5TGBA

Structure of chimeric 02-cb fab, a vrc01-like germline antibody
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
223
structure length
221
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDGWSGWYFDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differences in Allelic Frequency and CDRH3 Region Limit the Engagement of HIV Env Immunogens by Putative VRC01 Neutralizing Antibody Precursors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords 02-CB Fab Heavy Chain
total genus 37
structure length 221
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tgbA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tgbA01
4UV7H 1ORQB 3MRQB 4JFOB 5IVOA 5F93C 4DOHE 1A22B 3C60A 5IFHH 3V79C 4Q0XH 1R5VB 1M7XA 3RY5A 4ZUWA 1AR2A 3OR7B 5IMLA 1SYVB 4NIKB 4G6KL 1FZOA 3MLYL 3IETA 5GZNC 2OR9H 1RMFH 1FRGL 3TNMA 5ANME 4DGVL 4Y16B 1Z3GL 4U1NA 4HUMB 1JV5B 4OFVA 3LKRB 4XB7A 3OAYH 3RTQB 1LEGA 4LEXH 4JJ5B 5FUOH 2H2PD 1UXWB 2X4PA 1I3VA 3AXLA 5BVPH 3UDWA 5F7EH 4PJ9C 3MRDB 4PJIB 4DN4L 4APQC 1ZHNA 2IANB 1PSKH 1INEH 4P4KB 35C8L 4B53A 3T0DA 1TFHA 4ORGA 4MJ6A 2GTZB 5IM7A 4OCYH 3CC5A 1JRHL 3WS6C 1RK0A 1T7VA 5LG1A 5EFIA 4UNTA 4MNQD 2YK1L 3ARTA 3FT3B 3BP4A 4JFED 2NY5H 4WFED 4UTAH 3BXNA 2FX8L 2F54A 5BJTB 2YUWA 4N1HB 4NBYB 2NY0D 1WC7A 3CSPA 3NCYS 1VSCA 2AW2A 1LD9A 3O41B 5D9SB 3TLRA 4P3CH 2HG5A 3UDWC 2C7UB 3KYOA 1HHHA 2O26U 2RQ8A 5IEHA 2PXYD 2W0KA 3IDYB 3VXSE 4F7CB 3QB7C 4PBWD 3NN8A 1WBZA 4CADA 4E0RB 5B8CB 2NY1C 2R56L 4ZFZB 2WIIB 4M1DH 4YR6A 3VXMD 1DN0B 2R56H 4D0CB 3F6LA 3IF1A 4I2XA 1EXUA 3D9AH 3VXQB 2ZUUA 1MIML 1R3HA 1H3TA 1ZLSL 1NFIA 4K3DL 1FO0A 3E1F1 4IRZL 2D31B 3LKNA 1DQTA 1DEDA 4FS0A 4JZNA 1CFTA 1W72A 5IVXE 3VMOA 1S5HB 2ZOKB 5HYSA 5T1KD 2P7TB 3CMOH 3RJQB 4PTTA 1JYVA 5IG7A 4LK4A 4ZG1A 5A3IC 4LKXA 4LKXB 1NGZB 3CVHH 3QRGH 5FDWB 1OSZB 1S9VB 4IMKC 4K7PX 4LLDA 1CLZH 3VRLE 3KJ6H 1TZGH 2CKBL 4HGWB 2NY5L 3F12B 3VFOA 3PDGA 2DMKA 4ODBD 4DZ8B 4YHYC 3ZKND 3LKNB 4MNHB 5A16A 3I2CH 3WFBL 5CGMA 4LSPH 2YD9A 1TJGH 4N0YH 3Q3GA 1RZ7H 4R7DA 1DBAL 2VR4A 4X7SH 3HB3C 1HIML 3BKJL 3SDXE 1ETZA 4XX1E 2YD3A 4BFBD 4LDEB 3SHSA 1WFTA 1EGJL 3CLFH 4I13B 4D9LL 3DX9B 1T5WA 4IOFC 4K9EL 1XIWC 5J57B 2VLKD 2I25N 4HH9A 1N4XL 3KPQB 3W81A 3FTGB 1F97A 5GRXG 2C5DC 1E6JL 5F96L 2ZOKA 3EO1B 1MWAB 1IILE 2XTJC 3I6KA 3TNNA 1DZBA 1QP1A 1FDLL 2AV7B 1T3FB 2RCSL 4MAUL 2UV3A 1YJDC 5HHNB 3QEGL 1RURL 4HWZB 4WHDA 4PRPD 2ADFL 3Q48A 12E8H 3V0WH 3HC4L 3THMH 4AJ0A 2EKSA 1QFUH 4TVSa 5EIQA 3V7AE 2EYTB 1EEZB 1TQBC 3MRDA 4JHBA 4PG2A 1QFWM 4YDLC 4QHNB 3AMLA 3VFMA 1AO7E 4DK6A 2CRZA 4MHHG 2WAHA 1OCWL 1I8IA 2X4UA 3LDBC 1QPPA 3KWWB 4N90E 2E9IA 5SX5H 3AFLA 4JVPA 4XT1C 2R0LH 4ZD3H 2V7HB 2Q8AL 1OTTC 1FIGL 1P4LB 2VLJE 3KYAA 1FH5H 3KXFA 3QH3A 3VFRA 2IPTH 4Y4FC 3T0BA 4Y5YB 2IFGA 4NQCE 4JE4B 5L6YL 5KS9F 1T83A 3P9LA 3GI9L 3X11A 1AQKH 1D9KA 4PJGB 3MRQA 4YZFF 4Z7UE 3BN3B 1CR9H 3HMWL 5KG9A 5I1EH 4KH2A 4XP4L 1N2RB 1U8IA 1SBBA 1GYAA 2BOCA 1KT2B 3B5HA 3P9LB 2CK0L 1CR9L 2VDNH 3R0MA 1QD0A 3JWDL 4N8VG 2ADIA 3LOWA 2YEZA 2FEEI 3KAAA 3MRRB 2QJDA 1LEGB 4F7EB 1NCCL 3EJYC 4MCZB 4NT6A 4CW1A 1KJ2L 4U1LB 1PSKL 4X6DE 5JHLH 5HHXL 1SMAA 2X7LB 3LH2H 5L2JB 1VGEH 2CMRH 5EBGA 1OAZH 3QNZA 1ZLWK 2DN7A 4MQ7B 3LRGA 1EEYA 4QHLB 3PGFH 4M8QA 1U8QA 1FFOB 3FQNA 5DC4B 4LLYB 2E7BA 3V5KA 1IM3A 1AO7B 2BHZA 4JO3H 1Q9WB 4RFOH 2R2HB 4RQQB 1RUMH 5CGTA 5IKCB 3A67H 4IRJC 2EC9T 1ZANH 4X4XA 5DRXA 4N8VB 4JFZL 5EU4A 4YDKH 1A5FL 1BGXH 5IMMA 3P2TA 2WLYA 4WEMB 2H9GA 5DURB 4KJQC 4LPUA 5AUMB 3RY4A 1QFWH 3KHQA 5FF6A 1X4YA 3LEVH 2AK1H 4BFIB 1SJHB 3K8KA 3VWJB 2QSCL 4JY5H 4Q9CA 3A0OA 5GRJL 1RZJL 4G5ZH 4PJGE 4KGLA 1AHWA 3HZYB 4DKFH 4LLMB 2GJZA 2YSSB 4Y4HD 5EO0A 4XMLL 4X7SL 5I15L 1JGLH 3N9GL 1EERB 1A14H 2R1YA 1RV6X 5LXGL 4UAOC 3KYMA 1AC6A 4POUB 5JXED 1L9MA 3RDTA 1I75A 4U6YB 4C4KT 3SDDA 3SE9H 4I4WB 4TULL 1WF5A 5KVDL 1FNGA 1IQWL 1G7QB 1XF2B 32C2A 4N0CD 4R7DB 2X4QA 3LEXA 2QEJA 2YKLL 3JTSA 4KKAC 2OTPA 2JIXB 4X6DF 3CFKA 1X4ZA 3TA3A 2V6HA 1A47A 4MD5A 2E7LC 2VQ1B 4MJIE 3I6LE 3VE0B 4I18C 3ZKMD 1OT1A 1RULL 4MNQA 3TH3T 3RWHA 5IEKA 3D1MC 4OF6A 1H8NA 3EO9H 3GBMH 1HDMB 1Z9MA 3GMRA 5FDWA 1FGNH 2ZCHL 2X4OA 4XX1G 3QIBC 5IG7B 3FQRB 4KTEL 3F62A 2ITCB 4NN5B 1N0XL 3SGEH 2P8PA 2Q3AA 3MA9H 5FYKE 5KJRH 1S5HA 4PGCA 1OPGH 3V6FA 5E8PA 5F1SA 5IOPB 2F5AL 3C9NB 3JUYA 5T3XD 4B7IA 1XAUA 5F1NB 1PEZA 4DUWA 2BVQA 3QO1A 3GBNH 1EXUB 1DEEA 3LV3A 4CRPA 5IT2L 1QRND 2MQ0A 5DHXB 3UTZB 4WHCA 3QISA 4R4FH 3HC3H 1KULA 1T21B 1BFOA 2AXHA 4BZ2H 1F3DJ 3KPRB 4XCNA 1MFDH 3DI3B 4CADB 2FSEA 4K3EL 4ZAKB 3EOAA 4A6YH 3SE9L 4KDVA 3K74B 4G8GA 1RJYA 1TZGL 4QGTA 2HLAA 3ULVF 5IB1A 2RB8A 1T1WA 4Z78B 2XQBH 3QEGH 4LHUA 5C09A 2DTML 3VCLA 4NNPH 3O6KH 2AVGA 2D03L 1U95A 3SDDD 1GGUA 1MVUB 4ISVA 4AG4H 3EHBC 1VFBA 4U33A 3PHQB 1CICB 4XVUC 2HA1A 1IAII 2HFEA 4J4PA 1RJZB 2AXGA 4XXDA 3U1SL 3VXUB 5I1DA 4JVWA 3MODH 5FOBB 3ZZ1A 1MF2H 1YY9C 1UQSB 4XB8A 4KRPD 5K9QI 4NZDA 1UXSB 3CPLB 4LSDA 1WZKA 1SHMA 3LV3B 2BY2A 5DMGC 2BY3A 3WDHA 5KSBE 5C2BH 1ZAGA 4OZFG 2XWJB 2ZP0T 1ZV5A 4YC2C 1BVKA 1LK2A 2OL3H 1E4JA 5F1OB 4JJ5A 1MF2L 3EDFA 4LHUB 5JORA 4P4KC 4MMZC 2IGFL 1ADQL 2CIIB 4P4RB 3LQMA 3IU4L 4G6MH 1T1XA 4GQ9H 4EBQL 3TNMB 1UKQA 1OHQA 3ZE2F 3VH8G 1FC2D 2V5MA 4R97C 2APXA 4WFHD 1KENL 4X6EB 5T1DL 2ICCA 3UTSA 1R5VA 5FUCE 3EOTL 2AK1L 1FFNB 4QT5A 2EZ0C 5T3ZH 1T21A 1HCFX 4X5WA 3HE6D 2GT9A 1RZGB 3BKML 3GHBH 4OZIF 4KWUA 4G43B 2AQ3A 3EIFA 5FGCE 5ANMA 2WK2A 2RR3A 1XCQA 3MUY1 4KPHH 1FFPB 1IEBA 1HHIA 3L3JB 4U7KA 4K71B 2D3VA 4WNQA 1D5XA 1TJHL 1KJ3L 1EIBA 4YHMH 4KPHL 1J1XL 4XBGA 2YC1B 4WUUB 1OAXH 3ILPB 4WGVB 1J10A 4JN2B 5IHZA 3K1KC 1OAXL 4JO2L 4Y4KB 2PO6C 4M4RA 4F8TA 3MRBB 1QEWA 3BP6B 1BGXL 1UB6A 1T66C 1IJ9A 2YA0A 5DWUL 5DQDH 4CMMA 4KMQA 2VYRE 4Q0XL 4Z6AT 3CXHK 4HIXH 4PJ8B 4YK4B 5K9OA 1DDHB 1S5IL 5FO8B 1JPTH 5FO8A 2X1OA 2BVPB 2EDQA 3LQZA 5ENWB 1A3RH 1ZSDB 3SKOA 4FG6C 5A2IH 1FNGB 3L3KA 2KKQA 3TYFA 4G6AC 3S35L 2PYEB 3LAFA 1AO7A 4HIXL 1ZGLB 4JY4A 3HS0A 5ACMA 3QUZA 2BNUA 2C3GA 1DQMH 3MSPA 5MENB 1F4WH 4XCCH 4JM2D 3LD8C 3QJFB 3ECBA 1GGBL 2GJZB 2YSSA 4PJCA 3MRHB 2H45A 2PW2B 2Q7YA 2Z92A 4YHNB 1TZIB 4BZ2L 4P99A 5ILTH 3PWJA 4CBPA 4V1DD 1YJDL 4DZBB 2CKBH 1KXQE 1IC1A 4XNZC 3VXSA 4DKAA 2HFFB 4MGXA 1AP2B 4E5XB 3BE1L 5GJSH 5IF0A 1R3KA 5B39A 3NPSB 2VQUA 3U7AA 5F1IA 1K2DB 2K7QA 5C0BB 3S88H 5BS0E 3RL1A 4ZNEA 2ZKHL 1MWAH 3O8XD 1Q9WA 2WQRA 2BJML 2EECA 5FYJD 5J7CC 4OGXL 5DJ0B 3BIAX 3BP5B 2Z8VC 3MBEB 4UT9H 1IKFL 2IPUG 3A6BH 4MA8L 2G75B 3LEYH 1H15B 1K8IA 3QWOA 4PD4J 6FABH 1J1PH 2B1HH 2I07A 3PIQA 4IHOB 1MWAL 2HVKB 1JZ2A 3O2WL 1QLFB 3QQNA 4JDVA 4F15B 5J6GA 2AS5M 1WZ1L 2R23B 4QRQA 5FUZH 3BRGC 3E3QC 3BP7B 5SWZB 1IT9H 1NDMB 3SDYH 4L3CA 4QXTA 4J3SA 3TYGH 1K85A 4L4TA 3MLZH 3QIWC 1KGCE 3W39A 4LMQE 3KPMB 3DROA 3WN5B 1IRAY 3GRWA 4QOKD 1YY8B 2H6PA 2R9HC 1P6FA 1DQLH 2ESVD 4R90L 5FOBA 3S34H 4OCRL 3KDMA 4WFGD 4BSVA 3DV6B 3FMGH 3PHSA 1K3ZA 1M6OA 2P8MB 1MOEA 1MI5E 5EDXA 2MPAH 3DVGA 1MCKA 5M7QA 3JUZA 2W92A 2EEAA 1RFDL 3DRQB 4LKCA 1L6ZA 2A74A 1T3FA 1H8OA 2BVOA 2YRPA 1CE6A 3DGCR 4L1HA 4KK5D 1T1WB 3DX7B 3ARUA 2HH0H 4Y0GA 4RMSA 4O51A 4YHLL 1LE9A 4HIJA 1Q9KB 4HMCA 3MPCA 5D2NB 2F5AH 1JF6A 3CCHA 2FEDC 3FHQA 5I18L 3VFUB 1CLOL 5JW4R 1ZWIB 3OKYA 3VWKD 4OV6F 1BQHG 5JW5A 1MFCL 1NGQH 3ZE0F 4JZOA 1BIHA 5KSVB 1UC6A 1SEBA 4LLQA 4K55A 1A7QH 5F7NC 3DBXA 2OP4H 3WCYA 1GAFH 4QKXB 3RKPA 5E2JA 5HYEA 1HILB 3IT8D 3TJHC 3X3GL 3P3YA 1T7XA 3BN9D 1BEYL 5DXWA 4B5EA 1XGTA 4MX7B 1D5ZB 3FRUA 4UB0L 4PGBB 3I6GA 4Y1AA 4Y5XB 3ZTJH 4LQFH 2J88H 4IOIA 1Q38A 3O6KL 4PJ8D 3V5HB 1TZHA 2DM3A 2XN9D 4O58L 5IVXB 4BSWB 4X7FC 3BKMH 1K6QH 4Y19D 5KSUB 5F9JA 5IVXA 1NCWH 2WINB 5HJ3A 4I3SH 2MNUA 3E6HA 4JRXB 4YGAB 4NWTH 5ID1A 5BRZD 1HOCA 4HUXB 3MXWL 5DUML 5IHUH 3BEWA 4X5XB 3SE3C 5D7IE 3P0VL 2VE6A 1LDPH 3BDYL 7FABH 2XI9A 3QG6B 1MLBB 3B9VA 3DIFB 4HIEB 4MXVE 4Z7UA 1I85C 1IGFH 5IJVA 5GRUH 5IB3A 5FA3A 1A6TB 2B2XL 4HAFA 2DQEH 1NBZB 1UEYA 3QA3B 4PB9L 4GMTL 1S9XA 5C08D 3P4OA 5ECJE 2AEQL 4HLZH 4X6DA 5JO5B 2F5BL 3JV6B 4PY8J 3KHOA 2OP4L 4U6TA 5DC0A 4OZHB 2HT3C 2B1AL 3H6JA 3VMNA 1KPUA 1U91B 4G9DA 4MA1B 4F33A 4Z18A 4D3CL 1F3RB 3CFEA 4GRMB 5DI8B 3B9KA 3NZHL 3VXOB 2OS7A 1JYXA 3NPZB 4UINL 4GG6B 5EB9A 3O8XB 3QUML 5HHOD 4BKLA 3I50L 4QHMA 2WUCH 1RK0B 4JRYB 5EU4B 3FFDB 1KG0B 1NMCC 2H1PL 4NZJA 5KN5B 3JWDH 1CTOA 2N7AA 1ZKAA 5DUBB 1RVFL 4NKOA 2R2HA 4KHXH 4RQQA 2W9LA 2A6JA 2XKNA 4RSVA 3JXAA 4AMKH 1GGYA 4S10A 4UUJA 3DYOA 1CYGA 4KI5D 4CVXA 3P9MB 2ZUSA 3BD3A 1FHGA 2HG5B 3O6LL 2X41A 3ZHDA 1MRFH 2VZVA 2XWBA 3B2VH 4V1DA 4OB5H 3RTQA 3LZFL 4A2LA 2AKRA 2DM4A 1JPST 1QFWI 3PGFL 5KVEH 3N1MC 1I3GH 1IMHC 4Y16A 1RJLB 3BEVA 4ZFOA 3A6CH 2ZPKL 2VL5A 2G75A 1SYSA 5I9QC 1UCBL 4KJPC 4OIAA 5DJ0A 4XP5L 3M17B 1A0QL 4LSPL 4FFZH 4XVUD 1RIUL 2BSSB 3EOBA 3QIWB 4ONFH 4PRDA 1FVDB 4FABL 1NCDH 3U48A 4HDIB 3T2NL 4OCSL 3HG1D 4QOKE 2P1YA 1FYTB 5B39B 4N0RA 5J12B 1YPZF 2DWEB 4X9FA 3W39B 1NEZB 1YEKH 2FJHB 5CBAA 2W0FA 1CG9A 5EUKA 4OZHF 2D7MA 2N1KA 3BP7A 4JKKA 3L3IA 3MLSH 4X8JB 3M45A 3CMOL 3PQYA 4KZEH 2WUCL 1KBGH 4X7DC 3G5YB 3VWJD 4U05A 1FP5A 1IAKA 3IDGA 1A3LH 3C6SB 3BPCA 2RFXB 2PW2A 2Q7YB 5EU3B 3BYTA 1X5FA 3Q6FB 4NRYA 4DWHA 4RBPK 4LP5A 2MQ3A 4NO2A 4P5TD 5EO9B 3MRIB 1S7WA 2VDKL 5TPWH 1FZMA 3S8WA 2GUOA 4NZRH 1U92B 1QSVA 4P2RB 1ACYH 4TNWF 3IXTB 2CR3A 1NBVH 1BREA 4GRLB 4WFFD 3BGFC 3ZYOA 1NC2A 2B5IC 1URLA 1MRCL 4OM1L 2OSLA 1XF4A 4M9OA 3BUYA 4R2GB 3DVNA 4I5BA 3FO1A 2BFVL 3ULVE 3T3PF 1S7XB 1BAFH 1CZ8H 3IDMA 4Y19A 4OFDA 2AV7A 3ARBA 3CZJA 3CZFB 2AAVA 1H0DA 5EUOB 5FYKH 4MCYB 4P2RD 4Y5XC 3ROLA 2A1WL 3N06B 4BFGA 4PGJA 3CFCH 4X6CE 2Q76B 3MX0A 4EUPH 1JN6A 4HWBL 4GKOA 1KJVA 3KNBB 3N50A 1T5WB 4HF5L 4XPTH 1IQDA 1E6JH 3S3SA 1P7QD 1KEGL 3MGOB 4DTGH 1JZ4A 2BC4A 5IMOB 3S34L 1KCUL 1N7ML 1A7NH 1IKNA 3STZA 5KSBB 1JGUL 5DRZB 5SWQA 3WKMH 3OPZL 4NO5B 4OCXL 4NN6C 5F7YC 12E8L 3AY4C 4G43A 4AEHL 3L3HA 2B1AH 4Z7VA 3VXUD 2DIBA 3W9DB 4WFEE 1FBIH 2CLRB 2C4FT 1RUPH 5DQ9B 3HG1B 3SGKC 4GBXC 4O00A 3I9GH 2HJFB 2OTUA 1MQKH 5IESL 4N0CC 2M26A 3T8XB 4M6OH 5EWIL 3ZKXC 4LVHC 1FFNA 2X10A 3VFGH 1KC5L 3GSOB 4M7ZB 4ODXA 4OLYL 5T3XL 1C5DB 1E4XH 1JP5A 1NSNH 2B4CC 3GSQB 1L0QA 1MCOH 1NGQL 1M05B 4OZIE 1A6VH 2PW1B 4LLVB 1A9BA 2GSGA 4HJ0C 4WTWA 2WWKO 4GXVL 5CIPA 3TBSA 1Z6JT 4HS8L 4QO1A 5FV2A 3WFDL 3T0EE 4M7KH 4MX7A 2MCPH 1NDGB 1YY9D 1F8TL 5TFSH 2NY1D 5D7IB 5IBTH 1LMKA 4I2XB 4HBCH 5C86A 4D9QD 3I3BA 1TNNA 4X80H 1IBGH 2UZXB 4KK9C 1T0MB 4U6VL 2YD6A 4PJAA 3JWNC 3MR9A 1INQB 1C8PA 1ZLUH 3FT4B 5DK2A 2J88L 3A6CL 3OAZK 3OX8B 5C8JB 1XH3A 5CEYB 3VA2C 4QHUB 5EZJB 3AAZB 5T5NF 3TV3H 5KSAB 1IAIL 4WI3A 1CDIA 1YUHA 1UVQA 4KKNA 2WSKA 1OGAA 1J18A 2GY7B 2Z8SA 4P0DA 1EMTL 5IWLC 2L0DA 5ETUB 3RU8L 1HQ4B 4KROC 2EXWC 3B5TA 4FFYL 5AYQA 3M07A 4PJXA 2ZG2A 4NUGL 3SKMA 1YEJL 3OKDA 2PO6D 5TDNB 4M1GL 5IBLD 5SV4A 1ROWA 4QHUA 5BS0B 4PJ9D 5C08B 3B83A 4PLJC 2WNGA 2DD8L 1WBXA 5D7KE 3BMWA 1BOYA 1N3NA 3QAZC 1KBGL 4R2GC 5GGVL 1BQLL 3RVUC 4AEIL 3IS1X 3I6LD 4BELD 1I9RH 3SBWA 4NPYA 3O2DA 1ZVYA 3QDJA 4PIRF 1UWGH 5B8CC 3SE4C 4PRHD 2EH7H 4PJ9A 3TIEA 4ZFFB 1OB1A 2VLKE 4U0RB 1UXWA 5DQJB 5F7WC 2YD8A 1EO8H 1F2QA 3SDAC 4Q74A 3R06A 2F19L 4MS8C 1W8OA 5C09E 3C9NA 3RPIB 1D5MB 4KKCC 1CXHA 3T3ME 3BE1H 3V6FB 1V7ML 4ONFL 1NFDF 1A1NA 1KV3A 1IE5A 5C71A 1RJYB 1KN2L 2AQ2A 3WV0A 4LVOB 1FNEA 4UIMB 4HC1L 3GKWL 3MLZL 3DX6A 3QEQD 5HGBB 2AXJA 1SY6H 3FO9B 5TF1L 1KJ2B 2APBA 4Z76A 3VG0L 3RL1B 3OXSA 4ACPA 3BAEL 3TA3B 4MNGE 1BIIB 3CX2A 1GZPB 3FAXA 2A73A 2CLRA 4KDWA 4DW2L 3D3VA 5L8LB 5FYLE 3UTTE 4XMPL 1B3JA 4LSUH 5DD6A 4YDLB 3WL9B 1RZIB 3O3DB 4PJCF 4OM0L 4RRPA 3WFEL 2QSTA 4WU5A 2FWOA 3ES6A 4BZYA 1FNSL 5A3ID 1NL0H 4L5FH 5F97E 1HH6B 1MJ8L 2Q1EA 3DUHA 4PV8B 5E8PB 4NC1C 4XVSH 4LMQI 5DLML 3WO4C 3L5WB 1TETL 3RDTB 3ETBF 2P8PB 3MRHA 3ET9F 3SGKA 1AD0A 5JZ7D 3DI2B 3ZKSD 5HTSA 2NY7H 4H25B 1KIUA 1JIBA 4X4MA 4PG9B 4L4TE 2NR6D 2OR8A 3RGVC 1SBSL 5I75C 1UACL 5FHBH 3QBTB 3CXDH 1FZJA 2V5SA 3HE6A 4M48L 3U1SH 3PNWB 1D7FA 1H5BB 5F9OH 4XHQA 2XNAB 2HRPH 4Z7VB 4LF3A 2W65B 5DHYB 3PABB 4UOW1 1LQSR 3LCYA 2UYLB 5EA0L 5SWSB 3STZB 1HNGA 5HGHA 2FEDD 2QSCH 3IXAB 2DJUA 1DBBH 4JM2F 2BC4B 4NSKA 4ZUTB 4HWBH 1D9KD 3IJSB 4IMKA 4ORZC 3H42L 3O9WC 5D1XA 4KMTH 3C60C 4LGRB 3BPNB 1BZ9A 2MKLC 1QLEH 3M8OH 1KPRA 1OAKL 3EJYD 4Y2OA 4YEFA 4TSCH 3H0TB 4U1JB 5T3ZD 2OI9C 3ROLB 3O6ML 3QIUC 1KENH 3CFBA 5EUOA 5JR1L 3BW9A 3CSYA 4WCYH 3HI6H 1V3LA 4XCYB 1UADC 3H3PL 3P30H 3FCTB 4GXUN 3LDBB 4JAMB 5EU7E 3OBAA 5GS1A 5ICXA 5FUOL 3U6RA 4P5MA 1R3LA 4IM8A 4OLYH 5T3XH 3WS3B 2AABH 1FYTA 1N2RA 3BUYB 1NPUA 3NIFE 5SX4H 5D8JH 4RAVB 3SDAD 4MSWB 4HK3N 2NQCA 3M1BA 3SQOL 2VSCA 5LVEA 3JTTB 2AEPH 2NLJB 5F72S 3PQYE 2HH0L 1JJUA 3WEXA 2P8LB 3IS0X 2QR0B 4NQDE 1NEZG 3Q6FA 5BV7B 4Y5VB 3ZSTA 4JB9L 1BZ7A 1NGYA 1CF8H 4PRAA 1YECL 3S5LB 1W2KT 2EDNA 4PBXA 3HNVH 1Q9LB 3E6FA 1R24A 3LKOB 2DMCA 5D7SH 2YMXL 2IBZX 3P0GB 5DZLA 5KS9B 5E70A 1Z5LA 4ZYKB 3GSRA 4WI6A 3STLB 3FAWA 2J8UA 4ZS6C 3FQUA 3I50H 1R6VA 5DMIH 4UINH 3L9RA 3OZ9L 3QDMA 1RD6A 3HZKA 5KG9B 2AV1A 1A1MB 2PUQT 5GS0H 4NBZB 1MHEA 4FXKB 1K4CB 4FZEH 1T1ZB 4RDQF 3PHQA 5JTWA 1TVBB 1U6AH 4XPBH 1NGPL 2YD4A 3HI6L 5BCAA 5FA4B 4LVOC 1CDUA 2D0GA 3O8XA 1G0XA 4JG1L 5J1SC 4L4VD 1A9EB 4KXZH 2VDOH 1YEEH 3REVA 4YC2B 5DJ6B 4Z95L 4CNIB 2PTTA 1F6AB 5FHAL 4IDJL 4BK4A 2NY3D 2A2QT 2Y07H 1PX3A 3S37X 3QO0B 1DFBH 3IGAB 4OZHA 2EC9U 4QTIH 4KHXL 3C6LB 4D8PB 1MEXH 3QI9B 3P4OB 4CVXB 3QA3A 5F7DA 1U8KB 3PP4H 2GI7A 4WO4C 4OLXH 2HFTA 1LILA 2J5LB 2PF6A 3MNWA 2JCCE 3VXNA 2NYYD 2FD6H 3NFNA 5JXAH 4Z7UB 1B88A 2BK8A 1QO3B 5HVHB 1CLYL 4KUZL 1WAAF 5EU5B 4UOW0 3X3FH 4KK6D 1MAMH 3ZE1F 15C8L 3QEHA 2ATPA 3B9KB 3V5DB 2JK5B 5F7EL 3V8CA 4LBEB 5E6IA 5C0FB 3F12A 3DJ9A 2JB6B 3NCJL 5DVLA 5ELIA 5CS7A 4QF1B 1VA9A 2VLKB 1IL1B 1ACZA 2YPLB 3C09C 1HDMA 1KXVC 1A02N 3DUUA 3PDOA 4RX4D 3WFEH 3QULA 4P9HL 3ZT5A 2VNCA 1P7QA 1I7RA 1G1YA 4R4NC 4TTGA 5EBLA 1UWGL 2ATPB 2NY6D 2CIKA 3G04B 5B3JE 3BI9X 3LIZH 1WTLA 4L9DA 4R6UA 1NFIB 2LU3A 3JTSB 3GMPA 4XVTH 5EU5A 3KXFE 4KTEH 5I8EA 32C2B 1TQCC 3QG7H 4IRSB 4PJHB 5AWNH 4YXHH 1UWEL 4F2MA 2CIKB 3G04A 3SDDB 4XCEB 5HPOA 5DF0A 4ZO9A 1PD6A 3VGBA 1RULH 3BMVA 3VFOB 3MLTA 5DEGB 4OQ1A 1XGPB 1S8DA 4GO6B 4L4JA 1NUNB 1JF5A 2GCYB 1NGZA 1UWXH 5I76B 1RUQL 4TUKH 4XBEL 4L8BB 1CQYA 4KKAD 1V7NH 1UM4H 3NA9L 4RISH 1H3UA 3X3FL 2B4CH 2VDLH 4XGZB 3HRZB 1VPOH 1J0ZA 1D5IH 3VXTA 4CMHC 4RISL 4HKBB 4JFXB 4Y16C 5DD0H 3TCLB 3H2WA 5F6HI 5EZOL 1FO0B 3RZCD 3JBG7 3UPAA 3T77A 2YUXA 3C5ZA 1M6OB 3F58H 2HT2D 2NX5B 1EHLL 1S7UA 3KDMB 4XXCC 2WWMC 3PQYD 1F3JB 3EYUL 4S1QL 4L5FL 1OF2A 4OJFL 4G8IA 4FFWD 5GISH 5I17A 1HXMA 4WUKL 5CILL 3HNTL 3RX5A 4M02A 3EKCA 3BH9A 4LLAA 5JDSB 3OHXB 1A6WH 5FGBA 1RUAH 4KKLD 3GMOB 3TFKC 1A6VL 2NNAA 3S5LA 5SX5K 4FTVB 2CDGB 4E42A 1OAQL 3GO1L 4F9LA 2IALA 2WZPD 3EYSH 5KOVC 3HE6C 3EOYG 3GGWA 2NLJA 4PRPA 1T5XB 5ITBH 3EUUA 4HBCL 1K4CA 1OSPL 1ZS8B 1FGVL 5AZ2L 1NAKL 4HX1A 1BEYH 2NY5C 4PJIA 3TEUA 5FECB 3BPOB 2GJ6E 3VD7A 1MIEL 3ZL4L 2V2WB 4I0PD 4JPKH 1OAKH 2D0FA 3VW3L 3KXFB 3VFRB 3W0WE 5F8QC 1JNLL 1QRKA 2V7HA 2PTUA 5I0DA 3MV9D 3OZ9H 4JFFD 3QIUA 5JUEL 1KTLB 1UM5L 3GSNA 3WN5C 4U1JA 3FQWA 3WEXB 1UM5H 5CZVH 1YEJH 5GZOC 4Y4HB 3BKCL 2EDDA 4FFYH 2F53B 2WV3A 3NACH 2BNRB 5TJWK 4JFOA 5LBSL 2FO4B 3VMPA 5L0QB 5HYJA 4PJ7E 1QHOA 3GSUA 4JFDB 2UYLA 5SWSA 2VZTA 4URTB 1RK1A 4X6FA 3U4BL 4NQED 5D7JC 2MSPA 2FO1A 3VFNB 4HQQH 1I7UB 4RFOL 3BH8A 3FONB 5JHDD 3TVMB 4EI6B 1U8OA 1ZHBA 2O5XL 1NAMB 2KZ1B 5I8OL 1QFHA 1RIVH 4PB9H 5E1AA 1HYRC 3P4NA 1I8LC 1IGIL 2EYSA 2IH1A 4QNPE 3QPQD 1MCPH 1SJEA 2XWTB 3VA6A 1AD0B 3QG7L 5AWNL 4HG4J 3SCMC 4KRMB 3QIBA 3AMKA 1J1PL 2B1HL 5I19H 5C1MB 3ZL4H 4WNQB 1RZ8B 3O11A 4LCWA 3C5SB 3U4EB 4JANA 1SVCP 3EBAA 3MJ9A 4PV9A 4ZTPH 2D2OA 3H8NA 3CH1A 2BVTA 2YRZA 1SY6L 5TF1H 4C56B 4PGZA 3I85A 4H0GA 4ZPTA 4PJ8A 5HI4C 5IBUG 5I73C 1CGUA 1OD9A 2VR5A 5T1LB 3FB7B 3OKMB 4R96B 3D9AL 4UQ3A 4YXKH 1P2CA 3FQTB 3QQ4B 1UFUA 3PJSB 3QHFL 5E8NA 2Y1VA 4TQEL 3O8XC 3VG0H 4UNVA 2YC1A 5DK0A 5DUPH 3H9YA 1YEFL 5JIKA 4PYGA 3BWAA 4EI5A 3VWKA 5MEOB 4Z7QE 5E94A 5EN2B 2A6DA 3HPLB 2D4FA 4L4VB 4OLXL 3AU1B 3CAFA 4HKJB 4UV4H 3QR2A 3HPJA 5C6WH 4O2FB 3G5ZB 1EBAA 4PJ9B 1FQ9C 4U1GC 1CLOH 1RJCA 4NM8H 1RIUH 2B2XH 1EO8L 1KB5A 4RWYL 1AXTH 1TJIL 3PP3H 5LGKA 1JPGB 3ULUF 2FZ3B 2HFGH 1HHJB 1KN4H 1XIWD 4JPIA 4P2QE 5JW3L 1BFVH 4HUNB 1HN1A 1PDKA 4J6RL 4H0HB 3ARGA 5IEHB 5CKAA 2B4CL 3NCCB 5GPRA 4DKDC 2OQJA 2IJ0C 1DR9A 3G08B 5I74B 2GAZB 3GJFH 2MHAA 5JPNA 4A6YL 2VSDA 5MHSE 4KDTA 5ACZB 2FX9L 1LO5A 3PWVA 1DL7H 3RA7L 2QHRH 4R97B 3TIEB 4ZFFA 1U36A 1Y0LB 2H1PH 3OKLA 1N5AB 1FVEB 3QEQB 4YXHL 4JPIB 5HHQB 4Y2DB 4JRXE 4LSUL 4Q7DA 4AG4L 1MJ8H 1PBYA 1WCBB 5FO9B 2W07A 2RCSH 3MA9L 4IOFD 3KPSA 4MDIA 1CU4H 4UILH 4N1EA 4QXWA 3GSXB 1NAMH 2C3VA 3RVUD 1TLKA 5I1GH 2ORBL 3HNSL 4AIOA 1ND0B 2FB4H 2AJXL 3IJHA 2AEPL 4HCRA 4M61B 5INCB 4HLJA 4PJCE 3PGCA 2IAMD 3O0RH 4OFPA 4W6WB 4GUPA 5DGRA 3DMMC 5T1KB 1JZ8A 4JPWH 5F88A 5L6YH 3CFCL 1NGWB 1W0WB 5D7SL 3QXWA 2GAZA 4GMTH 3B9KC 3GMNB 5D1QA 3JZ7A 3TO4C 3SGJC 5EZOH 2LFGA 1S9YA 1QKZH 4ZUWB 4LU5L 2FECI 2WBWB 3TIDB 2DQHL 3GJFA 4JR9H 1YNTB 3SE8L 2RBLA 4NQXB 3IU4H 4G6ML 4XWGH 3T08A 5KBNC 3PUCA 5D7KD 1NBYB 3H7LA 2BSTA 4MD4B 2VC2L 3LN4B 4ODHL 5TE6L 4E41B 4FZEL 2O61B 5ISZD 3DTXA 3QZWB 4KK8D 2W60B 3N9GH 4PRHE 1C16A 1RVFH 1CLCA 1RHHA 4JZJA 2NZIA 4GG6E 1UKSA 4NQCB 3QQ9D 2Z35A 4PJ8C 2XQYG 1I1AA 4WWID 4ZTOH 2ILLA 4X98A 2WBJD 3HFML 1IQDB 3C08H 4YNYB 1M05A 4WFFE 3L95A 5AZEL 1HHKB 4P2OC 3RX7A 4RIRB 3NIFF 4D94A 4Y4FA 2BMKB 2Q76A 2FLBT 3BZFA 2Z31C 1LO0L 5FDYA 2EIZB 4HIHA 5EH1A 3PJSA 4NWTL 2W9EL 2OYPA 4UU9B 4EDWH 1HINL 2IQAA 3DURA 3B6SB 4I3SL 1MRCH 1MPAL 1QSFB 1ZHBB 1NANI 1I9JH 3QFJE 3WXVH 4ZSOB 4JO2H 1CVSC 5I1KL 2R1WA 1W0VA 1T22A 3KLHD 1OWRM 2H9GB 4JRWA 4ZPTB 2A38A 3WHXA 2F74B 3G6DL 1RK1B 1G7QA 4XTRD 5I1HL 1UJ3A 1DE4A 3MLPA 5HY9A 3PL6C 3SJVD 4RGNC 3C2SA 1A0QH 1BOGB 2AXFA 5FYJE 4M6NL 5I1LA 4MA3A 5CSZA 4FQLL 2Y5EA 2CJUL 4NHCL 5E8EA 3O3BB 2F53A 3G9VA 3STBA 5JXEA 3D39A 1DQQB 1RIHL 5CIPH 3RUGE 3GBNL 3F6IA 3O4LB 1IZKA 1I85A 1CE1H 1U8NA 3V4VL 4NRYB 3U7YL 3O81A 2VAAA 4PP2B 1AGFA 1KSRA 4M93B 3T0WA 3V4VH 4DTGL 1DBKL 3S96A 1GGBH 4AMKL 4G6KH 2X44D 2O5ZL 4XZUB 4BFIA 2DL9A 3O3AA 4P2QB 5A1AA 2QKIA 3OKOA 4PJDE 3EOTH 1U8MB 3DVNB 4JO4H 4N0FA 3GNMH 1JWMA 3RZWA 5DJCA 5EO1B 1MQKL 3SGDI 1G9NC 3U7WH 1CS6A 2YZ8A 3T2QA 4FQJH 3DSFH 2AEIT 1EPFA 4MA7L 2Z9TA 5IJKA 5GHWH 3I3EA 1U8QB 3NIDF 2UVFA 4ERSH 3B8SA 3PL6D 4JFPA 1U8LA 3CNKA 5CJ5A 3HUJB 2CD0A 3U7WL 2H26A 2R0ZL 5I71B 1UM4L 5JOPD 4KJPD 1ZGLP 4TUKL 5A2FA 4U4BA 1U41A 4L3EE 3KLSA 2EDWA 1YNLH 3UYRL 1G9ML 4OSUL 4OI7A 4ZDHA 4YGVB 2XA8H 3RUGB 5SWSE 3MJ7B 4G80A 4U49A 4P5TA 4WO4B 1AGBA 4G8GD 3T09A 2PYEE 1W72L 1SQ2N 3X13B 1YEKL 5DJXB 3D2UD 4ZNEE 3KPPA 2DQJL 5DFVD 1F4XL 3T77B 2DKUA 2VLJD 5EZIL 4L3ED 3F7RA 3SE8H 3U30C 3IDXH 5EOCL 4OLVL 3KS0J 1RJLA 3BEVB 5EWIH 5EPMB 3EO1A 4PJIF 1MFAL 4NRZA 1MJ7L 2FIRT 4PJAF 4N9GB 4YHKL 4Z7OF 4ALAH 1DSFH 1IGTB 4JJHA 3WMSA 4LOUC 4PLNC 5C0AD 2LVEA 2EXYD 3FL7A 5D2LB 1OY3B 1MCJA 5IFJA 3WO4B 4LSVL 5KW9L 3V52H 4NM4L 3QWRA 4X4YB 4U3CA 3IVKB 5BRZB 1RUAL 1ETZB 2FL5A 2PO6B 4YWGL 2DYPD 3UAJC 3KJ6L 4BK5A 5I66B 1PKOA 1WT5C 2Y6SD 4HIEA 5JW3H 2E7HA 4HWZA 1DQJA 1U3HB 5E5MA 3E3QE 1TVHA 4MYWB 5CJXA 5A2LH 4L3EB 2IANE 4WEBL 5H2BB 5MEPB 2LVCA 2OBGA 5CJQH 5L9DH 3O3EB 2XA8L 5D5ME 3RWFA 1EHAA 4R26H 5KSUA 3GM0A 4L8BA 4JDZA 2HTLC 3FB6A 1FBIL 1DBJH 2GCYA 5E9DD 3P73A 4TN9A 3SOBH 5LGHH 3FOMA 5IVZA 3RWGB 2HMID 3RWFB 4WTXA 2P48B 2HRLA 1KPVB 3CDFA 3VD9A 2E6JA 1QSED 1FCCA 3BVNB 3L3GB 2DLFL 1LEIA 2XY2A 2JKXA 3I02A 5DJDA 5FKAB 4R90H 2C1OA 1LEIB 3KGRA 3O0RL 5GS2H 4KZDH 4U7SA 4MNHA 5A16B 2DBLL 3LN4A 3GUTA 5KSVA 5ID1B 3Q5TA 5ESAB 2EE6A 2R0WL 5LCVH 2J8UF 5B4MD 1YNTA 1NLBH 3QI9A 1Q1JL 4LSTH 1QFOA 3HC0A 4YHPA 4RFEA 4F7TB 3C6LA 3UYOD 3SO3B 1KB5L 1TNMA 1KCVL 4N0UE 5DJ2B 1KACB 5DQDL 1YN6A 4RAUA 1MCFA 3V5HA 2HJKA 2CDEB 2IBBA 4ZPVB 2P24A 2OI9B 4P9MH 5I18H 4EN3D 3BXNB 1F90H 1WSST 3QPXH 4OGXH 1DCLA 4GBXA 3ALPA 3MMEB 4U2ZA 4JPVH 1JMZA 4KROD 1RIVL 2P4AB 4CGTA 4IS6A 2EDTA 1J7VR 2EYRA 4O58H 5T3XE 2KBGA 3O9WB 5JQHC 5IBLC 1MHEB 4FXKA 4MQTB 2R29H 2YHGA 3D0VB 3QIWD 5J1AB 3DV4B 3L1OH 5H8DA 1JF1B 4L8DB 5GRVK 3IDIB 3U46B 3QHTC 4CN1A 4K7PH 4ZDHB 3L5HA 4AH2A 3C2AH 4D9QE 4P23A 4M93C 2AJZB 5CLTA 4F7CA 1BLNA 4MVBC 1QBML 5I2IA 1Z5LB 3I3DA 4JN1H 2J6EL 1LD9B 2YPVL 4U1IB 2YOCA 3O6MH 3QXAA 2HJLB 4MLSA 2PXYB 2FIKB 2XACC 4G7YH 3BKCH 2NXYC 4EDWL 4ONGL 4Y5VA 4JDVB 3BGAA 2XG4A 5DDHA 3HUJA 4ENED 5CP3A 3NIDE 4M1GH 2BNQE 4YDJB 4IJ3C 4JFHD 3ARGB 2D7TL 4LCWE 1E4WH 3FO2B 4X9IA 4G6JH 1ITCA 4OTXH 3WE6B 3B2UD 1BQHA 3WIHH 5ADPH 5HVWA 4MAYA 5DUPL 1SBSH 4P4KA 4NWUL 1CCZA 2Z4QA 2X4SB 1OAYH 5FYJU 4M48H 3KJ4C 1LP9B 3J7HA 4UIKL 5CMAB 1IEHA 3VXUE 1IM9A 3G5ZA 3S88L 4KDTC 3OKOB 1XF3A 5SWZA 2DQFA 4XCFH 3W11C 2GK0B 1FNHA 3D3VE 5LXGH 4HJGA 3HPLA 4X8XA 3BQUB 4UT9L 2VXSH 3V7AG 2YXFA 4PJFB 5IMKA 4M5ZH 4XI5D 4GSDL 2E9WA 4NJ9H 3QWOB 5I1CH 2HFGL 5GRJH 3DWTA 2WUBL 5HXMA 4ZTPL 1HWHB 4O2CA 2HKHL 3VD3A 1MNUH 4WWKA 1XZ0B 4PJFE 2MPAL 1SY6A 3FB7A 2X70B 2XZCL 2R8SH 1T89C 4JVUA 4PRBB 4CL7A 2IADB 1KB9J 4PR5B 3T2OA 3QQ3A 1CVRA 4UILL 1WFOA 1ZTXH 2HFFA 1KIQB 4YBQC 1G7HB 4OLZL 5HGDA 4FQXA 3ARDD 3PNWA 5MI0B 4JAMA 3S5LG 1P9MC 1IGMH 1YNKH 3SY0B 3R1GH 5JQ6H 4XP5H 4H0IA 3C5SA 4K94H 1G6VK 5CINL 3WJLC 5D7JD 1R3JA 1FE8L 5F7UA 5LGJB 3DLQR 3R1GL 3JSSA 4IOSD 4FTVD 4GKZB 3OXRA 3L5WA 3IKCA 3P11H 2EDHA 5FXCH 5D96C 5B39G 4RZCA 3IFNL 5AEAA 4KY1L 3OAUH 1B0GA 5BZDB 5JHDB 3OSKA 2YD5A 1W72H 1FYTE 4YHYB 2VLRA 5C07E 5FM5M 4KQ4H 4XPGL 3TBTB 4Z7WF 4S1DD 1KCVH 3INUL 1EHLH 2JCCF 4RGND 5E08H 5A2KH 1LEKB 4N90D 1AGCA 2UZIL 2CKNA 3H3KA 4P2OA 4NJAL 3TT3L 3K8LA 2ATKB 4POZC 3UP1A 3AS3A 1AFVL 1E28B 1X6LA 1Q0XL 4NQXA 4QRRE 4NQDA 4HPYH 3HCVA 1P5UA 4NC1E 1A6UL 4UB0H 2XQBL 3AS0A 5EG6C 3JWOH 3WLBA 5JIHA 3D48R 1W0WA 3PXHA 2FNBA 4F57L 4I77L 2H3NB 3RVVC 2EKJA 4L9LC 2YA2A 3OF6D 5DFVC 4PRID 4PV8A 1J9CT 3BYYA 5DR5H 3MUGB 1BZQK 3UPRB 3QFDB 1LK2B 1BVKB 4PRHA 1QFUL 1GHFH 3V4PH 3QZWA 1GSMA 5HD8D 1VEMA 3ZE2E 5CBEA 2A77L 4P3DB 3MA7B 5ID0A 1G9NL 4QRRA 2NY6B 4GMSL 3VGFA 3DYMA 3F7VA 1CICA 1PKQB 5IQ9B 3BGMA 3FO2A 3WIIL 1CT8A 2GEEA 1OAUL 4Z77B 4P46D 4OCWH 4D3CH 5TDNA 5CEXB 4HV8B 2W59A 4GKSA 3G5XB 3WKNA 5CZXC 3GSWA 1CE1L 4GLRH 5HDBF 1IARB 2AERT 1IAIM 2NY2B 2ICWA 2P42B 5DMKB 4ZO6A 2E5EA 1UM6L 4NBXB 1Y6MR 3VGAB 4K8RD 3QIUD 1DUYB 2AJZA 4EBQH 5EU7C 4DGYH 1VEPA 5D93C 5DTFA 5I17B 5GSRA 4L8DA 5DJ8B 1N59A 5AG8A 1INQA 1G7PA 4ZUSA 4A6YB 3WJJC 3KPTA 4FFVC 1DJSA 1A14L 3VI3F 2D9CA 4BFEA 5C0GA 4FQHB 3MREA 1CFBA 3LQAH 3T65A 4V2CB 1HQ4A 4J1UB 1EAJA 3QDAA 3SDXF 5DJYA 2DQUL 1QZ1A 3DYPA 4FZ8L 1QLRB 4OZFA 2VXVH 3BZDA 3KYNB 4NNXB 4G9FB 1J0KA 2V5TA 5BXFA 4YBLB 1G9MH 3OF6A 5HYIA 1O7SA 5EZJA 5IEKB 1ERNA 5HHOA 3QQ4A 4LCUA 1YYLL 5IQ7H 5L8KB 5DS8B 3CU1A 3T1FB 1QFWL 4R96A 4MD5B 4I8DA 4JRXD 4H26B 4G42B 3CXDL 2E9BA 2Z8WC 2Z93B 4BZ1L 5C09D 2ZG1A 3V6ZA 3PWPE 1QBMH 5DD0L 5IB4A 4HFWA 1G7MB 5H94B 1FJ1A 3S4SG 5BW7C 3BHBA 1T6VN 1L6XA 3MLRH 3LS5L 1HHGB 1G7LB 1MI5B 5EBLB 5ICYB 1CXIA 4JANB 3TBVA 4P46C 4QRPA 5JMRA 5IW3A 5EZLB 2H32A 3U0TB 1KCLA 3FB8B 3NFSH 4FQ1L 3CIQA 1AKJD 1ED3A 4L1DA 4MJ5A 3FB6B 2V7NB 1AHWB 3HZYA 1S3KL 3K3QA 2IH1B 4MCYA 1UZ6E 3S3JA 1KJMB 2BDNH 2C26A 2JB6A 4TVPL 4UQ3B 3MGTB 5L2KB 3LKSA 5IHLB 1JRHH 4U1MB 2V17L 1L9NA 3CSBA 2IPKB 2X4NA 5C0EB 3S36L 2EDJA 3ULSA 1I3RA 5E2UL 5GGTL 1A1OA 1B90A 1MHCA 4NM4H 3LEXB 3NCMA 5E5MB 3MRFB 1NCAL 4EUPA 1NH6A 4P5KB 2AABL 3CH1B 1EGJH 3CLFL 3MROB 4FQPA 3BD4A 4RZCB 4P46A 5IFJB 1AGEB 2PTVA 2ZUQB 3EYVA 1HNFA 2V5YA 4PJHF 5DR5L 4S1SL 4BH7A 3DHJA 5DJAB 4EXKA 5TE4H 1Q72H 2SEBB 2V2XA 4P2CG 4RGOH 5C0IA 5L9DL 3ARDB 5K9KA 1P4BH 2VL4A 1A7QL 4LLMA 4OF8A 5D2LE 7CGTA 4N9GA 2G9HB 3ZKQD 5FYLH 1QKZL 3VFTB 1GCFA 1P4BL 1H0DB 2B39A 3TZVB 4F15C 4RGOL 3HR5A 5ISZE 1M71B 4LQ1A 1X3DA 2I5YL 4AQ1B 2W0FB 4TSBL 5EUKB 2NXZD 3U36A 3NABH 2VDRH 4X6FB 1S7QB 3RBSA 4OLZH 1NC2B 5D5MA 2DBLH 2ID5A 3CFDB 1IM9D 3P4LA 4LLWA 4GLRI 4PJGA 4LAQH 2ZG3A 1G7JB 1O7VA 4JFQA 1T7YA 4RNRB 4PJ5A 1J1OL 3UBXG 2GUOB 4KK9D 1YEFH 4OM1H 2IALB 4NZUL 3FQWB 5T5NG 2VDOL 1J87A 1NGYB 1P53A 4NFCA 1OLZA 1FH5L 4RRPG 1BBJA 4OFIA 5CSBA 4Z7VE 1PZUB 1FIEA 4GAFB 4QRSA 3HB3D 3CK0L 2XTLA 4IMLA 1N5YL 4PJ5B 5IBUB 3CUPA 1UB5A 4XPAL 3T04D 1YZZA 1MFBH 5L0QC 1LO3L 4MSWA 3TVMC 3DV4A 1V5JA 2DQUH 3IAQA 5FYKD 4H1LA 5CWSA 2VABA 3HRPA 3IAGC 4OD3H 1OWWA 2VXQH 5E0QA 5HHPB 1BF8A 2DJSA 1CL7L 1JUFB 4NUJA 2HT4C 3KPSD 4P5MB 2VZSA 1RUKH 4PJBB 6CGTA 5ESQB 2A6KB 3VJ6A 3O3AB 5E2VL 4ZS7L 1MCSA 2QQNL 3ARFA 5GGRY 4ZPVA 3EO0B 5J13C 1A4KB 2E9JA 2R2EB 4PJBE 1KPUB 2Y6SC 1T20A 4PP2A 1U8JA 1R5IB 1RUPL 5J3HD 5MP6H 3BPOC 4OCNC 4X6DB 5JDSA 5JO5A 3D25B 1DQQA 2E27H 3V4PL 1EEZA 2AEWA 2V2TB 1B6DA 3N1QC 2A6JB 2XKNB 4M7LL 3MJ9L 1N6UA 5KSBF 2H8PA 3GUTB 1JF1A 1JGDA 1GOHA 4NYLA 2Q86A 5H35B 1UJ3B 4PJHA 1TTFA 3VI4F 5B22A 2RHEA 1AHWC 4HLZG 4JQVA 1HKLL 1W0VB 1FLRL 3SDAA 3BJLA 3H9SA 4YLQT 1B4JL 3DHMA 3TO2B 5DI8A 2Z91A 5DGQA 5GJTL 2ARJB 4G5ZL 2NY0C 3ZKXB 3DX8A 5FOJA 1CQKA 5EBWA 5HJ3B 1U91A 4G9DB 4LLUB 1FAIL 5CAYB 4MJ5B 1I1CA 5F9AC 1P4IH 2ARJQ 3JV6A 2GK2A 3ARBC 5I19L 3DGGB 3WNMA 5H37G 3HNVL 2CGRH 5E6IB 5KVDH 5I1IL 3WBDA 5D2NE 3H9SB 5CP7B 4KAQL 4P9HH 1JFQH 4UDUA 2DQTL 1GPOL 1I1YA 4TSAL 4GW4B 3KS0H 1FL6B 4OGYH 1Z0MA 3VRJA 1OW0C 4HUXA 4PREB 1BPVA 1ZHKA 4JFEA 2H8PB 2OZ4L 1I7RB 1P69B 2J4WL 3FO9A 4H1LG 1EAPB 4E0RA 3RNQB 4NP4L 1YNKL 2DYPA 4KMLB 2KH2B 2VXTL 4TULH 2J6EA 4LLDB 3T4YB 1FNEB 3H9HB 3P0VH 5E2UH 1P1ZA 43C9A 5C0AE 4Z7UF 1CLYH 4S0TD 3BGFB 4NRZB 1Q9KA 4PLJD 3W0WA 3CVHB 5IQ7L 5C0FA 2F53D 1HI6A 4M61A 1E4WL 5INCA 3QUXA 5I74C 4Y5VC 4PGBA 4C4KO 1MI5D 4TTDC 3UJIH 1NC2D 4HSQA 1P7KA 5HYJE 4CN4A 3ULUC 2FCBA 2BNRD 3ROOB 2FEEL 3B43A 4CU8A 4JRYE 2FGWL 1AXTL 1TJIH 1KLGA 5L2KE 4CDGC 3MZGB 1TJGL 1FL3A 2DQCH 4JY6A 2JTDA 5FYKU 4JKPL 3IDNB 5CSGA 3ESVF 2CLVA 4XNXL 3OKKB 5I1IH 4L8SA 4U6XB 3T2NH 3I75B 3LHPH 5F7KC 2IEPA 2DQGL 5SWSD 4Q2ZB 5HI4D 4F58H 4WENB 1JFQL 4G9FD 2YN3A 3MV9E 4JFFE 3O41A 1CGVA 4F57H 2X2YA 5FCUH 5CCKH 3NMEA 5GGRA 5IT2H 3JWOL 1EUTA 2R8SL 2W1NA 1CE6B 3W5MA 1T4KB 1E4KA 5C07A 1G0DA 3MFFB 4CVZA 2QR0A 3LH2L 5GS1C 4AQOA 4M3KB 3UTQA 4JHWH 2XFXA 5JIIA 5IMLB 4B0MM 1AFVH 4JO4L 5AZEH 1JHLL 5FM5O 1ZHLA 3T1WA 5AG9A 4MZ3A 2P8MA 4TYUA 4GW5B 4EQ3A 4F9PC 3OWEA 4KJYA 5EU6E 1VFMA 4YWGH 2DLTA 3V6OC 5I1JL 4P9HC 4PJXF 1AR1C 3OMZA 1EJOH 5K59E 2R0KH 1CD0A 5E2TH 3VU2A 2VOTA 1OAUH 4L4TB 1ORSB 2ZUXA 4G6FD 4O2FA 4EUPG 5CEZH 5GS1B 3L7FA 4ONHA 3AROA 4YDIH 1BBJB 4FFZL 1AXSB 4DKEL 4JFDD 4YH6A 4NHCH 2GFBB 1EGJA 3HN3A 4JFEE 3VFTA 1ZT4B 3RGVB 5D2LF 2AK4D 4NNYA 2A83A 3SPVA 3RHWF 5EIIB 5TDOB 4JHZA 4UI2A 1L7TL 3DUSB 3BQUC 5DJAA 5C0ND 1UZ8B 4JFQB 1RUKL 2H2SC 3T8XA 1A64A 1ORQA 4LRNL 2HJFA 2OTUB 3BZ4B 3RZCB 5C08E 2EIBA 4WHYH 3WFCL 5C07D 3WUWB 4GAYA 1WIPA 1H3VA 2PYFB 35C8H 1XF1A 2Z31D 5LBSH 4EN3B 3S4SA 3UMTA 3ULUL 4MXQC 8FABB 5IMOA 1B0RA 2R1XA 3HNTH 1UZ6F 4LCWB 2IQAB 4M1CC 3ELAT 2EH8L 4I9WE 3AREC 3LIZL 4OUUB 3RWEB 2BSED 3D87B 4PRNB 5IESH 3UZQA 1LWRA 5I6XC 2H2SD 4YAQB 2ED8A 4L29B 1IGJB 1FO0H 3LPGA 5ICYA 1RHHB 1V8HA 1HHIB 3L3JA 4JZJB 8FABA 1RIHH 1MI5A 4NP4H 4FN0A 5HY9B 3JWOC 2XTJD 4NQTA 1RZIA 2PYFA 1MHCB 2XKUA 1CDHA 3G5VA 3SKNA 1PQZB 2DDQH 5I6XB 3GRWH 1UB6B 3P4MA 5E2VH 1MHHA 3T1FA 4WI8A 4Y4KA 2N4IA 2LQRA 3IXTA 4LPTA 5HHOB 5JXAL 2XN9A 4GQPH 2VXSL 3ILPA 4WDIA 2WIMA 3BZEB 1ZLSH 3GM8A 4XBGB 2CXGA 2MWCA 3EFDH 4I0CC 4OCSH 5HVGB 4JKLA 3MZTA 5D7LE 1II4E 5D71L 1INDL 5T1DH 1EUUA 4HQQL 1PY4A 4W4NA 1TXKA 1TTUA 4MA7H 1P7HL 5D1QD 2FR4B 2YUZA 3T65B 3UJTL 1XF5B 3OV6A 3R06B 4JGMA 1FFPA 1E4XI 1U93B 3UC0H 4YHZH 5DQJA 2YS4A 3JV4B 1FJ1B 4YE4H 1UKTA 1UENA 4KVNH 2DWEA 1KTDA 1EA9C 4LIQH 1X9QA 2Z4QB 1FLRH 1WCBA 5FCUL 4JQXA 5FK9B 5C6TL 4L8CB 4KK6C 3ZHLA 1OP3K 2Y5TB 3QIWA 2QSVA 4LCUB 2X89A 1BWWA 3GB7B 2GSIA 2ZSVA 1OT2A 1SYSB 1PGRB 4TOYH 4M1DL 4Z7VF 4F9PA 4Q9QL 2CGRL 2NY4C 5C07B 5FYJH 2BVYA 3N0PB 3PV6B 3NCFB 1M1SA 1UYWL 5C0DA 1WFNA 2ENYA 3GRWL 4PGDB 4HWUA 3ZDXE 5FUZL 2OQJB 5I1CL 4YXLL 2XTJE 5GGQH 2APTA 5IW6B 1QRNB 3ISWA 3IDNA 3DMMB 3QFJA 5F70A 3TFKD 1UQSA 3BDBA 1PZ5B 4XNUH 4LVNC 3X14B 1N64L 5T1MA 3D6GA 1MH5B 5E8DH 4HWBA 1Q9OB 4RGMB 1LNUA 5EBMA 3MUJA 2EXWD 5IW6A 1DEEB 4BUHA 5BS0A 4Y19E 4OAWA 3KPLA 1EO7A 1G7IB 1QVOA 1MVUA 4IRJB 1X44A 3HPJB 1F4XH 1K8DB 4BA8A 3LZFH 5I8CB 2VAJA 2IFFL 1J1OH 5D1ZB 3OJ2C 5E24E 3QHFH 4PS4H 2ICWI 1FNFA 2OL3A 1ACYL 1IGCH 3MV8A 1OD7A 1Q1JH 2CKBB 3EZ8A 5JLZA 4NZRL 3PDDA 4J4PC 1GL4B 5LCVL 3G08A 1X5HA 4D0BA 1LP9E 4HKZB 5GGTH 2AK4A 4XAWL 3VXPA 4DVBB 4RFEB 2V17H 4L8SB 4EI5D 3RWHB 1GIGL 1C08A 4PY8I 3RNQA 4JPWL 3BFOA 1PX4A 3P0YL 2JIXD 3NBNA 2W9EH 3K80A 3GBLA 3RIFF 1C1EH 2LAGB 1WZMA 3VXSD 4QRRD 1J0HA 3GJEB 3WIFA 3NH7H 1BMGA 2FH6A 3SKNB 2BY1A 2X1QA 3D0LB 1LE5A 4AT6B 5B4MC 4X83A 4YEEA 3T3MF 1NKRA 2VLRB 2DF3A 2I60H 5BZDA 4LQFL 3AU1A 4HKJA 3W9EA 3ULVL 4ZQKA 1G9EA 3CK0H 1FYTD 1AQDB 3EYFA 2UUDK 3MGOA 4R26L 1HYSC 5F9WC 1BJMA 5FGSA 5JHDE 4OZIA 1EO5A 4S1RH 4OGAC 1T04A 4O02L 2FDBP 2EC8A 3P77A 3QUYD 1RU9H 1GGCH 1KJ2H 4OFYA 4M5YH 2XN9B 2OR9L 1NAML 3QIBD 4IOIB 4JG1H 1ZMYA 2Z91B 3I6GB 4NDMB 4QY8B 4P2OB 1V3JA 2NCMA 5HHOE 3RVTC 3T3PE 1XGTB 1HINH 4FQXB 2JJVA 3FONA 3NACL 3MV7A 4L3EA 3WD5H 5DVNA 3RP1A 3T0AA 1VADA 1W0YT 4EDXA 4OLEA 3B3IA 3DBXB 4B41A 5C0BD 5JHDA 1NCWL 4GMSH 3RZCA 4U6YA 1A3QA 4KZDL 1BJ1H 2BNRA 4UV4L 4YQXH 2QL1A 5L2KD 2HWZH 1CBVH 4QRPE 5K9JH 3QNZB 4LL9A 2ZSWB 4GAGH 4TPRH 5DJZA 4KJWC 3HLAB 3MRCB 5E1AB 1VERA 1HSAB 2ARJA 1U8PA 2X05A 3F7PC 4F7EA 1QSEA 4OCLC 4UDTA 4K94C 5ITFB 4DQOH 5FYLD 2YEZB 3UTTD 3MACH 4FXGB 2B5IB 5JOPE 4ESKA 4D0DB 2HMIC 1IBGL 1LP9A 5FECA 5E08L 4R8WH 2VABB 1S5IH 2RIKA 4PTUB 3WE6A 1FVDA 4JQIH 3QAZB 2V9RA 3ZE0E 1UZ8A 4XPHL 2VLME 4MQSB 1OP9A 3MV7D 1FZMB 2J6EH 2UWEF 3KXFD 1ZOXA 2DIAA 3BPLB 2VL5B 5SX4I 1ZVHA 4QXGH 4HWEH 1Q9LA 4EI5C 1C7TA 5D7LB 3W5NA 1NMBL 2O5YH 3PP4L 2E7MA 5GHWL 4XAKE 2H26B 2D7NA 3QXAB 3EGSA 5CINH 1MJJB 5B3JF 4JDTH 1R5WB 4HXAH 4JHAL 1XF3B 3C5JB 3E2HB 5DD3L 3ARQA 4LASL 4CVWA 4KJWD 1AI1H 2IFFH 2BRQA 2R4SL 4PJDA 3TM6A 4W6YB 3QDGB 1BD2A 1OF2B 2XT1B 3CLEH 3NTCH 5EUOF 1Z3GH 2PXYC 5JZ7C 5D6DC 4WHYG 5HSFA 3MRNB 5JOFB 5KVEL 4NZTL 4IIQC 3CFJA 2YMXH 1RQ5A 4NWUH 2F19H 4D0DA 2WBJB 1EJ6A 1INDH 2ESVA 4CVZB 5GRYA 3UO1H 1I7ZA 5HGGS 3O3UN 1T2QH 3NCYP 4YFLI 4YHNA 1U8HB 2EICA 2WUBH 3EDEA 3LS4H 4FTVE 1PG7W 2JJWA 1WQVT 2N56A 5K9KB 4HKXB 3B2UC 1XIWB 2VDPH 3AREB 5MENA 3DMMD 2CLVB 3ARFD 2ADGB 3TT1H 2EYTA 4N0UB 4U1GB 1EAPA 3MLTB 5DEGA 1A8JH 4P46B 4YHOH 3OAYK 1FL3B 1NCUA 3U82B 4XMKH 4H8WH 1S7UB 3GMLA 2XQYK 1LK3L 1JYWA 3GMPB 4LHQB 3MLUL 4K8RH 4LHUG 1RUQH 1UWXK 1X5IA 1YPZB 3LPWA 4KK5C 1KCKA 3QXTA 3MBXH 4NQSB 2XN9E 4GKNA 4CJ0A 1GGTA 3DOSA 1UH2A 4R4BB 1A7OH 4L9LB 1WWBX 2ADJA 1KJMA 5HGAA 3U2SA 5ITBL 1PLGH 3LN5B 2FATL 3RVXC 5GGUB 2ZUQC 3TO4A 4UQ2A 5KAQG 5EUOE 3VDBA 5HI3D 4RFNC 2KL6A 2NR6C 2Y7QB 3O45A 3HE7D 2VLLA 4K2UH 4NCDA 1AGEA 4R4BA 3QXUA 4Y5XA 3G6JE 1NCNA 3MROA 4GKNB 3MJ8B 3ZO0A 4JCLA 5I75B 2E7LA 4U1SA 2FLRT 2C4FU 4P5KA 5H2BA 2EE2A 2I26N 4S1QH 4JFHE 1FG2B 1J5OL 1J0YA 1TVHB 5E7FA 5SV3A 4WTZA 3D0LA 1CFVL 4LRIA 4XHJC 4WUKH 1JWSA 4XWGL 4QRTB 4O2EB 3H42H 2IPKA 5C0EA 1X7QA 1CDJA 4ZOBA 1G9MC 1HOCB 1YC8A 4KI5E 4MD4A 5F3BB 1FYHB 1L4IA 4Z95H 1FNAA 3RY6C 3QDHA 5F9JB 1QUNA 4OLVH 4HKXA 3VFUA 1A7PH 4G9FA 3PE9A 5JNYB 5D2NA 3MBEC 5IIEA 1RSFA 1ZA6B 2YN5A 1JRHI 5EBWB 4W81A 4HIIB 2DL2A 4WUUE 2OXHA 5E8OB 1EFQA 4AIZA 5JDJA 4P4RA 2WMPA 4OV5A 5IV2B 5GS3A 4J1UA 3QDGD 1HZHL 2CMRL 4UT6H 2XPGB 3SDCD 4F9LC 5HHXH 3NH7L 5KVGH 3GSXA 1JNHB 3BPLC 3MRPA 4LDLB 2VXVL 4LCIL 5KVFL 1D6EB 1V05A 1LE5B 5IB4B 1G9NH 1HCVA 4NYLB 2Q8AH 3UTTA 2WBJC 4KJQD 5CGYD 3L9RB 5KTEL 1U2HA 1UB5B 1AJ7H 5CP3H 4LNVA 1IC5L 4QRSB 3WIIH 1IGYA 1UT9A 3FRPG 3OKDB 3WNPA 4JQXC 5JLZB 1TTGA 3BJ91 1KCRL 1U8HA 4GG8A 5GIRB 5ETUA 3U0WL 5D6CB 2IAMB 3GSWB 4CU7A 2C3WA 1QACA 5ADOH 1FLTX 2IQ9L 2J7LA 1NJ9B 5F89B 5GS0L 3RUGF 1RZJH 4FFWC 5ESQA 3IETB 3SDDC 5BVJA 1YUHB 4D2NA 4GRWE 3OR7A 4DGIH 4YXKL 2ZSVB 2E27L 1MY5A 3O4OB 5DJXA 2EEDA 4NQVB 3OX8A 5C8JA 4NKDA 5IM7B 1XGQA 4P59L 4PTUA 3MRNA 2NTFB 4ORGB 1IKNC 4RGNB 4YPJA 5DJ8A 3RZCC 3EW3B 3QDMB 1SM3H 4WFHE 1TENA 5C0JA 1AR1D 5T5FH 1KELL 3TJEH 2BOBB 3RAJL 1RUML 3U9UA 5E2WL 2J8UB 3JV4A 4GRWH 3IDJA 4OFYD 3IFOB 4ZYKA 4FQQB 4LSRL 2OJEA 1PY9A 5EN2A 4LSVH 4I18A 3MOAH 1MCIA 3GIVB 4GAJL 5C0RH 2ICWJ 1PG7L 1T83C 4FNLL 5D7LA 4NM8L 1NAKH 1JPFA 3BO8B 4IRJD 3RWDA 3D85B 1EHNA 3ZDZF 3H9SD 2R4SH 5KVMC 1BBDH 4WDIB 1KN2H 4XP9L 4OF3A 3FHAA 1YMMA 5E8NB 1CFQA 4DN3L 1BM3L 3EZJB 5JOEA 5I1AA 4L8CA 5FK9A 3MRKB 2AXFB 5EO1A 4M62H 3IDUA 1A7NL 4HUWB 1I8MB 2F8VA 2B7DT 2XZCH 1V7NL 5DHYA 4RFNB 1A1OB 2XNAA 2J1KA 2VITA 3OKEB 1GC1L 4C56A 3HR5B 3EFDL 4BH8A 5I0ZA 4KGJA 2FR4A 3DPBA 3LKQA 4KROB 4F7MB 4P23D 4J3VA 3S96B 4DVRL 4C59B 4Z0BL 2VWEC 4BQ8A 3TZVD 2G9HA 2GJ6B 1KJVB 3KNBA 4NC0B 5J89A 1J5OH 1OAQH 3FB8A 1XEDA 4G7YL 4XP1H 2DM2A 4XMPH 1P84J 4M3JA 1WICA 3VFSB 2J8UE 2JJUA 2PYEA 1ZGLA 4F7MA 1MHHB 2OM5A 1QYGL 1HE7A 4GH7B 3RVTD 2DB8A 5FHBL 4Y19B 1NLBL 3OKEA 1YDPA 4FQCL 1KIQA 4Z8FH 3WL9A 1CDBA 5JXEC 4I5BB 3QFJD 4AT6A 1G7MA 4OTXL 4WHTA 5H94A 1DVFA 4X4XB 3SCMD 2A73B 1JWUB 1DBAH 1AY1H 4H5SA 2YPLE 1V7MH 3VFSA 2DTSA 3IYLW 1FV1A 5HGBA 3K4AA 3NVQA 3VXME 4QCIB 3TPUA 3CDCA 3ULVH 5B3NA 4HJJH 4JRYD 1YMMD 4X6EA 2BMKA 2AK4B 3VXPB 5I73B 2AJVH 2YD2A 2VDLL 4OCWL 2P44B 4OZIB 2J3SA 3BIKA 1JZ5A 4LCYB 4YHOL 2AJUL 3NAAL 4PJ5D 3CX5J 5D1XC 3G5YA 2EDOA 4TRPL 5E99L 1AXSA 3SQBA 4EXPX 3IU3B 1G7HA 3O3DA 2VWEE 4DOHB 1KXTB 3DTXB 4R0LB 1DANT 2BOCB 4UTBH 4JQVC 1Q9OA 4Z0XB 2GJJA 4YPGB 3QUYC 3DXAB 4XXDB 2P47B 3FMGL 3H3PH 4V2BA 2F54D 4MB4A 4Y7MA 5HYSG 3G9AB 1R0AH 2BRRH 3QH3B 3NA9H 4PJXB 4DN4H 2VXUL 5FV1L 2NY7L 3L6FA 2D7PA 2YR3A 5DMKA 5ACZA 2CKBA 4ELME 4JGJA 5K9JL 2IAMA 1S7RA 4FTVA 2GFBA 3AUVA 3G6AA 4IRSD 2NNAB 4XC3L 4GKSB 1G84A 2GIYA 5DMGD 5IB2A 5CEXA 2ITDB 1UVQB 2K1MA 5D72L 5LWYH 2YZ1A 5DMIL 1PVHA 3K8MA 4MJIB 4P23B 4ZODA 2NXYD 1XH3B 5CEYA 3MV7E 4DEPC 5D72H 5LWYL 3F7VB 3MLYH 4ZAKD 3FT4A 1IC4L 5DK2B 5FO9A 4NPYB 4GAJH 5FKPB 3IFPB 5C0CD 5C0RL 5HYQB 2HP4A 3DXAD 2VH5H 3MR9B 3ARRA 5I1DB 1YYML 4LCCB 1KLUA 4QRRB 4XC1H 1CF8L 1HSBA 4B50A 4TVPD 2JB5H 4P23C 5DWUH 1KTDB 3MUHL 1YYMH 2V9TA 5F6IC 5D7IA 4OZGF 1QQDA 4DAGL 1S7VA 3MMEA 4YDJA 2ITDA 4ODHH 5TE6H 2UZYB 3W11D 3ZT7A 3MFFA 3L1OL 4Y88A 4NHUA 4APQD 3CFEB 3MLWL 2JELL 3MOBL 5J11C 3G5XA 1RZKC 5DJ2A 4U1IA 4DJMA 2JELH 3MOBH 3ARGD 3BZEA 4G6AD 4EN3C 1TMCB 3T4YA 5MERA 1VGEL 3LD8B 4R2GD 3QUKA 1ZT7A 2ORBH 3HNSH 5KZCD 3SE4A 5JHLL 4HXAL 3FQTA 3VFPB 3D69A 1BFTA 4J8RA 5IW1B 1YEIL 4ERSL 3DXAA 5DFWH 4OLWH 5BV7L 1AKJB 4JM2C 4ENEC 4JFEB 4D9RE 1LO0H 3HG1A 3CFKB 4O2EA 5BMFH 5CBEB 5IFHL 4APQB 5EC1A 5M94B 4Y8DC 1T0NA 2EYRB 4XP1L 1CI5A 2XOTA 2XXMB 1NLDL 3PWNA 4TUOB 5J6HB 3BEWB 1MHPL 1CIDA 4PV9B 1XF5A 3RNKA 5T33L 2BJMH 2EE3A 2A9NH 1KFAH 1T2QL 3CVHA 3OXRB 3KYMB 4LLVA 4LPWA 4LPCA 4LDOB 1ZA6A 5C3TA 2YXMA 3QDJD 4HUKB 3UBXA 3FN0L 3RTQD 3IFLH 4UQ2B 1AXIB 1FC1A 3VG9C 4F7TA 1D5BB 4AL8L 3MCG1 4KV5E 4PUBL 3KPOB 1FV1B 3T0EC 2CLZA 5LAXB 5F9WB 4DAGH 3QNYA 1N6QL 2KPNA 3CVIL 1I3UA 4MXWL 3QP3A 1U6AL 4WCYL 1R3IH 1NGPH 3NZ8B 4NC2B 4ZO7A 3DSFL 2FJFB 2NTSP 2LV4A 4QLRA 4ZAKC 3OB0K 3S98A 3VRIB 4WHTB 1FPTL 1PJ9A 3QUZD 2D7QA 3L7EB 4FHBD 1MFAH 2EO1A 3SDXB 3VFVA 3NFNB 1KOAA 2CDFA 3O2VH 1B0GB 3IVKA 4RA3A 4YR6B 2X1PA 2X70A 5HPMB 1GOGA 1MCDA 4UTAL 3OJVC 2FB4L 3F8UB 4J3UA 3ARPA 1O5DT 1XZ0A 2X4RB 3NN8B 3QCVH 1Z2KA 1U92A 2Y07L 1EEYB 1A7OL 4QHLA 2YPLD 4ODTH 4ODWB 3VGDA 4KFZC 2I24N 1A5FH 5KSAC 4MWFA 3VGHA 4MJ2A 3U2SB 3BQUA 4ODTL 3F5WA 3MLUH 4POYA 4PLOB 3WUWG 3SY0A 1FFQA 3HAEA 1F2XK 4ZSOE 2FJHA 4HCRL 5CBAB 3DRTA 5D2NC 2IAMC 4QYOA 5TF0A 3BD5A 2DDQL 5GXBB 1GC1H 4PJ7A 4H1LB 2PYED 2NY1B 4OQTH 2LTQC 3IDXL 4HCRH 2MCG1 4N0UA 1A21A 1YEHH 3OKNA 5E99H 3X3GH 4KVCL 3AREA 1M7IB 1A6WL 1NDMA 3UTQB 3RX8A 3SPVB 4F37K 5MEQA 3WNKA 3U30B 4TSCL 2IG2L 2RFXA 4U0RC 2R2EA 4E42B 3ARFC 4U1NB 2ZUWA 3IJYB 2F9BT 3TT1L 2HVKA 4JG0H 3MRRA 4JFPB 2J12B 3BISA 1CG9B 3HE7C 2EDFA 5B38B 4NUJB 3BH9B 4FP8L 3Q5YA 1WJ3A 3X13A 1HQRB 1HXMB 4YO0B 3VGAC 5KVGL 2BSRA 4QTHB 2ZUTA 2XZAH 1T0PB 2HRPL 2HLFD 4RMQA 5C9JA 5JMOC 1JYNA 1F42A 43CAB 4U0QB 1EVUA 2BFVH 2UWEB 1WTGT 1P7KB 2XFXB 3QWRD 2UY6A 5CZXD 3K81A 3HUJE 1U58A 3VXTB 5DMJB 5C0AA 3BN9C 1HSAA 3B9AA 3KWWA 2A1WH 4HHAA 5F3HA 5FCSH 3GMOA 4S1RL 2A6IA 2ZSWA 2VAAB 3QHZL 2M1KA 5ALCL 3B9KD 3I75A 4OFKA 4U1KB 1CD8A 3ULUH 5HDLA 4GG6F 4MNGB 3HHRB 2W0PA 3CJJA 4BH7B 5E8EB 1QRNE 5ESAA 1MCBA 4NUGH 4U1HA 3U46A 3QJHB 3BKYL 5D71H 1LHZA 3WD5L 2IG2H 4TSBH 3PHOA 4HXBH 2F15A 3QXDA 5A2JH 3GHEH 1WVZA 1SM3L 4R4ND 3V0AC 4WEUD 3SDXA 3VFVB 4XPFL 3NFSL 5K93A 4LVHB 3C5ZB 3C60D 3U9PH 1XGUA 3WHXB 3AS2A 3MRPB 3K1DA 4GRLD 3V6OE 2R1WB 3JVGA 4YJZL 4GBXB 3CU7A 4MD0A 3FZUC 4P2QA 1KC5H 5MHSD 2HT3D 1T1YB 1MCWM 2VN7A 4M6OL 2P24B 1J1XH 2ESVE 3PWUA 4JN2A 3TGXA 3RWGA 3GO1H 1PFCA 2DQEL 5DJZB 2EH8H 4HAGA 5D1QC 3UAJD 4YX2H 5JNYA 2E7CA 1KGCD 4YIQA 4OT1L 4QWWC 5C0CA 4H88H 3DO3A 1EEUA 4JPVL 3O3BA 2Z31B 4DN3H 2OL3L 5F3BA 4HS8H 3X17A 5J9PA 2FBOJ 2AEQH 3QUXC 3BRFA 5ESVA 1F4YH 3QT2A 4TUOA 4CVUA 5I1EL 3ABZA 1FL6A 2C1OB 3F7QA 4IRSA 2YA1A 4Y16D 1NUFA 2EXYC 3VD4A 3CDYA 1UA6L 3KPSE 1T22B 5I9QB 4X5XA 3EFFA 5ALCH 3NZ8A 2B0SL 3S37H 4L3AA 3MNWB 5CP7A 5ERWB 1ITBB 4ZFZA 1P7QB 4UU9A 4RMRA 1T6WA 3KPOA 3DGGA 1RZFH 1YEEL 1Q94A 3MRJA 3SEPA 5CGYC 2HVJB 2FRGP 4U3HA 3UX9B 2VLKA 3OG4B 1CK0L 4DUVA 5HVHC 3E8UH 3RDTD 1IQWH 3O6FD 4X6BB 4ZOAA 4OQTL 2EH7L 1RZFL 3WUZA 1DVFC 5E5UB 4XBPA 5I8CA 5J6HA 1G7LA 1YPZA 3SDAB 4YFEA 4KVNL 4K94L 3VXRD 4N5ED 4AEIH 4AEEA 5DSCB 1J12A 1T0NB 2DD8H 4HZAA 1ZA3A 2Y06L 2FHFA 5IROA 2GTZA 4K9EC 3KPNA 4HZLB 4JKMA 4P2OD 1FORH 5F9DC 3TN0D 1VKXB 1ZLWH 2C1PB 1C5CH 1PZ5A 2AJYH 3X14A 5DS8A 4G80B 3MJ7A 2H6PB 4NNPL 4GT7A 1NCAH 3NZHH 5C08A 5CJQL 2FX8H 2CUHA 3UJJL 3QWQB 4OZGB 1H3WM 3EJZD 1S9YB 2R0KL 3TIDA 4KRPC 1QYGH 3AXLB 3U7YH 3KG5A 3FOLB 4Z7QF 2VISA 1KYOK 2HKHH 5F3HB 2HT4D 3RI5K 1QA9A 5T1KA 1F02I 4RWYH 2AJVL 5EPMA 3DX7A 4OI8A 3G6JB 4K3HA 4U7MA 1G6RA 4K7PL 2ESVB 3PIQB 1MFDL 5BQ7B 4X4ME 2C3VB 1ZLVH 1HH9B 4BM7A 2GSIB 3FJTA 1YA5A 4ZAKA 1FPTH 1L7TH 5FB8B 4PJEA 3FN9A 1NMAH 1IT9L 4UTBL 1RFDH 1EV2E 3KLAB 3OGOE 2DQTH 1BD2B 3IKKA 2X42A 3DMMA 1HQRA 3ARSA 1R3KB 1KCUH 4YO0A 5E95B 4F37F 3HUJF 4OIBA 1R3LB 4TQEH 3MUZ1 1TCMA 1N26A 3BT2L 2WWMD 5ABDE 4G6JL 1ZVSB 4I0PA 4KI5F 2DM7A 1T03H 3TBSB 1LP9F 3CVHL 5J6GB 3WFZA 1S7RB 1J05A 1FL5B 4Y2DD 5JPMA 3L6FB 4O9HH 4IHOA 3MGAA 1JI1A 2QQKL 2XYCA 5A43C 5CD3B 5FYKL 5JW4Q 3GMRB 4KY1H 1M7IA 2RJMA 4ELKB 1CGXA 1G7JA 2IPTL 4W6XB 1E28A 6FABL 3EYVB 1U0QA 5CSZB 4LLWB 4NN5C 4UOJA 3M8OL 5FGRA 4OGAD 4MQXC 4X0KB 1Z9LA 2W65A 4HJJL 4IEFB 1LO3H 3SO3C 4P4KD 5ICXB 1GVIA 3IU3A 1MFBL 1S9WA 1IC5H 5ITFA 1OTSC 2XXCB 2VDQH 3ZDXF 1A6PA 1QR1B 4GKZA 2EIZA 1YMME 2BNQB 2P5EA 1JZ7A 2Q8BL 4MHHI 1FNLA 1U9KA 2QQNH 2D03H 3UYPA 2SEBA 2V2XB 1EBPA 2VLJA 3FB5A 3MCLL 4OUUA 2B0SH 1LDPL 1BAFL 1CZ8L 1JNNL 3P4NB 4LPYA 3NA4A 4NQCA 3IJSA 1NFKA 4H5SB 1E6OH 4W70A 3VWJA 1HZHH 4XI5C 3IB4A 1MEXL 3IDMB 3TVMA 4HUVB 3MRMA 4C56E 1M7DA 1EDQA 2XRAL 5EOTB 1MCOL 1I7UA 3G5VB 3BHBB 4EDXB 5HDBE 3PABA 2BVPA 3LQZB 5D8JL 1WEJH 3MJ9H 1I8LA 4J3WA 2MFNA 2OMBA 3SQOH 4FG6D 3VFWA 3QDGE 4H26A 4JCMA 1QSFA 3GK8L 3MACL 2IGFH 4MQXD 1YJDH 4J12A 4G8GE 4KQ3L 3DUSA 2C3HA 4Y4FB 4OLWL 2LAAA 5BV7H 2F8XC 4GBXD 3PL6A 4NRXA 4C56D 3RWDB 2DQHH 4LAJH 5DJYB 1B4RA 4PJEF 4RAHA 1K5NB 3IFLL 4IJ3B 1U8OB 4AIXA 3ES6B 1IC4H 1JK8B 3C8KA 3SGJA 2DQDH 3ORJA 2DQFB 4ONHB 4Y2DC 3MREB 4X5LA 2N7BA 3GI8H 4I0KA 4ZXBC 3D3VD 1EEQA 5AAWA 2F58L 5C0JB 5IK3B 4K71C 4WJ5A 4WU7A 3TF7C 3WDJA 5HHMD 1FN4B 5CJOH 5I1AB 4HDIA 2FO4A 4X7EC 2OJZL 4S11A 4XVTL 2KDGA 5DK3A 1XGQB 3NGBB 5TE7H 5GSRB 3VFPA 4OQTA 2CUIA 5FB8A 2K7PA 1S9KC 5E2WH 2P5WE 2X89D 1CWVA 4QGYA 4Y5YA 1MVFA 1GGIL 4OZFB 5F89A 3D85A 5F7HA 3O6FA 4M03A 4P57B 4JO3L 5FEBA 2J4WH 3PV7A 4QTIL 3CGTA 4GG8B 1CTNA 2AP2A 2PXYA 2EDBA 4HJGB 1T2XA 4XP9H 1EJOL 1NBQA 2VISB 4L4VE 4OD1H 1TETH 4LASH 2E6QA 4W4OC 1BBDL 5TGBB 4XH2B 3VGEA 1CD1B 1IM9B 4JDTL 2OTWA 1G7IA 5GRZA 3WNLA 3CDGB 3VH8B 5C9KA 2BOBA 4YXLH 4CDHA 2DICA 4UUJB 1F4HA 4LSQL 3RGHA 2XG5A 1AIFB 2OX5A 4X99A 4JY6B 5DUBA 5T1MB 2ARWA 4LEOB 3ZYJA 1F5WA 2JJSC 1KB5B 3AS1A 1WBXB 5HHQA 2VZUA 4H1LH 3K2MC 5CUSH 1N6VA 5DSCA 5E8DL 1DQML 4BKLB 4O4YL 2OTWB 3LPFA 1J0JA 2BVQB 4XNUL 4YK4C 5F1NA 1MFCH 3VI3E 4K3EH 3UZVB 4L4VA 4GRMA 2CDGA 4PGCB 5E8OA 4AIZB 1QA9B 4EOWL 3W0WD 2HLAB 4W4OA 4FFVD 2VQTA 3WLBB 3NIGF 4G8GB 4HT1H 3FOLA 5I76A 4Q2ZA 1Q94B 1R3IL 1CT8B 1ZT1B 2I9LA 1QSEE 2ZWLT 4XHJD 5DFTA 5DT1L 5IGXL 2F8OA 1ZHKB 1F3JA 5DQ9A 3LSOB 1ZA3B 4G3YH 5IJVB 1WBYA 4Q97A 5TE4L 2UY7A 2X4QB 3QO1B 5J06A 1FGNL 2ZCHH 5DRZA 3QFDA 3V0VA 3MYJB 1GRWA 2XPGA 5IOPA 1HI6B 4MVBD 2ICEA 1IVLA 1DBMH 2P5ED 5KAQF 3W0WB 5IIEB 2WINA 1RZKL 1WAAE 4ODVL 1DUZB 1L0XA 1DBML 1ADQH 3SDCC 5LGJA 4C83A 1IEAA 1MQ8A 1BD2D 4PTTB 5D7LD 2VDRL 3HCVB 4ODXB 3LN5A 3QUMB 3RJDA 3WHE0 5HYSB 3H7BB 4V1DE 3O3EA 4PJHE 1SJVA 2JLLA 3RVWD 1AGCB 4HUUA 2DLFH 3REWA 4MD0B 1GGCL 3RWIA 5LJYH 2F5BH 4R4FL 3K7UA 2J8HA 5SWZE 3TBTA 1OQXA 1DQJB 2ENSA 1FG2A 2OLDA 3QQ3B 3T0XA 5E4IA 4ETQB 3LRSA 4Q9BA 1AH1A 4HUVA 1XF4B 5B21A 3RIFK 4LFHD 3KR3H 3SOBL 1MELA 3HC4H 3THML 5E5RB 5MP6L 4PYHA 1BD2E 2VLLB 4NO0A 2Z8RA 3UEZA 4GXVH 4U1KA 4RCAA 1JBJA 1B0WA 1FSKB 3CCHB 4YIQB 5IFAH 5JW4N 1H3PL