4ZAS A;  5FT8 A;  3ELE A;  3RI6 A;  5DX5 A;  3AEJ A;  3H7F A;  4ITG A;  4A0H A;  2PB0 A;  2YKX A;  3PIU A;  4J8L A;  1WYT B;  2CIN A;  4NOG A;  3BS8 A;  3EI9 A;  2CJD A;  3OKS A;  2WK7 A;  5FT6 A;  1WST A;  3NYS A;  4UHM A;  4XJL A;  1OXP A;  1IVR A;  2ZJG A;  3E77 A;  4H51 A;  2TPL A;  4XAU A;  1O62 A;  2W7G A;  4EU1 A;  2AY4 A;  1MGV A;  3QM2 A;  3HVY A;  1SZS A;  2VMP A;  4XJP A;  3QPG A;  1O4S A;  2ZSM A;  2Z1Z A;  4F5G A;  3DU4 A;  4WYF A;  1YOO A;  3EI5 A;  5KTB A;  1B9I A;  2CJG A;  2BYJ A;  2QB2 A;  1IJI A;  3CQ6 A;  4LNM A;  4CVQ A;  1PFF A;  1C4K A;  1UU1 A;  1S06 A;  4WXB A;  4Y0H A;  1TAT A;  3PDX A;  4MQQ A;  1ARS A;  1AKC A;  1D7S A;  1UU2 A;  3GZC A;  4M2J A;  2ZP7 A;  1M4N A;  4MKJ A;  4U2H A;  4Y0I A;  3G8M A;  1BQA A;  4DGT A;  1AIA A;  4JEY A;  4K2I A;  1GDE A;  1Y4I A;  1CS1 A;  2HOX A;  2W8T A;  3I4J A;  4GEB A;  4K2B A;  4OMA A;  2Q7W A;  3RCH B;  2FYF A;  5F8V A;  3BC8 A;  2JGT A;  3BV0 A;  2WK9 A;  3VAX A;  2ZY4 A;  3DOD A;  2Z9U A;  2Z67 A;  1CZC A;  4P3M A;  4F5K A;  1AMQ A;  2BI5 A;  1ARH A;  3L44 A;  4RJ0 A;  3WX9 A;  4Y0D A;  4A6R A;  5K8B A;  4W1V A;  3PD6 B;  1B4X A;  3FCR A;  4OC9 A;  1AJR A;  2BIA A;  1LS3 A;  4GSA A;  1ELQ A;  1KKP A;  5F9S A;  3LVK A;  1ORD A;  1ASE A;  1AAM A;  2WKA A;  3FFH A;  2JJF A;  2W8J A;  1VJO A;  2BYL A;  2PB2 A;  1MAQ A;  3PDB B;  3R9A A;  4ADE A;  2CH2 A;  5J8Q A;  5D95 A;  3ASA A;  4ZLV A;  4F4E A;  5G2Q A;  5HXX A;  5M46 A;  1LW4 A;  2VGW A;  3COG A;  3H14 A;  3QBO A;  4JEZ A;  3FQ7 A;  3LWS A;  4IW7 A;  4OT8 A;  2HUI A;  5BJ3 A;  1DFO A;  2AY6 A;  3CQ4 A;  1S0A A;  3RCH A;  5LH9 A;  2BWP A;  5G0A A;  1FG3 A;  1ELU A;  5E5I A;  3EI6 A;  2ZY5 A;  2D61 A;  3GR9 A;  1WYU A;  9AAT A;  3QGU A;  3PD6 A;  4LNL A;  4W1W A;  2D63 A;  5EIG B;  2OKJ A;  1S09 A;  2VIA A;  4E1O A;  3TAT A;  3K7Y A;  4MQP A;  2AEV A;  3NUB A;  4WLJ A;  3ZRR A;  3D6K A;  1AY8 A;  2V1P A;  3B1D A;  3PDB A;  4IXO A;  4WLH A;  4CBS A;  3AEM C;  3HL2 A;  1DJ9 A;  3L8A A;  1CZE A;  3A8U X;  2ZSL A;  3BWO A;  1I48 A;  4WD2 A;  1TPL A;  4LW4 A;  3RBF A;  1LKC A;  2BI1 A;  2GB3 A;  1AHE A;  1QGN A;  5EFS A;  1J04 A;  2VI8 A;  5E3K A;  1AHX A;  5EAV A;  2Z9W A;  3BWN C;  2FQ6 A;  1I41 A;  3CAI A;  4ZWM A;  3GZD A;  4A6T A;  3IF2 A;  1M0N A;  2AY1 A;  2VMZ A;  5I92 A;  1VEF A;  1MDX A;  5EIG A;  2HOY A;  3KE3 A;  3G7Q A;  1AHF A;  2CH1 A;  4RAE A;  1ASM A;  3DZZ A;  3T32 A;  3AEO A;  2VMX A;  2E54 A;  3AEJ C;  3JWB A;  2HOZ A;  3B46 A;  4LNJ A;  4M2K A;  4BHD A;  4BQ0 A;  1IAX A;  1CJ0 A;  3DYD A;  4WYG A;  4JE5 D;  1LK9 A;  2EPJ A;  4ISY A;  3AOV A;  2BHX A;  1BJN A;  3FTB A;  4AO9 A;  3GBX A;  4WB0 B;  1AIB A;  4BA5 A;  4W5K A;  3N75 A;  1W7N A;  2W7E A;  4PFN A;  3PPL A;  3GJU A;  4WYD A;  4AH3 A;  3P6K A;  3PAA A;  5IWQ A;  4IY7 A;  1TOG A;  3E2F A;  3AOW A;  1RV3 A;  3ISL A;  5AX8 A;  2AY7 A;  1TOK A;  3AEN A;  4DBC A;  1MLZ A;  4W1X A;  1O69 A;  5HHY A;  4ADC A;  1IUG A;  1QJ3 A;  2W7K A;  1D7V A;  1RVU A;  1PMO A;  4AZK A;  3A2B A;  5M4D A;  2R5C B;  3FQ8 A;  3ACZ A;  5JAY A;  2VYC A;  1H0C A;  2Z9X A;  4XJO A;  3HMU A;  4IYO B;  2HUU A;  3FVX A;  3W1H A;  3PJ0 A;  1DJU A;  1KMJ A;  3NTJ A;  4QGR A;  2BWN A;  3ZZJ A;  2Z1Y A;  3EZS A;  4JF1 A;  2HP2 A;  3AAT A;  2CAN A;  1BW0 A;  4IX8 A;  2QBT A;  4MGR A;  4F5F A;  1E5F A;  3EUC A;  5EUD A;  2AY9 A;  4A0R A;  1YJY A;  4ZM4 A;  2HUF A;  3UWC A;  4LW2 A;  3E2Z B;  2AY2 A;  3ECD A;  3WKR A;  2JG2 A;  4JF0 A;  4UHO A;  5DJ1 A;  1ASA A;  3AEP A;  5G4J A;  1WYT A;  1B8G A;  1J32 A;  2VMN A;  1JG8 A;  4P7Y A;  4ATQ A;  3TFU A;  1V2F A;  3N5M A;  1S07 A;  1P3W A;  3DXV A;  2EH6 A;  3DR7 A;  4A0F A;  2EZ2 A;  1M0O A;  1ZOD A;  3EIA A;  1JF9 A;  1LC8 A;  4IYO A;  4GE9 A;  2R2N A;  1BKG A;  2DGK A;  3USF A;  1QZ9 A;  3EZ1 A;  3N4X A;  1M6S A;  2DGM A;  3E2Y A;  4R2N A;  4H63 Q;  3E9K A;  3I5T A;  1N8P A;  3R4T A;  2C7T A;  3NNK A;  1GEY A;  2F8J A;  3VP6 A;  2JJE A;  2FN6 A;  1G4V A;  1G4X A;  4IXS A;  4PFF A;  2WK8 A;  3HT4 A;  3E2Z A;  3FDD A;  2D7Z A;  1B5O A;  1FC4 A;  4ITX A;  4R8D A;  4L0O A;  4ZDL A;  2BI9 A;  1QIS A;  1CQ7 A;  4A72 A;  4AO4 A;  3N7N A;  2YKU A;  3K40 A;  4TMR A;  5C6U A;  4AOA A;  3PGY A;  4ZDO A;  2X5F A;  1BJO B;  1M0Q A;  3M5U A;  1UKJ A;  4O6Z A;  3DRD A;  1OAT A;  4UOY A;  2DGL A;  3FKD A;  5DJ9 A;  1BJW A;  4E77 A;  3BCA A;  1XI9 A;  1G7X A;  4U1T A;  2ZC0 A;  4WYA A;  3MC6 A;  4A00 A;  3MEB A;  1GC3 A;  4FFC A;  3WKS A;  2GSA A;  2KFP A;  2AY5 A;  1YJS A;  2QMA A;  4A0G A;  3EI8 A;  1N31 A;  4OBV A;  4K05 A;  2EO5 A;  1ARG A;  3BCB A;  2AAT A;  1BS0 A;  4W8I A;  5EAA A;  5FT5 A;  2E7J A;  3LVL B;  3ELP A;  1AX4 A;  3FZ7 A;  1SF2 A;  1Z3Z A;  3GZD C;  2EZ1 A;  3A9Z A;  3VK4 A;  1WYV B;  1DKA A;  2D65 A;  2VGS A;  1MDO A;  1ART A;  3FSL A;  3KGX A;  2NMP A;  4EB7 A;  3ZRP A;  2W7H A;  1BJO A;  2GMS A;  4R5Z A;  1N2T A;  1AAW A;  2HP1 A;  2PO3 A;  2CST A;  3NUI A;  1ASG A;  2EYQ A;  5BJ4 A;  3CBF A;  2AY8 A;  2JIS A;  4RIZ A;  1BT4 A;  5LHA A;  2XH1 A;  3A9X A;  3AV7 A;  1YNU A;  3WCN A;  1JS3 A;  4RJY A;  4R5F A;  3MAF B;  3I16 A;  3HLM A;  3F6T A;  4KYO A;  1GBN A;  2DR1 A;  2OQX A;  3H9X A;  2RFV A;  4GRX A;  4KAM A;  1D7R A;  1C7O A;  3II0 A;  2X8U A;  2BKW A;  2VGU A;  3FQA A;  2JJG A;  2YHK A;  1DJE A;  1SFF A;  2Z61 A;  1ECX A;  1WYV A;  1X2A A;  2XBN A;  3OP7 A;  2FM1 A;  3LG0 A;  3GET A;  2VMU A;  4AZJ A;  4JE5 A;  4BA4 A;  2G7J A;  1LW5 A;  4DQ6 A;  2VGZ A;  3KKI A;  2VMS A;  4MKK A;  2YCT A;  1V2E A;  1W7M A;  5M4B A;  2CFB A;  1AY5 A;  2W7M A;  2VMY A;  3MAU A;  1PMM A;  3NYT A;  1LC7 A;  4K2M A;  2BWO A;  1W23 A;  3HQT A;  4ZAH A;  3IHJ A;  1RV4 A;  4EMY A;  2FKI A;  3F0H A;  3E6G A;  1UU0 A;  4B9B A;  2DOU A;  2AEU A;  2R5E A;  2VMQ A;  2W7F A;  4N0B A;  2X3L A;  1MDZ A;  3ASB A;  1KL2 A;  3FRK A;  2W7I A;  1ASL A;  2YCP A;  3JTX A;  1OHY A;  4TV7 A;  2VMT A;  4RKC A;  3N4S A;  2VI9 A;  4HF8 A;  2ZY2 A;  5E4Z A;  3RUY A;  2BIG A;  3W1I A;  4MQR A;  2QLR A;  4ADD A;  1X28 A;  2YRR A;  3GWP A;  4J5U A;  2YKY A;  5G4I A;  2FNU A;  4WB0 A;  3MAD A;  3BB8 A;  1EJI A;  3ZZK A;  3MKJ A;  3TFT A;  1YIZ A;  1IX6 A;  2D64 A;  2OAT A;  2BI3 A;  3FFR A;  2W8W A;  4CXQ A;  3B8X A;  1WKH A;  1FG7 A;  4XEW A;  4FL0 A;  4GE7 A;  2VMV A;  4W91 A;  1MAP A;  2GQN A;  1GEX A;  3B1C A;  4PIW A;  3KGW A;  1KKJ A;  4F5J A;  2R5C A;  3LY1 A;  3DR4 A;  3VK2 A;  2CB1 A;  2ZUK A;  3HDO A;  1D7U A;  4WYE A;  3N0L A;  2X5D A;  2VGT A;  1C0N A;  1IAY A;  2E7U A;  4XK1 A;  1GEW A;  1QIT A;  3NDN A;  3W1J A;  4RLG A;  3LV2 A;  2ZYJ A;  2CTZ A;  2VMW A;  2W7J A;  2VMR A;  3UAK A;  1IX7 A;  4ZSW A;  7AAT A;  3P1T A;  2CJH A;  1CQ6 A;  3MC6 C;  1GCK A;  2D66 A;  1DGD A;  1AMS A;  1YIY A;  3FZ8 A;  1OHW A;  1U08 A;  5EUE A;  4EB5 A;  1AJS B;  3DC1 A;  1CQ8 A;  2BIE A;  1ZOB A;  3F9T A;  2ZY3 A;  1TAR A;  4LC3 A;  4RIT A;  2EGY A;  3VOM A;  4Q6R A;  3K28 A;  1M32 A;  3UE8 A;  4JEX A;  4JEW A;  1V72 A;  2W7L A;  4CXR A;  1ASC A;  1XEY A;  3QI6 A;  1WYU B;  2C44 A;  2W7D A;  2C0R A;  2HZP A;  1VP4 A;  5DB5 A;  4Q31 A;  2E7I A;  4ADB A;  1GC2 A;  2YCN A;  4EFF A;  3JWA A;  1TAS A;  4Q75 A;  2OGA A;  1S08 A;  3ZRQ A;  8AAT A;  1O61 A;  4IXZ A;  4UHN A;  2AY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...