5TFSH

Structure of chimeric 02-k fab, a vrc01-like germline antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
217
Chain Sequence
b'EVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELRSLRSDDTAVYYCARGWGWYFDLWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 02-K Fab Heavy chain
publication title Differences in Allelic Frequency and CDRH3 Region Limit the Engagement of HIV Env Immunogens by Putative VRC01 Neutralizing Antibody Precursors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2016-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tfsH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tfsH01
1MIEL 4ZUTA 4R4NC 3S98A 4NQDE 3DX8A 2FX8L 2Q7NA 5IMMB 2H45A 4HWBA 1NL0L 3QEQD 1FRGH 4TUOB 5EU6B 4HCRH 1J0JA 5D7LD 3G6AB 3MA9L 3Q5TA 5FDWB 2R69L 1RUKH 5KSBF 2DQDH 1ZTXH 4G7YH 5F96L 1F8TL 4PJ7A 4R2GC 3A6CL 2V9TA 1KN2H 3WSQL 3LEXB 3E8UH 3WFEL 3QWOA 3UX9B 3HC3L 4ENED 4G6KH 4W4OC 1DJSA 5FYLE 2VIRA 1EGJA 4G42A 2ITDA 2DM4A 3EJZC 3TO2A 4CKVX 4LAQL 1TVDA 1U41A 3KXFE 3C8KB 4JR9H 5TQ2L 1KB5B 4OF3A 1BZ9A 5EBMB 5IBLC 3SCMC 5LGHH 2BNRA 3PDDA 3KPLA 1DZBA 1UXSA 5D7JD 1NEUA 3H9SA 1K6QH 1RUPL 2BJMH 4CDGC 1BQLH 1Q1JH 4MWFA 4QNPF 4F7MA 3SEPA 5F9DC 4LCUB 3LN4A 3QHZL 1RK1B 4NOBA 4TOYH 3SDDB 3QIBC 3TPKA 2RHEA 3EIFA 3C60B 4LCCC 2JJTC 4ZDHA 3BGMB 5K9KB 1FSKC 3IXAA 3HZKA 3MGTB 1YY9C 4ODHL 3ZL4L 2A83B 2L4OA 4F3FB 3ELAT 3BQUC 3RX8A 3HTLX 1E4XL 1T89C 3RA7H 1JFQH 2OM5A 1KJ2B 4PV9B 1XGQB 4H8WC 5D7KE 1MFAH 5C09A 5A3ID 4F37K 2L0DA 4Y1AB 4HX1B 1NMCC 3SE9H 3C08H 4CGTA 4UIMA 1HH6B 1INEL 4U6HA 3SDAC 4Z0XA 5DC4B 4YFLI 2JCCE 2R8SL 4WO4C 4P2QA 1OOAA 2Q6WA 1FO0B 3RVTC 1BGXL 4JN1L 4AYFA 1IAOA 3MLRH 3VRIB 3V6ZA 2ZG3A 2FB4L 3WXVL 3O2DL 1UACL 5GS0H 3V95A 3UTPD 3JWDH 5LXGL 3QPQD 4ODWB 1JGEA 5F7MC 1EEYB 1FZMB 2PYEE 2BXYA 1YEHL 4HS8H 4XNMB 3SDXA 1QOKA 2BDNH 4OV6F 3VG0H 4UV7L 1MLBB 3BPOB 3GMMA 3UJTL 3O9WD 3RTQA 1OSPH 1KIPB 5MEND 1BMGA 1YEDB 2V5MA 3DXAB 4JO3L 3B5HA 4MA7L 4OZIB 4MX7B 3TIEA 4AMKH 1UKSA 5CZVL 3BE1H 3OAUL 3T2OA 4RFOL 4ODUB 1YN7B 1N3NA 4CJ0A 4Q2ZB 3HI5H 4UILL 4YGVA 3RWGB 2XICA 3MJ7B 3OQ3B 1OLZA 2C3WA 2MQ3A 4RGMB 1D7FA 4LLQA 2VLLA 5DRNA 3TZVB 1A6VL 2C1PB 5C71A 5J11C 3G6JB 3MRPA 3S7GA 5GRVK 3UBXI 4JQXC 3E3QE 1QNZH 1QVOA 3SDCD 4MAUH 4TSBH 3H0TA 4MMZC 3MLUL 5CSBA 3QFJB 1TPXC 1MCNA 3WKML 1F97A 4LVNB 3AMKA 1ES0B 2CDFA 3GKZA 3PWNA 4JFQB 1XEDA 2EE2A 1DBAL 2EXWC 5IBUB 3U0WL 4QHMA 1KLGA 3BT2H 2P1YA 4A6YH 5DD1H 1MAJA 1RZ7L 4X7EC 1CT8B 3PXHA 1NFDF 1ZA6A 2EDTA 3ARGD 1ZV5A 4K9EC 4PP2B 4N8CL 4AZ8A 4C56B 4HUVB 1Q9WA 1L7IH 1CGTA 3NCJL 3SKUD 3T0WA 3LKPB 1UWGH 5ISZB 1CICD 3OL2A 4OJFL 5E6ID 1T1YA 1AGCB 3KYOB 2I26N 1GRWA 3DYMA 4JFDD 4M7KH 5BJTB 2X10A 5DJ6B 4LPUA 3VGGA 3FHAA 1U95B 1QFPA 3EDKA 5A2KH 4IMKC 1VACA 1X4XA 4EIZC 5DJCA 3ZTNL 1S7RA 4QHNA 4U33A 1UM6H 2WBJD 4JANB 3ZTJG 3SGKA 3B2UD 3ROOA 1GIGH 3WHE0 5DRWA 4M9OA 1L9MA 1NGPH 4FN0A 1K4DA 1WZ1H 3AREB 1IEAB 2CLRA 4KRLB 1KCVH 2VAAA 4Z78A 2VTFA 2Q7YB 1S9YA 2EZ0C 4XAWH 1JUFB 4XZUA 2MNUA 1Z2KA 4X6EB 2OP4L 5FM5M 4EI5B 3EDDA 3MRKB 1QFUH 4IHOA 3UYRH 4PJAB 4XVJH 3MTRA 5I8OL 1CD8A 4WV1B 1H15A 4BA8A 4R7DA 3HZMB 2HT3C 3TN0B 1A1NA 1X5GA 1P7KB 4Z76B 2FX7L 3TT3H 3O4OB 5FB8A 3TIDB 1AR1C 3KPSA 5DSCB 3NVQA 2YZ8A 3BKCH 3PJSB 4KQ4L 4EI6B 3F12A 2ADGA 2R0KL 5LGJB 3OX8B 5MEPB 1W0VB 5B3JF 5CJ5A 3ILPB 4PJ9A 2VE6B 1O7VA 3MSPA 1V5JA 5I0ZA 3MUGB 4JDVA 3MLVH 1ORSB 5EA0L 4MD5A 3D85A 3VXSB 1BAFL 1BVKA 4XP9H 4KHXH 5EU6E 2LFGA 4GRLA 4MQ7A 5I75C 3PWVB 1MVUB 1QSZA 5D7SL 4KH2A 4IOFC 1CXIA 3QRFM 3MOBH 3TVMD 3OMZA 3QDGD 4L4VD 1HCFX 1LVEA 4YUEH 1FORH 1A22B 1G7HB 1HQ4B 5HYSA 4NN6C 4KTDH 4AQOA 4PRNA 3I3BA 5BW7C 3QXDA 5FGSA 3C2SA 1FZOB 4HGKC 1XR9B 1K2DB 4PRIB 1ZSDB 5FHAL 1F4XH 3X13B 3O3DA 3LMJL 3U4AA 4OLVH 2CKBB 3KDMA 3T2NH 4LSVL 3NABH 4FQHA 2VQ1A 2I27N 5EN2A 4ODBD 5DUPL 3PGFH 4M1GH 4CU7A 2EE3A 3MLXH 4PGZA 4TUJA 3O45A 1XR8A 4PJ5A 3UPRB 2D0GA 3RQ3A 4UV4L 5E2UL 1CG9A 3MODL 1MWAA 4I4WB 4MJ6A 1I4FA 2YOCA 2ICWI 2BOCA 3PQYB 4LPVA 2YEZB 4HPYH 4I18C 2QSVA 1QD0A 5K9QI 3GBML 2R2EA 1CGVA 4LSUH 4HJGB 1JWSA 1ZHBB 4MVBD 4CDHA 3GMOB 4LSPH 1Y6NR 2R9HD 4GH7B 5A40E 4KV5E 3I6LD 3CU1A 4OI7A 1F2XK 5F1IB 5FO9A 4HQQH 3PF2A 4MQXD 4PTTA 1UWEL 4TULH 4K8RH 3RNKB 1U8HA 1DBMH 1S3KL 2OTUA 5MERB 4YJZL 12E8L 1U8IB 1BBDH 1OGAD 5BV7C 4I48B 1U9KA 3S3PA 3TH3T 4FQIL 1E28B 1ETZA 4Y1AE 3D2UD 2XZQH 4Y2DA 2EYSA 1I1AD 4R6UA 1R3LA 3MRIB 1LO5B 4IRSC 3UTQA 3VFSB 4RGOH 1QRKA 4NN5C 5BO1H 1NUFA 1R5IA 3BVNB 2ICEB 5ICXA 1LNUA 5I1DB 2VZ3A 4KUZH 5IB1A 4D94A 1G6RB 3V4PL 5EOCH 3HCVB 2AJSH 1XH3A 2W9LA 4X7SL 5DGQA 4ACPA 2GSGB 3QFDB 4JN2B 5I1IL 4J4PC 3MR9A 2AQ3A 2V9RA 4UDTA 1NQBA 3ISWA 4YK4C 3WFCH 3D3VB 5E2TL 1QP1A 3LRHA 4MCYA 2QQKH 4FHBD 4J3OC 4EEEA 4NOFA 4RQQB 3DTXA 3MRGA 4DKAA 5FF6B 3T0BA 3QEHB 2F8OA 4J12A 3MNZB 3JWOH 5IM7B 3TA3C 5GS1B 3FTGB 5FKAA 1A6TB 4RIRB 5HYJA 4NJ9L 1AFVL 3IAQA 2XG5A 4W4OA 1CFNA 3T0EB 3K81A 4FQXB 1NCCH 2Y25A 5FA3A 3G5VA 3DXAE 1CK0H 4FTVB 3AS3A 2FHFA 2XTJB 1A5FH 3OAZK 4XNUL 4OZIE 2QADB 3QQ4A 1G9NC 5FCUH 4HXAL 1DBBH 1U92A 2AXJA 2EH7H 3SCMA 1A0QL 2DICA 2ICWJ 1S9KC 3VFGH 2NX5A 3L5XH 2QQNH 3DX7A 5JHLH 3ZHKA 3FN9A 3LS4L 4BKLA 1MCRA 1C5CH 3QR2A 1KIUA 5F3HA 3OAZH 2M26A 4TPRL 3RUGB 5D7IA 5EB9A 1B0WA 1FJ1B 3G6JE 5BXFA 3GBNL 2XT1B 2D4FA 3FMGL 5HYSG 5DUBA 1H3WM 4ZFZA 3GSWB 1TITA 2BOBB 3QIBA 4MHHG 3NPZB 2OR8A 3BP6A 2N4IA 1EHAA 4LCCA 5CLTA 5DD6B 2JJTA 3B6SA 3NACH 3QFJE 5IEKA 2HKHL 2CDEA 4NKIH 2D7PA 2X4NB 1FVDA 1A14H 3LKQA 4QLRA 3QCUL 3BQUA 3FT4B 2VXSL 1T89A 5J7CC 1LO3L 4OFYA 3FFDB 5C0AA 4NQEA 4C56E 3HS0B 4L5FL 1X9QA 5GS3A 3C5ZD 3TCXA 1I8MA 5F21B 4PB0L 4X7DC 2H3NB 3T3PE 5ISZE 3MA7B 5C0RH 2AW2A 3ARDB 1EO8L 3SDAA 1R0AH 2AEPH 4WO4A 4N0FA 3KLSA 4QWWC 1A4KA 4LEOB 3EO0B 2YA1A 1L9NA 4R3SA 3REVA 2Q76B 1EMTH 1RJYB 4XCYA 5BRZA 5ALBH 3NAAH 5SX4I 4ELKB 1U2HA 2V7NB 4X4XB 1YZZA 2W1NA 2X1WL 4OFPA 3O6LH 1ZVHA 5T33L 1FAKT 1WLHA 4ELMA 5HSFA 1Q38A 3LZFL 4HDIA 1RVFH 5L6YL 3GJFK 4G8FB 1YYLL 3WDIA 2VDPL 4PJ7F 3MREA 1V3JA 2BVOB 2YPVL 5JQHC 4PJAE 1OB1B 2AVGA 3GJFH 1JMXA 1I7RA 2PETA 1A1OA 2MPAH 1AKJA 2D9QB 3VRLE 3DVGB 5ADOH 4KFZC 2EEBA 3E3QC 3OWEA 1MI5A 4OKVA 5DJXA 1JTPA 4D0BA 5I1HL 4JDZA 1PDKA 1MH5B 4X5WA 3TO4C 1IEBB 4TNVF 4K9EH 5FXCH 2C4XA 2FHCA 1J1XH 3VFOB 3O0RL 1T6WA 3X14A 4JFFA 1UXWB 2AXHA 5AUMB 3V7AE 3NGBC 5HYEA 4FQJL 3V4VL 4JQXA 4PD4J 1VPOH 2EECA 4AEIH 2P8MB 4POYA 5MHSD 1F4AA 4XBPB 1XGRB 2VABA 4YR6B 4I0PD 2YPLB 3QIWC 1RJZA 2WQRA 1PYWB 3CPLA 2JIXA 4WGVB 3OHXA 3P40A 3FOLA 1S9XB 4KK6D 3VXSE 1HHIA 5GGQH 2AEQH 1PGRB 2X70B 1CLOH 3RPKA 3ULVL 4MNQD 4XAKD 3SOBL 4OCSL 1AJ7L 4P59H 3T1FB 5EO1A 5HGGS 4IDJL 4OCWH 3QRGL 1NEZA 3AY4C 3ARFD 1HHHA 4ZXBC 4UIKH 3QI9B 4WFED 4HC1H 3VD3A 5E24E 3BI9X 1KB9K 4OGAC 3DPBA 3CVHH 4UTBL 2IADB 4PRIE 2IBGA 4S1RL 1IC5L 5DGRA 4C83B 3B8YA 5DJ2A 4HIIB 4YAQB 4XNYH 4IMKA 5D93B 1I7TB 1HINH 3G6DL 5K9OB 4P46C 2EC9U 1YQVL 3D1MC 2P42B 3I6GB 3HZVA 1MRDL 1RU9L 3C09C 3TBYA 3GSOB 2CK2A 3OGCA 3PQYE 2DBLL 4M93C 1DQDH 5ERWA 1U93B 1MAML 4WTWA 4NNPL 3SDXF 3BHBA 5E8OB 3LOWA 1VGKA 2I9TA 3D0VA 1A2YB 1J8KA 3CVHA 3NFSL 1W72B 4QGTA 1T1WA 1CDBA 3LS5H 2CJUL 3GI8L 3O11A 2OL3L 5C07D 3P30L 1QPXA 4WEMB 2XOTA 4M62L 3TT1L 3RVWD 4KTYA 1HOCA 5J4MA 4O5LH 4HAGA 2V17L 1CGXA 5F1SA 5F88A 1J05A 2R0ZH 3BIKB 5F97E 1QR4A 3L1OH 3T8XB 3BEWB 1LD9B 3QP3A 3WNPA 3L3HB 3PP4H 4MXVE 3O81A 4ONHA 5E8DL 4XPAH 1N0XL 1JWUB 2NY5H 1IGJB 1T2XA 1G9MC 4BK5A 1LEKB 4D9QD 2WAHA 5C6PB 3DOSA 5T1LA 2ATPA 4UINL 5CP3H 3BZFA 4KPHH 5D8JH 1AGEB 3FO0H 3MXWH 3PNWB 3EOBB 4WI5A 4Z0BH 3PDOA 1RMFL 1NLBL 4X6CB 4TTGA 2DI7A 3HC4H 3LQAC 5HHVL 3OKNA 1J1PL 4UT9H 3LRSA 4O4YH 1IL1A 1K8IB 1HXYB 3X12A 5C0EA 3ARQA 1EERB 5IJKC 2A6DB 5DHXB 3ARBB 1FIGL 4P2OB 2R23A 3WIHL 5BW7A 5F93C 2NXZB 5EO0B 3T0EE 1ADQA 1KTRL 3CXHJ 4FQPA 4FTVE 2XTJE 3GHEH 4CVXA 1YEGL 1SEQH 3V9FA 1DQQA 3EYOB 1PLGH 1X5JA 3ARVA 15C8H 3SDDC 4YDVA 3S36L 2SEBA 1PEZA 5F9AC 2ZUTA 5HHOA 4MJID 3QIUB 3C60C 1FE8H 4YXKL 3EYSH 1U3HB 1SM3L 5DQDH 3BEVA 3DRTA 3DV4A 1X4ZA 4G7VL 4WHDA 4GAJL 3NTCH 1YN6B 3RUGE 2VXQH 2RR3A 1U8JB 4TVPH 3VXRD 4FNLL 5T1MB 5E99H 1P1ZB 4I18A 4XVTH 5AD0A 5IOPB 1UEMA 4Y5XB 3S37H 1OQXA 4YDIH 5TDPB 1KLFA 4XP5H 2NNAB 3OR7B 1KELH 4JY6B 5GGTA 4LRNH 2AABH 2UYLA 1N26A 1JNJA 1JGDB 3LH2H 2BSSB 5DC9B 1DSFH 1A9BB 5DWUH 2NY6B 5FYLH 3V0WL 2DTMH 1MF2H 2HH0H 4DUVA 3HMWL 5E94B 4PJHA 4PY7A 2C4FU 4RMQA 5EBWB 1KYOJ 1KPVA 2DLFL 2YD4A 3WNMA 5JLZB 3NA9L 4OLXH 1Z5LA 4KROD 4PG9A 4NQDA 5IWLC 1U6AH 5IJVA 4WWKD 4N5UA 2W9EL 1IFHH 4OLYL 3QWRA 1AO7D 2X1OA 1M7IA 2Q8BL 4IRSA 1ODAA 1WJ3A 1CE6A 2ILLA 1HI6A 4B53A 3O6ML 1G9NH 3FZUC 3MLTB 1XCTA 4L1DA 4YHPB 4R26H 1U8KB 2ZOKA 4D3CL 2XQBH 4J4PA 2P8PB 1UADC 1JF6A 4NCC1 5FOBA 3ZE2E 4FQQA 4HSQA 4Y4FB 4QRQB 4H1LH 2CPCA 4JHAL 5CMAB 5LVEA 1D5MA 3KXFA 1MY5A 5C9JA 3CFDA 3WUWA 2J6EA 4OB5L 5C86A 4X0KB 5J9PB 5IVXF 2X2YA 3TA3A 4Q9QH 3FB5B 5IMOB 2I5YH 3NCCB 5DJ0A 4N9OB 2CXKA 4IOIB 4G8IA 5EPMA 3MLWL 2HLFC 4RGMC 3KYKH 3MFFB 1CZ8L 3TZVC 2F9BT 4HW6A 3BRDA 3EOTL 4LLWB 3CFBA 5CEZL 1BQHB 5IG7A 2YK1L 4WFFE 1YPZA 1EFXD 3VD5A 4DQOH 1JHTB 3VH8A 3H7BB 5D1QD 3OKMB 3SN6N 4UTAH 4WENB 5I1JL 2O61B 4LVNC 1QSFB 3KVQA 4L3ED 1C08B 4KHTL 2WUCL 4LKCA 1IM9A 2WIIA 4KZEL 2V7HA 3VXUB 3PV6B 3CSGA 4JJ5A 3PXJA 4ZD3L 3KR3L 3UZVB 1G7IB 4K7PH 4W70A 4LOUD 4PJFA 4JHWH 4OQTA 5IW3A 3A67H 1J11A 3TJHC 3MJ8B 2YPLE 3DX9A 3WCYA 1T83C 3OJ2C 3I02B 3O4LB 5F1KC 5GGVL 1FFQA 2R1XB 4KMTL 5C0DB 1JWMB 2JCCA 4M7LH 1LO4L 1PBYA 5JW5A 4MQTB 1EAJA 5BS0B 3WUZA 1KBGH 4LP5A 5CINL 2H32B 1HHKA 3Q6GL 3OXSA 5IBTL 5E5RB 5KSAB 2AAVA 3RX7A 4MD4B 1HNGA 3AREC 4OIIL 5IESL 1TJIL 4AM0A 3TBTB 3GSQB 1Q0YL 1T0MB 3LKSA 4U7SA 5ITBH 4PJGA 1ZWIA 3P0YH 4KK5D 1DE4B 3EGSA 1FL6A 3PIQB 2DLTA 3EYVA 5CIPH 3V0VA 5IFAL 3LIZL 3T65A 3QH3A 1G7QB 1L0QA 1TMCB 3RGVD 2Z31D 3P9MA 2Z92B 3FOMB 4WV1C 4WUUB 3V8OA 3TN0C 5D5MB 4WFGD 5AAWA 4MS8C 1TIUA 2ZSWB 2B1AL 5I8CA 4HG4J 3VFTA 2R4SL 3U0PB 2IQAA 3MYZA 4FFVD 4POZC 2XZAH 3RZCD 2FEEL 4F7TB 4NQCB 1PAMA 3G9VA 1CFBA 3BDBA 3OG4B 2AK4D 5T1KB 2VUYA 3K4ZA 4BFGA 3GGWA 5A2IH 3QA3A 2DIJA 3MV8B 3VDBA 3TO4A 2P4AB 2IH1B 3BJLA 2FD6H 3KLHC 4H0IA 5JORB 3FCTA 2G75A 4EVNA 1X5IA 4MNGA 4KJWC 3S36X 1QBMH 2HLAB 1IC1A 3GHBH 2JELH 4ZTPH 4HUXA 5D7IF 4DVBB 2V5TA 5CBAB 4JFZH 4LLAA 1N5YL 4WEBH 4J7RA 3FB6A 2Z4QB 4OF5A 4GMSH 1MNUL 3QIWA 2V2TA 3MV7B 1PX4A 2NZ9C 4MA8H 1UH3A 3L3GB 2FJGB 5LCVL 4Z7VF 3F58L 2VO5A 2BMKA 2VISA 3VH8G 4X6CE 5KANG 2KH2B 4H26B 3TBSB 4TN9A 5HGAB 2R56H 1U8OB 3HRZA 5K59E 4DTGH 5EU4A 4D2NA 4GAGL 3T3MF 1G0DA 3AY4A 4ZXBA 4RA0C 4OCYH 3MCLL 3D39D 5DQJA 5KSBB 2J8HA 5HGDB 1LGVA 1DBJL 4NBXB 5AWNL 4C4KT 5DD3L 1N5AB 1N7MH 2JK5A 4UI2A 2HTKC 2Q3AA 4KK9D 4X9GA 4ZO8A 5AYUH 4V1DA 3U4BH 3P73A 1NAMH 1T2QL 1WT5C 4EUPH 2AJ3B 2N56A 4O9HL 3ZE1F 1XCQA 5L9DH 4HH9A 3PABA 2HJFB 4WTZA 4P46A 2H8PB 1T5WA 3IDNA 1MJ7L 2FJFB 3HKFA 1WITA 4GKZA 1U58B 2LU7A 1UA6L 4C59B 4ELMF 5EIQA 3UZQA 4JE4B 5JO5B 4X8JB 3AAZB 5E2VH 4YBLB 2VZSA 4N90E 5AZ2H 5CWSA 2ADFH 1VA9A 4YNYA 3MX0A 3P4MA 2P5EA 1BLNB 1FVCB 3W39A 1UZ6E 3FT3B 4TYUA 3U6RA 4JFOB 1HIML 4LPCA 1M4KA 4U6YA 4YWGH 1QFWH 5JOFA 4LSQH 4NKDA 4DFIA 1YMHA 2VDMH 4KRMB 1ED3A 4EUPA 5EU7E 3SO5A 3UC0L 2WWMC 1YNKL 5E1AB 5IMMA 2IAMD 1T4KB 2VLJA 2P43B 3JV5A 4TUOA 4UNVA 4FQLH 2FGZA 4XRCB 3U36A 3IU4H 4R96B 5FDWA 1IRAY 1A4JB 1YECL 1IAIH 3BGFB 5KSVA 3U7AA 5GS0D 4LGRB 4RGNC 4LPYA 1DQLL 2EDNA 3KWWA 3UZEA 3PHQB 5DTFA 1ZVYA 1KLUB 1JRHL 3QNZA 3LEXA 5DD5H 4XPGL 4FP8H 5IFHL 1KF9B 3T0EC 2UZYB 4S1SL 4DGIH 1AY1L 3DRQA 1EUUA 2XTJC 5FECB 5KZCB 3C8KA 1LILA 2DM3A 2QADC 1KB5A 3P0VL 5D9SB 5I9QC 4QYOB 5EBMA 4S0TD 4KI5E 3QUYC 3H3KA 2ZNWA 3CX5J 2HFGH 5IW6B 5IJKA 4JY4B 4YHMH 4JRWA 1H8SA 2VAJA 1K4CB 1KENL 3FT2B 3MRCB 3C8HA 3RVVD 2YD3A 1CF8L 4LCUA 4E9LA 3QO0A 1DQMH 1MPAH 3GMPB 4EN3B 3SDDA 1T03H 5DS8B 1OM3H 4RBPK 1FO0H 4Q58C 2A74A 5IV2B 3C60A 1QLEH 1F3JB 4EBQH 5K9KA 2D4DA 5E08H 4KZDH 1HXMB 1QSFE 1R3JA 5LAXB 3FQNB 2ID5A 4PRHD 1AHWC 2H9GB 1A7RL 1MFBL 3SE8L 4LHJB 4O2FA 4PG2C 2BY1A 3VXUE 3LKRB 5KVGL 4OLWL 3RDTD 1LDPH 5EZJA 2ZUWA 1KJ2A 1LQSR 1NKOA 1XGQA 2GJZB 1GC1H 4GG6A 1E0OB 1XMWA 4HHAB 5HHXL 5GIRB 1Q9LB 1PZ5A 1FG2B 2IPTL 3EFDL 2PYFB 4Y1AA 3GMNB 4ZAKC 5I30H 4AENB 1CXLA 5A2JH 2DMCA 3R4DA 4LSSH 3O4LE 1HH6A 3FN0H 3IRPX 5I1LB 4PPTA 2DYPB 3ARDC 3WFDL 1RUQH 3ULUC 1AI1L 1FO0A 2C3GA 1L0XA 3QDJB 5CKAA 1KSRA 2ZG1A 1I9JH 3C87A 3AS1A 5BS0E 5IWLA 4D9LL 1H3PL 5JDSA 4QXWA 1NGYB 1MJ8H 3M8OL 3VRIA 1D9KD 3V6FB 5JXAL 3U79A 3I85A 3ARTA 1KEML 3O3EA 1QYGH 1NFDB 4JPVH 1YEFL 4ODWA 5CGTA 1HQRB 1EEYA 1FZMA 3VWKD 1OAXL 1R3HB 4WHTB 1KFAL 1L0YA 1OP9A 5KW9L 3VJ6B 1MLBA 4UBDC 4C54A 4LDLB 2VR9A 4EXKA 3QG6B 1NGXB 2VZTA 1EBAA 1QBLL 5DURD 4LCWD 1IM3B 1KIPA 3WO4C 1YEDA 2I24N 1K5NB 2PNDA 4TSAH 4U1MB 4LEXH 1RV6X 4MX7A 4EUPG 4BZYA 2PO6D 4WUUE 4TSCL 5FUCE 1IC7L 1S7QB 4OF0A 4MGXA 5D5ME 4ZTOL 4YHZL 4H88L 2XKNB 4ODUA 1BD2A 4PBWD 4Q2ZA 4U4BA 3RWGA 1FYTB 5CBEB 2JF1A 3MJ7A 4ZOAA 4YHIB 5FGBC 3CLFH 3TZVA 2C1PA 4QHLB 3LSOB 4NQCE 3G6JA 5DD0H 4XGZA 3LAFA 1PG7L 3D9AL 3S8WA 2OJEB 3VWJC 4XVUC 2J8UB 3MV8E 3QHFH 4WI8A 3QFJA 1ZVSA 1QUNA 4MCZA 1S7UB 4JFQA 4NRXB 3UTSD 1NGQH 4OUUB 5KN5B 1OWWA 5IP4A 2XPGB 4PJ5D 1CT8A 2AXGB 3UROR 4G6JL 3G5ZB 2Y6SC 4C56A 3OXRB 3B3IA 2NQCA 3MJ6A 2PCPB 1HSAB 5F9JB 1T83A 5SV3A 3MV7E 5ISZA 5A1AA 2GTWA 3QI9C 3RI5K 4URTB 3KYOA 5HVWA 3U7WL 3ULSA 3KYAA 5ACZB 4G6FD 1NCTA 5BJTA 1EH9A 1GZPB 1RZIB 2DIAA 4E41D 2RBLA 2NTFB 5MEOB 1KEGH 2W0KA 3UJJH 4JDTH 1U95A 3CSYB 4PJHF 3SGDH 1CGSL 5AG9A 5D93C 1TTGA 3N85L 5HI5C 4JANA 1MCPH 3ZE0F 4YBQC 3WHE1 3FO9B 4WJ5A 4OGYL 5KSBE 3KPMB 2E9IA 3AREA 1U42A 4K94H 1IEAA 4NWUL 2OL3B 4EZMA 1MFNA 4TUKH 2Q7YA 4YPJA 5AZEL 4S1DD 4HV8B 4LP4A 5JUEH 3SGJC 1MRCH 1BVLB 3MRKA 5CJQH 3QISA 4R4BB 4PJAA 4FABH 2MSPA 4HXBL 1XIWC 2KBGA 4UT6L 3D25B 4WV1A 2NCMA 3HZMA 3JV4B 3TN0A 3VRJB 1ZLSL 2ZCHH 4JO2L 3CU7A 1F90L 1P7KA 4K8RD 5E4EB 2YWZA 2EE9A 4ORGB 3TIDA 5DSCA 2Y07L 2CLVB 4C58B 5DDHB 3S88H 4EI6A 5GZOC 1GYAA 4YX2L 1N6QL 3TNNB 3QULB 3SDYH 1UH4A 4GBXD 5LGJA 1VFOA 1UM5L 2AQ2A 1ZS8A 1JPSH 3OX8A 5C8JB 5MEPA 1D6EB 4KDWA 3HG1B 3ILPA 25C8L 1U2CA 1YPZF 1B6DA 2VE6A 5FO7B 5I1AB 3MV11 1A7OL 1VSCA 2F5BL 5H2BB 4OIAA 3IDXH 1J0HA 1TJHH 3MUGA 3HZYA 3BESR 1ORSA 3SKOB 2B5IC 5ELIA 1FNEB 1KGCE 1H5BC 5J89A 1UG9A 4BSWB 1IGCH 3X3GH 3PWVA 5GHWH 1ERNA 4ALAL 1W0WB 2R4RH 4RRPG 1MEXH 5IB5B 5EUOB 1G7HA 3I6KB 1MREL 2NY2C 5C6TL 3GRWA 4RX4A 4XVSL 1JPGB 4PJFF 3QIBD 4M1DH 4O2EB 4Q6IC 1Q9OB 1AIFB 4P2OC 3QBTB 1J88A 1XR9A 5C0BB 3UMTA 1K2DA 2B4CH 4PRIA 1ZSDA 4HPOL 3T04D 1T7XA 1ONQB 3X13A 3MLPA 2BNUA 2CKBA 4XCCL 2H41A 2V5RA 5IBUG 1NC2B 3WN5B 1B0RB 2DQGL 4NGHL 5DMGD 1U3HC 5JW3H 1FPTL 1TTUA 3UPRA 4XP1L 1S7XB 4N0CC 4KKCC 4MHHI 1NCBL 4ODTH 5KSUB 3ZMRA 2GT9B 1ZGLM 4I4WA 4UAOB 2DJSA 4LIQL 4LF3A 2Z8VC 2YEZA 1B2WL 3QJFB 4Y5XC 4AEFA 1G84A 1CCZA 4PJGF 2VC2H 1RZ8B 1WT5A 1D5XB 4HJGA 1T21A 4RZCB 1ZHBA 3V5HB 3GMOA 3STZB 3HRPA 4Z7QF 2WBWB 4M7ZB 2NY6C 1U8MB 5F1IA 4XB7A 3KHQA 3QDMA 3VGDA 2HRLA 2N7AA 4JRYB 1CDJA 1NCDL 3RNKA 3D5OF 1KPUB 4TQEL 4F57L 4ZFGL 5HI3D 5DYOB 1U8NB 4OZFH 1U8IA 2AJVH 4M5YL 1E28A 4M5ZH 1AP2B 5GJSL 1NAKL 5C0FA 1RZKH 2K7PA 3MRIA 5T1DH 5DO2D 2EH8H 3VFSA 3V2AR 3DHJA 3WLBB 3X17A 2IMNA 1EJOL 5IT2H 3BVNA 3T2PA 4Y16B 3NMEA 5TF1L 3AMLA 5I1DA 1G6RA 3ZYJA 2G5RA 2GAZB 4KKLC 3HCVA 3QDJE 1PG7X 4JN2A 3QFDA 4DCQB 2MCG1 5FYKE 1OTSC 2MCPL 3MBXL 3L3JB 5CEXB 1IT9H 3MRDB 4IRZL 3D6GA 3D3VA 3IDMB 1FL5B 3AGVA 4NO3B 4GMTL 2WUBL 4RQQA 2DDQH 3MRBB 4D9RE 1NJ9B 1DFBH 2FLRT 4MAYC 4MYWB 4YXLL 1NFDE 5FF6A 1NMBH 5E8NA 3OKDB 3QEHA 4JFFD 2VDQH 3MNZA 4KI5C 5IM7A 4HBCL 4CADA 3FTGA 2KL6A 1U8PB 3OKOB 4RIRA 3V7AG 3QUXB 1D5BB 5E0QA 3CFIC 2NY1D 3T0EA 4XHJD 1CIDA 1K9TA 4YDJB 2XG4A 1F4YL 3HAEB 3R1GH 5DMIH 4NP4L 1NUDA 2IMMA 2XWBB 4JKPL 4HK0B 1FYTE 2WV3A 3SQOH 5HJ3A 4PB9L 4JKWA 5CSZB 2VLMD 3RUGA 3MLZH 3W9EB 3B9VA 1FJ1A 1BX2B 1WBZA 4F9LC 5KVEH 5J3HC 3DGGA 2AK1L 2BOBA 4NJAH 4X83A 5IK3B 4PJ7B 2J8UE 4M6NH 3ULVE 4QXGH 2VDKL 5DD6A 4TTDD 2GK2A 2IBZY 1CLZL 2X4NA 1MOEA 1SY6H 1AHWA 1G7PA 4YHLH 5EC1A 1I85C 5JDJA 1GSMA 4PG2A 3FT4A 4YXHL 2O5YL 3WFBL 2BRRH 4ZOBA 4X7TB 3HE6D 5C0CB 4LGSB 2UZXB 5DRXA 3VCLB 1RPQA 3KPLB 3NH7L 1C12A 3HS0A 5F89B 1RZJL 4ZAKA 2WIMA 3MLYH 4GAYB 2IQ9L 2H3NA 4P2RD 3LN5A 4YHKH 3WMSA 2NR6C 4P0DA 3MA7A 4GXUN 5DEFB 4XBGB 4KK8C 2W07A 3ARDA 1B4JH 3PL6B 5KSAC 1L4IA 1TZGL 3LY6A 5CHNA 1KC5H 1LK3H 1FNFA 4LEOA 3EO0A 3QZWB 3SJVD 1OAUH 5DHYA 3VFPB 1YC8A 2Q76A 1RJYA 2P5WD 3B9EA 1WWWX 1DANT 4HF5L 4ZDHB 4OSUL 3IXAB 6CGTA 1RFDH 1FCCA 3F62A 4RDQG 2V5SA 1HKFA 1LK2A 3KPOB 5BOPA 4OBRA 2HWZH 5FUCC 5HDQL 1IVLA 1IC4L 2OCFD 3I3EA 3RY4A 2YA2A 4GOSA 4G8FA 3W2DL 1EEZA 2V2XB 2ESVD 2ERJB 1KNOB 1L7TH 4PLNC 1U3YA 2QSCL 4FFZH 3TCLB 3CFCL 5T1LD 2AQ1A 5EG6C 2G5BB 4OD3H 5FKPB 1Y6KR 3ZT5A 1OB1A 2A0LC 2JJSC 3MACL 3QEQB 4Z0XB 3DVGA 1F42A 4P2QB 1A7BA 2Q6WB 1FBIL 4PR5B 1FH5L 2YUWA 1QKZH 5DHVH 5HHPA 4YPGA 3CMGA 1CFVH 1OP5H 4KVCH 4MSWB 2NYYD 4YFDB 2P47B 1VFMA 5EOCJ 5FGBA 1FN4B 4HD9A 5JXEC 4GG8A 4OF6A 1P69B 4FQ1L 2FECL 5TQ0L 1UXWA 5J1AB 3WIIH 5ESAB 4WFHD 3ZDYF 2UUDK 4IOSD 4ISVA 4X9IA 4ZMAT 3VWJA 2BSRB 1A64A 3HG1E 2P8MA 2BCKB 1T22B 4QY8B 5EBGA 4YR6A 4JG0H 2Y36H 2YPLA 3GMMB 4HKBA 1DEEB 2PXYC 5DVKA 1PYWA 1V05A 5D7JB 2UUDH 3RTQB 4P3DB 1MRFL 1YEEL 3G5XA 3SY0B 2PR4L 4K3HA 3TIEB 4XC3H 5K9JH 4FZ8L 1ZT7B 2X70A 1J0IA 1WBYB 2VXVH 3ALPA 4DAGH 4OLUH 5EUOE 3T1FA 2A1WH 1N3NB 4U3HA 4BH7B 4BH8B 4GG6F 3QXTA 3CLEL 2IBBA 1MFDH 5TFSH 4LLQB 5CGMA 4QO1A 3QI9A 4YDLC 1XGTB 1JHKL 4OAWB 2FX8H 4Y8DC 2CD0A 2EDXA 3GNML 5C0BE 2IADA 3MRPB 2NPLX 2J6EL 1W72H 4HEPG 2QR0B 4K3EH 5GRJL 5FAAA 1QVOB 1YJDH 4G8GD 1QZ1A 4EOWH 4YAQA 1QLFA 4OF8A 1IKFL 3IJSB 4JPIB 5FIEA 1WCBB 1XGPB 1KJ3L 5IF0B 1I7TA 1E4WH 5K9OA 3PWNB 1GOHA 2DI8A 4PJEF 4QHMB 1I9IL 1VFUA 3VXOB 3WSQH 2ZP0T 3I6GA 1BFVL 1SJXA 1B90A 3GSOA 4TVPD 1N6UA 1ZA6B 4JKLA 3DMMD 4BSJA 4LAQH 1Q9WB 1U93A 1FFNA 3G08B 3FFCA 3SGJA 3M45A 1LO0H 4U6VL 3LD8C 1IQWH 3S3JA 1UYWL 5IR1A 1ZT4B 3SKNB 4ZNCD 3O8XC 5E8OA 3MBED 1OT2A 1A2YA 4CMHC 43CAB 1XIWA 4NO2A 4XI5D 5CSGA 2QKIA 3KLAA 2VLKA 2BY3A 3U9PH 1ZK9A 2C3XA 2XWTB 5FYLD 3FAWA 4JRYE 3L3KB 4OQTL 4AG4H 4GW5A 1QO3B 4APQD 2IEPA 3DO3A 4O02L 3CNKA 1VACB 3QEUA 4PS4H 3BP7B 3BEWA 2O5ZL 1X5LA 3ROOB 1LD9A 3HB3D 3L3HA 3OF6D 4F80A 5CJXC 1JI1A 3O9WB 5C0ND 2R0LL 2CLRB 4U1NA 3BGFC 4R4FH 3OTTA 4ODHH 5MENB 1HWGB 4G5ZH 2VAAB 3QUZD 4GSDL 5DJ8B 4NPYB 1S9YB 1LEKA 3VXMD 5I1CH 4XZUB 3BIAX 5DMYA 4TNWK 1ROWA 1VDGA 1H5BA 1QA9B 2X6MA 4R8WL 3GKWL 4X6CA 4R7DB 3DVFA 4LLVB 5FHBH 5CEZE 1A1NB 1INEH 1J7VR 2VYRE 1K8IA 1IQDB 1HXYA 4Q6IA 2ZZUT 1QTYT 4P2OA 1A47A 1A7NL 3F12B 5EO0A 3ZYOA 5KVDL 2EO1A 4U1IB 5IHZB 4HIXH 1BM3L 1AXSA 2X41A 3BDYH 2ZUSA 5JOPE 1IZJA 1UACH 2HAZA 3UAJC 3ZKXB 4EN3C 4EJ1C 5DQ9B 2ICCA 3U46B 3NA4A 1T66D 4PJ9B 4X9BA 4G9FD 3VMNA 3I9GL 3UPCA 3ARGB 1AE6L 1U3HA 1YEHH 4L9LB 4CL7A 4I77L 1YN6A 2GYSA 4G9DA 2XXMB 2FHBA 1U8JA 4J3SA 3N50A 3UJTH 4MQ7B 4OZHB 5IVXB 3NZHL 4JO3H 1P1ZA 1VEOA 5IOPA 1URLA 4JFDB 4PJ7E 1MHEA 4Y5XA 1G0YR 1QSED 3C6LD 5TDPA 4M43H 3E2HB 2NNAA 3MUY1 4RFOH 2CRIA 2PYED 5GRUH 4UILH 3V5DA 4DEPB 2BSSA 2MWCA 2WBJB 1JIBA 3O2DA 2CRMA 3JVGA 2FEDD 1P4BH 3I50L 3PHOB 5E94A 4E5XB 1MCLA 5EBWA 1IGIL 3KDMB 5TDOB 3HFML 1M71B 5EN2B 5M7QA 5LGKA 4TUJB 3O45B 4XPTL 3DO7B 1KTLB 1A6WL 1CG9B 4NFDA 2DF3A 4NWTH 3H9HB 1OAYL 3VU2A 4HKZB 3IYLW 2BOCB 1JHLH 4HWEH 4LVEA 3MLTA 2E27L 3U2SA 4M1CD 4QT5B 4YHPA 1U8KA 1ULVA 3CH1A 3K2MC 1X7QB 2P8PA 1JWSB 4N8CH 4MXQD 4QRQA 2P48B 5CMAA 4PLJD 3RWCB 1SYSB 3NCJH 2AERT 3HUJB 4X6DF 1B9ZA 5I0DA 5BVPL 5CP7B 2E3VA 1JNNH 4X0KA 5J9PA 3B2VL 3QNXB 3V8CA 3FB5A 3ARXA 4IOIA 4JKKA 5KJRL 3IS0X 1BP3B 2EDFA 1ETZB 4Y2DB 1M6OB 2EYSB 1UZ8B 3AS0A 3MFFA 1DL7L 4JFEA 4Q9BA 4LLWA 3ZTNH 5D1XD 1R5IB 4RA3A 1A02N 4H25B 5ICXB 3QEQE 1NDMB 5I71B 4GW4A 5GISH 4P2QE 4I8DA 5JMRA 2A9NL 3CFJB 1JHTA 3IU3A 3KGRA 3ULVC 3H7BA 1ZA3B 5HDBF 4QRRD 5IGXL 4J3VA 2O61A 5CCKH 1QSFA 2GEEA 4PV8B 4UDTB 3F7VB 1A6UL 2UWEB 4XH2B 2VRAA 3IFLL 1IGYA 2OP4H 2D0FA 4GO6B 4A2MA 2PW1A 3VXUA 2C1OB 2XN9A 4F9LA 3MRGB 4M7JL 5D1ZD 1OVZA 1CXKA 4HCRL 5I8OH 1G7IA 4R2GB 4PUBL 2EIBA 4F9PC 4PJ8C 1RUKL 1PY4A 2DQDL 3KYNB 5GSVB 1R5WA 2EDEA 4G7YL 3MJ8A 3HLAB 4GUPA 1L6XA 3I02A 2BHZA 5KANI 1I85A 5FA3B 3G5VB 2R1XA 1KN2L 1JWMA 3B43A 1YEJH 5KS9A 3E8UL 2JB5H 4KQ4H 2Z8RA 2IPUK 5HHNB 5GQBA 3W11D 4P3WA 3SCMB 2IWGA 3B9KD 2VERN 5SX4H 4BQCA 5BS0A 1OT1A 2WP3T 4RDQF 3TNMB 4JR9L 1BZQK 4J3TA 4BKLB 1B88A 2H32A 2ORBH 1XF3B 2W0LA 5F8RC 2E6QA 2HMIC 4OCLC 4U1KB 1K6QL 2R2HB 5KSAA 3GMRB 4P5KA 1BQLL 1ZHNB 5EA0H 4KU1A 2R29H 3TBTA 7CGTA 4MXVF 3GSQA 3MJ9A 4HWZA 4NSKB 3BP6B 3WJJC 1DE4A 4LCCB 5T3XE 1JNLH 4TOYL 3PIQA 1FSKB 5H35B 1FVDB 5K9QG 4Z7VB 2E8YA 1OGAB 1G7QA 2YRPA 1M1SA 2Q1EA 3QXWA 5FUOH 3FOMA 1I1AB 4MLIA 4JFXA 5D5MA 4L9DA 5EU6D 5C0AB 3G9AB 5E4EC 1LMKA 1Z0NA 4ETQA 1DBKH 5CAYB 3U0PA 2NW3B 4UT7H 2HJKB 1I8MB 2C7UA 1DVFD 4R90H 3LKOB 4F7TA 5EDXA 4L8SC 2JJSA 3SDAB 3SE9L 3JUYA 4WU7B 4WO4B 4NKOA 2A6KB 5T1KA 3WKNA 4DVRL 1HYSC 3MODH 2BNQD 2IH1A 1WBXB 4XCYB 1AR2A 3UTPE 5JORA 1NGWA 3GBMH 2HLAA 5J6GB 2RJMA 5EIIB 1WIOA 4P48A 5MENE 4I5BA 5GS0L 2VH5H 3PWPA 3WL9B 3HC0B 4AL8H 4OV5B 1M7XA 2UV3A 4GT7A 2KKQA 2PXYA 2RAMA 3Q0HA 1BQHG 4HS8L 5E7FA 1OHQA 2BDNL 12E8H 3L3GA 2FJGA 3VG0L 3O3AA 3CXHK 1PKQB 1Q72L 1UVQB 4H26A 3QPXH 3KS0H 1HILB 2VDOH 3TBSA 5HGAA 5F1OB 4D0BB 1U8OA 2HFFB 4LMQE 4KWUA 4AMKL 4LKXB 1WFNA 1TNNA 3WN5C 3V4PH 5I17B 4QRPA 5GPRA 4CU6A 3X14B 3HI5L 5EUKA 5KSBA 2HT4D 3D18A 4KVNL 2C3VA 4AK1A 1N5AA 4UAOC 5E2TH 3WLWC 1LEGA 3VW3H 3ULUF 3RIFF 2VABB 4OM0H 4WHYH 1GCFA 2EE6A 4Z77B 1QNZL 2AJ3A 3DARA 4RAVB 1BF2A 4NQSB 4TSBL 2GJ6A 2VXUH 1F11B 2JIXB 3I84A 3OHXB 3PWJA 2H8PA 3O2VH 4JRXD 3C5ZB 4BFEA 4NJ9H 4ZPTB 1I9EA 2FJFA 5DVMA 3W82A 5GRYA 1U58A 5DA0B 4OZHE 5IVXE 1JNHA 4CRPA 3RFZC 4A6YL 1E6OH 4JFDE 5JO5A 4XPBH 3O8XA 1D6VL 2FCBA 1WEJH 2XQYG 4CMMB 1L7IL 3LS4H 1FVCA 3FT3A 2NY4D 3K80A 4JFOA 2VXTH 3QYCA 2W9DL 4HMEA 4Y16C 2Y4SA 4PBXA 3DXAD 4KDTC 1JTOA 5BZWB 2X1PA 3OBAA 3MNVA 4M7KL 3T2QA 4BZ1L 3H3PH 5E1AA 4RSVA 1WSST 1EPFA 1T4KA 5I66B 2YRZA 5LBSH 3RVXD 1ZANL 5CJXA 5GRZA 4R96A 1A4JA 1UM6L 4LSRH 2HFEB 1GIGL 3L5HA 3TBYB 4N68A 1NGPL 3UTTD 3RWHA 3P4LA 2IPUG 4JM2C 1WZ1L 2VXSH 5ERWB 1KCVL 1LO3H 1SJHB 2X89D 3QUXC 3S5LB 4AH2A 4GXVL 2X42A 4XAWL 4XC1H 4L8BB 3OJMB 4F7EB 4Z7UB 4NCC2 5E2WH 2DLEA 4K2UL 3U9UB 4S10A 5SWZD 4PB0H 2LVCA 3O11B 4KKBD 3HUJE 3IDYB 1VERA 1N8ZA 1QFUL 1QQDB 3UYRL 1T0PB 3S4SB 1AQDB 4QYOA 4XVJL 1VB9A 1EO8H 4P3CH 1P7HL 2H26B 1NDGB 5IFJB 2Y72A 5L2KB 4JY4A 1CLCA 2VLRD 1K4CA 1FL3B 2C5DC 1WTLA 3MRCA 4MLSA 3F5WA 2FL5B 5DA4A 2EIDA 4EN3A 2ICES 5DS8A 5F9WB 3RU8H 2ATPB 3LZFH 5IV2A 4Y4KD 1F3JA 5L6YH 2EXYD 5FYKH 2B0SH 5LAXA 2UWEE 2CRZA 2H9GA 4AQ1B 3DSFH 2Y23A 4TVSa 2YPVH 4PBVC 1SJEB 3LKRA 1UT9A 1IAII 4XP9L 5C0IB 4FG6D 4WI9A 5J12C 4X7FC 5ABDE 2EC9T 3MOBL 5GIRA 1Q9LA 2V6HA 1FG2A 1FORL 2PYFA 3X12B 5C0EB 3GMNA 1P84K 3BN9C 2R23B 2W59A 3AUVA 4N5ED 4GXUM 5I1LA 2DYPA 3PL6C 4EI5D 3O0RH 1FGVL 1DQQB 1BQSA 2AV7A 1RSFA 2JKXA 2CGRH 3QDJA 4FQJH 4PJDB 1IEHA 1F4XL 4ESKA 1WGOA 2RIKA 4NHCH 4OLVL 1NKRA 3DETC 1JMZA 3H8NA 1NGYA 4LLDB 4NRYA 2NY0D 3AROA 1JPFA 3V6FA 2D7QA 4YHOH 4X4YB 1J0KA 4M1GL 2D3VA 3MLXL 1GGIH 4N0UA 4Z7WB 1GGCH 3IFOB 5I1GH 4I18B 5AD0B 1O7SA 1JZ7A 1R3HA 4HG4K 4WHTA 4HLZH 2I07B 3GIZH 1OAQH 3HI6H 4XNQA 1H0DB 2ERJC 1W2KT 3SOBH 4HGWB 1NGXA 4OCSH 5DLMH 4Z7VE 5CD3A 4HUWB 3QRGH 1IM3A 1OGAE 4WHYG 1K5NA 4LSUL 4U1MA 5EO9B 3VGBA 1YC7A 4LSPL 4LFHG 4X6CF 1S7QA 3VXSD 4QOKD 4B0MM 4PJHB 4PY7B 2YZ1A 3SKJL 2G9HB 1D5IH 2XKNA 3OG6B 3QQ9D 4HQQL 4UTBH 3T3ME 5C0AE 1Z5LB 4LSDA 1FYTA 4K8RL 1IC5H 4TULL 4Z7NE 3P77A 4YHIA 3ORJA 5IJVB 2HTLD 1DBML 2W0PA 1JCKA 3O2WL 3L7EA 4NN5B 5E5UB 1NCWH 3G6DH 5CUSL 2DWEB 2W92A 4ENEC 3D87B 2E7LC 2OJEA 5EOQL 2J8UA 1HEZB 4JQVC 1XCTB 2HKFL 2XZZA 2DKSA 1RU9H 2LTQB 4P9ML 2D7OA 4WI6A 1Z6JT 4L4TD 1OTTD 2F58H 3ZE1E 1KTKE 4KUZL 3QHTC 4I13B 2AJSL 4U49A 5F1NB 5FOBB 5D7JC 5D2LA 4NRXA 3U0TB 5KN5A 5HTSA 3NCEB 1AD9A 3NFNA 2YD8A 2XPGA 2H1PH 5DEGB 1JK8A 2GTZB 2AXGA 3RWIB 3CFDB 3L9RB 3NFSH 3WUWB 4J3UA 4IRJD 1MHCA 2ZUYA 2CJUH 3GI8H 4G80B 4PJ8A 4F9PA 3OXRA 5DJ0B 4G8IB 2V9QA 2OZ4H 5CJOH 4K07A 5F9JA 3PQYD 3JWOL 4MJIB 2V17H 5GGRA 3FO2B 3OKYA 1X5HA 1BVZA 3CFBB 4LARL 1PKQE 5ACZA 5IG7B 4P4KD 1YPZB 1GZPA 1RZIA 1NCCL 2X05A 2BHYA 4LDEB 2NTFA 1CK0L 4LIQE 5MEOA 2E9BA 5DF0A 5E8DH 3CSYA 3T0VA 5FCUL 5A2LH 1DBBL 2EH7L 5DFVD 3LEYH 4AEEA 4GW1B 3RWJB 3DIFB 4XPHH 2C4FT 5A3IC 1IM9B 1EZVY 1GXEA 1C5CL 3KPMA 4XMLL 3WD5L 1VENA 2OL3A 3LPFA 2XZCH 4XBEH 4M3KB 3ME0A 2QHLA 1NLBH 4AEHH 3WJJA 1J0YA 5FO8B 4PJFB 2N7BA 1UCBH 4RWHA 5HHVH 2DAVA 1BVLA 1J1PH 4KROB 4L3CB 4NZDA 4PRAA 1V7NL 4R4BA 5BVJB 3FQTB 2B39A 5FM8A 3NACL 3I75A 1S5HB 3D25A 2CO7B 3P0GB 4NKIL 4O51B 3SE3C 1A14L 1AO7B 2FX9H 3VRJA 2PW2B 4KKNA 3TBWB 1AQKL 1YEGH 4QHKJ 4ORGA 4GJTB 2OXHA 3QPQC 4DK3A 2AEWA 1EFQA 4K23H 2CLVA 5DDHA 3PV7A 3TNNA 3QULA 4YXKH 4L8SA 3KJ6H 3O9WC 5ADPL 4G7VH 4GAJH 4AM0B 5C8JA 1U8LB 5C0RL 2WSKA 4FQXD 3HG1A 4PJGB 1INDH 1R0AL 4FTVD 2AEPL 1FLRH 5JHDA 4FNLH 5FO7A 5I1AA 4XP6H 5H2BA 3EGSB 1IARB 4CNIB 3RIAF 1INQB 3EYVB 1EMTL 3SKOA 1FNEA 5ALBL 3T65B 3QH3B 3WIHA 3ULUL 4BSWA 2OYPA 4ONFL 5CILL 1W0WA 3QUMH 5IB5A 1GGYA 5EUOA 2DQUL 3O6LL 4U1JB 2NZIA 3M17B 4XTRD 3CX5K 1EFXB 2XRAL 3VFTB 1RVFL 2I9LB 3RKPA 3SDCC 4O2EA 4Z95H 3S35H 4Y19D 4Z7UE 5DMKB 4I3RL 5C0BA 3N1FC 4L3EB 1EXUB 3OV6A 4OLYH 4FXKA 2JJVA 2PN5A 5KS9F 1XGUA 4HBQA 3QA3B 4J3XA 3TO4B 1ZEAH 2MPAL 3AM8C 3IETB 3WN5A 1B0RA 4E0RB 4EVNB 3ARGC 4MNGB 1TZIA 5MHSE 5L2KE 4L9LC 5F6IC 3NGBB 4K7FB 1J1XL 5KSUA 2GT9A 1CICC 3BMVA 1JI2A 2IJ0C 4C4KO 1BEYH 4WTXA 4YBHA 1KXVC 5DFTA 2NLJB 3FB6B 5FGRA 4OB5H 1D5XA 1VPOL 3E2HC 2V2TB 5D72H 4AEIL 3QEGH 3V5HA 3BZ4B 4P9HH 3IDGB 5EU3A 5I1EL 4PY8I 5I16B 2EDHA 1MCOH 3NCBB 4DEPC 4ODXA 2BMKB 4I9WD 1U8MA 2VISB 2WBJC 1Z9MA 1RURL 5BCAA 1O5DT 1EHLL 2DLGA 3B2UC 4DKEH 4WFEE 3EOTH 4V2BA 4ZO6A 5CEZH 1MHHA 5D5MF 5DYOA 1WZLA 1U8NA 2YK1H 5GGQL 1JV5B 1XF5B 1CLOL 3N9GH 1FFPB 2MKLC 5CZKA 4JVWA 1OF2B 1AP2A 5FYJH 1CTOA 5DQJB 1RI8A 1PSKL 3L5JA 4IS6A 3WLBA 5IVZA 4JCMA 4KHTH 4Y16A 4UIKL 2WUCH 4HC1L 4NYLB 4KDTA 5DZNA 3HAEH 4PJDE 4DCQA 4RWYL 4WFFD 4V1DB 2FO4A 1C7TA 4F7CA 3KR3H 3L3JA 3EHBD 3MRDA 3Q1SL 3IDMA 1FL5A 4WDIB 3HNTH 4NO3A 5ETUB 2ZKHL 4BM7A 1HINL 3MRBA 3RZCB 3HE7D 1NJ9A 3L5WA 2YUXA 3C09B 3OKDA 1QLRB 4Z7WE 4JM2A 2DQIL 4M93B 5JPMB 1I7UA 3GMLB 4A2LA 1LO4H 1ZXQA 1U8PA 2JB6B 4UB0H 3BW9B 3QUXA 1D5BA 4X9FA 5CWSB 1DQDL 4TNVK 4BZ2H 2P5EB 3HPJB 5CINH 3W39B 1YNTB 4YDJA 2VUOA 1DANU 4XWGH 1BJ8A 1EGJH 3KLDA 5JOFB 1N59B 2J8OA 3HAEA 3HHRB 4NKDB 4PJHE 1YMHB 4LPWA 2OR7A 4HUMB 3DX6B 4OIIH 5FCSH 2XWBA 1NC4D 1GAFH 3NFPA 5DJZA 1CR9H 3TVMC 1Q0YH 4HK0A 4PTUB 4LLMB 3ZE0E 5EZOH 4GQ9H 2VLJB 5CSZA 1OWRM 5HYIA 4S1QH 4XWOD 3W9EA 1F58H 4PY8J 3U36B 2PTTA 2OTWB 5KSVB 1OD7A 1BX2A 3L1OL 3V5KB 4KXZI 2ARWA 5IK3A 2ADIB 3KWWB 3EZJB 3PP4L 4N0YL 5DTFB 3K8MA 1P6FA 2NY5L 3BZEB 3QNZB 3C5JB 3GUTA 3RKDD 4U7MA 7FABH 2DIBA 5B8CB 3B9DA 4AJ0A 4P2YA 4KPHL 3FO0L 4GLRI 3DRQB 3FQWA 1KN4L 3D39B 4X7TA 5C0CA 1S7WB 3ZTJH 1JE6A 3VCLA 4MZ2A 4AT6B 1D3CA 1TQBC 5F89A 3CSPA 3HC4L 2BVPB 4F8TA 4GAYA 4MJIE 5DEFA 3O6FD 5GZND 4XBGA 4OLEA 3PL6A 4MVBC 3GZKA 2Y06H 5DK3A 1VEPA 2ZCKH 3QO0B 3DI2B 4L3AA 2R9HC 4YO0A 2YWYA 3QZWA 1YPZE 3VFPA 1PVHA 3MRRB 4MQXC 3GHEL 1SEQL 2A74B 2FSEB 5JPNB 1N5YH 1IBGL 1PLGL 3UCRA 1FHGA 5KTEH 2J4WH 1R3JB 5H8DA 1FNLA 3C9NB 3VDAA 4BYHA 1MNUH 2CK0H 1FE8L 1IAKB 1Q94A 5TE4H 4DGVL 5FOJA 3PWLA 2VL5B 5DQDL 4O2FB 3KPOA 4KJYB 4WI3A 2X1QA 4YDKL 1I1AC 1I9RH 3NTCL 5EZJB 1S9WB 4ODVH 3DLQR 4TVPL 1CIUA 4GG6B 4PJFE 1HWHB 2V2XA 3RWFA 3ZKMD 1LEIB 1PZ5B 4LASH 4Q7DA 1KNOA 5JA8B 5E99L 5F44A 4XVTL 3ARPA 3TCLA 3S37L 4YDIL 1BFOA 4GAGH 4OT1L 1WVZA 1CL7L 2G5BA 5FKPA 2IAMB 4LRNL 3QEQA 3VGFA 3MCLH 5GRWA 1AO7E 4NQXA 3LH2L 5EIVA 2D0HA 1DLFL 4RMUA 5D7LA 1DSFL 4PR5A 4WHCA 5DWUL 4BQ8A 5AWNH 5FYLL 1QACA 1QHPA 2HH0L 4MSWA 4ODSH 5JDSB 4PJEB 1UGNA 1FN4A 2FO1A 3K0WA 4AY0A 5J1AA 1A8JH 5ESAA 1T2QH 1U6AL 4O9HH 4KKAD 2H2SD 4PRPD 3O3EB 2CKNA 2HVKB 3VD7A 1YDPB 1IFHL 5EORL 3ARBD 2E7LA 2BSRA 1FP5A 2NXZD 4XB8A 5KAQF 4JQVA 1IJ9A 4PJGE 2BCKA 1T22A 4OGZA 4MNHA 4QY8A 1UA6H 5T3XH 5D2NB 1DEEA 1CXEA 4WWID 5D7JA 1BFTA 1NLDH 3ZYIA 4R26L 4P3DA 4Z7QE 3ARZA 1QRND 3QIUD 3HAEG 3SY0A 4Z8FH 2CDGA 3V0AC 3OKEB 5GRXG 4GFTB 1NFIB 3W0WD 1KCSL 4M4RA 5DJYA 1ZT7A 5E03A 1WBYA 3DECA 1XT5A 3C8DA 2ZUXA 1BD2B 1FDLL 4BH7A 2BK8A 5LJYH 4BH8A 2EDOA 1TVHA 4NNXB 1DUZB 4JO4L 3UC0H 1JGLH 2F53D 1XGTA 1YNKH 4OAWA 5F71A 4XGZB 3EYQD 4DOHB 3O6KH 2F8XC 2J7LA 4N90D 4L3EE 4P5TD 3KYKL 1T20B 1J8HD 1WZMA 2QR0A 5L8JB 3U30C 1MCFA 2PTVA 4ERSL 5C92A 3GK8H 4KJPD 3IJSA 4PRDB 4A6YB 1ZVSB 1PW3A 4JPIA 5IF0A 1WCBA 1EZVX 1XGPA 2X44D 4DQOL 4MCZB 2RCSL 3BO8A 2VITB 4MNGE 5DZOA 1A3QA 2LABA 2K9UA 1X44A 2F74B 5BZDA 2FLBT 3VXOA 4DUXA 3C5ZC 5HYQA 4HAFA 1S9VB 4PGBB 4G6AD 2YMXL 2VSDA 4KC3B 5CJBA 3CIQA 3B3IB 3G08A 2D2OA 1CD1A 3BWUC 3P0VH 5F7DB 1ZT4A 3SKNA 3IKKA 4K7PL 2GTWB 4JHWL 43CAA 1GHFL 3QZWG 3A67L 3REWB 4Z5RA 3SE3A 3ULSB 1TDQA 1D9KB 3IRZA 2XWTA 4Y4FD 1KENH 3VE0B 3L3KA 2P44B 1HHJA 1CF8H 4M6MH 1QO3A 4M7LL 3TPUB 1U3ZA 5IIEA 2C9AA 4XMPL 3BP7A 4WJ5B 4JB9L 3O9WA 4N9GA 5MENA 1LO2H 5DJ8A 4GKNB 3SE8H 1YYMH 4J23A 4NPYA 2AP2A 2OSLB 2PO6B 4HJ0D 4OLWH 4P57A 2J8UF 4XPFL 3ULVF 3LPWA 4V1DE 4WFGE 1X5ZA 2H2PD 1AXIB 2BVEA 2UY7A 3QCVL 3P0YL 3RZWA 2DQCH 3EJYD 1QA9A 4HIJA 4K3DH 4NFBA 1H3VA 4PRBA 5D2LF 1OAKL 2OTPA 3GMQB 3IDYC 4OGXH 2CIIA 4LLVA 3MJ9L 3MROB 3AFLA 1WZKA 4Z6AT 1AI1H 2QQQA 5JIIA 1IQDA 4NO0B 2DM2A 3SDCA 1SVZA 2X4PB 4D9LH 4I0PC 2P5EE 4NZRL 4U1IA 5IHZA 4M48L 2VDRH 4G6MH 2XZAL 3UTSB 3IS1X 1ZS8B 4KK6C 3O4LD 3SKMB 5DQ9A 1MHPH 3U46A 2GY7B 5F9WC 1ZKAA 3TV3H 3AM8A 4D0CB 5JZ7D 2E7CA 2EICA 2O5XH 3ZHLA 2APFA 3ARGA 3DVNA 1OAXH 3HZYB 1RZJC 4CVWA 1JZ5A 1KT2B 4L9LA 4X6DB 2FD6L 2FH6A 2VLJE 5D96B 3DBXB 1BJ1J 3ARFC 1P7QD 1CICA 4OZHA 5B21A 5IVXA 1A21A 3TGXA 3GHBL 1MWAH 2JELL 5D71L 5T3ZH 3ECBB 3T0AA 5ACLA 4ZTPL 2VDLL 1W8OA 4JFDA 5D70H 4QXUH 2BVTA 3NIGF 1JGVL 4IIQC 1J0ZA 5F7LB 1OARL 4E41B 1I1FA 4WEBL 1KCUL 4ZTOH 1E4XI 5E6ZA 5B4MD 3QAZB 1YQ2A 3BJ91 2GJJA 2X7LB 4RMRA 2WBJA 3F65A 3S37X 3CMOH 3D39E 4KMLB 3PHOA 1XF4A 4E5XA 2BNUB 2AKRA 3D9AH 3UYPA 5I18H 5TDOA 1SJVA 3PGCB 1TFHA 4WUUD 5FV1L 1M71A 1CVSC 2BY0A 2R56L 3PUCA 5HVFB 1QEWB 3DO7A 1T7YA 1KTLA 1MQKH 4DTGL 1R3IH 3RPIB 3MYJB 4JM4H 3ZDYE 3WNKA 5BQ7B 2CR3A 3H9HA 1P2CB 4HKZA 2ATKB 4NQCD 4LF3B 3L3DB 5AAMA 3MOAL 4QT5A 1N7ML 5T1KD 4HULB 3RVWC 1F6LL 1X7QA 1T0NB 1T21B 2DJ4A 3MV8D 3BN3B 5KG9A 5AYUL 3BSZL 4Y5VC 3RWCA 1SYSA 1J1OH 4KUCD 1ZLUK 3HUJA 1IAMA 4OZ4B 3QDMB 1BWMA 1VFAA 5CP7A 4FFWD 3QNXA 3U7WH 4GBXB 4GG6E 3JZ7A 5EUOF 3DROB 4JZJC 4NO5B 1ZLUH 3OKKB 1TTFA 5HD8D 3E6FB 1M6OA 2YXFA 1UZ8A 5C0FB 5E2VL 1YNLH 1KCLA 2VN4A 1NMAL 3MV7D 2ADFL 4H25A 1E6JH 1NDMA 2X1XR 2E6JA 4OGYH 3CJJA 2EYTB 3CFJA 4JKMA 4NWUH 2LTQC 1CXFA 2IG2L 1ZA3A 1QFWL 3QDGA 2QEJA 3DI3B 4L4VA 4YWGL 3TVMA 1CBVL 4JFYB 1KXTB 2VDML 4PV8A 3F7VA 4PJEE 4XH2A 2UWEA 2Y7QB 3P4NA 1UCTA 3RVUD 4LQFH 2C1OA 1QFWM 3KPPB 1VCAA 3QB7C 1I8LC 4PJIA 5E8NB 4FQLL 4RGNB 3IU4L 4CADB 5HVHC 3KYNA 5GSVA 3HLAA 5TE6H 5D2NE 1MIMH 5CZXD 5A2FA 2A73B 1IAIM 1CDHA 3GSNA 2Y07H 5C3LD 5L88H 4K7PX 3WIFB 4U1HA 5I9QB 5HHNA 4YX2H 1JZ8A 2HRPH 1N4XH 1R5VB 3QUYB 1BD2E 2Z8WC 3TNMA 2VKWA 4H8WH 3KPQB 4XMKH 5HJ3B 1XF3A 3DYPA 1LE9A 4U1KA 5CGYD 1OSZB 2R2HA 4NUGH 2XTLA 3O3BB 3GMRA 4DOHE 4HK3J 1WBZB 1ZHNA 3DGGB 2NXYD 2FJHB 4Z7OF 4NSKA 3FL7A 4FXLA 3K7UA 3KPRD 5GGRY 1DQML 1MPAL 2OJZH 3LQZA 1T03L 1OM3L 4HFUL 5H35A 1MREH 4Z7VA 2OQJB 5CLWA 4KROC 1AHWB 1G7PB 1OGAA 5EC1B 4PGEB 4LFHD 1QLEL 3BZDA 3RHWF 4BELD 1ZHKA 1N0LA 4WWKC 3UO1H 5E08L 3D2UA 5D6DC 1I1AA 2J2ZA 5HGBB 1KGCD 3LHPL 3QXAB 5IB4B 5DRXB 1C12B 4JM2F 3MRJB 1LDPL 4HK3N 2NW3A 1O0VA 2HJKA 4ZAKB 4XCCH 3PGDB 1GC1L 4FMKA 3LN5B 3LKOA 3DWTA 3PP3K 2DQGH 4NGHH 2DJUA 4J8RB 5JIHA 5I30L 4WU7A 5CHNB 4EUPB 5IB2B 2A6KA 4XP1H 1A7PH 3CVIH 3RJDA 1E27B 4LSSL 4C55A 5DHYB 2D03H 1NCBH 1WBXA 1EX0A 1RUQL 5KZCD 4LIQH 4PLKD 4MA1C 3PP3H 1MELA 1B2WH 4Z9KB 5DK0A 3EDFA 1TZHA 4BJLA 1I9JL 2R39A 4X7CC 5J6GA 3NCYS 3NCMA 1Z9SA 2DWDA 4IDLA 1LK2B 5EIIA 1MCSA 1MJ8L 2NY1B 4QF1B 4BFBD 5BMFH 5H94B 3WL9A 1JZ4A 1Y18B 3EDJA 3EO1B 3HC0A 2WNGA 4OV5A 1QYGL 4LDOB 4JPVL 1EEZB 3GJFB 1A6PA 4NUJA 4Q97A 5D1QC 4X8XA 3WO4B 3RJQB 5C0JA 1A1MB 4IBLT 4XP4L 2APWA 1PKQA 3AS2A 1WICA 1UVQA 1HILA 1J12A 4UOW0 2LVEA 1EJOH 4LEXL 2HFFA 5HHPB 4LKXA 4X9HA 4DN3L 4YPGB 4I3GA 1UC6A 5I17A 1A6ZB 3MMEA 4LOUC 1TETH 4GG8B 4UDUB 3VFUA 1BHGA 1HNFA 2MCPH 4ZYKB 4DGYL 3RBGA 5CD5D 1S7TA 4IRZH 1T1ZA 4ISVB 3UTSE 3VWJB 4GMTH 5DD0L 2WUBH 4BUGA 4RNRA 3HE6B 4YXLH 4OCNC 5ID1A 1OPGH 4Z77A 4HKBB 4RAVA 4NQSA 1F11A 2LE9A 3QHFL 4X6DE 5FYKD 3G5XB 4MXWH 1U8QB 3C5ZA 2FBJH 4ZPTA 3CSBA 4HGMA 3CZFB 2R0WH 4BK4A 1I75A 2ZSVA 3BGAA 1J87A 4D9RD 3EYUL 2B2XH 2DL9A 4CN6A 3IT8D 1FNSH 3SJVB 4E41E 4LBEA 1N2RA 5JIPA 3VA2C 1WCQA 2P5WB 2GITB 4KK5C 5I15L 4M9PA 1DDHB 4CMMA 4JKPH 4G43A 4DWHA 5JA9A 4Q9RH 3E1F1 1FLTX 1SBSL 5ENWB 3QXUA 1LWRA 4H20H 3RGVC 1JF1B 2Z31C 5BZWA 4YE4H 5HDBE 5KVFL 2XKSA 1QLFB 5TJWK 2D7TH 4RAHA 9CGTA 4ZO7A 5I66A 2F54D 3VFVA 4LHUD 2VDKH 4FFVC 3SPVA 5IKCB 1FGNH 1MCPL 3RZCC 2HFEA 4N8VB 3CCHB 4K94L 1FFNB 3FFCB 4ZG1A 1SJHA 2VNCA 4OCXH 5IR1B 3S5LA 3UEZA 4F7EA 4L8BA 3TYGL 5JUEL 4Z7UA 1JBJA 43C9A 4UMGA 1A7QL 1NUNB 1XIWB 4NO2B 2HG5B 2QKIB 3KLAB 3U9UA 2VLKB 3JUZA 5CJQL 1NBZA 1QQDA 5B38A 1OTUD 4YFEA 1BJMA 3QDME 1SHMA 3BUTA 3V6BR 4OFDA 3S4SA 1AQDA 4FABL 5MEQB 3EOAB 4XNXH 2H26A 3BH9B 1OY3B 1NDGA 1X6NA 4GW5B 3KAAA 4OTXH 5IFJA 3BKJL 1NANI 3QEUB 3IDJB 5L2KA 1UB5A 2NY7H 4DK6A 1HH9B 1FL3A 4I0PA 3NPSB 4FFYH 2FL5A 4KJQD 3VMPA 1A3RL 4U1NB 4LNRA 3S88L 1ADQH 4ZPVB 1G7JA 5TDNA 1UJ3B 3UJIH 5HDQH 1JPSL 1ZLWK 5E9DD 4MNQA 3F7RA 5J13C 4DN4L 2B5IB 4LCYA 3TM6A 1H5BB 3D3VE 5B8CC 2DB8A 3ARFA 3BPNC 3MV9D 3QXVA 2A9MH 1SJEA 5HI4D 1TVBA 1GPOL 1ZLWH 5C0IA 3SBWC 1IGMH 4RGNE 2NY2B 5F3BB 1IGCL 4IIQA 2W38A 2WLZA 5LWYL 5GHWL 3KS0J 2AJUL 1FBIH 4OM1L 5GGVY 1MEXL 4G8GB 4KK9C 1FH5H 3ILQD 4Q6IB 1TXKA 5DJAB 1XGYL 3Q3GA 5GGTH 5ESVA 4B7IA 2EKSA 5L2JB 4PP1D 4WUKL 4ZUUB 2YBRB 1C1EH 1CFTB 1NPUA 4M1DL 1AXSB 1WIPA 2K3TA 4CJ1A 3OJVC 3JTTB 1UENA 3SQBA 2EEDA 1L6ZA 4PJDA 2B4CL 3MQIA 3DMMB 4LRIC 5BV7H 4LLDA 3MRFB 1UB6B 2YUVA 4DZ8A 1UKQA 4X4YA 2DKUA 4G9DB 4XXDA 2R15A 1OCWL 3MBEB 2NY3D 4HT1L 1F3DH 4TRPH 3FJTA 1MRFH 4Z7WA 5GGSA 1NEZG 2FNBA 3IFOA 5C07A 2WLYA 1MHEB 4ODTL 5E7BA 2I07A 4RAUB 1H0DA 4HGWA 1B3JA 4Y5VA 4HUWA 2X4OB 2X4TB 3H3BC 5FUZH 3V5DB 2VC2L 1UWXH 3CLEH 5EO9A 2IAMC 4ZQKB 2FYYB 4M6AA 3TFKD 1CGWA 1JHKH 1AC0A 3CX2A 4FQCL 2G9HA 2NMSA 4RCAA 2J6EH 5GS0C 5DI8A 3QUZB 5T5NF 3VXMB 4JZJA 4JVPA 3JWDC 1NBYB 3R8BB 3WXWH 1RUAL 4WY7L 1KJ3H 3PE9A 3L7FA 1CFSB 2DWEA 3ULUE 4U7KA 1YY8A 5T1DL 4QRSB 4DKFH 4ONGL 1HEZA 4H1LB 3ARWA 5ACMA 3S5LG 5C0BD 3U2SB 4Y4HD 5L7XH 3N1PC 1FNHA 3CH1B 1RHHB 4OZGB 5D2NC 5F1NA 3H7LA 3Q6FB 4E42B 3G5YA 32C2A 4HEME 1NC2D 1S7VA 1RUML 3U0TA 2AJYH 1MJUH 5F7EH 2IFFH 3BISA 4MAYB 4WGWB 2HT2D 1S78D 1I8LA 5DEGA 3VDCA 2GTZA 3RWIA 4PLOB 4L29B 3L9RA 2YPKB 4B5EA 3EBAA 4OZHF 4G80A 3RVVC 2DDQL 1DFBL 3C6SB 1G9EA 3U1SH 4JZOA 1NMBL 2VDQL 5C08D 4G9FB 4OQTH 4MJIA 5DRZB 2F5AH 3FO2A 3FAXA 4JFEB 4LLUA 3NZ8B 4R97C 3IFNL 2DMKA 4YC2B 2VLME 3BX7C 2DRUA 3IJYB 4GW4B 3VXRA 4BUHA 3IU3B 2R0LH 4Y7MA 1OGTB 2VQTA 3SGKC 4U05A 3RDTC 4GSDH 4JRYD 1UM4H 4OD1L 4P23D 4GW1A 5JNYB 3RWJA 2WP3O 3DIFA 1KJVB 3C6LB 1QSEB 2VQUA 4JGJA 5B22A 1IGYB 2Y1VA 2ZPKH 2PW1B 5SWSD 4OCRH 5E8EB 2XN9B 3EKCA 2BVUA 3MLZL 4R8WH 3GKWH 3AU1A 3CFEA 3TF7C 4J1UB 5FO8A 5KBNC 5KVEL 3B9AA 3VXPB 1R5WB 3MXVH 5INDB 1P4IH 5LQBL 4YZFE 5HDLA 1EO7A 4GUPB 4G3YH 4M6NL 4L3CA 5BVJA 3FQTA 4ZS6D 1G7LB 1S5HA 3QO1B 4OFIA 4WWKA 5DVOA 5D6DA 2X9XA 4O51A 4YIQB 5KS9B 3G04A 1CI5A 1I7ZB 1AO7A 1D9KC 4YHLL 2PW2A 1A7NH 3HUJF 1YMMD 5KVDH 1SEBB 3TBWA 1CLYH 1BM3H 3LN9A 2OR9H 4OBSA 2YC1B 2VB5A 5CEZD 3SJVE 2EIEA 3VWKC 1CWVA 3ESUF 5MI0C 2P5WE 1P84J 3KG5A 4WU5B 5C1MB 1AE6H 5FYJD 4P5KB 4YHKL 4K55A 1U8LA 4I77H 1RIHH 4HWZB 3WDHA 2PO6C 1WAAE 5TH2B 1ZOXA 1LK3L 1AGDB 2WZPD 2B1HH 4U3CA 4CNIA 1MFEL 1OAUL 1INQA 2BY2A 2UWEF 4MB3A 1R6VA 1TCRA 1BECA 5I6XC 4JFXB 4MDIA 4U1JA 5D1XB 5DVLA 3M17A 4PJIF 3W5NA 1EFXA 2HWZL 5K33A 3I50H 4ETQB 3BXNB 3FFCE 2I9LA 3ZLQC 3RGHA 1J86A 2C7UB 4JEGB 2WINA 5D1QA 1FZJB 4QRRB 5I76B 3HFMH 5DMKA 1KIRB 2VLKE 5IMKA 4L3EA 1EXUA 3QWQB 4FFZL 4NKOB 1A6WH 1DTUA 1C16A 4OD3L 4QHUA 2J12B 4JPKH 4WFHE 3MOQA 5D1ZB 2JLLA 2ZOLA 2I60H 3IETA 4JY5H 1VKXA 3H9YA 4E0RA 1FG9C 2CSPA 2E27H 1NGWB 1TJGL 2BNRD 2PKDA 5F7FA 4KVCL 5D96C 2JTDA 3WUWG 3X3FH 3H9SD 4N0RA 4K7FA 4K3GA 3CDCA 3CDFA 2VL4A 6FABL 5DR5L 4I5BB 3PWPB 2NLJA 1VFBA 5BVPH 4WW1B 2AJZA 3B83A 3B2VH 2PXYB 1BZ7B 2P46B 2W60B 3BZ4A 3QCTH 3IDGA 4KRPD 4NDMB 3QAZC 3TH2T 2DD8L 4M6OL 4GKSB 3A0OA 3O3AB 5I16A 2EDJA 2GY5A 2XWJB 3MC0A 3WEXB 1U91A 3K46A 4XC3L 5K9JL 5SX5K 4F58H 1JV5A 1XF5A 2OMBA 4Q0XH 4YHYB 4NBZB 4QRPB 4S1DC 2A9NH 4G8GE 1FFPA 4OLUL 4Z7NF 1RQ5A 1NSNH 4XCNA 2A1WL 1OF2A 4LVHB 4QGYA 4L8CB 1ACYL 1PQZA 4YDLB 5C09D 5EUKB 3V4UH 4Z18A 5IGXH 4EDWH 1VGEL 3HNSL 3D18B 1MFDL 1JPTL 1ZE3C 4G8EB 1I8KA 5TFSL 2C3VB 5ICYB 2FATL 3S34L 5SX5H 2DTSA 4NYLA 1LEGB 2QQLL 2Z31A 3HMXL 3RGVA 1BPVA 1MLCB 2CO6B 4NFCA 1M7DB 3GSXA 4M7JH 1W72L 4X80H 5DUMH 3VXTB 4P2QD 5DVNA 4TVPE 5JW4R 4K3EL 2EDRA 4PUBH 1YJDL 4K8RC 2GJ6B 4EOWL 4WDIA 3PWJB 4IEFB 1I3RA 5ETUA 1VEMA 1DVFB 1PG7W 3RZCA 1E4WL 4LVOC 5HHMD 4V2CB 5JIKA 1JNHB 1QLRA 2AK4A 2WW8A 4NC1C 2ZUUA 2MTPA 5JPMA 4GBXC 2Z35B 3GMLA 1G9MH 4L8DA 3BKMH 2J88H 4MA3B 3LD8B 2JB6A 5E00B 3O8XB 2BNQB 3BW9A 5T5FL 2M8XA 4CMHB 8FABB 3HPJA 3SGEI 1LO0L 3CAFA 1IQWL 1HHGB 1YNTA 5DK2A 4ZS7L 3K2UH 1AGBA 3RTQD 2MOVA 1N59A 4K71B 3LQAH 1C5BH 3DX6A 4HCRA 3MNVB 1KB5H 4W81A 2A6IA 3U9PL 4PTUA 3U4EB 4LLMA 3HR6A 5IEHA 3VXME 4AG4L 3GI9H 2AJXL 3NN8A 3JWOC 3LEVH 3RY5A 2OTWA 3OJDA 4PS4L 1G6VK 3V5KA 1DN0B 2APBA 1S5IL 1LP9B 3RWHB 3LB6D 2ADIA 3BIBX 2OK0H 4R4FL 3P11L 2FZ3A 3DSNA 3R0MA 4G5ZL 5C0GA 3BZEA 1FVEB 1NBVH 3C5JA 5I1CL 2HFTA 3VGAB 4AH2B 1D5ZB 4OZGE 3WE6B 5B8CA 5T3XD 5DMGC 1DP0A 1N8ZB 2GK0A 3D39A 4ZNEE 5HVGB 5FV2A 1S7WA 3SBWA 2YKLH 2VDNL 1R3KB 2ED7A 4AT6A 1KJ2H 1K3ZA 2AGJL 5FHBL 4DVRH 2BVPA 3VD9A 3QSKB 2XI9A 4ZSOB 4U1LA 3N06B 4G9FE 1HYRC 4AIOA 3KNBB 4JFEE 2COQA 2K7QA 3F5WB 2ZUQB 4NT6B 4DUWA 5ID0A 4JRXB 4M7LT 1MCCA 1BIIB 4XNZB 4HIXL 4JFHE 3MRRA 5J06A 3BDYL 5JPNA 5FDYA 2FSEA 3A6BH 2RGSA 3FQRA 4LRIA 1UFUA 5HI3C 2F19H 3VGHA 2OX5A 1QSEE 3C9NA 1IAKA 1JYWA 2VL5A 2RFXB 4KJYA 4FMFA 2XN9E 3H42L 3RP1A 1S9WA 2NY4B 5DO2C 1PEWA 1Q72H 1LEIA 3RBSA 1UQSB 2OI9B 1P6AB 4JVUA 4M43L 4JO1H 2IAMA 2BX5A 3MNWB 4Z7UF 5GRUL 5KS9E 3MUZ1 2IANB 4P5MB 2VZUA 1JL8A 2FEEI 2AV7B 5FYJU 4PFEA 1KUMA 4KVNH 1P4BL 2XA3A 3BP5B 4WTZG 3UTTB 2BSTA 2Z9TA 4PJEA 4NRYB 1JPFB 1MCBA 3GO1H 1EEQA 3U48A 2V5YA 3KPSD 4X99B 2GIYA 3BWAB 2HVKA 1YDPA 2NY1C 4JQIH 1V8HA 4N0UB 4XHJC 1CDIA 3WHXA 5SWZB 2WWKT 4NWTL 3RY6C 1IILE 4XNQB 3HPLB 3AXLB 2CUHA 1JHLL 2R2BB 4HWEL 5D2NA 1MAKA 4PJ9D 3ROLA 5CD3B 1D6VH 2C26A 3OKEA 2DQFA 1RIUH 2VLRB 1B6UA 1NFIA 1K8DB 4KQ3L 5IVOA 1A3LH 1CE1L 3D85D 3C2AL 3DUUB 4I3SH 1CVRA 4GRLD 2W9DH 5LG1A 3P77B 1JNNL 4NNXA 4S11A 1DUZA 3OR6B 5TPWH 1MVFA 4BZ1H 2XYCA 4Y4KB 3HNVH 4TTDC 3L7EB 4LL9A 4QRRE 4QTIH 2X09A 2QSQA 3MRLB 2XA8H 2A2QT 2WK2A 5JW4Q 4PRHA 4LU5H 1VADB 1T20A 2ITCB 1HDMA 2ED8A 1ZANH 1RIVH 4HZAA 3HE6C 2ZCLH 4PRDA 3RDTA 4A6YA 4PJDF 5GISL 2VITA 5D2LB 3IB4A 4JFPA 2GCYB 2F74A 1SYVB 3UTZA 4X6BA 5C2BH 1AXTL 1AD9B 5CCKL 4GXVH 1H3GA 1S9VA 4NQVA 3NFNB 3FB7B 1RZFH 4PGBA 1JK8B 3ZKND 4K2UH 3M1BA 1MHCB 4RISL 3ZYZA 3PWPE 4PJ8B 4Z7WF 3E6HB 5T3ZD 5F7DA 2A38A 3NIDE 2AXFB 4PGJA 1S7SA 1MCQA 3ZSSA 4XCFH 4MD0B 2LU4A 3FONB 3E0GA 5GGRB 4KY1L 3REWA 2NY0B 1D9KA 4W6WB 5IB3B 1YEKH 4R9HA 3VE0A 1YEJL 2EDLA 2IC2A 5IMLA 1G0XA 2JB5L 2DKMA 3TPUA 3HR5B 5GJTL 5HPMB 4JPWL 3VWKA 4FZEH 4QRPE 3GSNL 2IPKB 5ITFB 2ORBL 5F7UA 1EJ6A 3IDIB 3S97C 1G1YA 3VFMA 1N64H 2BFVL 4LCWA 4Y2DD 2YN5A 2GSIA 4GKNA 4HIHB 2UZIL 2OSLA 4NZUH 2PO6A 2R29L 2UY6A 3UYOD 4QOKB 5EWIL 4PRAB 4FQ2H 2GJ6E 2NYYC 1JNLL 1HKLL 4R4ND 3I75B 3BKYH 3GMQA 3W81A 2BVQA 2G60L 3MROA 1JRHI 3X11B 4LSTH 3ZDZE 2WMPA 5FUOL 1FGVH 1F4WH 2DQHH 3QQ3A 1CD0A 1KJMA 4NO0A 1MCWW 3GRWH 2BNQE 5JOEA 4R2GD 1AGFA 2NY5C 4L4TB 3BAEL 3MCKB 2X4PA 3U7YH 1DBKL 4L8SB 4UT7L 5HYJD 3NPSC 4ONOA 3U82B 3HN3A 3UTSA 1I1RA 4R90L 1FQ9C 3SKMA 2XFXB 2HN7B 3EJZD 2HVJB 4D0CA 5JHDB 1Z0MA 2CMRL 1UJ3C 3BD4A 2CKBH 4IRJB 2YSSB 5IBLD 3ABZA 3SCMD 1KT2A 4LHQB 4LMQI 5JQ6L 2NX5D 4X6DA 3DBXA 3DJ9A 3QJHB 4OLZH 4WW2C 5C3TA 2NTSP 3WYRA 4P4RA 3VXNA 2CUIA 4UU9A 3ECBA 1LP9E 4NC2B 1NCAL 4P4KB 2ARJQ 3L3OB 4E41A 5F9OH 3LKNA 2FIKB 1CQKA 3SKJH 2VH5L 4F2MB 4AL8L 5L8KB 5MP6H 3DURA 1BIHA 5ILTH 1QSVA 2X7LA 3CK0L 1X5KA 4HKJA 1YY9D 4FXKB 3O2WH 1XGUB 4QXTA 1YEIL 4EQ3A 5CUSH 1NGZB 3BQUD 4LCIH 3PGCA 4L4JA 3QPXL 2VDOL 2APTA 5EOQH 4I2XB 2X4UB 3DMMC 4OFYD 2HKFH 1TZIB 1MY7A 1QEWA 4ZSOE 4P9MH 1GH7A 5C0AD 4NQED 3RPIA 3MYJA 3NBNA 5BQ7A 3MBEC 1P2CA 3TWCH 2L7JA 4YHNB 1IGFL 4XI5C 3GSVA 2ATKA 3FB8B 4JRXE 3L3DA 3SDAD 4U31A 3JTSB 4BQ9A 4D8PA 4W6XB 1R24B 4R0LB 1G6RH 4WO4D 3VW3L 3RVTD 1T0NA 1NFKA 3WFHB 5EU3B 4APQC 5I74B 4OM0L 3IDUA 5BRZD 3WS6C 4ODXB 4OZFB 5C7XH 4OZ4A 5HBBA 2J5LC 2VXUL 4D0DB 2CXGA 3O2VL 3HB3C 5I1KH 1WISA 4GBXA 1MHHB 4LARH 5C0NC 3QUZC 3VFRB 3DROA 4NO5A 2X40A 3OKKA 1YUHA