5TGBA

Structure of chimeric 02-cb fab, a vrc01-like germline antibody
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
223
structure length
221
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDGWSGWYFDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 02-CB Fab Heavy Chain
publication title Differences in Allelic Frequency and CDRH3 Region Limit the Engagement of HIV Env Immunogens by Putative VRC01 Neutralizing Antibody Precursors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 221
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tgbA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tgbA01
2VDLL 1GHFL 5A43C 2I5YH 4HKZB 4WENB 5C2BL 4LPCA 4WTXA 1S9YA 3QRFM 3TO4C 4F7TB 4WY7L 2W9DL 2FWOA 3KPOA 1JGDA 2H2PC 1VHPA 3KYOA 4OFPA 3KPRA 4E42B 4PP2B 4WFHD 3GRWL 4Z95H 4G42B 4GMTL 3FFDA 4YDKH 2JJSC 2NTFA 1U8LB 2PW1A 3MRCB 5H8DA 5I16A 4L4VD 1WZ1H 2WWMC 2Z8RA 3S96A 4H1LB 3SDXF 2NY3C 1JZ2A 5I1LB 5DMJB 5ITBL 4PJHF 3UJTH 3UTPD 4F57H 5F96L 1BIHA 5AAWA 4KRLB 1OCWL 4X7SH 2R4RH 1I7UB 4G3YL 1BFSA 5MP6H 5F9WC 3HFML 3JBG7 5K9QI 5EZLB 4HUWB 1D9KB 2E6QA 1Z2KA 4GAJL 4LCIH 5I1JH 3STLA 1I1AC 1DSFL 3AS2A 3BAEH 3OKEB 3GKWH 4KV5E 3K7UA 3OAUH 4PB0L 6FABL 4YFLI 3AAZB 2AJSH 5E99H 4LLUA 1JWSB 3MLPA 1HHIA 5T5NF 3BGFC 2HFEA 4M7LT 4PG2A 4HAFA 3VXRD 2FX7H 3F7QA 2OCFD 2PW2B 2IBGA 4ODWA 3I75B 1ZHBA 1EFXA 4N0UB 1TJIL 4DGYL 3VXTA 1JMZA 1DANT 3P4LA 4ONFH 5KG9A 4J12A 2YN3A 5HI5C 1BQSA 4UNVA 4OZFA 1H3PL 1K8DB 3BZFB 4OZHE 4YHYC 4TUOA 1IGMH 3NABH 5E4IA 2VH5H 5DD0L 1BHGA 2NY0D 5CBEB 4JFEB 1CD1A 5JQHC 2HRPH 1EH9A 4HD9A 4G8IA 4XGZA 4AIZB 3DURB 2JJVA 1AR2A 1DQLH 4LDEB 4ONGH 5GS0C 4J3XA 3EO1B 5FGCE 1C12A 1N6VA 2CK0L 3S34H 1HINL 1QLRB 4ZYKA 2FH8A 5HYJA 1YJDC 4LLMB 2FIKA 3Q6GL 5D7JD 1W2KT 4E41D 3O4LE 2JJWA 3IFPB 4ZXBD 3U2SA 3SDDA 3LQZA 1I7RA 2UWEF 4S1SH 2OM5A 4Y7MA 3SQBA 3NPSB 3NTCH 4JCMA 2YD8A 2OI9C 1DL7H 3IETA 3KYKL 4J3TA 1OPGL 3T3PE 2Z31C 4ZAKA 1JPTH 4ZD3H 1PD6A 5EA0H 1NDGA 4APQA 4U4BA 1C5BH 3DARA 2HLFC 1FG2B 3TCLB 5IVXF 3QEUA 3ARZA 1U3ZA 2KZ1B 5T5FL 3L5IA 1INQB 4RX4D 4Z8FH 2EC8A 3K8KA 3KPPA 4M1CD 2I07B 3N50A 4KAQL 5CZVH 1M71A 3OXSB 2NW2A 2B1AH 3MRNB 2A1WL 2Y23A 4OIIH 2ATKB 3BUTA 3QZWB 3GO1L 1OWWA 1WBYA 1ITBB 2ADGA 1JGUH 3HAEA 1YA5A 1ZKAA 3QDJB 4TNVK 4IIQB 3VI4F 2M1KA 4CL7A 5JPMA 5F9DC 1A6ZB 2EYTA 3O41A 3I2CL 2W0PA 1CD0A 4XMLH 2IPKB 3KNBB 5HVHB 1KPRA 4QHNB 4WRLA 4WVRA 3TBYB 3UJJL 5FOBB 3QXDB 4LCCA 3MV7B 5EU3B 1MIEH 3TCXA 1NKOA 2HKHH 3P0YH 3ROOB 5J89A 3VJ6B 4JQVA 4C56B 1UCBH 4S2SB 5F7YC 1A7RH 3C5ZA 4I9WE 4LLQB 4WGWB 5IBLC 2WANA 3P73B 3HE7D 2MKLC 3MACH 2Q20A 3MODL 1BF2A 1AXSA 2ZJSL 1IM9A 4PRDA 3LKNA 5F1NB 4ODSH 5D7KE 2N7AA 4YQXH 3STZA 1BOGB 4V1DA 3S35H 3CK0L 1I1YB 4G9FE 2IEPA 3LKQA 3GUTA 4RIRA 4PJFF 2QQLL 2V5MA 3SDXE 4KKNA 5D2NB 4PJHE 2D0HA 1CG9A 1UB6A 4Z78B 3ALPA 4WIQA 5IW1B 3IFLL 5E6IC 3QIBB 5BZDA 1QRKA 3GK8L 1XGQA 3G6JB 1JRHL 5DUMH 3GSNL 2ARJQ 4GRMA 1BZ9B 1QSFE 3WDIA 3FFCA 4RFEB 1DFBH 3D39E 3MRJB 4B41A 4HXAH 1UWEH 1EO7A 3TN0B 4RCAA 4WHTA 3JTSB 3E1F1 3D6GA 5EOQL 1E6JH 4WU7B 1TCRB 2GI7A 3O3AB 4KDWA 3S8WA 4P4KB 5DJ0B 3BGMB 2WQ8A 4ONOA 5DMIL 1QG3A 2WM0A 1VEMA 3OXRB 2IBZY 5FCSH 3SE3A 1AKJB 4K3JH 4PTTA 4KQ4H 4WW2B 3WEXA 1BQHB 3ARGC 2GSGA 3G04B 1XCTB 3WFCH 1S5HB 2ZCKH 1VCAA 3CDFA 1NL0H 1S9WA 3HA0A 4RAUB 2CH8A 1YYLH 5E2JA 3U0TA 5FGSA 1BVLB 3BYTA 3QI9A 1FGVL 4I0KA 4Z7WB 1S7QA 2LVCA 4C83A 4K71B 3MRPA 4DZ8B 3EJYC 2GAZB 4XAWL 2OP4L 3TC9A 2BHYA 2WINA 3EYFA 1LK3L 3H9HB 3CVIH 3OSKA 4I18A 2GY5A 4GS7B 2ADJB 3C09C 3FO1A 1QR1B 3T0ED 4JDZB 3P0VL 5FYLL 3Q5OA 2DTMH 4WHDA 4PJDE 4G8EB 1MCWM 1JN6A 3BDBA 3QXAB 1GOFA 3FT4B 5I19L 2ENYA 1PQZA 1FVCB 5GRWA 4NPYB 4ZG1A 1C08A 1OY3B 3O3BB 2E8ZA 3QO1A 1JI2A 3B3IA 3KPNA 4S0TD 3DVFA 5BJTA 3ARDD 2A73A 3TBVB 1QBMH 2AGJL 3KHQA 2H9GB 4QHKI 4TNWK 1G7JA 4RFOL 3T0WA 4YPJA 1ZAGA 5IVXE 3FB6A 2FGZA 4MJID 4NOBA 5AG8A 4JDTH 4MMXC 2BFVL 1RHFA 1CXLA 1KPVA 3DVGB 4HK0B 4O51B 1WCBB 5I66A 4PRID 4G43B 4JFZL 1YNTA 3GI8L 3T0AA 3V5DB 1A6TA 3VRJA 2BSSA 4OM0H 4ZSOA 4QEGA 3FQUA 1IGIH 4I0PA 1RZ7H 5DJ6A 4Y2DC 5D93C 4KI5C 3X3FH 3VI4E 3TO4D 5FAAA 3TNMA 3WFDL 2ZSVA 5DR5H 3NIGE 4TVPD 2AV7A 5BMFH 1JZ3A 2H2PD 2UYLB 4HGWB 1FGNL 5IR1A 1ES0A 1J11A 3MV9E 4PYGA 5D1QC 2YPLE 3H0TA 1CGXA 4BFIA 4N1EA 4P5TB 4JG0H 1EXUA 3KWWA 1U0QA 3EIFA 2WWMD 3C8KB 2MTPA 1E27B 4ALAL 1DN2A 2EE2A 5HPMA 3AS1A 4ZUVB 2Q3ZA 1RUAL 4B50A 5DA0B 1WBZB 4IMLB 4OFVA 1DBKL 35C8L 2FLRT 1PZUB 4DQOL 4TSAL 2DIJA 5FM4A 1FZMA 3I02B 2IMMA 3GSRA 3D48R 4XPAH 4LK4A 4PJFE 4LVNB 3OJDA 4WV1C 4OQTH 4D0DA 1W72H 3E6HA 1QA9B 3FO2A 4LL9A 5DD1H 1D5MB 5BVPL 1VADA 3MRMB 3MR9B 1DVFB 3GDBA 4G6FD 3PXJA 1U91B 4GBXC 4IJ3B 3VFOB 1FVDB 1QYGL 3ZSTA 2D2OA 2ZOKA 3B9EA 4X9IA 4JGMA 3QDGB 4FZEH 4K23L 3GB7A 5HI5D 1YUHB 5C0AB 3VFVB 1V05A 1E4JA 1KF9B 1IGFH 1VPOL 4ZS6D 5FIEA 4OLZH 1XF4B 4TVPL 4Y5VA 5J6HA 2BX5A 3TZVA 3U0WH 1VFAB 1BJ1J 4R97C 3CCHA 5KW9H 5GS0D 2J8UF 3MYJB 4QRTA 5E1AB 3OB8A 4XB7A 1QP1A 1JZ7A 3QG6B 3AS0A 2H8PA 2PYEB 2YSSB 1F3JB 1TQBC 1EA9C 1HSAA 1N6QH 4YPGB 3U0PA 3DGGB 4O2EA 3BP5B 1A1MB 5GISH 4KJWD 1XGYL 4F7CA 4G80B 3QWOA 1U8QB 5CCKH 3P4MB 5ESQA 4Y16C 5KOVC 1MCKA 2Y5TA 2Z31D 2ZG2A 5IHUH 4OCXL 1Q0YH 4Y5YA 1RU9L 1F3DH 3DGCR 1IQDB 3GI9H 5BV7B 5DRZB 3V52H 4JHAH 1JHKL 1NAMA 2ITCA 2HLFD 1F4HA 4A6YH 1X7QB 1U6AL 3NFSL 3E0GA 5ACZB 5BO1L 4HWBA 1KNOB 3U82B 3PV6B 3RL2A 4MCZB 4YGAB 2CLRB 3DO3A 4NC2B 2VLJD 1JNHB 3QHZH 1MJ8L 2XTJE 3BPCA 4DK6A 4LGPB 2CJUL 4CNIA 4QHUB 5KSBE 5CMAA 5C0DB 4XVTH 5LXGL 1V5JA 4KZEH 4PY7A 5T1KB 2J6EH 2XQBL 1EAPA 2AEQL 4Z7VB 3HCVB 4J3UA 1D5XA 1P4IL 4PJ9A 2FJHB 3P11L 2ED9A 1CFVL 1NLDL 5HVFB 3UEZA 1J9CT 4PRHA 1K4DA 3PG2A 3SGJA 4JN2B 1KLGB 1LO4L 3NIDF 4JPKL 3EZ8A 2ZZUT 5JHDE 2O5ZL 4NQDE 1X5ZA 3VG9C 5DQ9B 3IDIB 4PJIF 3GSWB 1PW3A 4PUBH 1WBXA 1IKNA 3P3YA 4UOW1 4X98A 2MPAH 2A83A 1OSPL 5IBLD 5HGDB 4P46B 4IHOA 1QLFA 4URTB 1A6UL 5H94A 3ZHLA 3ZKQD 4OZIF 1DQMH 4RGNC 1P4LA 2VITA 2Z35B 3MO1A 3CFDB 2VMFA 1QUNA 1MEXH 4FQIL 3OQ3B 4BZ1H 1WSST 1MHCA 3RWJB 1KIQB 3AB0B 1T80A 5EORH 5BOPA 2B4CH 5FF6A 3UPRA 4HH9B 3D0VA 3BRGC 3A0OA 1YEIL 4OFYA 3U9PH 3NZHL 4FQJH 2PXYC 4PG9B 2CDFA 1I9RH 3S5LA 3PGDB 5E6ID 2YBRB 2V5TA 4OM1H 5B8CB 5EZIH 4M48L 3F12B 2LU4A 5E5UB 1U3HC 1VGEL 3IYLW 5EBLA 2EEBA 2OS7A 4FQ2H 1R5VA 4ORZC 2OL3L 4ZTPL 4HXBH 3U7WL 1NFDA 5C0EB 1LP9F 1FV1B 2ICWI 2X1OA 2DLHA 3CFBB 1JPGB 4XCEB 2XXCB 4HMEA 8CGTA 3MLRH 1A6WH 2C4FT 3KPRE 4XPTH 1A9EA 3DXAB 4GG8B 3MLWL 5HXMA 3LRGA 5TDNA 1TZHB 3CPLA 4M6OL 4OZFH 1QFWL 3ARGD 4GOSA 3T2NL 2HG5B 3LN5B 5A2KH 4XNQA 3MUZ1 4NKOA 5A3IC 3BUYB 15C8L 4K07A 3LV3B 4Y4HB 3PE9A 3RQ3A 5HHMB 1M6OA 5EUKB 3RUGF 1KN4H 5IB3A 3SE8L 1WWWX 3TM6A 1O0VA 3L3GB 1JTPA 1KEGL 1NQBA 3CFKB 2XT1B 3AXLB 4ZUWB 1SJEB 1D6VH 4L9LC 3FQXA 3LDBB 2Y06L 2YR3A 4GRLA 4KXZH 3E6FA 1GL4B 4OD2A 1F97A 4FQ1H 4MNQB 3RWIA 3EW3B 3MJ8B 2Q6WB 3TA3B 1H3UA 3SQOL 1JIBA 4X80L 4HDIB 4UT7H 4F8TA 3WO3B 4HX1B 1KSRA 3KAAA 3QUKB 1FFQA 3BPOC 3QQ4A 1A7OL 2VXQH 5CJ5A 1J12A 4OF8A 3H8NA 4U1HB 3EFDL 2X4PB 1JZ5A 4OKVA 1UGNA 1AHWC 4LMQI 4NNXB 4QF1A 3GJEA 4BQBA 1ZHNB 3MA7A 3GSUB 1RSFA 1UB5B 4IRJA 5B38B 3WSQL 4U3XA 5DQJB 1ZA3A 3KS0J 4R2GB 5EZJA 4NSKA 1DANU 1FL3A 2WBJB 1AD9A 2IQAA 3F8UB 3PABB 3SPVA 3WLBA 4G8FB 5EU4A 4JRYD 4LHUB 5IROC 2IQ9L 2VDKH 3D9AH 4TVSa 3NCYP 1EX0A 2AQ1A 1KJMA 1A5FL 3BKYH 1LO3L 3HAEH 3HR5A 4PREA 1T5WA 5HYJE 3SOBL 4HKJA 4MJ6A 4LPWA 1MLCB 4H0GA 1RJCA 4BSJA 1MCSA 2R4SL 1HH6A 1A1NB 2OMBA 4NT6B 4M7ZB 1DUZB 1I9EA 5FGBC 4Y2DD 1INDL 1LEIA 1FPTH 2OXGA 3LQAC 3QUXA 1CGTA 3WE6B 1RMFL 2NNAB 4X9HA 2X4NB 2VLRE 1JGEB 2CRIA 1N59B 2AXFA 3J7HA 5DZOA 4NJAH 4RA0C 5D1QD 4LRIC 3UTZA 5I75B 1M1SA 3GHEH 3I6GB 4ZPVA 1OP5H 1DBAH 4OCSH 5HYQA 4L4VB 3MLVH 3G9AB 1LO5B 3BPNB 4LLVB 2D31A 4PGZA 3HN3A 2I9LA 3HRZA 3Q5TA 4HHAA 4H20H 4D9LL 2F8VA 5EIQA 4Z7UA 2NTSP 4MA8L 5EIVA 1HYRC 2FYYB 3WUWA 3BJLA 2FX8L 1AQDA 5E7BA 5IF0A 3PXHA 2VDPL 4PJGB 4N5EC 3TH3T 4S1RL 3WN5B 1H9VA 3U36B 3RWEB 4MA7H 5SX4I 3VXRB 1GPOL 1I8LA 4OGAC 2YS4A 2D03L 3WIHA 2DLEA 2FR4A 2IMNA 2XNAA 4XCNA 2XKSA 3QCUH 2ICWB 1JFQH 3RIFK 4GBXD 3OAZK 4XPGH 4S1QL 4H8WH 3K0WA 4NRZA 2CO7B 2C3VB 4GRWF 3R1GH 1ZMYA 3JWDL 2QADC 1LP9E 2F53D 5FA4A 3PWVA 3RWDB 2XN9A 3IU3B 1OVZA 2NY0B 3O11B 1TVBB 1A2YA 2BSRA 2GJZA 4V1DE 3RWGA 4RNRA 1LDPH 4PY8J 2HYMA 1T03H 3ETBF 4NKMA 3BYYA 4U3CA 3EDDA 2X6MA 4HBQA 4HIXH 4HWZA 4NP4L 3FT2A 5D7JB 4E41B 4JRXD 5TQ2L 3QCTL 3PWLA 5IB4B 4ZXBB 5FUZH 3SDYH 4X5XB 5GGRY 4RMRA 3L3DB 3O3DA 1G7MB 2P5WA 3FFCE 1G9EA 4M5ZH 1WQVT 3ARXA 1UJ3C 2FD6H 4DFHA 1OL0A 2JK5B 2NMSA 4Y16D 4P2OA 1PKQB 4NQEA 1GAFL 1C16B 3FOLA 4RISH 5T5NG 1E0OB 2ZP0T 2IFFL 2CR3A 2R8SH 3FO9A 4I2XE 4YHML 3QSKB 3VXSA 4HJGA 1AJ7H 2LV4A 5HYIA 5KN5B 2NX5A 2QQNH 3DV6A 4U2ZA 3I9GL 1UADC 3GSNB 1I9JL 3MOAL 5BRZE 4UOJA 5ESVB 5L2KD 3VDBA 3SE4C 3A6CH 5IESH 1IT9H 3O2WH 4U6HA 4O02L 2F19H 1RD6A 3RA7L 1Q1JL 4YXLL 5B39A 5HHOD 3HZYB 4HKXA 2Y36L 3B43A 2O5YL 5I1EL 4YHIA 1VB9A 2CR6A 1REIA 4FNLH 3ULUF 3JTTA 1MIMH 3HHRB 4M8QA 5F44A 1CXEA 5ECJE 4DKFH 3G6AB 1KB5A 1A4KB 2XRAL 5D96B 2R2HB 1MJJB 1MREH 4UV4L 1ROWA 1OP9A 5GGVL 4OD3L 3JVGC 1G0XA 3W5MA 1CE1H 2GIYA 2H6PB 4PGBA 1CR9H 1P7QD 3OTTA 3OF6A 12E8L 4NCC2 2EH7L 1N3NA 2ICEA 1U8HA 3HE7B 4XAKE 2AAVA 2BCKB 3TBSB 4X6CB 4IOIB 3GSOA 5DRXA 2B5IB 3PP3H 1JF5A 4O9HH 4X83A 1C1EL 4MD4A 4F9LA 5CP7A 1RAMA 2IG2L 4R4FH 1VESA 5I30L 1KIPA 1OD9A 2BVYA 4JQIL 4ETYA 1CGYA 3VWJA 2G5BA 1MCEA 1NLBL 2IPTH 3T08A 1Y0LB 4HUUA 3MCLL 4MXVF 3SCMA 1YNKH 4NHUB 3DROA 4NO2B 2PXYD 5C0FA 1JGVL 1OTTC 2DL2A 3CFIC 1T1YA 1RUKL 1X5JA 2OZ4L 2VE6B 3VFMB 4KTYA 5AUMB 4F37K 1JCKA 1KFAH 2WUBL 3B5TA 5DJ8B 1M05B 4ZSOE 4YC2B 1U3HD 5JQ6H 1LE9A 1DLHB 5DHVA 1BAFH 1H8SA 2ED8A 2J4WH 1OAZL 3PWNA 4JM2D 1DQDL 3VU2A 5CEYB 4KK6D 3KXFE 3N85L 4OLUH 4MS8C 3MRIA 3H42L 1OP3H 5TFSL 4WU5A 3TF7C 3MTRA 1QPXA 5E2TL 1IL1A 4H88H 5CHNA 4GW5A 3F7YA 5TPWH 4K7PL 2X70A 1SMOA 5D9SB 5A3ID 1H5BA 3BKJH 3NBNA 3FQTA 2P49B 3UYPA 1FIGH 3SGKC 4UBDC 2G5RA 4KROC 4MD5A 2W65B 1NEZB 4PJ8C 4FFYH 4HFWA 3V95A 3UAJD 1J1XH 1YEGH 5LVEA 2FATH 3QQ3A 1A7QL 1C5CL 4KJYB 2EYSB 4DZBB 5EN2A 3BSZH 4M7KL 4UDUB 5C7XL 5IQ7L 3O6LL 1RIUH 5EPMA 2BOBA 2C3WA 2E9IA 3SGDH 1KACB 4LCWA 1EJOH 1JGLL 4MB3A 2DQJH 1NFDF 3T0EB 2DQHL 4X4ZA 3EYQD 2NYYC 3LVEA 5EC1A 5CKAA 1DN0A 2A6KA 3QFJD 5FA3A 4UQ2B 4I3SH 4NN5C 1WIOA 2A9ML 3HC0A 4OB5L 4PJXF 2R2EB 3CLEL 1S7XA 2DQUL 1DDHB 1YEFL 1NAMH 3ARDB 4Z0BL 1R24B 4YFLF 4EI5A 2XICA 1A7PH 2J8OA 4HWBH 1ED3B 3G6JF 3NZ8B 2I60H 3TT1L 4L8BB 3RRQA 1SBBA 2GTZA 1UYWH 2E27H 4OFDA 1MUJA 4MJIB 3C2SA 2OTPA 5L2JB 2NY1C 4HW6A 1MQKH 3GMNA 4U6YB 5MEPA 4RFNB 3VI3F 1MI5A 4W4OC 3GJFA 2D7PA 4PRIB 1HILA 2VABA 2ERJC 1HI6B 2HKFH 4LRNL 2ZCHL 4U31A 5F3HB 1CDUA 1SJXA 5F1OB 4DCQB 2VDNL 3ULVL 2Q86B 1CL7L 2HN7B 5C0IB 1P7HL 4MVBD 4L5FH 4QCIA 5IMLA 3TO4B 5FYKE 2BOCA 1D5IH 4WJ5A 5ID0A 2QHRH 5C6WH 5HDLA 3PL6C 4JAMB 1Q9WB 5DC4B 3HNSL 5BVJB 4JKPL 4YBHA 2HFGL 4ZNCD 1T0NB 1LE5B 1AXTL 2D0FA 2NY3B 1MLBB 2UUDH 2DQGL 2FJFB 2VWEE 2V2TA 2G9HB 4Z7QF 3P4NB 5DC0A 3VFNB 4EQ3A 1G7QA 1MFBH 5LAXB 2EXWC 5EO9B 5F9WB 3SKOB 3HZKA 1HDMB 1P84J 2YPKA 5HGAA 1Y6NR 4Q2ZB 1BF8A 3MLSL 4BH7B 5I15L 3WS3B 3BP7A 5IUSA 3D25B 4MXVE 2BVUA 1L0XA 4PJ5D 1HQRA 2CIIA 3MREA 1PG7H 4LDLB 1AGDA 2QSVA 3BGFB 1G6RA 1GGYA 4OGAD 4YDJA 4H25A 5GRJL 1HHHA 4PRHE 4G6FB 5HJ3B 1S7RB 1MWAL 5LQBL 1B3JA 4I3RL 3O0RH 4X0KB 5I76B 1UKSA 3REWA 3EYUL 1I1CA 2VDOH 2XZQH 2QADD 4RAVB 3BHBA 5C0BA 4M00A 4OJFH 2C3HA 2PO6C 4YHYB 1CU4H 3UTSB 4PLOB 1CDBA 3IVKA 1S5IL 4MQXC 2AKRB 2ARWA 1U2CA 1FN4B 2DICA 4XT1C 3QEQE 4Z7UF 2MFNA 1RZIB 3BQUD 3QPQD 4LQFL 5CZKA 1I7ZB 4HMCA 3OAYH 3EJJX 3UC0L 3DBXA 4HH8A 3O6FC 3DUUA 3LRHA 2IGFL 4QRRA 3O2DL 5IK3A 3O4LD 3HZMA 1B0WA 4CW1B 1CTOA 5FHBL 1XF3A 2HWZL 2BERA 5D1XA 2NY4C 4YX2L 4E5XA 4NN7C 3HRPA 4D0CB 4KTEH 5IB5B 4HV8B 5T3XL 3VXUA 2W0FB 4HLZH 4NQXA 1LHZA 4PGEB 4Y2OA 2OI9B 5EBMB 5D7LA 4JDVA 3RIAK 3X17A 2AI0L 3ROLA 4K7FB 1SMAA 2Z31B 4N1CA 3PDOA 4XTRC 4FP8L 4PYHA 1JBJA 3KR3L 3IB4A 4BZ2H 1BECA 5TE6L 4NFDA 4XBEH 1NFDE 5LGJA 4AEIL 1X4ZA 5DD3H 1HHJB 2GSIA 4PJXE 2F74A 4B7LA 5E6YA 1ZA6B 3IDYC 3O2VH 3UYRL 5J1AB 4ODXA 1W0YT 2XTJC 3KVQA 2HT2C 4JFOA 5KANG 4YUEL 2VLJB 4NDMA 2Q7YB 1QHOA 2C4FU 3MRFB 2M2DA 2AJVL 4XP9H 2DKUA 3MLUL 3ZDXF 1T4KA 1ZT1B 1FFPA 1P84K 1ZVYA 5CUSH 1EFQA 3G5ZB 2OL3B 4O4YL 5CJXA 3MLZL 4FFZH 2GT9B 4QRQB 3WO4B 2RFXA 4PJAB 1A3LH 4LLWA 1I7TA 1CLYH 5IHZB 3VA2C 5ANME 1SVZA 4MXWL 2BVQB 3BKML 5ETUB 2LFGA 4TRPH 2K7PA 4P49A 2E7BA 1NC4A 1UQSB 4UB0L 2R2CA 4F3FB 3KLAA 4I9WD 1W0VB 3E3QE 4NBYB 1X5AA 5EC2B 3RI5F 2Z93B 4FZ8H 4JPVH 5DSCA 3S36H 3GMOA 2UVFA 2YKLH 4FA8A 2VZSA 2YMXL 5D7KD 1AI1L 1TPXC 4ZFGH 5BW7C 2W07A 3DX7A 1L7TL 1QRNA 3TFKC 3DYPA 3BGAA 3OHXB 3AROA 4W70A 5D71L 4G9FD 4OZFG 2DLFL 2OSLB 2EDKA 1G9NH 4DN3L 5FKAB 1DBJL 4Q6IA 4ZUSB 4CMMB 1A4JA 3BKCH 1QR4A 3WHXB 5DQDL 3RGVC 4HK3N 4Z7QE 3OZ9L 2EKSB 2VZUA 5GGRB 3QUML 1ZWIB 3RWFB 5GGTA 5J6GB 2CDEB 2LAGB 5HYEA 1LO2L 1OTTD 3GMQB 1LO0H 1QSFD 4HQQL 5E6IB 1R3KB 2K1MA 1Q9KA 3D39D 1JWUA 1ND0A 1WC7A 2BC4B 5C0CA 2Y6SC 4U7KA 5I9QC 3VFSB 4U05A 5DMGD 3WIHH 3UBXG 5C08A 3MRBB 5JUEH 1UH3A 1QBLH 4JFPA 4OLYH 4NM4H 3FHAA 43CAA 1FJ1A 1NUFA 4WI4A 5HSFA 5IEHB 4MS8D 2XFXB 1MOEA 1X5HA 5E2VH 2DQIH 5KS9A 5FYJL 4HJJL 5MEOA 5DMYA 3H3KA 3TO2A 3ARGB 4AEFA 3QJFA 4N0RA 3LPWA 2AS5M 3LN4A 1W0WB 4XVSL 2C26A 5DK3A 3FL7A 4XNYH 1UVQA 4HZAA 3TIEB 4HFUL 5IB1B 1BGXH 5GPRA 2JB6A 1VENA 2XZZA 1F5WA 2XA8H 4FABL 1RZFL 4K3GA 3K8LA 4UBDD 1E4XI 3UPAA 1WAAF 4KROD 1MCCA 5GRVL 4PJ8D 4Z7UE 1KT2A 5D6DC 1OAQL 4P3CL 2BVOA 2CGRH 1A47A 4OD1H 1NBQA 2VSDA 4G7VL 3H7LA 4N68A 2H41A 4RSVA 1ACZA 3F62A 4OGYH 5T33H 4QOKA 1T5XA 4OAWA 5JHLH 4FXGA 3DRQB 1INEH 4L3CB 3TYGH 3C09B 5IVNA 1JZ6A 2GFBB 1MRFH 2NYYD 4X99A 1DE4A 2ESVA 2F5BH 4HT1H 3X11B 4BKLA 5DJXB 2J5LC 4JEGB 4GG6B 2Y4SA 1YPZB 4NO3A 1TJHL 1EGJL 1F4YL 3MRQB 1KCSH 2AXGB 1J05B 2XN9E 4NQCD 1BEYL 4KHXL 1RIHL 5F6HI 2DBJA 2YD7A 4I3GA 3W0WA 1SJHA 5FO8A 2Q8BH 4AT6B 4JRYB 1AR1C 1AY1L 2NY1D 3IGAA 3C2AL 1Q8MA 5GHWH 3MRKA 2Q7NA 1QFOA 3ZDXE 5K9OB 4C58B 3HLAB 1OAYH 1IC7H 4JZJA 1MCHA 3V6ZB 4N9GB 1SEQH 1V3MA 4Y2DB 3SE9H 1QKZL 5JZ7C 5D93B 2EDLA 4ZAKC 2CLVA 2P5WE 2EDXA 1ZLWH 1A14L 3A67L 5CEZH 3MV9D 4APQC 3CUPA 5EBWA 5D2LB 4KHTL 3PL6D 1RZGB 1N2RB 4HEME 2G2RA 5D1QB 2PKDA 1NBVL 4NQEE 3PWPD 2ZOLB 1F2QA 2XWJA 4QTIH 4QWWC 1CFTB 4L29A 4MZ3A 4NZJA 3FN3A 1FNEB 1P53A 4OCYH 1MCPL 3MBXL 3VXSE 1Q9LB 5ENWA 1YN7B 3OWEA 2X4OB 3R8BB 5K9KB 3FB8A 5MEQA 1TFHA 2DTSA 3FQNB 3KPMA 4JY5L 3NA9H 1E28A 1NPUA 2EXWD 4BSWB 4UI2A 5LGHH 1X4XA 1H15B 4XPHH 1QPPA 3MOQA 2NQCA 1FVEB 2EE3A 1NSNL 4PS4H 2DKMA 3WFHA 2AJUL 2BSTA 2KZWA 2R29H 3LKRB 5KAQF 4WV1B 4HAGA 5FHAH 5L9DH 2DM7A 4LARH 4HBCH 3QB7C 1BQLH 3RAJH 1JYXA 2DQCL 3D18B 4LCCC 4HKZA 3L5XL 4OTXH 2UV3A 3WXVL 3UTQA 5DHVH 4LNRA 3T1FB 3FOMA 3EO9L 3OL2A 4JQVC 4GBXB 5GJSH 3T8XA 3C5ZC 5CJQH 4YGVA 4PJBB 3VGBA 1DQQA 1EAJA 3ZKXC 2V7HB 2W9EL 1S8DB 4HPOL 3MRCA 2F53B 3NH7H 1A21A 1OSZA 2PO6D 3U46B 1G7LA 4XX1E 4XVJL 3K46A 1YQ2A 1CXIA 5F9AC 1P9MA 3H9ZA 4UUJB 1BX2B 3VFTA 5DVOA 4R97B 2EEAA 1OGTB 2IPUG 4XNUL 2MCPL 2GUOB 4TQEL 1U8IA 3SY0A 3VFGL 3O6FD 4G9DB 2YA2A 5EZLA 3HUJB 4MX7B 3BIAX 1NCNA 2FB4L 4JFHE 5GGSB 4JRXB 5TGBB 1NCBH 4KVCL 1WAAE 2NY4D 4AK1A 1TQBB 3U4AA 2H2SC 3DSFH 3L5WB 3W11C 5L0QC 1IC1A 2W0LA 2OTWA 4XHQA 3GHBL 1U8OB 2CLZA 1I4FA 2G75B 2WSKA 4K8RH 5FUOH 4L8DB 3T65B 4C55A 4XZUA 1F11B 1RHHB 4Y16B 4XTRD 1GZQB 3T0XA 4NNPL 5M7QA 1IMHC 3W39B 3I6KB 3P30H 43C9B 4G6ML 2CKBL 3SE3C 1N5YH 4LLYB 4AH2B 4QXUL 5FCUH 4PJGF 3L3IA 4I5BA 5J7CC 3CDGA 5CBEA 4PTUB 1FSKC 5DUBB 2HT2D 4UIMB 4R7DA 3QI9C 3O6MH 2H45A 4AIZA 5I18L 3GMMB 3L9RB 5HHOB 3CU7A 4UT9L 4DKEH 5FKPB 4JO2L 1WVZA 4ZPTB 5LCVL 4JN1H 4YXKH 1FC2D 3JV4A 5GIRA 3OPZL 4NQDD 4O58L 4QXGH 3DXAE 4LCWE 5CZXC 4LASH 5F7EL 5JR1H 3QNXA 3VG9B 5C1MB 2VIRA 3N1QC 1IGTB 2A74A 1P7QB 4H1LG 3CFCL 5FK9B 2PN5A 1WZLA 4P4RB 3ZYJA 2IH1A 3V0VB 4KRNA 4WUKL 1A02N 3EOBB 4MNGA 1FG2A 1T3FA 5DO2C 4HUVA 3UX9B 4Y89A 4WTWA 3TFKD 3PNWB 1N64H 3BISA 2UZYB 1BMGA 3ZDYF 3KPLA 3IXAB 1INQA 1J0IA 3DV4A 4UV7L 3L1OH 3V8OA 2EIZB 1NGYA 1DBML 6CGTA 5T1LA 1BP3B 1LGVA 2VAJA 3RGVD 3SDAA 3L5JA 2PXYB 1PGRB 1V7MH 3LRSB 5IM7B 3GKZA 4NGHL 3RNKA 1Z5LA 4PY8I 3GSVB 1FBIH 1MI5E 4OZGA 5I1IL 2VL5B 2ZCLH 4I0PC 1IEAB 3G5YA 4KFZC 4LKCB 4YFDB 5I74C 2VDMH 3CVHL 1T83A 2BDNL 2IPKA 4M7JL 1U3HB 1MJUL 2JCCA 4WFEE 2Y6SD 4PJ7A 3D69B 3TBYA 4Y4KC 4P9HC 1NGPL 1G6RH 5FOBA 3O6KH 4PB9H 3MJ9L 4JM2B 3CMGA 3ZE1F 3RNQA 3KPRD 1Z9OA 2FX9H 1NUGA 3VJ6A 5ALBL 4S2SA 1U3YA 4XXDB 5EDXA 1NMCC 1AGBB 4WEBL 3TJEL 5KVGH 5T3ZH 1A6PA 4MAUL 4FQHA 4LKXA 1NGXB 2R1XB 3MA9H 1FZKB 1EO8L 5EO1B 4PBWD 5DFTA 5SX5K 5TH2B 4MNHB 5DWUH 4ELKA 2BMKB 1U42A 1MCIA 3ARBA 2MHAB 2EO1A 5D2NA 3MQIA 1Z3GL 3DRTB 2EO9A 1RK0B 3BT2H 2APBA 4ODTH 2YUZA 2DBLH 4L9LB 3FB7A 3NN8B 5DHXB 3T09A 1ZANL 5GZNC 4LSRH 3QIBA 1I8MB 4X6CF 3EFFA 4CN1A 2P8MB 5KOMC 1BFVH 1XGTA 1MH5B 5IHBA 3QFJB 1NBZA 1L6XA 1RJZB 3BPOB 4XH2A 5ELIA 3JTSA 2OX5A 1EFXD 3IDGB 4L4TA 2AV1A 4KTDH 4UINH 2QKIA 4CJ1A 3HS0A 5DJ0A 5F7UA 1V3KA 1AHWB 2EH8L 1IGYA 2VN4A 5IIEA 5E8EB 3OXRA 1A7NH 3TT3L 1BQHA 1D7FA 1P7KB 3ZT6A 1XCTA 3E8UH 4W6YB 1CFNA 4IDJL 5C0BE 3WXWH 1K5NB 3SKJL 3V5KB 5D7SL 4GKNB 1NAKL 4ONHB 1MAKA 3MRRB 5TQ0H 1TZGL 3BDYH 3X13A 4GXUN 4Z7WA 1AR1D 3O3EB 1FAIL 1OOAA 1N7ML 1CFQA 5HYJD 4RDQF 1GOHA 5GS1A 5DJAB 5CSZB 3ILPA 3ULUC 4QXTB 1IC5L 1YEDB 4MQTB 3S5LG 5I17B 5TF1H 2D9CA 2EDYA 2QQKL 1PFCA 4G6KH 3VXUE 4WI3A 4D0BB 1R3JB 5JZ7D 3GZKA 5F7HA 2VLRD 4ZAKD 3RX5A 5D7LE 3PWJA 1CDGA 3MJ7B 3IFOB 4APQD 1IGJA 5I8OL 2R0KL 2QSTA 4NYLA 2A38A 4ZUTB 3SO5A 3MROB 2EDBA 1KJVB 2YK1H 4K55A 1J8HA 3QUZA 4QWWD 2VWEC 4UDTB 1ULVA 1VKXA 1QNZH 4N8VG 1WCQA 3LCYA 1J18A 1KCUL 3NACH 5JIKA 4NZTL 3RY4A 4NQTA 4NOFA 4MA1C 1OTSC 3GBLA 2DQDH 1C7TA 2HLAA 1CD9B 5JMOC 2MWCA 3WD5H 4Y0GA 4J2XA 5GGTH 4ZFOL 1F90L 1CBVH 4Y4FC 1WITA 1L7IL 4OLXL 4G43A 3H3PH 1U93A 4PJ5B 4JFYB 1YMHB 3KJ6L 3SGJC 1EEUA 1FZOA 3CAFA 4JM4H 5B4MD 4FFVC 3L3JB 2X44D 5LBSH 5CJOL 1IKNC 5E6ZA 1ACYH 5GRXG 5EOCL 4EQ2A 3C5ZD 4OZHB 2VQ1A 2ILLA 4F7MA 4XI5C 3ZE1E 4K3DH 2QADB 4DOHE 4YHOL 4XRCA 3EGSB 1IM9D 1I3UA 4FQCH 4ZO9A 3WFEH 4L8SA 2IBZX 2NY5H 4JHBA 3VD4A 2OMNA 3C8KA 4J6RL 4W4NA 4WEUD 1XR9B 4V1DD 1QRNE 1T7YA 4HCRA 4U1JA 4ZUVA 5FGCB 2V17L 5AZEL 3U9UB 4PV9A 3U7YH 2DI9A 4LEOB 4O5LL 1MFEH 3A6BL 1OQXA 3WKML 3MRDB 2Q8AL 3O4LB 1T04B 2X7LB 5L6YH 1HZHL 1QBAA 3TWCL 3QJHB 1F8TL 2FZ3B 2XWTA 1A9BA 1W8OA 4RQQA 2OJZH 5IB2A 5EWIL 2WUCH 4LEXH 4JZNA 3FFCD 4M1DL 2EDEA 2H2SD 4U1KA 2DQEL 5HHPA 5C0CE 4HS8L 3BPLC 2RGSA 1NUNB 2C7UB 1TDQA 5AD0B 3U1SH 2DD8L 5C08E 5KVEH 3ME0A 4HPYH 4WHYH 3VFOA 1FVDA 1BWWA 5IVOA 4ELMF 1OW0A 1FO0L 4YE4H 1O7VA 3QDGA 1BZ7A 1R3IH 4NNYA 1CDHA 1U2HA 5C0AA 1YMMA 3KLSA 3KPQB 3QNYA 5F1IA 5SWQB 3LZFL 3GMRA 2KQMA 4DKDC 4S0SD 3CFJB 2FEEL 3MCKB 1DEEB 2ZPKL 1ZT4B 1BBJB 2R39A 1KG0B 1TENA 1FZJA 4NWUH 1VFAA 3QI9D 5IBUG 2B2XL 4AMKL 3PIQB 2R69H 1S7TB 2N1KA 5KSUB 3MRHB 1L0YA 5CINL 3CH8A 1MVUA 1B4JH 3QRGL 2VZ3A 1FFOA 5E8DL 3BZ4B 5IOPA 4GRLC 3L3OB 5AWNL 4N8PA 4TSBL 4F58L 3DPBA 3BZEB 2EEDA 1IC4L 5CIPA 4NQUA 3QP3A 5HDQH 3RJDA 3S98A 3V4VL 1IKFL 4QOKE 3B2VL 4X6FB 3E3QC 1NGWA 3F65A 4ODHL 4AG4L 4JZOA 5DJZA 3BIBX 1IQWH 4F7EB 1TJGL 3PDDA 4L8CA 3FCTA 2VR5A 3LHPH 4XAKD 1OAXH 4MDJB 3QXTA 1KXQE 3MMEA 5I71C 4TSCL 1EEYA 1F13A 1XH3B 2R2BB 4IRJC 3BN9D 3ARFA 1MFAH 4QRSA 4ZTOH 2YOCA 4XNMA 3OG6B 3VFWB 1X7QA 5DO2D 2X89A 1RUQH 3IAPA 2K3TA 2V2XB 3S7GA 2VJXA 3QFDA 4G9FB 5IGXL 1G7HA 3SDXB 2X4QA 2VQUA 4PJHB 1F4WH 2CLRA 1JNHA 3W0WE 1YECL 3JWOH 4P2RE 2YPVH 1O7SA 2DM3A 4XNXL 2EE6A 4KJPC 4U0RC 2JELH 4UIKH 2WAHA 1KULA 2I27N 2AK1H 2NW3B 4GW1A 4O2CB 2YRZA 4HIJA 2FRGP 1QSFB 3NAAH 5DC9B 1MRCL 3D39B 1J5OH 4BQ6A 2CK2A 4I0PD 4J4PA 5AG9A 5ACLA 2FJHA 3EO0A 3OKNA 1NKRA 4AZ8A 1AE6L 3QUXC 1U58A 1YEHH 1CGUA 5DGRA 4Y4KD 1BREA 3KXFD 2ORBH 3IRPX 4TNWF 3GSWA 1VEOA 1WFUA 1JF6A 2XKNB 3DTXA 1NC2A 4JFQA 4KUCF 4QTHB 2CDGB 1XGUB 3ISWA 2QR0A 5BS0A 1G9NC 3BRFA 1FDLH 4YWGH 3CFDA 4FQXC 1FNLA 5EZOH 3WIFA 3HMWH 3QO0B 4YHPA 4ZFZB 4PRIE 4X7DC 1EHXA 4RMWA 3T2OA 1BFOA 2Y7QB 4KROB 4EBQL 4LGSB 4PJ8B 1X5FA 1Y6KR 4A2MA 5CP3H 5LWYL 2DQFA 1EHLL 3HMXL 5D6CB 1NFIB 5B39G 3RFZC 4R0LA 1RV6X 2UY7A 2JCCF 5F9JB 1U92B 4OUUA 5DTFA 3CZFB 1KEML 4OZ4A 4OCRH 4PJDB 3PGCB 5KJRL 4MD0B 2XACC 4TTGA 2YC1B 2IALA 4DGIL 3MSPA 4WO4A 1CDYA 1SYVA 1SM3L 3AGVA 3EYOA 1IBGL 1JPGA 5IMMB 1FNGB 1TNNA 1K3ZA 2B39A 2J88L 5KVDH 4TTDD 3S4SB 4ELME 5CWSB 2YN5A 3ZE0E 1VGKB 3IS1X 4CVXA 1RULL 4JPWH 4NQCB 5C6PB 5JPNB 4P9HL 4HIIA 2BK8A 5IVXB 5CILL 2VB5A 3TZVD 3ZO0A 1U41A 3CSYB 4XX1G 1JTOA 4AEHH 3U79A 5IJVB 3DHJA 1DQJB 1S9XB 1H0DB 2MJWA 5EUKA 1ZVSA 4Q0XH 3PJSB 3MUGA 3ESUF 3ULSA 1RUPH 2NY1B 4AEEA 2DQTL 1QQDB 4KUZL 4NUJB 5LG1A 1JNNH 1SJEA 1JF1A 2ERJB 3WFBL 3IKCB 2X9XA 3GRWA 5D4QA 1GC1H 2EDOA 1HEZB 2J2ZA 1WEJL 2Q6WA 1Y6MR 4N0FB 3TA3A 1N4XH 3D85A 4HDIA 3EAKA 4LGRB 3P9WB 3OJMB 3MNWB 1A3RH 4Q9QH 3OKOB 1R5IA 3CX5J 4P2OC 2MSPA 4YAQA 1ZOXA 3IFNL 3FTGA 3MV9B 4HUNB 1Q72L 4MGXA 3D5OF 5JIIA 3MLXH 3PL6B 4AM0B 4GXVH 4FQLH 4N8CL 1FE8L 3PWPB 5EOTB 5GGVY 1KENH 2BRRL 5D1ZA 3NMEA 3GIZL 3LS4H 1BM3H 4ERSH 5TE7H 2C9AA 1EMTL 2UZIH 2H32B 1KCRH 4Q7DA 3S37X 2PCPB 5DQJA 1ORSB 4RRPA 4JVPA 5GRVK 3GMPB 2VRAA 4ETQB 1GIGL 1M7IB 4LSPH 1E4WL 5EU5A 2P24A 3IDNB 1MAJA 1OTSD 3CMOL 5EU7C 5TDOB 3DMMC 1XF5B 4LHUA 5BQ7B 3JV0A 3IXTB 4PJFB 4X5WB 3VGEA 5I8EB 3M17B 2XV6B 3PHQB 4DUVA 3KHOA 1AFVL 1OF2A 1YPZF 2CKBB 4Y4FD 3UO1H 2X1PA 4PJ9D 4OF6A 2C1OA 5B3JF 1G9MH 1CGWA 3EYVB 2V7NA 25C8L 3QCVH 4NHCL 4NT6A 3O81A 4PRHD 3X12B 1KC5H 4HGMA 3NCCB 5ABDE 1UACH 4WNQA 4IRZH 1GGBL 4YIQA 1BIIB 2R0LL 3B4NA 1CLZH 4LDOB 1OB1A 5F70A 4F33B 3GM8A 3MBEC 5TDPA 2RCSH 4WI7A 1AGFB 3ULUL 1RZKC 5FYKL 5CD3B 1F58H 3H9SA 3VE0A 2BVPA 3RP1A 2PO6B 3QEQD 4TPRH 1UEYA 4MNGE 4WUUA 5AZ2L 2AJZA 3VFRA 4M61B 4U0QB 3L7EB 1XR8A 1MCJA 3CSPA 3VWJC 3L95A 2ADFL 3BO8A 3QWRA 1IAOA 3RY6C 3AREA 1LD9B 3O6FB 3B6SB 2J7LA 1CWVA 4M6MH 4X7CC 4P59L 1BLNA 5D2LF 5ICZB 4XPFL 3WHE0 4UT6L 3GIVA 1MF2L 1S7VA 1FHGA 1P69B 1ZEAL 1P5UA 2NY4B 5HGBA 3AU1B 4NN7B 2VXSH 2UY6A 1QHPA 3IJHB 4OZGE 1AIFA 2COQA 3R8QA 1KN2H 3U30B 1JV5B 4GKOA 3TIDA 3D0LB 1AGCB 4D3CL 4QRPA 3ES6A 1R5WA 4BH8A 3CX5K 5KAQG 2JCCE 1E4KA 5IBTH 1T20A 4PJ7E 1MHPH 4LSTL 4U1MA 1IAMA 4XBPA 1Q94B 1LEKB 5JW3L 1OARH 1AD0B 1PSKH 4KVNH 2ENSA 3BH8A 5BZWB 2CXKA 3IU4H 1CYGA 3M1BB 3K4AA 1CQKA 3RKDC 2AABH 5MERB 3IDYB 1H5BC 4QYOA 4CMHC 3LEYH 2IADA 1HHKB 4KZDL 5KSBB 4FFWC 3N9GH 5DHYA 1FRGL 3BE1H 3K74B 1FORL 1T2JA 3V0WL 4NCDA 3VG0H 4R90L 1XF2A 2XG4A 2DJUA 4KXZI 4DN4L 4GRLD 5D7JA 1YEJL 1KTLA 1B88A 5I8KH 5IJKA 1J0KA 4JO4H 3C6SA 1WWCA 3CD4A 1ETZA 2D0GA 4X5XA 5JHDB 4NQDB 1NMBH 1MCOH 5MENE 4LVOC 3RY5A 4N5UA 1X5XA 4NIKB 5IMOB 3UROR 1MJ7L 3SKNB 4YNYB 3OR6B 4L4TE 4ZDHB 2BY2A 3MXWH 3HPJB 1C16A 3AM8A 4IBLT 1H3WM 2VYRE 1VACB 4JKKA 5EFIB 4A6YB 1BBDH 2QL1A 3P9MB 4EUPA 2CMRH 4Q97A 3CSBA 2V6HA 4TUJB 1CZ8H 4IRJD 1TPXB 4EI5C 2OK0L 2ED7A 4LAQL 4D8PB 1F6LL 4NRXB 2VDRH 3VD3A 3RX7A 4LLAA 3GSNA 4EOWL 5JO5A 1CXKA 2W60A 4JR9L 1CGSL 3RGVB 1OAKL 4KJPD 2KBGA 2FO1A 5JNYB 5K9JH 4OSUH 1S9VA 7CGTA 1TVHA 5FDYA 3EHBC 1ZLWK 3TEUA 4PD4J 3GBML 2YZ8A 2X09A 1QFUL 1F6AA 1MJJA 1S9YB 4X4MA 4YEEA 1IFHL 4GAGH 2PF6A 1UXSA 5I9QB 2FWOB 3KPOB 3QUXD 2C1PA 1JGDB 5I1GH 3KYOB 1IAIH 2AK4A 3QQ9C 3KPRB 3VFUA 3VW3H 5B3JE 2H6PA 3DX8B 1OLZA 2YD4A 2NTFB 5I16B 3K2UH 3ZZ1A 4NC0B 4DTGH 3HE7A 3S96B 1ADQL 1TTUA 1BJ1H 1J8HE 4U33A 4DUWA 4JO3L 3V4PL 1RUML 4FQXD 4R26H 4YHLH 4HCRH 2VISA 4EKXA 1RFDH 1T7WA 5DFVC 5HY9B 1ORQA 2X42A 1J1PL 5BXFA 4JY4B 2NY7H 4G8GA 4NHUA 3D87B 1MCBA 4H26A 4RGOL 1XAUA 1LEGA 1YNLH 3ZE2F 3MRLB 2VE6A 4LSSH 4LLUB 5I75C 4MLSA 5D2LE 1HHIB 4LSVH 2HFEB 1A6VH 1RIVL 5DLMH 5DEFA 2Z8VC 4ODWB 1DLHA 4MAYA 1ZHBB 4U6VH 4NWTH 5DD6A 1EFXB 1KLUA 1TLKA 3P77A 2DWEA 5DK0B 3VXTB 3ZKMC 2ZNWA 1GGIL 1BD2A 5IMKA 5KG9B 1OGAE 4R8WH 3HI6H 2J5LB 2R0ZH 2X5PA 4OZFB 4XP4H 5IT2L 4TUOB 5AYUL 5HHNA 5DFWH 2XN9D 1I3RA 1MHEA 1BJ8A 5TE4H 1WJ3A 2AEIT 2ZUUA 3WL9A 1CD1B 4BM7A 5E2UH 1UZ6F 1N0XL 4JFDA 1Y18A 4G8IB 2NY6C 1DLFH 3TP4A 4XXCC 3B83A 4XGZB 4ZOCA 1UENA 3HC4H 4EJ1C 1CF8L 5IWLC 1C12B 2FEDC 4JM2F 4X5LA 3THMH 1JUFA 4IM8A 4M6NL 2W65A 4JKLA 2B0SL 5HYJB 2FIKB 1UM5H 3HG1E 5D1XC 2OYPA 5HDBF 4D2NA 5CIPH 4P3DA 4PD4K 3U2SB 3UBXB 3LQZB 1I7RB 5DD5L 3FRPG 4U6XA 2P5WD 3Q1SH 1YQVL 2VLRB 3KJ4C 4ZAKB 4ENEC 3LKSB 3T77A 2BJMH 5I1CL 3PQYA 4P2OD 5IW6B 4UQ2A 1NDGB 4NQED 4APQB 2Z8SA 4GH7B 4PBVC 4H5SA 4ZS7L 3BXNB 4K94H 4KQ3H 5BV7H 4B5EA 5CJBA 3VXSD 3QEUB 5GRUL 3D2UA 1WZKA 4HKBA 5DF0A 1PKOA 5I1KL 3LH2H 1YMME 1VDGA 3CFEA 3KPPB 3MJ6A 3TH2T 1FIEA 3PV7A 5C6TH 1BQUA 2NW2B 5E9DA 5C0RH 5L2JA 1MNUL 3S6CA 1I3GH 1WBYB 2XTLA 1I1FB 2ADGB 3W2DL 1CE6B 5K59E 4G7YL 3N1PC 1MELA 5FO9B 1FO0B 5JPMB 1YDPA 2EYTB 2QQQA 3O41B 3RJQB 1FAKT 1GGCL 1VFBA 4UMGA 5I73C 2AEPH 1KPRB 1EV2E 4QY8B 4LCCB 1FH5H 1UM6L 5D7IA 5C0IA 5GJTH 5EOCJ 3VFPB 3AMLA 3WIIL 4ODUA 4P9MH 4K2UL 2NZIA 2FBJL 4TOYL 1NCWL 1X44A 3C5ZB 3DUSA 4M62L 5DJDA 3WJLC 3OF6D 3BD5A 1LP9B 5BVJA 3QPXL 3MBED 2YD1A 4WHYG 5L2KE 2JJSA 1AXSB 1RURH 1IM9B 4PRDB 4XP6L 3LKNB 2HJFA 5F7DA 2R0WL 4WDIB 4ODVL 2NPLX 3STZB 2DRUA 4XPBH 5CS7A 4V1DB 4LSUH 1CXHA 1JPSH 4PJCA 2DDQH 2HH0H 4XMPH 4Q6IC 3EDJA 3LKQB 4U1GC 3GUTB 4RIRB 3FB5A 3HZVA 2WZPD 4XWGL 3VWJD 4GQ9L 1OLLA 4HF5H 1UB6B 3GMLA 3SCMD 5JIPA 2BVEA 4JFHD 4QHMA 4JO1L 2H26A 1WFOA 3FMGL 1JL8A 3Q2CA 5JMRA 1I1AA 3QXWA 1XGQB 4LSQH 4YDIL 4GRMB 3D25A 3FFCB 4K9EH 1CL7I 5L0QB 1T1XA 3PP4L 5F89A 5L7XL 3OAZH 3F58H 3ZE2E 2D4DA 1S7RA 3HC3H 2HVKA 4OLEA 5TF0A 4PRBA 5D5MF 3QG7H 5C8JA 4GKSA 4I2XB 5CGYD 4HIEA 1KB5L 4PTTB 4KV5F 2O5XL 4RMUA 4UILL 3X3GH 3KS0H 3WEXB 2NY5C 4KMTL 4ZOBA 3O45A 4DGVH 3UTSA 5BRZB 4N0YH 3U0TB 1JHLH 3RTQA 1ZLSH 5BS0E 1D5BA 1W72A 1X5LA 1YEKL 1FSKB 2GITB 5IFHH 3VGGA 3BJ91 3QI9B 4N0CC 4ZQKA 1IGCL 1S7QB 4C83B 4FFWD 2VDLH 1DBBL 1GHFH 3Q6FA 5ISZA 5C2BH 1T1ZA 3QEGL 3MRPB 5KZCB 5GSVB 2EDJA 1RZKL 4M1GL 4WY7H 5LKNA 2WINB 2GW5A 2W9DH 3BMWA 4B7IA 2D3VA 3EYFB 3ARYA 4I18B 1RK1B 3K1KC 3SGDI 1H3VA 3GRWH 3IJSA 4LCWD 4GMTH 5F88A 2HTKC 4RGMC 3FO1B 4XP5L 3DWTA 2GY7B 3ARUA 1AO7A 1CFBA 1JYVA 4FTVA 5ITBH 3MNZA 1JN6B 2X4TA 5F96H 3RZCA 2GJJA 4DUXA 5ALCL 3UZQA 1OCWH 1PQZB 1D6EB 1FNSL 1HSBA 1C08B 4G3YH 3C9NA 3B3IB 3QO1B 3GGWA 3HFMH 4NKDA 5BJTB 2A73B 5JW4N 4EI5D 4GAJH 5I6XC 4QNPE 2H3NA 4KY1L 3OV6A 1DSFH 5E5MB 5J1AA 4PB0H 6FABH 3LN9A 3FB6B 2R1YA 2WP3T 3DECA 3MRFA 4XBGA 3L7FA 1TETL 2G60L 2GK2A 2BP3A 4ISVA 1MI5D 5IVZA 1SHMA 2OL3A 5I66B 2EIBA 5E8OA 1KCKA 1A6TB 2F9BT 2BSSB 4PJAA 3VRJB 1J0YA 1TJIH 5E94A 4ZSOB 4DGYH 4JRWA 3DX9A 3EHBD 3FQUB 2MQ3A 4I0PB 4WFED 5DJ6B 5I74B 1G7PA 1TQCC 4OT1L 3V6OA 1FCGA 1H3PH 3VWKC 3TNMB 2ZSVB 3DI3B 4Y4KB 5J56B 3IAGC 3KXFB 1A0QL 5DD0H 4WI5A 5CKGA 1J7VR 5F72S 1P1ZB 2Z8WC 3QQ9D 3U4BL 1ES0B 4AENA 5EC2A 4BFIB 3RU8L 1MCQA 3R06B 1EXUB 3KWWB 1HCVA 2CK0H 3DNKA 1HINH 4EN3A 5SV3A 5HPMB 3Q6GH 1YY8A 2VXTL 1EO5A 2F54A 2OSLA 3R4DA 5HI3C 1SBSL 2PTTB 3BD3A 5FDWB 4XCYA 4MXQC 5DFVD 4CMMA 2ZUWA 1FZMB 3S3PA 3KYKH 3GSRB 3RPKA 1OPGH 1NFKA 3OJDB 3RWFA 3GMQA 2YRLA 4D0DB 3E6HB 1R3KA 1FLRL 1F00I 3BRDA 3CGTA 2R56L 2BC4A 1VADB 2YD3A 2CXGA 4PRPE 3TVMA 3CX2A 5T5FH 2GCYA 5EB9A 3MRBA 4IOFC 2IH3A 3OKYA 4PJEA 2AQ2A 3V6FA 4YFEA 3ZKMD 4KAQH 3GB7B 1QBBA 2XFXA 4X7FC 4YLQT 2A1WH 2X4RA 2FLBT 5C0BD 3GO1H 1PAMA 5D5ME 2AJXL 3H9SE 4KKLC 1FYTA 4Y5VB 5J6HB 3CU1A 3TZVB 4Y19E 3ET9F 1VFUA 5DS8A 1QSEA 3TIEA 4WUUE 5KTEL 4OGXL 5IB1A 2NY6D 2XWBB 4WWID 3VXQA 3VXMA 1RJLA 3I2CH 3A6OA 3CCHB 3T2PA 4PJ5E 1I75A 4QRTB 3OGOE 1A64A 2FEDD 4QRRD 5HHVL 3MZTA 3UJJH 3NFPA 2JF1A 1T21A 3ARSA 3MOBL 4K3EL 2H8PB 2HTLD 5AAMA 2VR4A 3B8SA 3P0GB 2OR9L 2FDBP 5D1XD 3U48A 1HSAB 1BPVA 2ATPA 3VXUD 4KK5D 1PEZA 4ZS6C 5GGQL 4F7CB 5HI4C 3QWOB 3MODH 5D7LD 2ZJSH 1K3IA 4MQ7A 5E1HB 1FP5A 4RBPH 4ENED 3SJVA 4QRPE 3ZTJG 4ORGA 1FC1A 4WGVB 1K4CA 4BJLA 4Y5YB 3CK0H 3QHFL 3FONB 1LQSR 3J8F7 1CICA 5ADPL 2QQLH 2CRZA 2ITCB 2CIKA 5DJXA 3LKOB 4GG6A 3JV5A 4C59B 4EUPH 2GQHA 1BOYA 4AQOA 1HN1A 2IBBA 2NR6D 3RL2B 3BEWA 4J8RB 5HHQA 3IFLH 1HQ4A 2E9WA 3ZDZF 3GK8H 4PJDF 1JRHH 3GBNL 4MA1B 3GSNH 1YZZA 3BPCB 4KJWC 3BP6A 2M8XA 4CNIB 4HGKC 5CMAB 1A1OA 1BFTA 4NZUL 3MGTB 5EOQH 3RIAF 1BVKA 4PP1C 4PY7B 3LEVL 2YZ1A 4PLJC 4EDXA 1X5IA 4Y4FB 1EAPB 4FQQA 2AJ3B 4LVHC 3HLAA 1D5XB 5DMIH 3QDHA 2ZUSA 4PRHB 5IHLB 3MUJA 5FEBA 2IJ0C 3DX6A 1NC4D 2DWDA 4TUKL 4OV5B 5MHSE 2VR9A 1U8KA 2JKXA 1PLGL 1N2RA 3H3BC 1QLFB 1FGVH 2XY2A 5E95B 5H94B 1KUMA 1P4LB 2VITB 1QRND 3QEQB 3WO4C 3MO1B 1GGUA 4JHZA 4TULL 2LU3A 4XAWH 2OP4H 1PG7W 1MHCB 2RQ8A 3F6LA 1LK3H 3NIGF 3OB0H 1NDMA 2KKQA 3MYZA 5FF6B 3UPRB 3D0VB 3K8MA 3QUYA 4NFCA 2IWGA 3SDAC 5FXCH 2CDFB 5I8CA 3S5LB 1FVEA 3P0VH 1ZE3C 5FYLH 3WNNA 3U83A 5EU6A 4R7NA 4Q9RL 4Y8AA 5DJYA 5I19H 1T83C 2X05A 1HCFX 1J88A 5C0CD 3MNVA 7FABL 5EBLB 1KOAA 2J1KA 3OX8B 1R5VB 2P4AB 4X4ME 5C08D 1T2QL 2AGJH 3BPLB 4XC3L 1NFDB 2X4UA 1RZJC 4GBXA 4RFOH 2AK4E 4N8VB 4BSVA 4PJBA 3Q5YA 1A9EB 1FL6A 1S7WA 5C07A 1QVOA 4PJXB 5TDNB 3VGHA 3BIKB 3OKMA 3CPLB 2BFVH 1S8DA 5CFHA 2DM4A 2V5RA 4XNQB 4U1SB 1KBGL 2V2WA 3BD4A 3NCBB 4MA3A 5ICYA 4DW2L 4JFZH 3GI8H 2XZAL 5KSVA 5IB3B 3UJIL 5E00A 3ARBC 1B2WL 1JPFA 4N0CD 3CLFL 2GUOA 2H1PL 1PZ5A 3WFDH 3HUJA 2WNGA 4TYUA 1P2CA 3FQXB 2N4IA 5GXBB 5ANMB 3BW9A 4GRLB 3E6FB 2OR8A 4G8GE 4OD2B 3NFNA 5FYLE 1F4AA 4M5YL 1FGNH 3UP1A 5D8JL 4QOKD 3D3VE 1JYWA 4FXLA 1JI1A 2HTKD 1CD8A 1M7DA 2P5EA 3KDMB 5DYOA 4ALAH 2G75A 4IRSA 3FAWA 4LSDA 1F11A 2FECI 1RUAH 4OKVB 1GZQA 3ZL4L 4QF1B 5F6IC 3W39A 4HZLB 3GJEB 2Z4QA 43C9A 4BQCA 1JMXA 1DBKH 3MA7B 3NCJL 1SY6L 35C8H 5I71B 1BD2E 4IRJB 1ONQA 5C09A 2A9NL 2PTUA 4TSAH 4WWKC 5DMKA 4L3AA 4DQOH 4HG4J 1XGPB 3FO0L 1ZA3B 4X8JA 3R0MA 2L7JA 4W6WB 5EZJB 4NSKB 1J1OL 3D1MC 2OZ4A 3W0WD 1FL3B 1R3HB 2W91A 1KXVC 3ESVF 4P2RD 1AD9B 3G08A 3WLBB 5EU4B 4JFDE 4NQSA 3LQMA 4JFXA 5BVPH 1IARB 5A1AA 1AGEB 1KJMB 1QACA 2AJYL 1HWGB 2VTFA 4U0RB 3ZDZE 4PIRF 2D7TL 4PREB 5GS1C 1T5WB 4U1IA 2Q76A 4OF5A 1WWAX 4MJ6B 1QYGH 3C5SB 4NC1E 1HH6B 4XMKL 1CS6A 4K23H 1LEIB 1WTLA 3EYSL 3ARWA 4F7PA 3QUXB 3VWKD 1VPOH 2ICES 5KSBF 1XIWA 4TVPH 2AXFB 2W1NA 5CGTA 3PQYE 4NQCE 2LVEA 2ADIA 3UTZB 5L8LB 5FK9A 1UZ8A 4ZPVB 4BK4A 1T0MB 1WK0A 1KIRB 4KKCC 5BCAA 2D31B 3EOBA 4WI8A 2I9LB 2EKJA 3HRZB 5IBUB 5H2BA 1HHGA 4JPIA 5DVNA 3CXHJ 1T7VA 5H37G 4FQXB 3QISA 3BVNA 4P99A 1MFDL 5HI3D 2EIZA 4GQPH 4Z7UB 4H0HB 4MXQD 3WUWB 5I2IB 4YXHL 5E9DE 1XGYH 3O9WA 4M9OA 3TBTB 4X6EA 2BXYA 3FQWA 1YYML 2IANA 5D72L 4MB5A 1JK8A 5DVLA 1ZT7A 3GSVA 1KB9J 4OCXH 1IJ9A 1RU9H 4FXKA 3HI1A 1GOGA 1IEAA 4Z7NE 1JHKH 3EOTL 3PWPE 2Y1VA 4LPVA 1KGCE 1U6AH 3FT3A 3NFSH 3T0DA 1NANI 5BO1H 2XNAB 4XCNB 5D7IE 3S37L 1HIML 4O00A 3RBGA 4PGCA 4IOFD 3DO7A 1S3KL 4GMSL 3RWHA 4NRZB 3U4EA 1SYSA 2VXVL 5J9PA 2VERN 1MJ8H 1JWMA 3W9EA 3QBTB 5FA4B 2CJUH 4HG4K 4L8SC 3PWVB 1NCCL 2XN9B 5F9OL 1KPUB 4DKAA 2DS4A 1A2YB 4KKLD 5LXGH 2BSRB 2GJZB 3B9KC 5DT1L 1G84A 4KMQA 3RWGB 4WFFE 2Q87A 1HKLL 4PJCE 2XQBH 3GSQA 2AEQH 4UTBL 1ZHLA 1P4IH 5IP4A 3P11H 1CFVH 1NLDH 2EE9A 4NKMB 1EHAA 2EDFA 4HWZB 5C86A 3IT8D 1LO4H 4JPKH 3S35X 5F7WC 3FT2B 4YEFA 2O5ZH 5IFAL 1RK0A 2AP2A 2EDNA 2P45B 3PWLB 1QFPA 4X6DA 3CC5B 1OSPH 5J4MA 3O3DB 2I9TB 2N56A 2P5WB 1A6UH 2P8MA 2W0KA 2QSCL 4PJEF 5HI4D 2X41A 4AIOA 1VFOA 2EDRA 1ZK9A 4DEPC 4P2OB 4NQEB 4FQIH 3FOLB 1G1CA 5IG7A 1WT5A 2YHGA 4ZMAT 4XCFL 3L3HA 3FO9B 1AHWA 1WFTA 2GJ6A 1YEIH 4U1LB 3VXSB 3NZHH 4HJGB 5L88L 3NOIA 3CXHK 2NXZC 1PBYA 3DV6B 4X7EC 3RX8A 1CK0L 3MV8A 2FO4A 1NGQL 3B5GA 1T1WA 1UXWA 3V5HA 1UM4L 2WIIA 4GUPA 4F15C 4GKNA 4U6HB 5E4EC 4M48H 3VDAA 3MRRA 4PGDA 5B39B 4I77L 1VGEH 3DMMB 4HKXB 1ZGLM 3O3EA 4NZRL 5ISZE 1MWAA 2OL3H 4ZTPH 3U7WH 3JTTB 4M8QB 1KB9K 4PP1D 2D7QA 4PLJD 1KB5B 3SO3C 5CSZA 5ACMA 3LSOB 4OQ1A 1BZQK 3MLWH 3RDTA 5C0GA 4K3HA 3MXVL 4M6OH 4HIHB 5F7FA 1QFWH 4RZCA 5FGBA 3T2NH 1JPST 4OLWL 1HH9B 4M02A 2Z92B 1EBAA 3T3MF 2X1QA 1AO7E 2EDDA 4PGBB 15C8H 4K94C 4FTVE 1GZPA 2CSPA 3IFOA 3VXPA 1N3NB 2ICEB 1U8HB 3MBEB 3ARFC 3SE8H 2AQ3A 1ZTXL 4LRIA 4PFEA 2VC2L 3O2DA 1KEGH 3GSOB 5DRXB 4UDTA 4J1UA 5IQ9A 5FB8A 2HA1A 3KYNB 4KUCD 3RVVC 2Y06H 5CP7B 5KVFL 5DZLA 1MRDL 1KIPB 3VWJB 4KRPC 3CH1A 3SQOH 5T1LD 4HUUB 4X80H 3SCMB 3OR7A 5SWZA 5GS0L 1HXYA 3DROB 3SDAD 3DYMA 5C0FB 3QIUA 1E6OL 5GS3A 3AMKA 1CN4A 1Q9OB 1FNHA 1A7OH 1MFCL 3WNPA 1YJDL 2X10A 3BDXA 5JDSA 3EFDH 4I48A 2Y5EA 1YMHA 1LE9B 5DHVB 5E08L 1OM3L 1JNLL 4DK3A 3PGFL 3V6OE 3WSQH 3PWNB 5DVMA 3W9DA 3FHQA 1TCMA 3I50L 3MRIB 2VLLA 4X4XA 5A16A 4Q58C 1GSMA 3VXOB 4KPHL 5C70A 2X4SA 1PY9A 3MZGB 1IL1B 2IQ9H 4QHKJ 5CHNB 3QEHA 4GW5B 3C8DA 3AY4A 3F7YB 2E3VA 4YHKL 4M7LL 2WBWB 2X70B 1A5FH 1KELL 3MV01 1LO3H 1H5BB 3SOBH 5T1DL 4CMHB 3RBSA 2FHFA 5M95B 5A2LH 2R4SH 2F54E 3VH8A 4EEEA 3ARBD 4MD5B 3V4UL 3ARRA 4HFWB 4LEOA 1INDH 2BNQA 4R96A 4ACPA 4JM2C 3QQ3B 1DQTA 5EG6C 3VXNA 4R0LC 5K93A 4KK6C 4GSDL 1RMFH 5EN2B 3K4ZA 2HJKA 4K9EC 2BOBB 5EPMB 4P5MA 4LCWB 5MEND 1T7ZA 3MLYL 1NBYA 1MPAL 1DN0B 2BNRA 2YUXA 4LVOB 4WO4C 5CBAA 4L4TD 1HOCA 1UJ3A 3HC0B 1J86A 3RVWC 1S7XB 2OQJA 5LJYH 3HI5L 3LB6D 4PJEE 4D9LH 3IRZA 3UAJC 3V7MA 4MA8H 5HBBA 1CFSA 2FX8H 5ADOL 4EI5B 5T1MA 2ZUYA 4WWKD 3QUMA 2VDPH 2QV2A 5E56A 4BFEA 1D5ZA 1TZIA 1HXMA 3ELAT 3RI5K 3CFJA 4KJQC 4S1RH 1ZT4A 1QSEE 1BBJA 1RZJL 3MGOA 4RWYL 1I8IA 3GMNB 4HC1L 5MEPB 3VXME 5F3BA 3EYQC 1GPOH 3IDJB 4GAYB 4PR5B 1MI5B 2D03H 4XWOC 2KQNA 4QRUA 5ITFB 1MCLA 3GJFB 1HILB 2VABB 1QSZA 3QH3B 2DB8A 4GFTB 3KLHC 1ZS8A 2GYSA 2ARJA 5HVWA 5L8JB 4BUGA 4S1QH 3X14B 5IFJA 5FOJA 3JWDH 4QCIB 4WJ5B 3G6DL 4WFGE 4XC1L 3SJVE 4F7EA 5FO7B 4RMQA 5D1ZC 3OKDA 1G7IA 2PNDA 5HHXL 3T3ME 1J8HD 3QUZD 2R2BA 1X6LA 4KKCD 4HLJA 4NP4H 4WEMB 2YUVA 2V2TB 2V2XA 2VXUL 4JB9L 1DEDA 3SDXA 5TQ2H 3QCTH 3OKLB 4W68A 3H6JA 1G7QB 4PJHA 4JFFA 3F5WA 1ERNA 4CKVX 4MVBC 4JHWL 2D4FA 2YPKB 1PYWA 2ZUVA 5HGAB 1GXEA 4JJ5A 4G6JL 3ZTNL 1B0GA 4DAGL 3MLTA 5JW5A 3LAFA 3BP7B 5FFLA 5JLZB 1GAFH 4PBXA 5EUOA 5A40E 1HQRB 2CIIB 3MREB 1AGDB 1YC8A 2IFFH 3HE6A 4LF3A 1S78C 1MCFA 1AQKL 1EGJA 1FCCA 1G6RB 4YHMH 4MLIA 4YDJB 4H25B 2FJGA 4P5KA 1HHHB 5DRWB 3KPSA 2QTEA 1OGAD 4EI6A 2R1WA 3I9GH 3MOAH 1I9JH 1QEWB 4POYA 3REWB 1WTGT 3ARVA 3G5XA 4O02H 4YXLH 2F58L 1Q1JH 5C0BB 3RA7H 5SX5H 3IVKB 2Y36H 3UXFA 2CDGA 2O5YH 5I1EH 4LCUA 2HFFA 5DUPL 4Z5RB 2NY6B 3B9KD 2XRAH 3AREC 1CGVA 3DBXB 4E0RA 1X4YA 4UV4H 3SGKA 4QRRB 3HG1D 5IK3B 4M43L 4WCYL 3HZMB 5JXAL 5GGVH 2ITDA 4OD3H 1C7SA 4DVRL 5D1XB 1KYOJ 4E5XB 1F42A 4X4YA 1NFIA 4XP1L 3VXUB 5EU6E 5F9JA 4MB4A 4YO0A 3QDMA 12E8H 2EH7H 4NQXB 3CZFA 1O5DT 2P46B 4R4BB 4Y5XC 1FFRA 4G5ZL 5D7LB 4JDVB 4R3SA 2UWEA 3ROLB 2DI7A 2JB5L 1ZHKA 2V9QA 3KJ4B 3UPCA 3GM0A 3PDOB 1CT8A 3FQRA 1UWGL 3BQUC 1C1EH 3QPQC 4LIQL 4RMTA 2IG2H 1AP2A 5LGJB 5I30H 3MUY1 4JQIH 1QLEL 1FNGA 1NLBH 5C07E 1JNJA 2HVJA 3MCLH 1YMMD 3C60A 1JGVH 5CWSA 1VGKA 4ODXB 1RUKH 2NXZD 4JFOB 3S9DB 4NDMB 5FV1L 2OZ4H 3DI2B 1UA6L 5JORB 5FECA 2WUBH 1FFPB 4Z76A 5I1DB 1U3JA 3PJSA 1HYSC 4HWUA 1T2XA 3SKMB 5E2WL 1OAZH 2RFXB 2Q3AA 4LLWB 1DQDH 5IJKC 3V0AC 3C5JA 3CJJA 3N85H 4PRAA 3H42H 4OCLC 3GJFK 5I73B 5TFSH 1HEZA 4LOUD 4NM8L 1FLTX 2ICWJ 5E2TH 1NC4B 2AERT 3MNWA 1X5YA 2R9HC 3NCMA 1MHHA 2P5EE 4K7PH 2C3XA 3OKOA 3MX0A 3INUL 3MV9A 2YPLA 3ARQA 5DSCB 5C0ND 3GMOB 4DOHB 2F5AL 3PL6A 5FGRA 4LLDA 3NCEB 4DFIA 3ARFD 4LU5L 1F2XK 3DX7B 3BP4B 1QRNB 2X89D 5C09E 3GSXA 1OAUL 3GNML 5ESAA 4YHZL 1A7QH 1C5CH 4QT5A 3RVVD 5SV4A 4M7KH 5C7XH 4Q6IB 5IQ7H 3KYMB 3O6LH 5HPOA 4JLRB 1A4JB 4U1GB 4U1NA 1EEZA 3AFLA 1MFNA 4JG1L 3VDCA 4KRPD 1E4XL 4P2QA 2Z91A 1F6FB 1JGLH 5TDOA 2E9JA 1N26A 4NRYA 2DQHH 2LABA 3O4OC 1R0AL 1KYOK 4P57A 4PV8A 3ALWA 2A9MH 4OB5H 4P23C 4UTAL 4NKIL 1Q9KB 1JWUB 1ND0B 3CLEH 4M03A 2DQUH 5C0CB 2MCG1 3O8XA 4KMLB 3IDXL 1YEFH 3MPCA 4Z0BH 5C08B 3X12A 4HEPG 1CXFA 5EO0A 2F8OA 4NN6C 1NMAL 3FN0L 43CAB 1FJ1B 3TT1H 3G5VA 3S3JA 4MWFA 2EYRA 3S4SG 3DVNA 5KS9B 3LEXB 3QULB 3I85A 1KCVL 2E8YA 5DJ2A 1NC2D 1XZ0A 3TO2B 1KTRL 1I9IL 5BS0D 1KJ3L 3NVQA 2PO6A 5H35A 1UVQB 1RVFL 3SDCA 4RGNE 2JB6B 4M61A 1Q0XL 3N06B 2W59A 4LRNH 2ZCHH 3OG4B 4JKWA 1U8PA 1U95A 2VDNH 3IJYB 3ULVH 1CL7H 5DMGC 3LIZL 1KT2B 2BVOB 2DL9A 4NUGL 2B20A 2SEBA 5CAYB 1F02I 4KKAC 5KBNC 3HNVL 2IANE 2XZCL 4ZO8A 2VLKA 4OLVL 4QOKB 3HNSH 3DIFA 1T5XB 4JKPH 4OAWB 4FXGB 2HFGH 3IJHA 1N5AA 2YA0A 4RGMB 4JANA 4MAYC 1AGCA 1AXTH 2BHUA 4UZGA 2PYFA 4X99B 4WO4D 1LMKA 2YEZA 2DQGH 5DI8A 2EIDA 5KSAA 4X9BA 3RVWD 1PEWA 4NO3B 4EXPX 4QHLA 3RPIA 1V7NL 3DOSA 3MLSH 4OCWL 5I6XB 3W0WB 5I15H 1SJHB 4P2RB 5FO8B 2FGWL 3FZUC 2M26A 4KJQD 3CVHA 3L3KA 4GLRH 4OI8A 4U7SA 5INCA 5GGUA 3M8OL 1Z9LA 4HMDA 3IGAB 5J3HC 3ULVE 2ZNXA 3MRKB 3MJ9A 2YA1A 4NC1C 4XWOD 5GRJH 2W9LA 2VQTA 5AEAA 3HNTL 1TXKA 1MWAH 4M4PA 2ZKHL 5LQBH 3MRGA 5DEZA 3OJVC 3KLHD 4JZJB 2D9QB 4MJ5A 4RBPK 2APVA 4I3RH 2BVTA 4WHCA 1K8IA 1QO3A 4LCYB 1YN6A 3D85D 3EYUH 1TQCB 4X6DE 5I1HL 3VD5A 5JHDA 2VDQL 2CLVB 3VWKB 3TYFA 4S10A 1T22B 1S5IH 1ZV5A 3CUPB 5EBWB 3FRUA 2NLJB 2JIXA 2G2RB 5JIHA 2XWJB 3OR6A 4LQFH 4J3SA 2OJEA 3BH9B 5D1ZD 2VAAA 3UC0H 2FSEA 4MSWA 2A77L 3F7VB 2IGFH 4TUJA 1P4BL 3O2DH 2GJ6E 5BW7A 3BN3B 5E0QA 5ENWB 5IEKA 3RHWF 1IM3B 4DVBA 5FHBH 2WIMA 4AL8L 2HWZH 3FB8B 1JP5A 5MEQB 4YX2H 3MV8E 3KPMB 1DUYB 5MI0C 4EDWL 5T3XH 1NGZA 1E28B 3ECBA 1FL5A 1U8MA 2HJLA 1EEQA 3S88L 3AUVA 3C08L 3WFHB 2BSTB 4J7RA 2AI0H 3TPUA 3T4YB 3CXDL 3LS5L 5JNYA 4FP8H 3KR3H 2MNUA 5TE6H 5HYSA 3VCLA 4PRPD 4AEIH 1KJ2L 2B1HL 4EVNA 1KTDA 3P40A 1S78D 1RJYA 5HVGB 3UTQB 4LNRB 3FOMB 4L4JA 5JXEA 4LAJH 3UYRH 4CVWA 3T8XB 4YGVB 2ZUXA 2XPGA 4YUEH 4YR6A 1DQQB 3DX8A 2AJVH 3MLUH 4ELMB 1NCAL 3P9LA 3OB0K 3H9SD 2YXMA 2E5EA 5ILTL 4EZMA 4M93C 1OSZB 4O4YH 4Y19D 2GEEA 1G7LB 1MAML 3MLZH 4WUUD 2PR4L 4NO0A 4XCCL 4AIXA 3PHOB 5DRNA 3LMJL 5E8NA 5JDJA 5C9JB 5C0JA 3VFTB 2VZVA 4Z0XA 4NJ9L 1GGTA 2XI9A 3QWRD 1Z9SA 4MXWH 1FFNA 2X9YA 3ARED 5HY9A 1U8IB 3SY0B 5ICXA 5T3XE 3DETC 5CEXA 1T66C 3BKMH 1U8NA 4JY4A 5SWZE 3WYRA 4UB0H 4KDTC 5D6DA 5EUOF 2J8UA 5FM5O 1OT2A 3TV3L 5DEGA 3MRLA 3BWAA 5ERWA 1ZGLP 1NCUA 2OBGA 2BZDA 4HWEL 2OTWB 2YMXH 1AI1H 4ESKA 2CLZB 2DYPD 1I4FB 4QRPD 1WLHA 1L7TH 3UTOA 3ZYIA 3OKKA 3LQAL 4XZUB 2Y07L 4X7TA 3M07A 3VMNA 2HT4D 1EIBA 5D71H 3WS6C 2DLFH 1TTFA 4DN3H 4M3KB 5DK0A 1V8HA 1DBJH 3FKUS 4HUXA 3L3IB 5DQDH 1XCQA 4I5BB 4JY6B 3OZ9H 2OTUB 4CVUA 3CDGB 3QUMH 3RTQC 4ZFOA 1LO2H 5D70L 4HQQH 4R7DB 4YDVA 3U30C 1K6QL 4A2LA 4DJMA 1F4XL 3RKPA 1NCDL 1HYSD 4FMKA 2BNQE 1YEEL 1CLOL 3ZHKA 2WQRA 5F8QC 4LVHB 3JV4B 2I5YL 5GIRB 3REVA 3UBXA 1JVKA 5FYJH 4HJJH 2ZSWA 5MHSD 1T6WA 3VRLE 3QNXB 2VLRA 4XVSH 4NBZB 4HUKB 2R9HD 3LKSA 3RZCC 2VIRB 3RWCB 4HFUH 2BNRE 5IW6A 2A74B 2WWKT 4Z95L 4YDKL 4FABH 1RZFH 4GO6B 2IH1B 2CRMA 4PJIA 3BXNA 1WZ1L 2CQVA 4GXUM 4MNGB 1T3FB 4HUVB 4P3WA 1DCLA 1RZ8B 1OAQH 4P3CH 2PUQT 3UJTL 4F57L 3KPLB 4OZIA 4G7VH 3UDWA 3DV4B 3B9DA 1DJSA 2R4RL 4X7SL 2LQRA 3K4DA 1NGYB 4YDLB 5MP6L 1BWMA 5T1LB 4YBQC 4MCYA 3QA3B 1LWRA 3SDAB 4LCIL 1B0RB 4CVZA 1A6AA 4BUHA 5GSRA 4X8XA 5I1JL 1I1FA 3RNKB 1Z5LB 1CE6A 3BAEL 3R0NA 3GKWL 3OAUL 1I8KB 2RAMA 2E7HA 4OZGB 2AJSL 1R3LA 2CUHA 5FO9A 1FO0A 3G5YB 4P23D 5E99L 5HYFA 3V6OC 4KKBC 3TNNB 2JCCB 2FX7L 4PJ7B 2V9RA 1TJHH 4QY8A 1EGJH 1F4YH 5FYJE 1IAII 5AYQA 2ZUTA 5HGHA 1MCRA 3VFPA 3RNQB 2AK4D 4Y1AA 1BEYH 4KHXH 1RIHH 4JJHA 4ONFL 4MDIA 3BEVA 2EDQA 1LP9A 2GTWA 3JZ7A 1AY1H 4EN3C 1IGML 3NABL 2VH5L 4FQHB 3C2AH 4LKXB 4WDIA 5DGQA 2A6DA 1J8KA 2HRPL 2MKWA 4ELKB 2ZG1A 2VKWA 2CD0A 4GW4A 1DQLL 4ONGL 3ARBB 3S34L 3EOAA 4JCLA 4JFFE 1QKZH 3RUGA 3P4OA 4G8GD 4CRPA 5FYLD 3FB7B 1A14H 3A67H 4AQ1B 4HS3A 4KKAD 3PHSA 4OV6F 3D3VD 5F7LB 4KHTH 4S1SL 4NCC1 3EFFB 5MENB 1NBVH 3NTCL 3PWUA 1KCLA 3N0PB 5EUOE 3TVMC 1XGTB 1DL7L 4L3EA 3MUHL 4MAYD 1NBZB 3MFFA 4XH2B 1MCPH 1K2DA 3MBXH 4KGLA 1JPTL 4L4TB 4ZD3L 2AV1B 2A6IA 5EA0L 2E7LA 2R23A 3KPSE 2B4CC 2QKIB 3HS0B 1BD2D 4LPTA 1PG7X 2QHLA 4I2XA 1C5BL 1IGYB 5F6IB 5IIEB 4JY5H 4WWKB 3RL1A 1NSNH 1CFNB 2AJUH 4Z8FL 2DF3A 5BRZA 5IV2B 4JFDD 3HAEG 5HDOA 5CZVL 2GITA 1IAKA 4PG2C 2B1AL 3FZUD 3X13B 4OIIL 4ZUUA 2NXYC 3CSGA 2DQCH 3Q3GA 3Q48A 3L5XH 1CFQB 5J3HD 1JGUL 3WXVH 5GSVA 5GS1B 3EO9H 3C6LA 3LKPB 3ILPB 1RK1A 4XMLL 4LBEA 4F2MA 3L6FA 3QYCA 2W9EH 4HPOH 3QDME 4YK4C 1JHTA 1MIEL 2O61A 2HKHL 3PQYD 3P0YL 4XVJH 3PWJB 2IAMA 2UWEE 4WI6A 1IGJB 1UCBL 4U2YA 1CICC 4NYLB 1A7RL 5DJCA 1D6EA 3IDMB 2AW2A 3IF1A 2MCPH 4XNUH 1J8HB 3QUZB 3MACL 4NQVA 4TQEH 3VFGH 3D2UD 4ODSL 1VKXB 1UT9A 4YQXL 3HMXA 3S35L 2FB4H 1KV3A 2H32H 3HPLA 4PRNA 4Z77A 1FQ9C 5E5MA 3SDDC 4KVCH 1IEBA 5E9DD 4MHHI 3IKKA 3JV6A 8FABA 2HLAB 2R15A 5E03A 4YHNA 3GHBH 4IS6B 2FH6A 3T4AA 3W5NA 1U93B 5EIIA 4NNPH 5DUML 3JWDC 4WI9A 4G6MH 2CKBH 4JVWA 5SWSA 1KGCD 1DFBL 1FNAA 4QXUH 1FZOB 4I0CC 4HXAL 1IILE 1UWEL 1E6JL 2P8PA 4Y4KA 3KXFA 3U6RB 1OGAB 5IKCA 1P1ZA 5I1AB 2NX5E 2VQ1B 4K3JL 4F7MB 4KQ4L 5I18H 4XRCB 3WFCL 5JOFB 3R06A 4L8SB 3UTTA 2ZCKL 32C2A 1NL0L 4UT9H 1YYLL 2NY3D 4WFFD 4EIZC 3BMVA 4E9LA 1UKTA 4U1JB 3S36X 5C9KA 2P7TB 4WW1A 3QIWA 3B9KB 4JO2H 5LCVH 2PTTA 3QUYC 4PV9B 5FDWA 5F7MC 3OPZH 3HG1B 4O58H 3DETD 4Z9KB 1T66D 5B4MC 4F7TA 5F7EH 4P2QE 5DA4A 1NANH 2XWTB 5FM5M 1A9BB 4RQQB 5CEZE 1I1AD 3CVIL 1CI5A 2J12B 5F1KC 4E42A 5IB2B 4PP2A 3F7PC 3CFCH 4JZNB 2X1XR 3NGBC 4G42A 2WMPA 1CQYA 4U1KB 5HHPB 1U8LA 4WUKH 1FNFA 4MYWB 4H1LA 2DTML 5I1LA 1U9KA 2CRYA 4DEPB 5EBGA 1WWBX 4W81A 4UV7H 1I7UA 5J1TC 4CU6A 1DBMH 1BZ7B 4NNYB 4HUWA 5CP3A 1D9KA 3ZT7A 1YMMB 1QBML 3QNYB 2KL6A 5F1IB 4J23A 3UTSD 3VRIB 3GMRB 1OWRM 4NGHH 2NXZB 3RTQD 3OKEA