5TISU

Room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 28
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5tisU01
5B5EU 4IL6U 3A0HU 5E79U 5TISU 5B66U 5GTIU 5H2FU 3WU2U 3KZIU 4UB6U 1S5LU 2AXTU 4PJ0U 3A0BU 5GTHU 4UB8U 2DUYA 5KAFU 5KAIU
chains in the Genus database with same CATH superfamily
1PVRA 1ZQTA 2BQUA 1SV0C 2DF4B 1TKDA 3T5LA 4JK1A 4B9LA 1UT5A 2K8AA 5KFXA 4DL5A 3KZIU 1S5LU 4IQWA 5AI9A 1URJA 3UQ2A 4UB8U 4PZNA 2IHMA 3V7LA 3SYZA 5IIMA 1DRGA 4NLGA 3TFRA 1DK2A 2JZBA 7ICMA 3SENA 8ICOA 1QQ5A 3M9OB 4ACOA 2NRXA 3TAQA 3NVWA 4O9MA 4FO6A 2L5YA 3F5AA 2LM4A 4R8UA 2HHXA 2KVCA 4Y2JA 4M9GA 5IIOA 5ALQA 4DSKA 1RYSA 4ED3A 4DFMA 1D8LA 4NM1A 2FE9A 3JPSA 5ALWA 4YG2A 1NJZA 2WFAA 3M1YA 4P2HA 1JI7A 2AGPA 5ALHA 1SXEA 1RDFA 2KIWA 3WK8A 5L1LA 2RHFA 1PVQA 2ZIXA 4ZH4A 3N28A 1KFTA 3QE9Y 4LZDA 4Z6EA 5JUMA 2W54A 9ICXA 4QW9A 2HI0A 2V4QA 5J0OA 2HW3A 1BNPA 3OGUA 5J2EA 4XA5A 3LWMA 2K8CB 3QEAZ 5AM4A 3RRGA 4ECWA 3V7JA 5J0RA 9ICMA 2HHVA 2IOFK 5J8YC 3V6HA 4F3OA 1V97A 2E8PA 1WUDA 5KFJA 1RM6C 5KFPA 3M6KA 5ALLA 3V6JA 4F5PA 1MA7A 2ZTCA 3LK9A 2A3VA 3G6XA 2YX8A 5ALJA 2AH5A 4I29A 3AU2A 2W8KA 4OJOA 2AXTU 3FYHA 8ICTA 1ZD5A 2K4EA 2DKXA 5HMMA 4ECTA 4IS7A 5CB1A 9ICNA 4AYBC 4PH5A 4RQ7A 7ICQA 3MR2A 1ZXIA 2IOFA 5AKLA 2W55A 4B9VA 8ICFA 5J2GA 2OXOA 4KITB 2F3NA 5J0SA 2I9GA 4YR3A 1TV9A 5C5JA 4KLLA 2KD1A 1MQ3A 5KAIU 5AM2A 2NO4A 1T94A 2YB1A 4ICAA 1VJ5A 4JV1A 1Z00A 3KOOA 4QNLA 5KG6A 3R9KA 3WKAA 3BQ0A 4I2EA 1TVAA 2E3TA 2BCQA 3WK4A 1WG8A 2NYVA 1PK1A 1MQ2A 1L3TA 4B9SA 5KFHA 4F93B 4QZGA 2D6FC 1PZNA 5KFTA 4ED6A 1KEJA 1S77D 4RNMA 1N48A 2ALZA 4IRCA 5KG7A 3QUBA 5AKGA 4KN4A 1L3SA 3EYZA 3IP4B 5KL1B 3LYSA 1ZQXA 4RQ6A 3QUCA 4UB5A 4M0AA 5F9NA 4I2CA 4DQIA 3OSNA 2A1JB 4EZ6A 2NO5A 1ZQLA 4DSIA 7ICKA 2OHFA 3HWTA 5J2DA 3UM9A 2Z7JA 3MGIA 1UA1A 2ASLA 5DQIA 4RNNA 2WB1F 3RJKA 7ICTA 5TZVA 2DPJA 1MC8A 5KFYA 3TANA 4ZOHC 4YR2A 3F2CA 2KK0A 1RPLA 4US8A 1ZYQA 3PO5A 3Q8KA 4TQSA 2EQYA 2W3RA 3PX0A 4BJQA 1ZQRA 3SV3A 4Y2VA 5CJ7A 7ICVA 5BOMA 1KQQA 3DEEA 3DDHA 4QIWC 1D9FA 2DBYA 5AI8A 2MUTB 4J9PA 2W7OA 7ICRA 1NOMA 5ALVA 1NK8A 3PX4A 1A6SA 4C7YA 5J0QA 5KFSA 3UQ0A 1U48A 1B22A 3KHRA 1JRPA 3QU9A 4DF8A 2FPMA 3RBEA 7ICGA 1ZQDA 4I2IA 3PSTA 3BDPA 3H8MA 1S76D 1UPHA 2Y9TA 3GIJA 2V9WA 3B9JA 1SZPA 5ALYA 3HW8A 4FE3A 5JRTA 1ZQWA 5DDYA 2KJ5A 2EZZA 3UXOA 1NNLA 4R66A 8ICCA 1Z4OA 3VCBA 2ZXIA 2LMRA 1JXLA 4FZNA 4I28A 5FP0A 1RG6A 2XGPA 1LKYB 4PGYA 3J81j 1O03A 1D8BA 3RH5A 2LYAA 2J6TA 3V6KA 5GTIU 2DFLA 2VANA 1Q3VA 1QSLA 5DDMA 8ICLA 2IA6A 5DB8A 4OJLA 3RB3A 2HHTA 2JR5A 4YMOA 4AP9A 5CR0A 3F2BA 2KSOA 2MU2A 4MEYA 5K4LA 2G07A 2XICA 5HR6A 3AMZA 2GWSA 2VJ5A 1JIHA 1KN5A 4Y2YA 4ECQA 2PFNA 1XO1A 4ECYA 5KT2A 3C5FA 3ZDBA 4KMUA 2P35A 5AKXA 2JH1A 3OHBA 3MABA 1XSLA 3RF9A 3A0HU 3HJEA 4BWJA 4DQRA 3KHLA 4JUZA 1KW4A 5J0WA 5TISU 2JZBB 1C20A 2K4PA 4CF4A 3M8SA 2VA2A 2F8LA 5KTQA 4J03A 1L5UA 3BQ1A 1TE2A 3H0LB 5F3XB 3M8RA 9ICBA 1ZQVA 2KG5A 5HHHA 1CRXA 3D6JA 3HRDD 4UAUA 1OXJA 3M7DA 1YZ7A 2EZYA 2W9BB 3GQCA 5AM5A 2ZTEA 5EWFA 1XO0A 3I1YA 3ETRA 4R8UB 3MDAA 3KTQA 2JHDA 4KLEA 3A0BU 4DWIA 4DEZA 2AU0A 3QU2A 2BHNA 1FIQA 4MF2A 4RQ3A 8ICIA 3WKCA 2PFOA 1N2XA 1Z3EB 1X9MA 4LZGA 4Y2RA 5KL8B 5DLGA 5KFBA 3LVVA 4QWEA 3PW2A 1TK5A 2CRXA 2F2AB 4DSLA 3NUQA 3PW4A 1ED1A 7ICIA 1P7DA 3ALRA 1Q8KA 3UPQA 4F91B 4Q8EA 1WCLA 3RB6A 2EAOA 2JEFA 2AJQA 2PMZF 1L3UA 3AM9A 2KZ3A 1KBUA 2W9AA 2I1QA 5F9LA 5DKWA 2C2RA 2PFQA 5KFNA 4EYIB 3BS5A 3RBDA 4OD0A 5AI4A 1FFVA 5EOZA 4B9UA 4O3PA 2LM1A 3NVYA 5AI0A 2XCAA 1FFUA 4JMUA 1ZQEA 1ZQPA 2FMSA 5KG4A 3K75D 1XSPA 7ICJA 3C29A 4FS2A 3BQ2A 4RPXA 4YQWA 1UHUA 8ICUA 3ICXA 2FMQA 3KKAC 3M6ZA 1FO4A 4P0QB 3I28A 2B6GA 3JPOA 3IV6A 1KKXA 7ICUA 8ICZA 1N60A 5BOLA 3H0MB 5KFGA 1S8OA 1UA0A 2HBMA 1ZQFA 3RJGA 4J9LA 4DL6A 2YMLA 4CGZA 2WAQF 4ECVA 1L7MA 3MC1A 4P0PA 5EE1A 2W43A 2DKZA 3PW7A 3G6YA 1JX4A 4UB6U 3GDXA 2KZMA 3LVWA 4RT2A 7ICPA 4UAVA 9ICEA 2QLTA 3GV7B 5J2BA 2P66A 3OPXA 1ECWA 4MHVA 1JXEA 3PY8A 1IM4A 2JEIA 4NWIA 4CF3A 5E79U 4XUSA 3AQFA 3HPOA 4F2SA 1X6IA 4KLQA 2HVHA 1NJYA 3EPIA 2W3SA 1NK0A 2H3FA 3WK6A 2MA1A 2R8KA 4F50A 3HKZC 2BPGA 2E1FA 1B43A 2RQ5A 4Q45A 4MFCA 3L3FX 4IQTA 3RFAA 2KJ8A 4YMNA 9ICWA 2NRVA 3IHQB 3MGHA 4MFFA 1ZQ1C 8ICJA 3VC8A 9ICJA 3TKAA 1A0PA 2JEJA 3SAGA 2OH2A 4UBCA 7ICNA 4O3OA 1S0NA 1KSPA 4BXOB 5ALXA 2K89A 5T14A 4CRXA 3TQ1A 1TK0A 1IIPA 5L1KA 5CEHA 9ICAA 2B0CA 1CUKA 2Q4TA 1IG6A 4HAIA 2N1RA 2VIXA 2DL0A 2BPFA 4ED8A 2E8OA 3C5GA 4RQNA 4F5RA 4DL3A 1M6YA 4GC7A 1BPDA 7ICFA 3RTVA 2W9CA 2H5XA 4DFDA 1Y88A 5J2FA 1X9XA 1NI3A 4PJ0U 1ZQIA 4DQSA 4KLUA 1PUZA 4RQ0A 4JV2A 4C80A 2JMGA 5ALFA 4J9KA 9ICRA 1AQ6A 1T7PA 2ZIUA 3GZFA 1JROA 5EE9A 1SKRA 5DG9A 9ICSA 2Y9UA 2XVTA 4YN4A 1H38A 3UMBA 4FS1A 4O3QA 2C28A 3BS7A 1SB3C 4OCZA 4I2FA 5KFQA 4B9NA 8ICPA 1N5WA 4J9QA 2LYBA 4EBCA 1SIJA 2QARA 9ICTA 5J29A 1COKA 4ECRA 4C8NA 4AYBF 4NJ8A 5AM1A 4ECXA 2OM6A 1L7PA 4DOBA 3F53A 4IRKA 8ICKA 3D2NA 4ECUA 4O3MA 3GIIA 2LI6A 4ELTA 4K4GA 3C1YA 1SL1A 4NY8A 3F5EA 3H8SA 3ZDDA 1TK8A 5J2CA 2C2EA 1KTQA 3Q8RB 1ZD4A 4DSEA 5KFOA 4EEYA 2ESEA 4PZOA 1ZQZA 4KLMA 3JPRA 1Q46A 4EX6A 2E5SA 4YVZA 2F1IA 3SMVA 2JH7A 3QUQA 2XO7A 3PMLA 5AHXA 2ZJ8A 4KN7A 5IIJA 2BQRA 4B6JA 4F5QA 3M9MB 1BPYA 4QZBA 3BZCA 1NK4A 1ZRNA 2XY6A 4UBBA 2ODGA 4PGXA 3L4PA 3RH4A 4JWMA 4PHPA 3OHAA 3BZKA 4U6PA 2R8HA 9ICLA 3EW9A 5DB9A 3WK7A 1N62A 1D8YA 5EWGA 2H3IA 2Y0SF 2HHSA 2HOFA 3K1RB 3PSFA 2GH1A 1X66A 1L3VA 1SGGA 1Z1BA 4TUSA 5AIAA 4O5CA 4UW9A 1ZQKA 2P6RA 4F4KA 4F5NA 2G09A 2QB0A 3AUOA 4A8EA 2ASDA 4Y2SA 1QQ6A 4XRHA 2XGQA 1QCKA 1CEZA 2HCFA 4RQ8A 5KFLA 1V85A 4CDGA 3MR3A 3QXGA 5ALPA 1L7NA 3AL0B 4OJ5A 1XSNA 5KAFU 3QU5A 1WWUA 1U4BA 3HILA 4QIWF 5KFAA 1BPZA 5DBBA 1B4FA 3GILA 2G5HB 4J9SA 1ZJNA 3PSIA 3RJIA 4F4ZA 2F1JA 3TFSA 9ICGA 8ICRA 3T5KA 5KFCA 2NV3A 3I76A 5KT4A 4Y2XA 5KFVA 3RR7A 3ZDAA 3H8WA 1DGJA 3QU7A 1BPXA 5EE3A 2PKEA 2R8IA 2HHUA 1DXSA 2HSZA 5KFWA 4EENA 2ZIVB 1SZHA 2YY6A 2H3VA 5EWEA 4DOAA 2UVVA 2WF7A 2CXYA 3F2DA 3N97B 1U45A 3QX7A 1Q3UA 3QYPA 2K8BB 4YP3A 3N7RC 4QWBA 2RP5A 2ZXHA 3IG5A 2ZTDA 1XC9A 5DG8A 3UMGA 4C8KA 3RRHA 2HBJA 1QSSA 4Q8FA 5J0TA 5ALNA 3TAPA 3RJEA 4M6WA 3PW0A 4UAZA 2CPRA 3CNHA 2J6SA 3Q8PB 2UVWA 2G08A 5ALIA 4I2AA 3PW5A 2WB1C 4G9BA 2NRTA 1RQLA 1ZD3A 1XS9D 3QZ8A 4M9LA 2AQ0A 5DG7A 2KFNA 1KFDA 2P6UA 4MFAA 3JPQA 4RT3A 4IQVA 2AHOB 3QEBZ 2RDJA 3TACB 8ICEA 3JPPA 2F77X 3ZD9A 1K1QA 4DLEA 4I2GA 5C0YA 3QU4A 5CWRA 2O6KA 4YMMA 5IILA 1LV5A 1ZQHA 4DL2A 4TURA 3THVA 3IDWA 3H4BA 5AIBA 2LPEA 4M47A 5CP2A 4QZIA 4DO9A 4OJPA 4QWCA 3KHGA 1LVHA 2IMWP 4EZ9A 2YN4A 2YB4A 7ICHA 4KLOA 1T3NA 4BDPA 1ZD2P 2ATLA 3WKDA 2BCVA 4RU9A 8ICVA 1UCVA 4FBTA 2KOBA 4GXKA 4I2BA 2QKQA 5B66U 2ZIWA 4O3SA 3LDAA 9ICOA 4QZDA 4RUAA 3PSPA 8ICBA 2LYHA 1XU4A 4KLFA 3WKEA 1YZ6A 5J2JA 2KTQA 1WYGA 3QZ7A 5L1JA 1A77A 2EH9A 1CI4A 4I2JA 4NL9A 4DFJA 1ZQOA 5CRXA 4NXZA 3OTQA 3NS1A 1NZPA 5L1MA 1RXWA 4KLHA 2W7PA 1ZQAA 9ICKA 4USAA 2W8LA 2BCUA 2BGWA 4C4TA 4YFKA 4UB2A 9ICFA 4PHEA 4F4XA 2ZIXB 3MFIA 2H3ZA 2W03A 4TQRA 1NK5A 2A1JA 3C1ZA 3PR4A 2VA8A 4CE6A 1ZOLA 2W04A 5AM0A 7ICLA 3ZD8A 2H3QA 1AROP 3FM9A 2FLPA 2UVUA 2NRZA 4GC6A 2J6UA 1K1SA 4DS5A 8ICYA 5KT3A 1IXRA 3IM1A 2ISOA 4C0ZA 5KFEA 5DB7A 5J8YA 5ALZA 1ZQNA 3ZDEA 2XC9A 1KDHA 1C7YA 5IINA 3N7PD 2KEYA 5EE0A 2KZZA 2YQEA 1TFRA 2MUTA 4F71A 3DV9A 1JALA 2KKPA 4QZ8A 2BZFA 5AK5A 1F5SA 5AKZA 3OJSA 5D46A 2JEGA 3ISBA 5HMLA 3N4MB 4I2DA 4F92B 4GIBA 4KTQA 4BGDA 4UB3A 1ZQSA 4ED2A 4EEKA 4J9RA 9ICCA 3NVVA 4QZAA 3PO4A 2E8MA 1Z4NA 4FBUA 2YMQA 4R65A 2ASJA 5HR7A 2KP7A 4Y2UA 2BDPA 3Q8SB 4DFKA 4O3NA 3D2SA 1Z00B 1XNSA 2WF6A 1X9WA 1NK7A 1QH9A 2ISPA 2XIDA 3M9NB 3RJFA 4QWAA 4IL6U 1L6NA 2XY5A 7ICOA 4QZEA 1MSWD 3PMNA 1PK1B 1DOQA 2B21A 4CF5A 5ALOA 4P4MA 3SI8A 1NKCA 1LKYA 2ES6A 3AEVA 1FEZA 3NRZA 5ALUA 2ZJAA 4O3RA 1TAMA 1X40A 1YT3A 5DQHA 3ISCA 1S0OA 1S0VA 2DWQA 2FJ6A 3ZI4A 3BJYA 3JPTA 2HDOA 4MEXA 1S10A 1Z19A 2W9MA 3NASA 4RQMA 4P4OA 3H8JA 4ELUA 5AKHA 8ICAA 3V72A 2WAQC 1HIWA 3UMCA 1NKEA 1N5XA 4K4HA 3RB4A 3C21A 2I5HA 1SKSA 5IIIA 2D8CA 3JPNA 3SR6A 4RQ1A 4K4IA 4UB4A 2G0AA 8ICQA 1U49A 3PNCA 2WF5A 1ZQYA 2PXIA 5AKEA 1IV8A 5CA7A 2R18A 2G5IB 4GXIA 5AM3A 5DQGA 4M2YA 3E2EA 5KFFA 1QSYA 3K1ZA 3S6JA 1F0MA 3U26A 2KE7A 1V38A 4NL9C 2KICA 3NRWA 1ZQQA 2OWOA 1UQVA 3NTUA 4RQ2A 4MF8A 2FDRA 3EPGA 4Q44A 3C23A 2HOQA 5KFIA 2W9BA 2OCEA 4XQ8A 1KLNA 2M9NA 3TARA 1KFSA 4C8MA 4M6WB 1SWWA 1SXDA 2F8KA 4BX9C 4IR9A 2VKQA 3HP6A 1XWLA 2AGOA 2KNJA 2ZUCA 1DK3A 5ALMA 4JV0A 4CNQA 4UB1A 9ICPA 2KJ9A 3BQTA 2K60A 4Y2TA 3WKBA 5AKJA 4O5KA 1L8LA 7ICSA 2HOIA 4J9NA 4C4RA 2KV2A 4YXMA 5J2IA 1K5OA 2YMPA 3E58A 4F4YA 2KVSA 2GO7A 5ALSA 5KNIA 4PHDA 5J2HA 1UT8A 4B9MA 4ED0A 2XCPA 9ICVA 5G5GA 2FI1A 2YMMA 1ZQBA 5KT7A 4O0IA 1BPEA 2QB1A 2OYYA 3GIMA 2ZUDA 2YTUA 3ZDCA 4GLXA 3NVZA 2XI9A 3HX0A 1SL0A 1S97A 2KSOB 1COOA 4YD2A 4DL4A 4Y2QA 1WCNA 2LHTA 3ED5A 4DLGA 4WJ3B 3ORYA 1X2IA 4UARA 3K4GA 5JTIA 5D4BA 1O08A 3SQIA 2BQ3A 2LKYA 2LBOA 1QLNA 1JMSA 1NZBA 4P0QA 3RAQA 2IOHA 2EANA 3Q8QB 4DSJA 4PPXA 2GLEA 3E0FA 3AN1A 4QZCA 2NRWA 1PK3A 1RYRA 1J2NA 5KFDA 2BKEA 5KFUA 2IBKA 1ZQCA 3G6VA 2CN1A 4J9MA 5GTHU 2ZIWB 2WF8A 5KFMA 4F2RA 3C2MA 4EBDA 1ZETA 3GIKA 8ICNA 2C22A 3T79A 3UXPA 1JUDA 1PVPA 5KG2A 4DQPA 1GO3F 3IRUA 4PHAA 4I2HA 3OJUA 1SWVA 2KKVA 1VLBA 2BPCA 2PI5A 4C4SA 2K4IA 4PGQA 4F72A 1V9PA 2BDUA 3N7SC 4PL1A 5J2KA 3Q8MA 3C2LA 2XY7A 4EYHB 4QZ9A 4YCXA 4DQQA 2C2DA 3CP8A 4C8OA 2KN7A 4KLTA 4FFDA 3WU2U 2MSNA 3LWLA 1OUQA 4RQ4A 4RNOA 1TAUA 3MDCA 3H0RB 3CYMA 4M04A 1T4GA 4BXOA 4Z6FA 3EWAA 8ICWA 1S0MA 2Y0SC 4OO1J 5J0YA 3SEIA 1X6JA 3KBBA 4J9OA 3BS5B 4Y2PA 3RJJA 3AU6A 3PZPA 2KHVA 5AICA 2FLNA 4DFPA 2DPIA 4PL2A 4ECSA 4QW8A 4NLCA 4IC9A 4JWNA 5ALDA 5AK3A 4RUCA 2M0NA 2BCRA 3UXNA 5KT6A 2WHEA 4KLGA 5AKKA 5KG5A 5AK6A 4G3IA 5HP4A 1ZJMA 2RLTA 2F76X 5DGAA 4ED7A 2K4HA 2AQ4A 4UAWA 1X42A 5KG3A 3C2KA 2R8GA 1RQNA 4E0DA 1VDVA 3EUB2 4F8RA 4NV0A 4M9NA 3KZXA 1BGXT 1J97A 4ECZA 3H4DA 4GFJA 3GU3A 3KKAA 4M9HA 1RYUA 4GXJA 4KX5A 4C7ZA 5KFKA 4P0PB 2EZXA 4RZRA 3TADA 1HEKA 2DQNB 4JB3A 3IN5A 4NLKA 3T3FA 2FPLA 2KHQA 3L5KA 5J0UA 3Q8LA 4CCHA 1X9SA 3FDSA 1HUZA 2PI4A 3KD3A 4F5OA 5HHIA 4IQUA 2JGAA 5KT5A 5ALGA 5H2FU 4QJFB 4FZMA 3MFHA 5ALEA 3AQEA 2DGZA 4R63A 2KIVA 7ICEA 1B0XA 3H40A 4C8LA 3D2QA 4EBEA 2RRDA 2A1AA 2I6XA 8ICGA 3RH6A 1T8EA 2UVRA 5KG1A 3ONNA 3PV8A 1U9LA 5AI5A 1T3QA 3PX6A 2F1HA 4M9JA 5J0XA 2DUYA 2JV3A 3SV4A 4O5EA 2HBLA 2JXJA 4KLJA 3T5JA 1RZTA 2ZJ5A 4R64A 5ALRA 3ISDA 3EZ5A 3V7KA 4HYKA 1ZQGA 2IHNA 2ZG6A 3QNMA 2EDUA 1SV0A 1KL9A 1N56A 1SV4A 1N63A 1L7OA 3MGVA 3PR5B 4F4WA 2MAXA 2W11A 4DSFA 3ETLA 5AKIA 2W9CB 2E1EA 5B5EU 5KFZA 1NK6A 3HT3A 2Q0ZX 5IIKA 2EAMA 3PVXA 3KHHA 4X5VA 4LVSA 3C28A 2FPKA 3NGDA 4RQ5A 2ZIUB 2WTFA 4U7CA 2PFPA 9ICIA 4I27A 4EELA 1QQ7A 1L8OA 5DGBA 4KLDA 4QZFA 2KMDA 1ZQJA 8ICXA 2VA3A 2Y1IA 3B0YA 2D3DA 4NM2A 2VJ4A 2EAPA 2Y1JA 2QARB 2KFZA 1TAQA 4YD1A 1QTMA 2R8JA 2FLLA 1RXVA 1A76A 5G5HA 4Z6CA 4DF4A 5KG0A 3TI0A 4DS4A 3H7IA 4BUGA 1N61A 2V4RA 3GV8B 3SAFA 2AGQA 5DBAA 3RAXA 1KRPA 2BR0A 4KX3A 2ZUBA 5CHGA 4B9TA 2RDIA 3MR6A 2OEHA 4YXJA 5JU5A 1SL2A 2HVIA 3O0FA 4ELVA 5ALKA 1F44A 1BVSA 5AKYA 5DLFA 5J0PA 2ZIVA 4DL7A 1MN8A 2MRLA 1ZQUA 1EXNA 3WK5A 8ICHA 2G06A 3MR5A 1HUOA 2HHWA 4NLBA 1NJXA 1NK9A 1S9FA 1J2MA 1OW5A 1ZRMA 5DB6A 4FZLA 4NLNA 1BNOA 3OSPA 2HHQA 8ICMA 2BCSA 1Z1VA 1DGSA 3HKZF 3CRXA 1HJPA 2GOLA 3SZ2A 3RR8A 4TUPA 5A0LA 2HMXA 2HBKA 3RB0A 1LB2B 3RJHA 4UASA 3SD7A 2PMZC 4LJXA 3GFKB 4RPZA 3TADC 5HNKA 9ICQA 4QZHA 4UATA 4US9A 5ALTA 5BPCA 3KFUF 5AI6A 3MBYA 5KFRA 1U47A 5DBCA 4TUQA 4DOCA 4EX7A 2A19A 4IRDA 4KLIA 4RPYA 3SAHA 4ED1A 4NLZA 3B0XA 2QB0B 4UQGA 9ICHA 5AK4A 4Z6DA 3WK9A 3T5HA 5J2AA 1WWVA 2F44A 3BQ7A 1NKBA 8ICSA 9ICUA 3FAHA 1ZQMA 2E8NA 4Q43A 4P4PA 1D9DA 5L1IA 2WF9A 4IR1A 5D49A 4YR0A 3GV5B 2FMPA 4DCCA 4QWDA 3CW2C 4OJ6A 4KMOB 3IG8A 4KLSA 1JN3A 3FC4A 3QUTA 2JRZA 1BPBA 1SKWA 4UAYA 5L9XA 1NJWA 4BWMA
chains in the Genus database with same CATH topology
5B5EU 4IL6U 3A0HU 5E79U 5TISU 5B66U 5GTIU 5H2FU 3WU2U 3KZIU 4UB6U 1S5LU 2AXTU 4PJ0U 3A0BU 5GTHU 4UB8U 2DUYA 5KAFU 5KAIU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5E U;  4IL6 U;  3A0H U;  5E79 U;  5TIS U;  5B66 U;  5GTI U;  5H2F U;  3WU2 U;  3KZI U;  4UB6 U;  1S5L U;  2AXT U;  4PJ0 U;  3A0B U;  5GTH U;  4UB8 U;  2DUY A;  5KAF U;  5KAI U; 
#chains in the Genus database with same CATH topology
 1PVR A;  1ZQT A;  2BQU A;  1SV0 C;  2DF4 B;  1TKD A;  3T5L A;  4JK1 A;  4B9L A;  1UT5 A;  2K8A A;  5KFX A;  4DL5 A;  3KZI U;  1S5L U;  4IQW A;  5AI9 A;  1URJ A;  3UQ2 A;  4UB8 U;  4PZN A;  2IHM A;  3V7L A;  3SYZ A;  5IIM A;  1DRG A;  4NLG A;  3TFR A;  1DK2 A;  2JZB A;  7ICM A;  3SEN A;  8ICO A;  1QQ5 A;  3M9O B;  4ACO A;  2NRX A;  3TAQ A;  3NVW A;  4O9M A;  4FO6 A;  2L5Y A;  3F5A A;  2LM4 A;  4R8U A;  2HHX A;  2KVC A;  4Y2J A;  4M9G A;  5IIO A;  5ALQ A;  4DSK A;  1RYS A;  4ED3 A;  4DFM A;  1D8L A;  4NM1 A;  2FE9 A;  3JPS A;  5ALW A;  4YG2 A;  1NJZ A;  2WFA A;  3M1Y A;  4P2H A;  1JI7 A;  2AGP A;  5ALH A;  1SXE A;  1RDF A;  2KIW A;  3WK8 A;  5L1L A;  2RHF A;  1PVQ A;  2ZIX A;  4ZH4 A;  3N28 A;  1KFT A;  3QE9 Y;  4LZD A;  4Z6E A;  5JUM A;  2W54 A;  9ICX A;  4QW9 A;  2HI0 A;  2V4Q A;  5J0O A;  2HW3 A;  1BNP A;  3OGU A;  5J2E A;  4XA5 A;  3LWM A;  2K8C B;  3QEA Z;  5AM4 A;  3RRG A;  4ECW A;  3V7J A;  5J0R A;  9ICM A;  2HHV A;  2IOF K;  5J8Y C;  3V6H A;  4F3O A;  1V97 A;  2E8P A;  1WUD A;  5KFJ A;  1RM6 C;  5KFP A;  3M6K A;  5ALL A;  3V6J A;  4F5P A;  1MA7 A;  2ZTC A;  3LK9 A;  2A3V A;  3G6X A;  2YX8 A;  5ALJ A;  2AH5 A;  4I29 A;  3AU2 A;  2W8K A;  4OJO A;  2AXT U;  3FYH A;  8ICT A;  1ZD5 A;  2K4E A;  2DKX A;  5HMM A;  4ECT A;  4IS7 A;  5CB1 A;  9ICN A;  4AYB C;  4PH5 A;  4RQ7 A;  7ICQ A;  3MR2 A;  1ZXI A;  2IOF A;  5AKL A;  2W55 A;  4B9V A;  8ICF A;  5J2G A;  2OXO A;  4KIT B;  2F3N A;  5J0S A;  2I9G A;  4YR3 A;  1TV9 A;  5C5J A;  4KLL A;  2KD1 A;  1MQ3 A;  5KAI U;  5AM2 A;  2NO4 A;  1T94 A;  2YB1 A;  4ICA A;  1VJ5 A;  4JV1 A;  1Z00 A;  3KOO A;  4QNL A;  5KG6 A;  3R9K A;  3WKA A;  3BQ0 A;  4I2E A;  1TVA A;  2E3T A;  2BCQ A;  3WK4 A;  1WG8 A;  2NYV A;  1PK1 A;  1MQ2 A;  1L3T A;  4B9S A;  5KFH A;  4F93 B;  4QZG A;  2D6F C;  1PZN A;  5KFT A;  4ED6 A;  1KEJ A;  1S77 D;  4RNM A;  1N48 A;  2ALZ A;  4IRC A;  5KG7 A;  3QUB A;  5AKG A;  4KN4 A;  1L3S A;  3EYZ A;  3IP4 B;  5KL1 B;  3LYS A;  1ZQX A;  4RQ6 A;  3QUC A;  4UB5 A;  4M0A A;  5F9N A;  4I2C A;  4DQI A;  3OSN A;  2A1J B;  4EZ6 A;  2NO5 A;  1ZQL A;  4DSI A;  7ICK A;  2OHF A;  3HWT A;  5J2D A;  3UM9 A;  2Z7J A;  3MGI A;  1UA1 A;  2ASL A;  5DQI A;  4RNN A;  2WB1 F;  3RJK A;  7ICT A;  5TZV A;  2DPJ A;  1MC8 A;  5KFY A;  3TAN A;  4ZOH C;  4YR2 A;  3F2C A;  2KK0 A;  1RPL A;  4US8 A;  1ZYQ A;  3PO5 A;  3Q8K A;  4TQS A;  2EQY A;  2W3R A;  3PX0 A;  4BJQ A;  1ZQR A;  3SV3 A;  4Y2V A;  5CJ7 A;  7ICV A;  5BOM A;  1KQQ A;  3DEE A;  3DDH A;  4QIW C;  1D9F A;  2DBY A;  5AI8 A;  2MUT B;  4J9P A;  2W7O A;  7ICR A;  1NOM A;  5ALV A;  1NK8 A;  3PX4 A;  1A6S A;  4C7Y A;  5J0Q A;  5KFS A;  3UQ0 A;  1U48 A;  1B22 A;  3KHR A;  1JRP A;  3QU9 A;  4DF8 A;  2FPM A;  3RBE A;  7ICG A;  1ZQD A;  4I2I A;  3PST A;  3BDP A;  3H8M A;  1S76 D;  1UPH A;  2Y9T A;  3GIJ A;  2V9W A;  3B9J A;  1SZP A;  5ALY A;  3HW8 A;  4FE3 A;  5JRT A;  1ZQW A;  5DDY A;  2KJ5 A;  2EZZ A;  3UXO A;  1NNL A;  4R66 A;  8ICC A;  1Z4O A;  3VCB A;  2ZXI A;  2LMR A;  1JXL A;  4FZN A;  4I28 A;  5FP0 A;  1RG6 A;  2XGP A;  1LKY B;  4PGY A;  3J81 j;  1O03 A;  1D8B A;  3RH5 A;  2LYA A;  2J6T A;  3V6K A;  5GTI U;  2DFL A;  2VAN A;  1Q3V A;  1QSL A;  5DDM A;  8ICL A;  2IA6 A;  5DB8 A;  4OJL A;  3RB3 A;  2HHT A;  2JR5 A;  4YMO A;  4AP9 A;  5CR0 A;  3F2B A;  2KSO A;  2MU2 A;  4MEY A;  5K4L A;  2G07 A;  2XIC A;  5HR6 A;  3AMZ A;  2GWS A;  2VJ5 A;  1JIH A;  1KN5 A;  4Y2Y A;  4ECQ A;  2PFN A;  1XO1 A;  4ECY A;  5KT2 A;  3C5F A;  3ZDB A;  4KMU A;  2P35 A;  5AKX A;  2JH1 A;  3OHB A;  3MAB A;  1XSL A;  3RF9 A;  3A0H U;  3HJE A;  4BWJ A;  4DQR A;  3KHL A;  4JUZ A;  1KW4 A;  5J0W A;  5TIS U;  2JZB B;  1C20 A;  2K4P A;  4CF4 A;  3M8S A;  2VA2 A;  2F8L A;  5KTQ A;  4J03 A;  1L5U A;  3BQ1 A;  1TE2 A;  3H0L B;  5F3X B;  3M8R A;  9ICB A;  1ZQV A;  2KG5 A;  5HHH A;  1CRX A;  3D6J A;  3HRD D;  4UAU A;  1OXJ A;  3M7D A;  1YZ7 A;  2EZY A;  2W9B B;  3GQC A;  5AM5 A;  2ZTE A;  5EWF A;  1XO0 A;  3I1Y A;  3ETR A;  4R8U B;  3MDA A;  3KTQ A;  2JHD A;  4KLE A;  3A0B U;  4DWI A;  4DEZ A;  2AU0 A;  3QU2 A;  2BHN A;  1FIQ A;  4MF2 A;  4RQ3 A;  8ICI A;  3WKC A;  2PFO A;  1N2X A;  1Z3E B;  1X9M A;  4LZG A;  4Y2R A;  5KL8 B;  5DLG A;  5KFB A;  3LVV A;  4QWE A;  3PW2 A;  1TK5 A;  2CRX A;  2F2A B;  4DSL A;  3NUQ A;  3PW4 A;  1ED1 A;  7ICI A;  1P7D A;  3ALR A;  1Q8K A;  3UPQ A;  4F91 B;  4Q8E A;  1WCL A;  3RB6 A;  2EAO A;  2JEF A;  2AJQ A;  2PMZ F;  1L3U A;  3AM9 A;  2KZ3 A;  1KBU A;  2W9A A;  2I1Q A;  5F9L A;  5DKW A;  2C2R A;  2PFQ A;  5KFN A;  4EYI B;  3BS5 A;  3RBD A;  4OD0 A;  5AI4 A;  1FFV A;  5EOZ A;  4B9U A;  4O3P A;  2LM1 A;  3NVY A;  5AI0 A;  2XCA A;  1FFU A;  4JMU A;  1ZQE A;  1ZQP A;  2FMS A;  5KG4 A;  3K75 D;  1XSP A;  7ICJ A;  3C29 A;  4FS2 A;  3BQ2 A;  4RPX A;  4YQW A;  1UHU A;  8ICU A;  3ICX A;  2FMQ A;  3KKA C;  3M6Z A;  1FO4 A;  4P0Q B;  3I28 A;  2B6G A;  3JPO A;  3IV6 A;  1KKX A;  7ICU A;  8ICZ A;  1N60 A;  5BOL A;  3H0M B;  5KFG A;  1S8O A;  1UA0 A;  2HBM A;  1ZQF A;  3RJG A;  4J9L A;  4DL6 A;  2YML A;  4CGZ A;  2WAQ F;  4ECV A;  1L7M A;  3MC1 A;  4P0P A;  5EE1 A;  2W43 A;  2DKZ A;  3PW7 A;  3G6Y A;  1JX4 A;  4UB6 U;  3GDX A;  2KZM A;  3LVW A;  4RT2 A;  7ICP A;  4UAV A;  9ICE A;  2QLT A;  3GV7 B;  5J2B A;  2P66 A;  3OPX A;  1ECW A;  4MHV A;  1JXE A;  3PY8 A;  1IM4 A;  2JEI A;  4NWI A;  4CF3 A;  5E79 U;  4XUS A;  3AQF A;  3HPO A;  4F2S A;  1X6I A;  4KLQ A;  2HVH A;  1NJY A;  3EPI A;  2W3S A;  1NK0 A;  2H3F A;  3WK6 A;  2MA1 A;  2R8K A;  4F50 A;  3HKZ C;  2BPG A;  2E1F A;  1B43 A;  2RQ5 A;  4Q45 A;  4MFC A;  3L3F X;  4IQT A;  3RFA A;  2KJ8 A;  4YMN A;  9ICW A;  2NRV A;  3IHQ B;  3MGH A;  4MFF A;  1ZQ1 C;  8ICJ A;  3VC8 A;  9ICJ A;  3TKA A;  1A0P A;  2JEJ A;  3SAG A;  2OH2 A;  4UBC A;  7ICN A;  4O3O A;  1S0N A;  1KSP A;  4BXO B;  5ALX A;  2K89 A;  5T14 A;  4CRX A;  3TQ1 A;  1TK0 A;  1IIP A;  5L1K A;  5CEH A;  9ICA A;  2B0C A;  1CUK A;  2Q4T A;  1IG6 A;  4HAI A;  2N1R A;  2VIX A;  2DL0 A;  2BPF A;  4ED8 A;  2E8O A;  3C5G A;  4RQN A;  4F5R A;  4DL3 A;  1M6Y A;  4GC7 A;  1BPD A;  7ICF A;  3RTV A;  2W9C A;  2H5X A;  4DFD A;  1Y88 A;  5J2F A;  1X9X A;  1NI3 A;  4PJ0 U;  1ZQI A;  4DQS A;  4KLU A;  1PUZ A;  4RQ0 A;  4JV2 A;  4C80 A;  2JMG A;  5ALF A;  4J9K A;  9ICR A;  1AQ6 A;  1T7P A;  2ZIU A;  3GZF A;  1JRO A;  5EE9 A;  1SKR A;  5DG9 A;  9ICS A;  2Y9U A;  2XVT A;  4YN4 A;  1H38 A;  3UMB A;  4FS1 A;  4O3Q A;  2C28 A;  3BS7 A;  1SB3 C;  4OCZ A;  4I2F A;  5KFQ A;  4B9N A;  8ICP A;  1N5W A;  4J9Q A;  2LYB A;  4EBC A;  1SIJ A;  2QAR A;  9ICT A;  5J29 A;  1COK A;  4ECR A;  4C8N A;  4AYB F;  4NJ8 A;  5AM1 A;  4ECX A;  2OM6 A;  1L7P A;  4DOB A;  3F53 A;  4IRK A;  8ICK A;  3D2N A;  4ECU A;  4O3M A;  3GII A;  2LI6 A;  4ELT A;  4K4G A;  3C1Y A;  1SL1 A;  4NY8 A;  3F5E A;  3H8S A;  3ZDD A;  1TK8 A;  5J2C A;  2C2E A;  1KTQ A;  3Q8R B;  1ZD4 A;  4DSE A;  5KFO A;  4EEY A;  2ESE A;  4PZO A;  1ZQZ A;  4KLM A;  3JPR A;  1Q46 A;  4EX6 A;  2E5S A;  4YVZ A;  2F1I A;  3SMV A;  2JH7 A;  3QUQ A;  2XO7 A;  3PML A;  5AHX A;  2ZJ8 A;  4KN7 A;  5IIJ A;  2BQR A;  4B6J A;  4F5Q A;  3M9M B;  1BPY A;  4QZB A;  3BZC A;  1NK4 A;  1ZRN A;  2XY6 A;  4UBB A;  2ODG A;  4PGX A;  3L4P A;  3RH4 A;  4JWM A;  4PHP A;  3OHA A;  3BZK A;  4U6P A;  2R8H A;  9ICL A;  3EW9 A;  5DB9 A;  3WK7 A;  1N62 A;  1D8Y A;  5EWG A;  2H3I A;  2Y0S F;  2HHS A;  2HOF A;  3K1R B;  3PSF A;  2GH1 A;  1X66 A;  1L3V A;  1SGG A;  1Z1B A;  4TUS A;  5AIA A;  4O5C A;  4UW9 A;  1ZQK A;  2P6R A;  4F4K A;  4F5N A;  2G09 A;  2QB0 A;  3AUO A;  4A8E A;  2ASD A;  4Y2S A;  1QQ6 A;  4XRH A;  2XGQ A;  1QCK A;  1CEZ A;  2HCF A;  4RQ8 A;  5KFL A;  1V85 A;  4CDG A;  3MR3 A;  3QXG A;  5ALP A;  1L7N A;  3AL0 B;  4OJ5 A;  1XSN A;  5KAF U;  3QU5 A;  1WWU A;  1U4B A;  3HIL A;  4QIW F;  5KFA A;  1BPZ A;  5DBB A;  1B4F A;  3GIL A;  2G5H B;  4J9S A;  1ZJN A;  3PSI A;  3RJI A;  4F4Z A;  2F1J A;  3TFS A;  9ICG A;  8ICR A;  3T5K A;  5KFC A;  2NV3 A;  3I76 A;  5KT4 A;  4Y2X A;  5KFV A;  3RR7 A;  3ZDA A;  3H8W A;  1DGJ A;  3QU7 A;  1BPX A;  5EE3 A;  2PKE A;  2R8I A;  2HHU A;  1DXS A;  2HSZ A;  5KFW A;  4EEN A;  2ZIV B;  1SZH A;  2YY6 A;  2H3V A;  5EWE A;  4DOA A;  2UVV A;  2WF7 A;  2CXY A;  3F2D A;  3N97 B;  1U45 A;  3QX7 A;  1Q3U A;  3QYP A;  2K8B B;  4YP3 A;  3N7R C;  4QWB A;  2RP5 A;  2ZXH A;  3IG5 A;  2ZTD A;  1XC9 A;  5DG8 A;  3UMG A;  4C8K A;  3RRH A;  2HBJ A;  1QSS A;  4Q8F A;  5J0T A;  5ALN A;  3TAP A;  3RJE A;  4M6W A;  3PW0 A;  4UAZ A;  2CPR A;  3CNH A;  2J6S A;  3Q8P B;  2UVW A;  2G08 A;  5ALI A;  4I2A A;  3PW5 A;  2WB1 C;  4G9B A;  2NRT A;  1RQL A;  1ZD3 A;  1XS9 D;  3QZ8 A;  4M9L A;  2AQ0 A;  5DG7 A;  2KFN A;  1KFD A;  2P6U A;  4MFA A;  3JPQ A;  4RT3 A;  4IQV A;  2AHO B;  3QEB Z;  2RDJ A;  3TAC B;  8ICE A;  3JPP A;  2F77 X;  3ZD9 A;  1K1Q A;  4DLE A;  4I2G A;  5C0Y A;  3QU4 A;  5CWR A;  2O6K A;  4YMM A;  5IIL A;  1LV5 A;  1ZQH A;  4DL2 A;  4TUR A;  3THV A;  3IDW A;  3H4B A;  5AIB A;  2LPE A;  4M47 A;  5CP2 A;  4QZI A;  4DO9 A;  4OJP A;  4QWC A;  3KHG A;  1LVH A;  2IMW P;  4EZ9 A;  2YN4 A;  2YB4 A;  7ICH A;  4KLO A;  1T3N A;  4BDP A;  1ZD2 P;  2ATL A;  3WKD A;  2BCV A;  4RU9 A;  8ICV A;  1UCV A;  4FBT A;  2KOB A;  4GXK A;  4I2B A;  2QKQ A;  5B66 U;  2ZIW A;  4O3S A;  3LDA A;  9ICO A;  4QZD A;  4RUA A;  3PSP A;  8ICB A;  2LYH A;  1XU4 A;  4KLF A;  3WKE A;  1YZ6 A;  5J2J A;  2KTQ A;  1WYG A;  3QZ7 A;  5L1J A;  1A77 A;  2EH9 A;  1CI4 A;  4I2J A;  4NL9 A;  4DFJ A;  1ZQO A;  5CRX A;  4NXZ A;  3OTQ A;  3NS1 A;  1NZP A;  5L1M A;  1RXW A;  4KLH A;  2W7P A;  1ZQA A;  9ICK A;  4USA A;  2W8L A;  2BCU A;  2BGW A;  4C4T A;  4YFK A;  4UB2 A;  9ICF A;  4PHE A;  4F4X A;  2ZIX B;  3MFI A;  2H3Z A;  2W03 A;  4TQR A;  1NK5 A;  2A1J A;  3C1Z A;  3PR4 A;  2VA8 A;  4CE6 A;  1ZOL A;  2W04 A;  5AM0 A;  7ICL A;  3ZD8 A;  2H3Q A;  1ARO P;  3FM9 A;  2FLP A;  2UVU A;  2NRZ A;  4GC6 A;  2J6U A;  1K1S A;  4DS5 A;  8ICY A;  5KT3 A;  1IXR A;  3IM1 A;  2ISO A;  4C0Z A;  5KFE A;  5DB7 A;  5J8Y A;  5ALZ A;  1ZQN A;  3ZDE A;  2XC9 A;  1KDH A;  1C7Y A;  5IIN A;  3N7P D;  2KEY A;  5EE0 A;  2KZZ A;  2YQE A;  1TFR A;  2MUT A;  4F71 A;  3DV9 A;  1JAL A;  2KKP A;  4QZ8 A;  2BZF A;  5AK5 A;  1F5S A;  5AKZ A;  3OJS A;  5D46 A;  2JEG A;  3ISB A;  5HML A;  3N4M B;  4I2D A;  4F92 B;  4GIB A;  4KTQ A;  4BGD A;  4UB3 A;  1ZQS A;  4ED2 A;  4EEK A;  4J9R A;  9ICC A;  3NVV A;  4QZA A;  3PO4 A;  2E8M A;  1Z4N A;  4FBU A;  2YMQ A;  4R65 A;  2ASJ A;  5HR7 A;  2KP7 A;  4Y2U A;  2BDP A;  3Q8S B;  4DFK A;  4O3N A;  3D2S A;  1Z00 B;  1XNS A;  2WF6 A;  1X9W A;  1NK7 A;  1QH9 A;  2ISP A;  2XID A;  3M9N B;  3RJF A;  4QWA A;  4IL6 U;  1L6N A;  2XY5 A;  7ICO A;  4QZE A;  1MSW D;  3PMN A;  1PK1 B;  1DOQ A;  2B21 A;  4CF5 A;  5ALO A;  4P4M A;  3SI8 A;  1NKC A;  1LKY A;  2ES6 A;  3AEV A;  1FEZ A;  3NRZ A;  5ALU A;  2ZJA A;  4O3R A;  1TAM A;  1X40 A;  1YT3 A;  5DQH A;  3ISC A;  1S0O A;  1S0V A;  2DWQ A;  2FJ6 A;  3ZI4 A;  3BJY A;  3JPT A;  2HDO A;  4MEX A;  1S10 A;  1Z19 A;  2W9M A;  3NAS A;  4RQM A;  4P4O A;  3H8J A;  4ELU A;  5AKH A;  8ICA A;  3V72 A;  2WAQ C;  1HIW A;  3UMC A;  1NKE A;  1N5X A;  4K4H A;  3RB4 A;  3C21 A;  2I5H A;  1SKS A;  5III A;  2D8C A;  3JPN A;  3SR6 A;  4RQ1 A;  4K4I A;  4UB4 A;  2G0A A;  8ICQ A;  1U49 A;  3PNC A;  2WF5 A;  1ZQY A;  2PXI A;  5AKE A;  1IV8 A;  5CA7 A;  2R18 A;  2G5I B;  4GXI A;  5AM3 A;  5DQG A;  4M2Y A;  3E2E A;  5KFF A;  1QSY A;  3K1Z A;  3S6J A;  1F0M A;  3U26 A;  2KE7 A;  1V38 A;  4NL9 C;  2KIC A;  3NRW A;  1ZQQ A;  2OWO A;  1UQV A;  3NTU A;  4RQ2 A;  4MF8 A;  2FDR A;  3EPG A;  4Q44 A;  3C23 A;  2HOQ A;  5KFI A;  2W9B A;  2OCE A;  4XQ8 A;  1KLN A;  2M9N A;  3TAR A;  1KFS A;  4C8M A;  4M6W B;  1SWW A;  1SXD A;  2F8K A;  4BX9 C;  4IR9 A;  2VKQ A;  3HP6 A;  1XWL A;  2AGO A;  2KNJ A;  2ZUC A;  1DK3 A;  5ALM A;  4JV0 A;  4CNQ A;  4UB1 A;  9ICP A;  2KJ9 A;  3BQT A;  2K60 A;  4Y2T A;  3WKB A;  5AKJ A;  4O5K A;  1L8L A;  7ICS A;  2HOI A;  4J9N A;  4C4R A;  2KV2 A;  4YXM A;  5J2I A;  1K5O A;  2YMP A;  3E58 A;  4F4Y A;  2KVS A;  2GO7 A;  5ALS A;  5KNI A;  4PHD A;  5J2H A;  1UT8 A;  4B9M A;  4ED0 A;  2XCP A;  9ICV A;  5G5G A;  2FI1 A;  2YMM A;  1ZQB A;  5KT7 A;  4O0I A;  1BPE A;  2QB1 A;  2OYY A;  3GIM A;  2ZUD A;  2YTU A;  3ZDC A;  4GLX A;  3NVZ A;  2XI9 A;  3HX0 A;  1SL0 A;  1S97 A;  2KSO B;  1COO A;  4YD2 A;  4DL4 A;  4Y2Q A;  1WCN A;  2LHT A;  3ED5 A;  4DLG A;  4WJ3 B;  3ORY A;  1X2I A;  4UAR A;  3K4G A;  5JTI A;  5D4B A;  1O08 A;  3SQI A;  2BQ3 A;  2LKY A;  2LBO A;  1QLN A;  1JMS A;  1NZB A;  4P0Q A;  3RAQ A;  2IOH A;  2EAN A;  3Q8Q B;  4DSJ A;  4PPX A;  2GLE A;  3E0F A;  3AN1 A;  4QZC A;  2NRW A;  1PK3 A;  1RYR A;  1J2N A;  5KFD A;  2BKE A;  5KFU A;  2IBK A;  1ZQC A;  3G6V A;  2CN1 A;  4J9M A;  5GTH U;  2ZIW B;  2WF8 A;  5KFM A;  4F2R A;  3C2M A;  4EBD A;  1ZET A;  3GIK A;  8ICN A;  2C22 A;  3T79 A;  3UXP A;  1JUD A;  1PVP A;  5KG2 A;  4DQP A;  1GO3 F;  3IRU A;  4PHA A;  4I2H A;  3OJU A;  1SWV A;  2KKV A;  1VLB A;  2BPC A;  2PI5 A;  4C4S A;  2K4I A;  4PGQ A;  4F72 A;  1V9P A;  2BDU A;  3N7S C;  4PL1 A;  5J2K A;  3Q8M A;  3C2L A;  2XY7 A;  4EYH B;  4QZ9 A;  4YCX A;  4DQQ A;  2C2D A;  3CP8 A;  4C8O A;  2KN7 A;  4KLT A;  4FFD A;  3WU2 U;  2MSN A;  3LWL A;  1OUQ A;  4RQ4 A;  4RNO A;  1TAU A;  3MDC A;  3H0R B;  3CYM A;  4M04 A;  1T4G A;  4BXO A;  4Z6F A;  3EWA A;  8ICW A;  1S0M A;  2Y0S C;  4OO1 J;  5J0Y A;  3SEI A;  1X6J A;  3KBB A;  4J9O A;  3BS5 B;  4Y2P A;  3RJJ A;  3AU6 A;  3PZP A;  2KHV A;  5AIC A;  2FLN A;  4DFP A;  2DPI A;  4PL2 A;  4ECS A;  4QW8 A;  4NLC A;  4IC9 A;  4JWN A;  5ALD A;  5AK3 A;  4RUC A;  2M0N A;  2BCR A;  3UXN A;  5KT6 A;  2WHE A;  4KLG A;  5AKK A;  5KG5 A;  5AK6 A;  4G3I A;  5HP4 A;  1ZJM A;  2RLT A;  2F76 X;  5DGA A;  4ED7 A;  2K4H A;  2AQ4 A;  4UAW A;  1X42 A;  5KG3 A;  3C2K A;  2R8G A;  1RQN A;  4E0D A;  1VDV A;  3EUB 2;  4F8R A;  4NV0 A;  4M9N A;  3KZX A;  1BGX T;  1J97 A;  4ECZ A;  3H4D A;  4GFJ A;  3GU3 A;  3KKA A;  4M9H A;  1RYU A;  4GXJ A;  4KX5 A;  4C7Z A;  5KFK A;  4P0P B;  2EZX A;  4RZR A;  3TAD A;  1HEK A;  2DQN B;  4JB3 A;  3IN5 A;  4NLK A;  3T3F A;  2FPL A;  2KHQ A;  3L5K A;  5J0U A;  3Q8L A;  4CCH A;  1X9S A;  3FDS A;  1HUZ A;  2PI4 A;  3KD3 A;  4F5O A;  5HHI A;  4IQU A;  2JGA A;  5KT5 A;  5ALG A;  5H2F U;  4QJF B;  4FZM A;  3MFH A;  5ALE A;  3AQE A;  2DGZ A;  4R63 A;  2KIV A;  7ICE A;  1B0X A;  3H40 A;  4C8L A;  3D2Q A;  4EBE A;  2RRD A;  2A1A A;  2I6X A;  8ICG A;  3RH6 A;  1T8E A;  2UVR A;  5KG1 A;  3ONN A;  3PV8 A;  1U9L A;  5AI5 A;  1T3Q A;  3PX6 A;  2F1H A;  4M9J A;  5J0X A;  2DUY A;  2JV3 A;  3SV4 A;  4O5E A;  2HBL A;  2JXJ A;  4KLJ A;  3T5J A;  1RZT A;  2ZJ5 A;  4R64 A;  5ALR A;  3ISD A;  3EZ5 A;  3V7K A;  4HYK A;  1ZQG A;  2IHN A;  2ZG6 A;  3QNM A;  2EDU A;  1SV0 A;  1KL9 A;  1N56 A;  1SV4 A;  1N63 A;  1L7O A;  3MGV A;  3PR5 B;  4F4W A;  2MAX A;  2W11 A;  4DSF A;  3ETL A;  5AKI A;  2W9C B;  2E1E A;  5B5E U;  5KFZ A;  1NK6 A;  3HT3 A;  2Q0Z X;  5IIK A;  2EAM A;  3PVX A;  3KHH A;  4X5V A;  4LVS A;  3C28 A;  2FPK A;  3NGD A;  4RQ5 A;  2ZIU B;  2WTF A;  4U7C A;  2PFP A;  9ICI A;  4I27 A;  4EEL A;  1QQ7 A;  1L8O A;  5DGB A;  4KLD A;  4QZF A;  2KMD A;  1ZQJ A;  8ICX A;  2VA3 A;  2Y1I A;  3B0Y A;  2D3D A;  4NM2 A;  2VJ4 A;  2EAP A;  2Y1J A;  2QAR B;  2KFZ A;  1TAQ A;  4YD1 A;  1QTM A;  2R8J A;  2FLL A;  1RXV A;  1A76 A;  5G5H A;  4Z6C A;  4DF4 A;  5KG0 A;  3TI0 A;  4DS4 A;  3H7I A;  4BUG A;  1N61 A;  2V4R A;  3GV8 B;  3SAF A;  2AGQ A;  5DBA A;  3RAX A;  1KRP A;  2BR0 A;  4KX3 A;  2ZUB A;  5CHG A;  4B9T A;  2RDI A;  3MR6 A;  2OEH A;  4YXJ A;  5JU5 A;  1SL2 A;  2HVI A;  3O0F A;  4ELV A;  5ALK A;  1F44 A;  1BVS A;  5AKY A;  5DLF A;  5J0P A;  2ZIV A;  4DL7 A;  1MN8 A;  2MRL A;  1ZQU A;  1EXN A;  3WK5 A;  8ICH A;  2G06 A;  3MR5 A;  1HUO A;  2HHW A;  4NLB A;  1NJX A;  1NK9 A;  1S9F A;  1J2M A;  1OW5 A;  1ZRM A;  5DB6 A;  4FZL A;  4NLN A;  1BNO A;  3OSP A;  2HHQ A;  8ICM A;  2BCS A;  1Z1V A;  1DGS A;  3HKZ F;  3CRX A;  1HJP A;  2GOL A;  3SZ2 A;  3RR8 A;  4TUP A;  5A0L A;  2HMX A;  2HBK A;  3RB0 A;  1LB2 B;  3RJH A;  4UAS A;  3SD7 A;  2PMZ C;  4LJX A;  3GFK B;  4RPZ A;  3TAD C;  5HNK A;  9ICQ A;  4QZH A;  4UAT A;  4US9 A;  5ALT A;  5BPC A;  3KFU F;  5AI6 A;  3MBY A;  5KFR A;  1U47 A;  5DBC A;  4TUQ A;  4DOC A;  4EX7 A;  2A19 A;  4IRD A;  4KLI A;  4RPY A;  3SAH A;  4ED1 A;  4NLZ A;  3B0X A;  2QB0 B;  4UQG A;  9ICH A;  5AK4 A;  4Z6D A;  3WK9 A;  3T5H A;  5J2A A;  1WWV A;  2F44 A;  3BQ7 A;  1NKB A;  8ICS A;  9ICU A;  3FAH A;  1ZQM A;  2E8N A;  4Q43 A;  4P4P A;  1D9D A;  5L1I A;  2WF9 A;  4IR1 A;  5D49 A;  4YR0 A;  3GV5 B;  2FMP A;  4DCC A;  4QWD A;  3CW2 C;  4OJ6 A;  4KMO B;  3IG8 A;  4KLS A;  1JN3 A;  3FC4 A;  3QUT A;  2JRZ A;  1BPB A;  1SKW A;  4UAY A;  5L9X A;  1NJW A;  4BWM A; 
#chains in the Genus database with same CATH homology
 5B5E U;  4IL6 U;  3A0H U;  5E79 U;  5TIS U;  5B66 U;  5GTI U;  5H2F U;  3WU2 U;  3KZI U;  4UB6 U;  1S5L U;  2AXT U;  4PJ0 U;  3A0B U;  5GTH U;  4UB8 U;  2DUY A;  5KAF U;  5KAI U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...