5TISZ

Room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 21
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5tisZ00
1S5LZ 2AXTZ 4UB6Z 4PJ0Z 5E79Z 4UB8Z 5GTHZ 5B5EZ 3KZIZ 5GTIZ 5H2FZ 5TISZ 4IL6Z 3A0BZ 5B66Z 5KAIZ 3JCUZ 3A0HZ 5KAFZ 3WU2Z
chains in the Genus database with same CATH superfamily
4HNAB 4CC6A 2ADPA 3SJAC 2EILB 3ABUA 1VP7A 4KL1A 4UUJC 4O4LA 1G8MA 3EXAA 5GW7A 4CS3A 2DYRC 4DW0A 4OPAA 3JD3A 3OUFA 1YF2A 4DV2O 4RQFA 1SQVH 4W4LA 5D5QA 1GM9A 2BTQA 1G4YB 1K7DA 3K5MA 5EZYA 2XT9A 4FLWA 3STLC 1RPOA 1V54B 1E79G 4PA9A 1AVMA 2ZR3A 3N2GA 4NVPA 2FKXA 4NR1A 2CTRA 3CHXA 1JQ0A 3SDLA 4NYKA 3QNEA 4LF7B 1U96A 1KC8W 2IJJA 4R8CA 3H1JH 4KHPO 4FFBA 2ETNA 3RYCA 2UXDB 3ZHUA 3UT5A 3SYCA 4LF5B 2FB5A 1PL0A 3ZN0A 2A79B 4JI0O 4J7JA 4LR3A 2F66C 4IHJA 4JTAB 1XILA 4ZIBA 3BFRA 2HJDA 2MK3A 4DXWA 3UM7A 4OXSA 3T1YB 3JARB 3K57A 2R9AA 3CRMA 2JDIG 4FLXA 4EFEA 3A0RA 3SPHA 1Z5WA 1XL4A 5KHJA 2F93B 1M5IA 4UFZA 1NTMH 1TGOA 3APOA 4IIJB 3W7WA 1RFYA 3DXRB 4TUYA 3SJCC 1XHZA 4DV0O 1TVKA 4CS4A 3FAVB 3RVZA 5LMNB 3ZMVA 4DR6O 5KA6A 2QJ1A 5GONB 4B3SO 5J9PC 1OCCB 3QG5A 4JYYA 5IJ9A 2QKSA 3FYIB 2IU0A 1M90W 1S5HC 3OEEG 2ITDC 2HEPA 4JI7B 4H37A 4LF4O 1I0HA 4QGPA 4D6TH 4DUZO 3G6EV 3OE7G 3W7XA 1N34B 4LFCO 3ABLB 3F5WC 2KSDA 4ZOLA 1AJQA 4O2AA 3J81N 2WLMA 1PM9A 1W2BU 3L75H 2QKCA 2GSMB 5ITZB 2UXCB 1SA0A 4P30A 1DTOA 1R3KC 2DYRB 3CCJV 2EZOA 2UXBB 2WA4A 3FB6C 2K9PA 5JH7A 1H38A 1BQ0A 3A0HZ 3MHSC 4DV6O 2E75B 4ZKIA 2JS3A 1B3QA 2HG5C 3Q4HB 1QR9A 4PJ0Z 1FAFA 1XEQA 1VQPV 4N21A 5LXTA 4FMTA 5KMGA 1LUWA 1Q81W 2RDCA 2Q5ZA 1KQSU 4DR2O 4B3TB 4GLXA 3JD1A 2AZ0A 2P5OA 1VF7A 3ABKB 1BGYH 5KHKA 5JQGB 4DV4B 1N8RW 4DV5B 4UCRA 1AP6A 3CC4V 3PJSK 2OIEA 1IBLB 2Q0AA 1JJOA 4B08A 2XASA 4MVMA 1GN4A 1Y74B 1WA8A 1K97A 4X88A 1P84F 1H2SB 1M57C 2EIKC 4PV1B 3SYOA 1JFFA 1H8EG 3QTCA 2JGDA 4TQFA 5DEDA 1ORQC 3TXQA 4O2BA 2ZKOA 2IW5A 4X66O 3VQVA 1EZVH 1FFTB 5CB4A 1QBZA 4GT1A 5AG2A 3JASA 4EEQA 5KUKA 3HKEA 2UUBB 1LR1A 1S5JA 4JZ2A 1E1QG 1NR1A 1WJZA 4Z2WA 3OGCC 2CDYA 3G71V 1RSOB 2BSKA 4X1KA 1YJWV 2OIGA 4MTOA 4B3RB 5DECA 3P3NA 1R73A 3TGUH 2FTKA 1R6NA 2XAQA 5IY5C 1OCRC 4X1IB 2F23A 1M93A 2QR4A 1N32B 3CD6V 3JALB 5B66Z 3FFQA 2EBOA 2B1IA 1COWG 5H5NA 3ICXA 4B7KA 3ZHQA 1IBKO 1PPJH 1Q3EA 1QU7A 5BMVB 1S5LZ 1GTOA 4I5SA 3X2QB 3E8FA 5LP6C 1VQ6V 2QWRB 3O65A 5IDJA 3HKDB 4K35A 4PA3A 3RYFB 1QQCA 2WLNA 1BCCH 2KB1A 1W59A 2OWOA 1XNQB 2R72A 3N2KA 2UXNA 4J10A 5JJNB 4NB5A 5IWAB 2AXTZ 1QLEC 3QO7A 3OW2U 4I7ZB 4G2KA 4E4EA 3DTUB 3SPIA 3AG2B 2QDOA 1OCZB 4YY3B 5KX5B 3QF7A 3OTOO 5LGTA 4PD4F 2ZM6B 2VQEB 4MVSA 3AK2A 4D7SA 4LF8O 2HR3A 3OT7A 4JGSA 3CMEV 3BRCA 2Q7HA 1QNMA 3ETGA 1FXKB 3BA8A 3AG7A 2CH7B 3ZHRA 4JI8O 5H6QA 2BOCC 1XDCA 1H2NA 5EYPB 5KHGA 3C3SA 1YVWA 3LSSA 5C93A 1M57B 4DV7O 4FZ0A 4AHCA 1N33B 3OR6C 1N4CA 4HZ3A 3FKSG 5FNVA 1R6KA 4LWSA 1FJGB 4J9YB 4JYBA 2P4VA 4LNUA 2NN4A 1K4CC 3K5OA 4GZRB 4WFBV 5FPRA 3HKBA 3EVKA 2LJ2A 4LBEC 3ZRSA 3KCXA 1ZSPA 5BY1A 2UXDO 2WSSG 4UXNA 4ASUG 4JI1O 1TUEB 4EKWA 1KB9F 5HFLA 3GB7C 4Z1VA 1WP7A 4OX9B 4ZHQA 4N23A 1E1RG 3ZN1A 2JEUA 5J2TA 1YTFB 5B1BC 1VQLV 3LDEA 3E8HA 1SZTA 1BMFG 2ZNJA 1IZ3A 4UVBA 3I55V 5LP6B 5LYJB 5BR8O 3K9SA 1W0JG 4K8ZA 1SRYA 4XBFA 2W6JG 1FXVA 2HHHO 2WLIB 3B2EE 4B3MB 3H1KH 1B06A 3F7YC 4AI8A 2UU9B 3U0ZA 1AR4A 1HR0B 4JV5B 5LBQA 3CCVV 4DV3B 2DQ0A 2Z0AA 2HKOA 2YICA 1D5AA 3MAQA 1MZEA 1NQTA 2Y69C 2EULA 3IGAC 3SJBC 3JAMN 1QLEB 4O4HA 1UJWB 4O4LB 1XBLA 2Q73A 4UV9A 5LA6B 1YJNV 2F4VB 4CH4A 3WB0A 2KKWA 4X89A 4DR3B 1OCOB 1XREA 4I9QA 5B3SC 3B8MA 3ABMC 4NXMO 1S77D 1IXMA 3UO3A 2BTQB 1R1BA 4AQYO 1NJIW 2FYUH 5EZYB 1HNWB 1N34O 5LL6Y 1VMGA 1MOFA 1QVFU 2IU3A 3SYAA 5LMUB 4TV8B 3L71H 4LF9B 4LFBO 3OFNG 5FPOA 5CMUA 3L70H 1P49A 4Q6GA 1NZ6A 1L0LH 2EZPA 4BIZA 1KUQA 2YXYA 5L3DA 3TCUA 2UXBO 4FFBB 1Q43A 3RYCB 1HNXB 2WLHA 3JD0A 2QM4A 1H2MA 1GO3F 3B77A 2GDSA 5E1AC 1KBHA 2Y4TA 3K0GA 1XI1A 4IHJB 4UVCA 4P2ZA 3HPLC 4DUYB 3UO2A 4TV9A 2EIMC 2CTPA 3KKYA 1BE3H 3C90A 1KMIZ 4GUNA 4MVUA 3G6BA 3KG2A 4J7ZA 4DV5O 1YEWA 1ZL8A 3ASNB 3IFXA 1KECA 1JMKC 4DR1B 5IYZB 4TUYB 3SJQC 1M56C 1TVKB 2HVKC 4X64O 3BY6A 4D7TA 1AILA 5B1BB 4KP4A 2W0XA 4U3FH 1NS1A 2YEVB 2FL4A 5EC2C 1KU9A 1SQBH 2OTJV 2WLLA 4LC1A 2LFRA 2VWJA 2Q6AA 3CMAV 2M7WA 2WA3A 5L3FA 2HLDG 5JVDB 5LGNA 1VF5B 2X6AA 4RO2A 4NTYA 1KD1W 3BEHA 4ZOLB 5IJ0A 2UUCB 1JVMA 2Y69B 4O4IA 1IBMO 3HKCA 1Q86W 2JIZG 1PL4A 3RFRA 1K92A 4BIUA 1I08A 3VBBA 4JTCB 5F2VO 1MABG 1HDJA 3W7UA 3VQWA 2ATKC 1ENVA 5A2QN 4ZI7B 2QEXV 1IDSA 2M6YA 4K0KO 3ABMB 2P90A 3JSNA 3ASOC 5H6RA 1GM7A 3LSUA 5LHIA 1L1FA 3CCSV 2GUZB 3SYPA 2ODMA 5LXTB 5KMGB 3CX5F 2ZR2A 2HJFC 1XUQA 3ZX6A 1BL8A 2B9ZA 1EN6A 2JS5A 2ZQMA 4EB6A 4GX1A 3K03A 2ZXWB 2JRIA 2P6JA 1JPXA 3M99B 2ZIOA 1YCIA 3JATA 4LFAB 1NR7A 4JI4O 2Q67A 2GBOA 5D5PA 1BQZA 1VIBA 4JI6B 3CCQV 3DGEA 1Q90D 4X1YA 2KQXA 3A0BZ 4U7OA 1BSMA 1K5SA 4WFEA 1NH2D 4YIPA 1QCEA 5EIBD 4DR7O 2EIMB 1JX9A 2P7TC 1JFFB 4YXWG 5J2UB 2WAMA 4GX5A 1WPBA 4GKKB 3JAWB 5E79Z 3OM3B 1GMGA 2GTSA 4WBNA 3GWKC 4PA6A 3CPWU 3WB2A 4RQEA 2LW7A 2XTAA 3HKEB 1I5YA 1M56B 1AR1B 1VQKV 5CA1B 2DWEC 1AB3A 2XOKG 3BAAA 2YC0A 1OJHA 1J5EO 4J41A 3J80N 3TETA 4H44B 3D3IA 1N33O 4X1KB 3T1HO 4UCUA 1S3JA 2P4KA 1BT8A 4IYIA 4YHHB 4U3JA 3ZRXA 1NT2B 1SQGA 3CC7V 1FFXA 1Q5OA 4JI2B 3JAKA 1VQ7V 2E5LB 2EX3A 4ICGA 1R3IC 2LO1A 1AI6A 5L3GA 1CXZB 5B1NA 3STZC 3K5NA 3CCMV 1XMOB 2EIJC 2XAFA 4NTWA 2D3OW 3CP1A 3N2KB 4JYAB 4Z1MG 3ASOB 4HNAA 2A3QA 3OEHG 4FM2A 1V9PA 3H01A 3CC2V 4P9PA 2DOSA 3CRQA 1DLBA 2AZ2A 4FFKA 1DGSA 2DW4A 2W6IG 2YS8A 1ZUQA 3G67A 4X65B 4JI3O 1XMQO 3ZBHA 1D5NA 1H2GA 4JV5O 1Y76A 1S76D 4DV3O 4JI5B 3W7SA 3OR7C 4UB8Z 2UUAO 3LDCA 1EN5A 2QM7A 2XAGA 5TISZ 3RWRD 4IYHA 4NXNB 3PN1A 4DV1B 3ETDA 2OT5A 2PTMA 1WLEA 3ETQA 1K3EA 4RAIA 1PKXA 4R6ZA 2YXHA 4I55A 3K5LA 4QNHB 4LF6B 4DR4B 2BOBC 5JCOA 2IJIA 2XAJA 3F7VC 3E83A 2IH1C 3E8GA 1XNRB 5LMUO 1AP5A 1H8HG 4I50B 1XL6A 4F4LA 1N0NA 1PV0A 3JARA 4XDJA 1BHBA 1P7GA 3RYIB 3HKBB 2EINC 3AK1A 1K9MW 3T2MA 3W7TA 2QWOB 2YIDA 4MSWC 1HNXO 1ZTEA 2VS0A 4JYCA 4DR5B 3K08A 3CCUV 2GV9A 4UCSA 4WFGA 2OCHA 4QJFB 4KUMA 1ZAUA 2ZT9B 2VWKA 3E35A 3OTFA 1UPGA 3KCYA 5B1AC 3VOUA 1I94O 1SF9A 4PDVA 1JJ2U 1X4TA 1YDXA 3GWOA 1P7BA 3SYQA 5L3EA 1XOUA 3AEIA 2Q4PA 4CH3A 2PYJA 4DYLA 1SKVA 1NKDA 2NR5A 4X8AA 4TWKA 2ZIMA 3J7AU 2CAZC 5ITZA 3K3WA 3CS5A 4PI2A 1H2LA 1I7FA 4KHPB 2YIBD 4UVAA 1AJNA 5H9CA 1M4UA 3T1CA 3NXSA 5JWPA 2DE0X 3L73H 4K8XA 3FB5C 1PNMA 5B1OA 2QGNA 1SZXA 3TK1A 4I0XB 4TQDA 4J42A 1H2KA 4XDLA 1O9GA 2IJHA 2IBZH 2PZSA 1SS3A 1WB7A 3F5TA 2ZE5A 1R6TA 1JR9A 2QA4V 5JQGA 2EIKB 4GKJB 3P32A 5KAFZ 4UCVA 1WPXA 2N04A 2YIBA 5JJEB 3TXSA 3C3TA 1NVPD 3SPGA 3JD2A 3T4ZA 4DV0B 4QIWF 1Y74A 1JA8A 2L35A 4DR6B 1F7YA 1K4DC 3TJTA 4B3SB 3SPJA 3D3QA 3MD0A 1YI2V 4TV9B 2Y4UA 1EN4A 4LF7O 1BHAA 5CA0A 4YJ3A 1THZA 2AGAA 3O9OA 1ZL8B 2UXXA 4DUZB 1GM8A 3AG4C 2CGOA 2Q68A 5IT9N 3APQA 4LF5O 4LFCB 4HAMA 2R70A 5A9GA 5IY5B 4JAAA 1OCRB 4FZ1A 3R66A 4LH7A 5LOVA 1Q6HA 4DRXB 4CH5A 3T1YO 4X9QA 2YIAA 4UB6Z 5B1AB 1K8AW 5C8YA 2P22C 4FLUA 3KZIZ 1R3LC 4FIPC 4L8JA 3IAYA 2WPDG 1TA8A 2RCVA 2YI9A 4TT3G 4U7NA 4PA7A 2F1MA 4F6RB 5BMVA 2WLKA 4O4IB 4WFHA 1YHQV 5LMNO 2QWPB 2NLJC 1Q6UA 2JJ2G 2E74B 1Q82W 1S72V 3K59A 1ROPA 2AW9A 2R9RB 3JD4A 2DN9A 4JI7O 4LH6A 4B7EA 3E22A 1N36B 4YHHO 3UCSC 3ZRWA 5L3BA 5LHGA 1YJ9V 1QR8A 3T4DA 2EJRA 4TSFG 4CS2A 2A06H 3K0DA 1XHXA 3SGIA 5KLVH 1US6A 4FJCC 1F4NA 4JI2O 3ZHVA 1CPYA 5KX5A 3N2GB 1GH6A 1FYJA 2Q8VA 2UXCO 4EB6B 4OGQB 3CXCU 4X66B 3JATB 2CTWA 2ZINA 1N0JA 1Q6IA 1FXKA 4JYAO 3UT5B 2ILMA 2B5UA 3THOA 1IURA 1NTZH 4IGGA 3LNNA 2X0LA 3L72H 3RYHA 3N27A 2QKAA 1LUVA 2RMKB 3ZS8C 3ZMSA 3RVYA 1FD9A 2QWQB 1QVGU 4B3TO 2WWWA 1RPRA 5JCOC 1VF6A 1KYOF 4BW9A 2H3OA 4DV4O 4WBNB 2AHYA 1TUBA 4J7KA 2JGUA 3AG4B 1O9HA 4H0LB 1WB8A 1YTFD 4UCTA 4YIOA 1IBLO 1AROP 2DWDC 1IBKB 3LNMB 3FX7A 4GCZA 4J9ZB 1GK9A 1J95A 2X7RB 2LFSA 2ZDIA 4FK5C 5IYBO 4NXNO 3EHBB 3WG7C 4BAYA 5IJ9B 4JPRA 3CJHA 2FMLA 1XQ8A 3WFVA 1CEZA 4H13B 4MVQA 4ABMA 1KP3A 3UQ8A 1SETA 1VQNV 1UFIA 1G1XB 4JAVA 4X20A 1FFXB 1T5EA 1SC5B 2UUBO 4O2AB 3LUTB 3UKMA 3OTOB 3AK3A 5LP6A 5LYJA 1G6UA 2PI5A 2R9IA 2WLIA 3BVOA 1SA0B 4LF8B 4J80A 4B3RO 5JH7B 1HNZB 3ABLC 4F6EA 1KKCA 2GTAA 5B3SB 5CBGA 1N32O 2V4DA 1K73W 1Q8IA 1HW7A 1ZWIC 2LW1A 2ITCC 3RW0A 2WLJA 4QPKA 5LA6A 5EBLC 3U11A 4DV7B 3MHHC 2ARHA 4GX2A 1V55C 2VQFB 3K04A 3QO8A 3JYCA 5BZBA 4O4JA 1IVSA 2ZE7A 1XNQO 1Y76B 1Y4MA 2D2CB 1F23A 3ZIAG 3P3PA 4TV8A 2OYQA 5IWAO 1U97A 2QSAA 2V7QG 1WA8B 2XHBA 4JZGA 3B4SA 2BTOA 1B6QA 1Y66A 3ABKC 1NI8A 4YY3O 4I55B 4BW5A 2ZM6O 2VQEO 2PI4A 4JI1B 4WFAV 2BE3A 2JGDB 2YSUB 4O2BB 1EFRG 4PDRA 3E2EA 1GN2A 5GTHZ 3CXHF 1QLNA 2RQ6A 5CB4B 3CSXA 3JASB 2Q9LA 3BABA 5KHIA 4DO2A 3B8NA 5BR8B 3WG7B 1NBMG 2X6CA 1PNLA 1CP9A 4LCUC 4GKJO 2HHHB 5CBHA 2BSKB 2YUAA 2E3CA 3ZMUA 1Z2GA 3SR2C 5IYZA 2H94A 1M9NA 4MTFA 2CGNA 3H9VA 4XDKA 2KG7A 4YJ2A 1FJGO 3MDSA 1FKAO 2YEVA 1AI5A 1A32A 1GKFA 4OPHA 4W4KA 4FLTA 4I4TA 1Z5VA 5EK0A 1L0NH 3FB7C 3ZEDA 4FLYA 5IE9A 3JCZA 5KUMA 5JVDA 4NXMB 4PDMA 1MSDA 1SQFA 4AQYB 4G27B 4MW3A 2F95B 2DJVA 3H1LH 1K34A 1WAZA 4R50A 4OX9O 3BCCH 4FM1A 3OMNB 3X2QC 4LFBB 4R7CA 3E86A 3L9DA 1P4RA 4X62B 1S0VA 3D36A 1V55B 3BA9A 4ZI7A 3WB1A 3OAAG 3ZHSA 3G4SV 4B3MO 4FM0A 2HP8A 4P9OA 2UU9O 2P67A 2GUZA 3K79A 1HR0O 2PUSA 3AG2C 1OCZC 2XUMA 5EBMC 4MVRA 2Y48A 2F4VO 1DF4A 4DR3O 2DQ3A 3I56V 3E89A 1OHHG 1I5XA 4LP8A 1N36O 1FXKC 1SQPH 2GHYA 5FNVB 1GRJA 1EBOA 3LDDA 4LWSB 2K1EA 1HNWO 2W0FC 4X64B 3S3WA 2XAHA 5H2FZ 1JOYA 5KHHA 1SQXH 2JJ1G 4CH6A 2QM8A 1MSWD 3AG3C 1BZKA 1KKDA 4LNUB 4LF9O 5J2UA 1VF6C 1YZBA 3CCRV 4TOIA 3CYOA 3G80A 3CB2A 5CA0B 3JAWA 4YJ3B 2JEXA 2YI8A 4E2LA 2N05A 3H1HH 2IH3C 4PELA 4GX0A 4MW8A 4IIJA 2YXLA 1NVPB 3DXRA 4PHZA 5HFMA 3SPCA 1IBMB 4ZHQB 1NU1H 4BIOA 5CA1A 2ZDIC 1EM1A 3FAVA 5KA5A 5LOVB 5J2TB 1FXHA 3RBZA 2RN9A 2HVJC 3DC5A 5GONA 1RP3B 3B09A 4UV8A 4DUYO 4BWAA 2DMXA 1YIJV 4G28B 2VRZA 4Q20A 5C8YB 2ZNIA 1MMMA 5CBFA 5IYDO 2E76B 4DV2B 1YITV 1MG1A 3ETEA 4K0KB 3OD4A 3QVNA 2EIJB 2LP7A 4H33A 4DR1O 1GN3A 1R3JC 5L3CA 4FLZA 4WCEV 4KXRA 2QE7G 2ADQB 1F51A 3ZJZA 5FLXN 1MNGA 4O4HB 4RUEA 4DK0A 2AHZA 3OMIB 3CWBH 3IC7A 5JJJB 1ZLZA 2RJZA 3AG1C 4JI4B 3CRCA 3E22B 3CCEV 2RNBA 4C7UA 2A0LA 4FPPA 3ZRWB 3ZHTA 3WU2Z 1AI4A 3ZCCA 3Q4HA 4JI0B 3ML0A 3QO5A 2UUCO 3DC6A 5B5EZ 2MW2B 4CZZA 4DR7B 1LNQA 2EJ7A 4IL6Z 1BS3A 1OCOC 4HBNA 3CCLV 4K3AA 1FPOA 1VEWA 2Y0PA 1W0KG 4MTGA 5CA3A 3GVMA 1IX9A 3CE2A 5EBWC 5DM6V 3A2FA 4FVMA 1Y67A 1HNZO 1AR5A 1NTKH 4BR6A 1QHTA 4PDLA 5LHHA 5GTIZ 4A5UB 1VQ8V 1L8DA 1J5EB 1VQ9V 3RYHB 1WN7A 3L74H 3AG3B 1DF5A 1TAEA 4MVZA 5KAIZ 4RWUA 3S3XA 3T1HB 1Q7YW 2EINB 3M8AA 2VQFO 1PP9H 2C2AA 4RUFA 2LGQA 4LF4B 2P06A 4WF9V 4DK1A 1TUBB 4LFAO 4QE7A 2ZD9A 3K06A 2DYSC 2G38A 4I50A 1HP8A 4WFFA 1IXBA 5EC1C 4JI6O 3R65A 4DW1A 1RM1C 2Q0OC 3RYIA 3BPZA 2X6BA 2NNUA 1RSOA 3ASNC 3CJHB 5EIBC 2WLLB 2PYLA 1DK1A 1Y6XA 1MA1A 4CC5A 1X59A 4GKKO 3FD9A 4X1IA 1SERA 4CBCA 1VQ5V 4DV6B 3JALA 3VQYA 1F4MA 3JCUZ 3CRAA 1FS0G 4X20B 1GAXA 3E8BA 3ZMTA 3HB3B 2QWNB 5IJ0B 2LGWA 4NTXA 3BHPA 3HKCB 1WNSA 1AJPA 4DR2B 3HKDA 3ABTA 3RYFA 2Y0IA 2YDEA 1M1KW 4JI3B 1XMQB 2F43G 3AG1B 2CE4A 3NR7A 1EZJA 1SESA 5DN6G 4L87A 3D8CA 2UUAB 2OCCC 4J11A 2JK5C 4QE9A 1KP2A 2EILC 1URFA 3U10A 3RT3C 2BCCH 4MTXA 2E5LO 5LGUA 3D36C 1HWYA 5K1PA 2Q7GA 2HFEC 4EFBA 3A8TA 1OV9A 4O4JB 1XMOO 2JVDA 2Z3YA 1VQMV 4I0XA 2A9HA 3RN4A 3HR0A 2CTQA 1WP8A 4PA4A 3IJ4A 1YXBA 1V54C 2CH7A 4JTDB 1PD3A 2ZE8A 3DSQA 3ZRVA 5EYPA 4X1YB 3H1IH 4JAUA 5CN0A 4X62O 2Q69A 2ZXWC 1VQ4V 2CUGA 1AI7A 2PGGA 1VQOV 4HYOA 3OGIB 4JASA 4X65O 3RGBA 3JSLA 3K58A 3CRRA 4ZBMA 4JI5O 2DYSB 2O57A 2IJKA 1K33A 1K5QA 1B04A 2Z5UA 1RM1B 4IT5A 1YSCA 4FLVA 1OZ0A 1I94B 4DV1O 3B40A 1VARA 4MS2A 3CEIA 4AILC 1PNKA 1NH2B 2B1GA 4KFMA 5IYCO 2OTLV 4MT8A 4LF6O 1ZX3A 4DR4O 4JF3A 3K9AA 4QPJA 3FYEB 4NKGB 3EFFK 2A7WA 3I5DA 3P30A 1JCHA 3LSQA 4I9WA 2L6LA 4U3JB 2KG7B 4YJ2B 1XNRO 4DRXA 1SQQH 4PI0A 4UCOA 5K1XA 1OCCC 2PY5A 3JAKB 2Q7EA 2V1DA 2IM9A 4I4TB 2CK3G 4MVOA 3VQXA 4GYCB 2QTSA 3OMAB 2N74A 2PF4E 3IC9A 1MZFA 2XNDG 4DR5O 1D2DA 2H8PC 2ZE6A 3M7MX 2ZCEA 1GN6A 5FL7G 4F6RA 2LQTA 2QTOA 3FB8C 3OUSA 3ZMZA 5BXZA 4JI8B 2OCCB
chains in the Genus database with same CATH topology
1S5LZ 2AXTZ 4UB6Z 4PJ0Z 5E79Z 4UB8Z 5GTHZ 5B5EZ 3KZIZ 5GTIZ 5H2FZ 5TISZ 4IL6Z 3A0BZ 5B66Z 5KAIZ 3JCUZ 3A0HZ 5KAFZ 3WU2Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5L Z;  2AXT Z;  4UB6 Z;  4PJ0 Z;  5E79 Z;  4UB8 Z;  5GTH Z;  5B5E Z;  3KZI Z;  5GTI Z;  5H2F Z;  5TIS Z;  4IL6 Z;  3A0B Z;  5B66 Z;  5KAI Z;  3JCU Z;  3A0H Z;  5KAF Z;  3WU2 Z; 
#chains in the Genus database with same CATH topology
 4HNA B;  4CC6 A;  2ADP A;  3SJA C;  2EIL B;  3ABU A;  1VP7 A;  4KL1 A;  4UUJ C;  4O4L A;  1G8M A;  3EXA A;  5GW7 A;  4CS3 A;  2DYR C;  4DW0 A;  4OPA A;  3JD3 A;  3OUF A;  1YF2 A;  4DV2 O;  4RQF A;  1SQV H;  4W4L A;  5D5Q A;  1GM9 A;  2BTQ A;  1G4Y B;  1K7D A;  3K5M A;  5EZY A;  2XT9 A;  4FLW A;  3STL C;  1RPO A;  1V54 B;  1E79 G;  4PA9 A;  1AVM A;  2ZR3 A;  3N2G A;  4NVP A;  2FKX A;  4NR1 A;  2CTR A;  3CHX A;  1JQ0 A;  3SDL A;  4NYK A;  3QNE A;  4LF7 B;  1U96 A;  1KC8 W;  2IJJ A;  4R8C A;  3H1J H;  4KHP O;  4FFB A;  2ETN A;  3RYC A;  2UXD B;  3ZHU A;  3UT5 A;  3SYC A;  4LF5 B;  2FB5 A;  1PL0 A;  3ZN0 A;  2A79 B;  4JI0 O;  4J7J A;  4LR3 A;  2F66 C;  4IHJ A;  4JTA B;  1XIL A;  4ZIB A;  3BFR A;  2HJD A;  2MK3 A;  4DXW A;  3UM7 A;  4OXS A;  3T1Y B;  3JAR B;  3K57 A;  2R9A A;  3CRM A;  2JDI G;  4FLX A;  4EFE A;  3A0R A;  3SPH A;  1Z5W A;  1XL4 A;  5KHJ A;  2F93 B;  1M5I A;  4UFZ A;  1NTM H;  1TGO A;  3APO A;  4IIJ B;  3W7W A;  1RFY A;  3DXR B;  4TUY A;  3SJC C;  1XHZ A;  4DV0 O;  1TVK A;  4CS4 A;  3FAV B;  3RVZ A;  5LMN B;  3ZMV A;  4DR6 O;  5KA6 A;  2QJ1 A;  5GON B;  4B3S O;  5J9P C;  1OCC B;  3QG5 A;  4JYY A;  5IJ9 A;  2QKS A;  3FYI B;  2IU0 A;  1M90 W;  1S5H C;  3OEE G;  2ITD C;  2HEP A;  4JI7 B;  4H37 A;  4LF4 O;  1I0H A;  4QGP A;  4D6T H;  4DUZ O;  3G6E V;  3OE7 G;  3W7X A;  1N34 B;  4LFC O;  3ABL B;  3F5W C;  2KSD A;  4ZOL A;  1AJQ A;  4O2A A;  3J81 N;  2WLM A;  1PM9 A;  1W2B U;  3L75 H;  2QKC A;  2GSM B;  5ITZ B;  2UXC B;  1SA0 A;  4P30 A;  1DTO A;  1R3K C;  2DYR B;  3CCJ V;  2EZO A;  2UXB B;  2WA4 A;  3FB6 C;  2K9P A;  5JH7 A;  1H38 A;  1BQ0 A;  3A0H Z;  3MHS C;  4DV6 O;  2E75 B;  4ZKI A;  2JS3 A;  1B3Q A;  2HG5 C;  3Q4H B;  1QR9 A;  4PJ0 Z;  1FAF A;  1XEQ A;  1VQP V;  4N21 A;  5LXT A;  4FMT A;  5KMG A;  1LUW A;  1Q81 W;  2RDC A;  2Q5Z A;  1KQS U;  4DR2 O;  4B3T B;  4GLX A;  3JD1 A;  2AZ0 A;  2P5O A;  1VF7 A;  3ABK B;  1BGY H;  5KHK A;  5JQG B;  4DV4 B;  1N8R W;  4DV5 B;  4UCR A;  1AP6 A;  3CC4 V;  3PJS K;  2OIE A;  1IBL B;  2Q0A A;  1JJO A;  4B08 A;  2XAS A;  4MVM A;  1GN4 A;  1Y74 B;  1WA8 A;  1K97 A;  4X88 A;  1P84 F;  1H2S B;  1M57 C;  2EIK C;  4PV1 B;  3SYO A;  1JFF A;  1H8E G;  3QTC A;  2JGD A;  4TQF A;  5DED A;  1ORQ C;  3TXQ A;  4O2B A;  2ZKO A;  2IW5 A;  4X66 O;  3VQV A;  1EZV H;  1FFT B;  5CB4 A;  1QBZ A;  4GT1 A;  5AG2 A;  3JAS A;  4EEQ A;  5KUK A;  3HKE A;  2UUB B;  1LR1 A;  1S5J A;  4JZ2 A;  1E1Q G;  1NR1 A;  1WJZ A;  4Z2W A;  3OGC C;  2CDY A;  3G71 V;  1RSO B;  2BSK A;  4X1K A;  1YJW V;  2OIG A;  4MTO A;  4B3R B;  5DEC A;  3P3N A;  1R73 A;  3TGU H;  2FTK A;  1R6N A;  2XAQ A;  5IY5 C;  1OCR C;  4X1I B;  2F23 A;  1M93 A;  2QR4 A;  1N32 B;  3CD6 V;  3JAL B;  5B66 Z;  3FFQ A;  2EBO A;  2B1I A;  1COW G;  5H5N A;  3ICX A;  4B7K A;  3ZHQ A;  1IBK O;  1PPJ H;  1Q3E A;  1QU7 A;  5BMV B;  1S5L Z;  1GTO A;  4I5S A;  3X2Q B;  3E8F A;  5LP6 C;  1VQ6 V;  2QWR B;  3O65 A;  5IDJ A;  3HKD B;  4K35 A;  4PA3 A;  3RYF B;  1QQC A;  2WLN A;  1BCC H;  2KB1 A;  1W59 A;  2OWO A;  1XNQ B;  2R72 A;  3N2K A;  2UXN A;  4J10 A;  5JJN B;  4NB5 A;  5IWA B;  2AXT Z;  1QLE C;  3QO7 A;  3OW2 U;  4I7Z B;  4G2K A;  4E4E A;  3DTU B;  3SPI A;  3AG2 B;  2QDO A;  1OCZ B;  4YY3 B;  5KX5 B;  3QF7 A;  3OTO O;  5LGT A;  4PD4 F;  2ZM6 B;  2VQE B;  4MVS A;  3AK2 A;  4D7S A;  4LF8 O;  2HR3 A;  3OT7 A;  4JGS A;  3CME V;  3BRC A;  2Q7H A;  1QNM A;  3ETG A;  1FXK B;  3BA8 A;  3AG7 A;  2CH7 B;  3ZHR A;  4JI8 O;  5H6Q A;  2BOC C;  1XDC A;  1H2N A;  5EYP B;  5KHG A;  3C3S A;  1YVW A;  3LSS A;  5C93 A;  1M57 B;  4DV7 O;  4FZ0 A;  4AHC A;  1N33 B;  3OR6 C;  1N4C A;  4HZ3 A;  3FKS G;  5FNV A;  1R6K A;  4LWS A;  1FJG B;  4J9Y B;  4JYB A;  2P4V A;  4LNU A;  2NN4 A;  1K4C C;  3K5O A;  4GZR B;  4WFB V;  5FPR A;  3HKB A;  3EVK A;  2LJ2 A;  4LBE C;  3ZRS A;  3KCX A;  1ZSP A;  5BY1 A;  2UXD O;  2WSS G;  4UXN A;  4ASU G;  4JI1 O;  1TUE B;  4EKW A;  1KB9 F;  5HFL A;  3GB7 C;  4Z1V A;  1WP7 A;  4OX9 B;  4ZHQ A;  4N23 A;  1E1R G;  3ZN1 A;  2JEU A;  5J2T A;  1YTF B;  5B1B C;  1VQL V;  3LDE A;  3E8H A;  1SZT A;  1BMF G;  2ZNJ A;  1IZ3 A;  4UVB A;  3I55 V;  5LP6 B;  5LYJ B;  5BR8 O;  3K9S A;  1W0J G;  4K8Z A;  1SRY A;  4XBF A;  2W6J G;  1FXV A;  2HHH O;  2WLI B;  3B2E E;  4B3M B;  3H1K H;  1B06 A;  3F7Y C;  4AI8 A;  2UU9 B;  3U0Z A;  1AR4 A;  1HR0 B;  4JV5 B;  5LBQ A;  3CCV V;  4DV3 B;  2DQ0 A;  2Z0A A;  2HKO A;  2YIC A;  1D5A A;  3MAQ A;  1MZE A;  1NQT A;  2Y69 C;  2EUL A;  3IGA C;  3SJB C;  3JAM N;  1QLE B;  4O4H A;  1UJW B;  4O4L B;  1XBL A;  2Q73 A;  4UV9 A;  5LA6 B;  1YJN V;  2F4V B;  4CH4 A;  3WB0 A;  2KKW A;  4X89 A;  4DR3 B;  1OCO B;  1XRE A;  4I9Q A;  5B3S C;  3B8M A;  3ABM C;  4NXM O;  1S77 D;  1IXM A;  3UO3 A;  2BTQ B;  1R1B A;  4AQY O;  1NJI W;  2FYU H;  5EZY B;  1HNW B;  1N34 O;  5LL6 Y;  1VMG A;  1MOF A;  1QVF U;  2IU3 A;  3SYA A;  5LMU B;  4TV8 B;  3L71 H;  4LF9 B;  4LFB O;  3OFN G;  5FPO A;  5CMU A;  3L70 H;  1P49 A;  4Q6G A;  1NZ6 A;  1L0L H;  2EZP A;  4BIZ A;  1KUQ A;  2YXY A;  5L3D A;  3TCU A;  2UXB O;  4FFB B;  1Q43 A;  3RYC B;  1HNX B;  2WLH A;  3JD0 A;  2QM4 A;  1H2M A;  1GO3 F;  3B77 A;  2GDS A;  5E1A C;  1KBH A;  2Y4T A;  3K0G A;  1XI1 A;  4IHJ B;  4UVC A;  4P2Z A;  3HPL C;  4DUY B;  3UO2 A;  4TV9 A;  2EIM C;  2CTP A;  3KKY A;  1BE3 H;  3C90 A;  1KMI Z;  4GUN A;  4MVU A;  3G6B A;  3KG2 A;  4J7Z A;  4DV5 O;  1YEW A;  1ZL8 A;  3ASN B;  3IFX A;  1KEC A;  1JMK C;  4DR1 B;  5IYZ B;  4TUY B;  3SJQ C;  1M56 C;  1TVK B;  2HVK C;  4X64 O;  3BY6 A;  4D7T A;  1AIL A;  5B1B B;  4KP4 A;  2W0X A;  4U3F H;  1NS1 A;  2YEV B;  2FL4 A;  5EC2 C;  1KU9 A;  1SQB H;  2OTJ V;  2WLL A;  4LC1 A;  2LFR A;  2VWJ A;  2Q6A A;  3CMA V;  2M7W A;  2WA3 A;  5L3F A;  2HLD G;  5JVD B;  5LGN A;  1VF5 B;  2X6A A;  4RO2 A;  4NTY A;  1KD1 W;  3BEH A;  4ZOL B;  5IJ0 A;  2UUC B;  1JVM A;  2Y69 B;  4O4I A;  1IBM O;  3HKC A;  1Q86 W;  2JIZ G;  1PL4 A;  3RFR A;  1K92 A;  4BIU A;  1I08 A;  3VBB A;  4JTC B;  5F2V O;  1MAB G;  1HDJ A;  3W7U A;  3VQW A;  2ATK C;  1ENV A;  5A2Q N;  4ZI7 B;  2QEX V;  1IDS A;  2M6Y A;  4K0K O;  3ABM B;  2P90 A;  3JSN A;  3ASO C;  5H6R A;  1GM7 A;  3LSU A;  5LHI A;  1L1F A;  3CCS V;  2GUZ B;  3SYP A;  2ODM A;  5LXT B;  5KMG B;  3CX5 F;  2ZR2 A;  2HJF C;  1XUQ A;  3ZX6 A;  1BL8 A;  2B9Z A;  1EN6 A;  2JS5 A;  2ZQM A;  4EB6 A;  4GX1 A;  3K03 A;  2ZXW B;  2JRI A;  2P6J A;  1JPX A;  3M99 B;  2ZIO A;  1YCI A;  3JAT A;  4LFA B;  1NR7 A;  4JI4 O;  2Q67 A;  2GBO A;  5D5P A;  1BQZ A;  1VIB A;  4JI6 B;  3CCQ V;  3DGE A;  1Q90 D;  4X1Y A;  2KQX A;  3A0B Z;  4U7O A;  1BSM A;  1K5S A;  4WFE A;  1NH2 D;  4YIP A;  1QCE A;  5EIB D;  4DR7 O;  2EIM B;  1JX9 A;  2P7T C;  1JFF B;  4YXW G;  5J2U B;  2WAM A;  4GX5 A;  1WPB A;  4GKK B;  3JAW B;  5E79 Z;  3OM3 B;  1GMG A;  2GTS A;  4WBN A;  3GWK C;  4PA6 A;  3CPW U;  3WB2 A;  4RQE A;  2LW7 A;  2XTA A;  3HKE B;  1I5Y A;  1M56 B;  1AR1 B;  1VQK V;  5CA1 B;  2DWE C;  1AB3 A;  2XOK G;  3BAA A;  2YC0 A;  1OJH A;  1J5E O;  4J41 A;  3J80 N;  3TET A;  4H44 B;  3D3I A;  1N33 O;  4X1K B;  3T1H O;  4UCU A;  1S3J A;  2P4K A;  1BT8 A;  4IYI A;  4YHH B;  4U3J A;  3ZRX A;  1NT2 B;  1SQG A;  3CC7 V;  1FFX A;  1Q5O A;  4JI2 B;  3JAK A;  1VQ7 V;  2E5L B;  2EX3 A;  4ICG A;  1R3I C;  2LO1 A;  1AI6 A;  5L3G A;  1CXZ B;  5B1N A;  3STZ C;  3K5N A;  3CCM V;  1XMO B;  2EIJ C;  2XAF A;  4NTW A;  2D3O W;  3CP1 A;  3N2K B;  4JYA B;  4Z1M G;  3ASO B;  4HNA A;  2A3Q A;  3OEH G;  4FM2 A;  1V9P A;  3H01 A;  3CC2 V;  4P9P A;  2DOS A;  3CRQ A;  1DLB A;  2AZ2 A;  4FFK A;  1DGS A;  2DW4 A;  2W6I G;  2YS8 A;  1ZUQ A;  3G67 A;  4X65 B;  4JI3 O;  1XMQ O;  3ZBH A;  1D5N A;  1H2G A;  4JV5 O;  1Y76 A;  1S76 D;  4DV3 O;  4JI5 B;  3W7S A;  3OR7 C;  4UB8 Z;  2UUA O;  3LDC A;  1EN5 A;  2QM7 A;  2XAG A;  5TIS Z;  3RWR D;  4IYH A;  4NXN B;  3PN1 A;  4DV1 B;  3ETD A;  2OT5 A;  2PTM A;  1WLE A;  3ETQ A;  1K3E A;  4RAI A;  1PKX A;  4R6Z A;  2YXH A;  4I55 A;  3K5L A;  4QNH B;  4LF6 B;  4DR4 B;  2BOB C;  5JCO A;  2IJI A;  2XAJ A;  3F7V C;  3E83 A;  2IH1 C;  3E8G A;  1XNR B;  5LMU O;  1AP5 A;  1H8H G;  4I50 B;  1XL6 A;  4F4L A;  1N0N A;  1PV0 A;  3JAR A;  4XDJ A;  1BHB A;  1P7G A;  3RYI B;  3HKB B;  2EIN C;  3AK1 A;  1K9M W;  3T2M A;  3W7T A;  2QWO B;  2YID A;  4MSW C;  1HNX O;  1ZTE A;  2VS0 A;  4JYC A;  4DR5 B;  3K08 A;  3CCU V;  2GV9 A;  4UCS A;  4WFG A;  2OCH A;  4QJF B;  4KUM A;  1ZAU A;  2ZT9 B;  2VWK A;  3E35 A;  3OTF A;  1UPG A;  3KCY A;  5B1A C;  3VOU A;  1I94 O;  1SF9 A;  4PDV A;  1JJ2 U;  1X4T A;  1YDX A;  3GWO A;  1P7B A;  3SYQ A;  5L3E A;  1XOU A;  3AEI A;  2Q4P A;  4CH3 A;  2PYJ A;  4DYL A;  1SKV A;  1NKD A;  2NR5 A;  4X8A A;  4TWK A;  2ZIM A;  3J7A U;  2CAZ C;  5ITZ A;  3K3W A;  3CS5 A;  4PI2 A;  1H2L A;  1I7F A;  4KHP B;  2YIB D;  4UVA A;  1AJN A;  5H9C A;  1M4U A;  3T1C A;  3NXS A;  5JWP A;  2DE0 X;  3L73 H;  4K8X A;  3FB5 C;  1PNM A;  5B1O A;  2QGN A;  1SZX A;  3TK1 A;  4I0X B;  4TQD A;  4J42 A;  1H2K A;  4XDL A;  1O9G A;  2IJH A;  2IBZ H;  2PZS A;  1SS3 A;  1WB7 A;  3F5T A;  2ZE5 A;  1R6T A;  1JR9 A;  2QA4 V;  5JQG A;  2EIK B;  4GKJ B;  3P32 A;  5KAF Z;  4UCV A;  1WPX A;  2N04 A;  2YIB A;  5JJE B;  3TXS A;  3C3T A;  1NVP D;  3SPG A;  3JD2 A;  3T4Z A;  4DV0 B;  4QIW F;  1Y74 A;  1JA8 A;  2L35 A;  4DR6 B;  1F7Y A;  1K4D C;  3TJT A;  4B3S B;  3SPJ A;  3D3Q A;  3MD0 A;  1YI2 V;  4TV9 B;  2Y4U A;  1EN4 A;  4LF7 O;  1BHA A;  5CA0 A;  4YJ3 A;  1THZ A;  2AGA A;  3O9O A;  1ZL8 B;  2UXX A;  4DUZ B;  1GM8 A;  3AG4 C;  2CGO A;  2Q68 A;  5IT9 N;  3APQ A;  4LF5 O;  4LFC B;  4HAM A;  2R70 A;  5A9G A;  5IY5 B;  4JAA A;  1OCR B;  4FZ1 A;  3R66 A;  4LH7 A;  5LOV A;  1Q6H A;  4DRX B;  4CH5 A;  3T1Y O;  4X9Q A;  2YIA A;  4UB6 Z;  5B1A B;  1K8A W;  5C8Y A;  2P22 C;  4FLU A;  3KZI Z;  1R3L C;  4FIP C;  4L8J A;  3IAY A;  2WPD G;  1TA8 A;  2RCV A;  2YI9 A;  4TT3 G;  4U7N A;  4PA7 A;  2F1M A;  4F6R B;  5BMV A;  2WLK A;  4O4I B;  4WFH A;  1YHQ V;  5LMN O;  2QWP B;  2NLJ C;  1Q6U A;  2JJ2 G;  2E74 B;  1Q82 W;  1S72 V;  3K59 A;  1ROP A;  2AW9 A;  2R9R B;  3JD4 A;  2DN9 A;  4JI7 O;  4LH6 A;  4B7E A;  3E22 A;  1N36 B;  4YHH O;  3UCS C;  3ZRW A;  5L3B A;  5LHG A;  1YJ9 V;  1QR8 A;  3T4D A;  2EJR A;  4TSF G;  4CS2 A;  2A06 H;  3K0D A;  1XHX A;  3SGI A;  5KLV H;  1US6 A;  4FJC C;  1F4N A;  4JI2 O;  3ZHV A;  1CPY A;  5KX5 A;  3N2G B;  1GH6 A;  1FYJ A;  2Q8V A;  2UXC O;  4EB6 B;  4OGQ B;  3CXC U;  4X66 B;  3JAT B;  2CTW A;  2ZIN A;  1N0J A;  1Q6I A;  1FXK A;  4JYA O;  3UT5 B;  2ILM A;  2B5U A;  3THO A;  1IUR A;  1NTZ H;  4IGG A;  3LNN A;  2X0L A;  3L72 H;  3RYH A;  3N27 A;  2QKA A;  1LUV A;  2RMK B;  3ZS8 C;  3ZMS A;  3RVY A;  1FD9 A;  2QWQ B;  1QVG U;  4B3T O;  2WWW A;  1RPR A;  5JCO C;  1VF6 A;  1KYO F;  4BW9 A;  2H3O A;  4DV4 O;  4WBN B;  2AHY A;  1TUB A;  4J7K A;  2JGU A;  3AG4 B;  1O9H A;  4H0L B;  1WB8 A;  1YTF D;  4UCT A;  4YIO A;  1IBL O;  1ARO P;  2DWD C;  1IBK B;  3LNM B;  3FX7 A;  4GCZ A;  4J9Z B;  1GK9 A;  1J95 A;  2X7R B;  2LFS A;  2ZDI A;  4FK5 C;  5IYB O;  4NXN O;  3EHB B;  3WG7 C;  4BAY A;  5IJ9 B;  4JPR A;  3CJH A;  2FML A;  1XQ8 A;  3WFV A;  1CEZ A;  4H13 B;  4MVQ A;  4ABM A;  1KP3 A;  3UQ8 A;  1SET A;  1VQN V;  1UFI A;  1G1X B;  4JAV A;  4X20 A;  1FFX B;  1T5E A;  1SC5 B;  2UUB O;  4O2A B;  3LUT B;  3UKM A;  3OTO B;  3AK3 A;  5LP6 A;  5LYJ A;  1G6U A;  2PI5 A;  2R9I A;  2WLI A;  3BVO A;  1SA0 B;  4LF8 B;  4J80 A;  4B3R O;  5JH7 B;  1HNZ B;  3ABL C;  4F6E A;  1KKC A;  2GTA A;  5B3S B;  5CBG A;  1N32 O;  2V4D A;  1K73 W;  1Q8I A;  1HW7 A;  1ZWI C;  2LW1 A;  2ITC C;  3RW0 A;  2WLJ A;  4QPK A;  5LA6 A;  5EBL C;  3U11 A;  4DV7 B;  3MHH C;  2ARH A;  4GX2 A;  1V55 C;  2VQF B;  3K04 A;  3QO8 A;  3JYC A;  5BZB A;  4O4J A;  1IVS A;  2ZE7 A;  1XNQ O;  1Y76 B;  1Y4M A;  2D2C B;  1F23 A;  3ZIA G;  3P3P A;  4TV8 A;  2OYQ A;  5IWA O;  1U97 A;  2QSA A;  2V7Q G;  1WA8 B;  2XHB A;  4JZG A;  3B4S A;  2BTO A;  1B6Q A;  1Y66 A;  3ABK C;  1NI8 A;  4YY3 O;  4I55 B;  4BW5 A;  2ZM6 O;  2VQE O;  2PI4 A;  4JI1 B;  4WFA V;  2BE3 A;  2JGD B;  2YSU B;  4O2B B;  1EFR G;  4PDR A;  3E2E A;  1GN2 A;  5GTH Z;  3CXH F;  1QLN A;  2RQ6 A;  5CB4 B;  3CSX A;  3JAS B;  2Q9L A;  3BAB A;  5KHI A;  4DO2 A;  3B8N A;  5BR8 B;  3WG7 B;  1NBM G;  2X6C A;  1PNL A;  1CP9 A;  4LCU C;  4GKJ O;  2HHH B;  5CBH A;  2BSK B;  2YUA A;  2E3C A;  3ZMU A;  1Z2G A;  3SR2 C;  5IYZ A;  2H94 A;  1M9N A;  4MTF A;  2CGN A;  3H9V A;  4XDK A;  2KG7 A;  4YJ2 A;  1FJG O;  3MDS A;  1FKA O;  2YEV A;  1AI5 A;  1A32 A;  1GKF A;  4OPH A;  4W4K A;  4FLT A;  4I4T A;  1Z5V A;  5EK0 A;  1L0N H;  3FB7 C;  3ZED A;  4FLY A;  5IE9 A;  3JCZ A;  5KUM A;  5JVD A;  4NXM B;  4PDM A;  1MSD A;  1SQF A;  4AQY B;  4G27 B;  4MW3 A;  2F95 B;  2DJV A;  3H1L H;  1K34 A;  1WAZ A;  4R50 A;  4OX9 O;  3BCC H;  4FM1 A;  3OMN B;  3X2Q C;  4LFB B;  4R7C A;  3E86 A;  3L9D A;  1P4R A;  4X62 B;  1S0V A;  3D36 A;  1V55 B;  3BA9 A;  4ZI7 A;  3WB1 A;  3OAA G;  3ZHS A;  3G4S V;  4B3M O;  4FM0 A;  2HP8 A;  4P9O A;  2UU9 O;  2P67 A;  2GUZ A;  3K79 A;  1HR0 O;  2PUS A;  3AG2 C;  1OCZ C;  2XUM A;  5EBM C;  4MVR A;  2Y48 A;  2F4V O;  1DF4 A;  4DR3 O;  2DQ3 A;  3I56 V;  3E89 A;  1OHH G;  1I5X A;  4LP8 A;  1N36 O;  1FXK C;  1SQP H;  2GHY A;  5FNV B;  1GRJ A;  1EBO A;  3LDD A;  4LWS B;  2K1E A;  1HNW O;  2W0F C;  4X64 B;  3S3W A;  2XAH A;  5H2F Z;  1JOY A;  5KHH A;  1SQX H;  2JJ1 G;  4CH6 A;  2QM8 A;  1MSW D;  3AG3 C;  1BZK A;  1KKD A;  4LNU B;  4LF9 O;  5J2U A;  1VF6 C;  1YZB A;  3CCR V;  4TOI A;  3CYO A;  3G80 A;  3CB2 A;  5CA0 B;  3JAW A;  4YJ3 B;  2JEX A;  2YI8 A;  4E2L A;  2N05 A;  3H1H H;  2IH3 C;  4PEL A;  4GX0 A;  4MW8 A;  4IIJ A;  2YXL A;  1NVP B;  3DXR A;  4PHZ A;  5HFM A;  3SPC A;  1IBM B;  4ZHQ B;  1NU1 H;  4BIO A;  5CA1 A;  2ZDI C;  1EM1 A;  3FAV A;  5KA5 A;  5LOV B;  5J2T B;  1FXH A;  3RBZ A;  2RN9 A;  2HVJ C;  3DC5 A;  5GON A;  1RP3 B;  3B09 A;  4UV8 A;  4DUY O;  4BWA A;  2DMX A;  1YIJ V;  4G28 B;  2VRZ A;  4Q20 A;  5C8Y B;  2ZNI A;  1MMM A;  5CBF A;  5IYD O;  2E76 B;  4DV2 B;  1YIT V;  1MG1 A;  3ETE A;  4K0K B;  3OD4 A;  3QVN A;  2EIJ B;  2LP7 A;  4H33 A;  4DR1 O;  1GN3 A;  1R3J C;  5L3C A;  4FLZ A;  4WCE V;  4KXR A;  2QE7 G;  2ADQ B;  1F51 A;  3ZJZ A;  5FLX N;  1MNG A;  4O4H B;  4RUE A;  4DK0 A;  2AHZ A;  3OMI B;  3CWB H;  3IC7 A;  5JJJ B;  1ZLZ A;  2RJZ A;  3AG1 C;  4JI4 B;  3CRC A;  3E22 B;  3CCE V;  2RNB A;  4C7U A;  2A0L A;  4FPP A;  3ZRW B;  3ZHT A;  3WU2 Z;  1AI4 A;  3ZCC A;  3Q4H A;  4JI0 B;  3ML0 A;  3QO5 A;  2UUC O;  3DC6 A;  5B5E Z;  2MW2 B;  4CZZ A;  4DR7 B;  1LNQ A;  2EJ7 A;  4IL6 Z;  1BS3 A;  1OCO C;  4HBN A;  3CCL V;  4K3A A;  1FPO A;  1VEW A;  2Y0P A;  1W0K G;  4MTG A;  5CA3 A;  3GVM A;  1IX9 A;  3CE2 A;  5EBW C;  5DM6 V;  3A2F A;  4FVM A;  1Y67 A;  1HNZ O;  1AR5 A;  1NTK H;  4BR6 A;  1QHT A;  4PDL A;  5LHH A;  5GTI Z;  4A5U B;  1VQ8 V;  1L8D A;  1J5E B;  1VQ9 V;  3RYH B;  1WN7 A;  3L74 H;  3AG3 B;  1DF5 A;  1TAE A;  4MVZ A;  5KAI Z;  4RWU A;  3S3X A;  3T1H B;  1Q7Y W;  2EIN B;  3M8A A;  2VQF O;  1PP9 H;  2C2A A;  4RUF A;  2LGQ A;  4LF4 B;  2P06 A;  4WF9 V;  4DK1 A;  1TUB B;  4LFA O;  4QE7 A;  2ZD9 A;  3K06 A;  2DYS C;  2G38 A;  4I50 A;  1HP8 A;  4WFF A;  1IXB A;  5EC1 C;  4JI6 O;  3R65 A;  4DW1 A;  1RM1 C;  2Q0O C;  3RYI A;  3BPZ A;  2X6B A;  2NNU A;  1RSO A;  3ASN C;  3CJH B;  5EIB C;  2WLL B;  2PYL A;  1DK1 A;  1Y6X A;  1MA1 A;  4CC5 A;  1X59 A;  4GKK O;  3FD9 A;  4X1I A;  1SER A;  4CBC A;  1VQ5 V;  4DV6 B;  3JAL A;  3VQY A;  1F4M A;  3JCU Z;  3CRA A;  1FS0 G;  4X20 B;  1GAX A;  3E8B A;  3ZMT A;  3HB3 B;  2QWN B;  5IJ0 B;  2LGW A;  4NTX A;  3BHP A;  3HKC B;  1WNS A;  1AJP A;  4DR2 B;  3HKD A;  3ABT A;  3RYF A;  2Y0I A;  2YDE A;  1M1K W;  4JI3 B;  1XMQ B;  2F43 G;  3AG1 B;  2CE4 A;  3NR7 A;  1EZJ A;  1SES A;  5DN6 G;  4L87 A;  3D8C A;  2UUA B;  2OCC C;  4J11 A;  2JK5 C;  4QE9 A;  1KP2 A;  2EIL C;  1URF A;  3U10 A;  3RT3 C;  2BCC H;  4MTX A;  2E5L O;  5LGU A;  3D36 C;  1HWY A;  5K1P A;  2Q7G A;  2HFE C;  4EFB A;  3A8T A;  1OV9 A;  4O4J B;  1XMO O;  2JVD A;  2Z3Y A;  1VQM V;  4I0X A;  2A9H A;  3RN4 A;  3HR0 A;  2CTQ A;  1WP8 A;  4PA4 A;  3IJ4 A;  1YXB A;  1V54 C;  2CH7 A;  4JTD B;  1PD3 A;  2ZE8 A;  3DSQ A;  3ZRV A;  5EYP A;  4X1Y B;  3H1I H;  4JAU A;  5CN0 A;  4X62 O;  2Q69 A;  2ZXW C;  1VQ4 V;  2CUG A;  1AI7 A;  2PGG A;  1VQO V;  4HYO A;  3OGI B;  4JAS A;  4X65 O;  3RGB A;  3JSL A;  3K58 A;  3CRR A;  4ZBM A;  4JI5 O;  2DYS B;  2O57 A;  2IJK A;  1K33 A;  1K5Q A;  1B04 A;  2Z5U A;  1RM1 B;  4IT5 A;  1YSC A;  4FLV A;  1OZ0 A;  1I94 B;  4DV1 O;  3B40 A;  1VAR A;  4MS2 A;  3CEI A;  4AIL C;  1PNK A;  1NH2 B;  2B1G A;  4KFM A;  5IYC O;  2OTL V;  4MT8 A;  4LF6 O;  1ZX3 A;  4DR4 O;  4JF3 A;  3K9A A;  4QPJ A;  3FYE B;  4NKG B;  3EFF K;  2A7W A;  3I5D A;  3P30 A;  1JCH A;  3LSQ A;  4I9W A;  2L6L A;  4U3J B;  2KG7 B;  4YJ2 B;  1XNR O;  4DRX A;  1SQQ H;  4PI0 A;  4UCO A;  5K1X A;  1OCC C;  2PY5 A;  3JAK B;  2Q7E A;  2V1D A;  2IM9 A;  4I4T B;  2CK3 G;  4MVO A;  3VQX A;  4GYC B;  2QTS A;  3OMA B;  2N74 A;  2PF4 E;  3IC9 A;  1MZF A;  2XND G;  4DR5 O;  1D2D A;  2H8P C;  2ZE6 A;  3M7M X;  2ZCE A;  1GN6 A;  5FL7 G;  4F6R A;  2LQT A;  2QTO A;  3FB8 C;  3OUS A;  3ZMZ A;  5BXZ A;  4JI8 B;  2OCC B; 
#chains in the Genus database with same CATH homology
 1S5L Z;  2AXT Z;  4UB6 Z;  4PJ0 Z;  5E79 Z;  4UB8 Z;  5GTH Z;  5B5E Z;  3KZI Z;  5GTI Z;  5H2F Z;  5TIS Z;  4IL6 Z;  3A0B Z;  5B66 Z;  5KAI Z;  3JCU Z;  3A0H Z;  5KAF Z;  3WU2 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...