5TK4A

Crystal structure of uncharacterized cupredoxin-like domain protein from bacillus anthracis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
91
Chain Sequence
b'PIASAKVIEVELNDDYFNPNVITIPINESTTLLLKNKGKSEHTFTIKKLGIDVVVESGKEKNITVKPKSAGTYELIRYHLLKGMEGKVIVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome B
publication title Crystal Structure of Uncharacterized Cupredoxin-like Domain Protein from Bacillus anthracis
rcsb
source organism Bacillus anthracis str. ames
molecule tags Oxidoreductase
total genus 21
structure length 91
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5tk4A00
2IDTA 1JZHA 2BW5A 3CG8A 4AZUA 1OV8A 1JOIA 3S8FB 2EINB 1JERA 3FYEB 1JZGA 1IBZA 1A65A 2PP8A 4KO5A 3N2JA 2EIKB 4DPAX 1PCSA 2BZCA 2ZONA 1E5YA 3HEIB 4YSPA 3FSAA 1RZQA 4YVNA 3T71A 2YQBA 2H5UA 3FSVA 2WO2B 3OD3A 5B1AB 3SBQA 4KNSA 1BXAA 1X9UA 3KW7A 3AW5A 1I53A 1AS6A 5I5IA 3EH5B 3X1BA 1PZCA 2OCCB 3FQ2A 1AS7A 4KOCA 1JZIA 4RH4A 1J9TA 4G7RB 5ANHA 4Q8BA 3U25A 4NERA 1JZJA 3L45A 1F56A 2GHZA 1AIZA 5FC9A 1KCBA 4EF3A 2GI0A 3NSCA 4YSTA 2PPFA 3PAVA 3QJRB 2HX8A 1L9SA 2PPDA 4E9XA 2PP9A 2XU9A 5I6MA 1SNRA 2XV2A 4QLWA 4YSCA 5B1BB 3NSFA 4JHVA 1RCYA 1QNIA 3H4FA 4Q89A 2QDVA 1TEFA 1ZPUA 4CSPA 2QPDB 3X1GA 3FPYA 1A4AA 4FAAB 5AFAA 2XYBA 3S3BB 1AACA 1JXFA 4GXFA 4HIPA 5B1KA 1MZYA 1V10A 2UX7A 4JKNA 2WSDA 4AI7A 3H4HA 1J5CA 1MDAA 1A4CA 1L9TA 3GDCA 2JXMA 5I6LA 3WG7B 2ZXWB 2VM3A 4E9RA 2YAEA 2DY2A 3GYRA 8PAZA 2X87A 4E9TA 1M56B 2TSAA 4W1TA 2CCWA 1ZV2A 4P5RA 1NWPA 1XMEB 2IAAC 1J5DA 1IUZA 2UX6A 3X1EA 4BXVA 1AZRA 1OCCB 3PAUA 2MTAA 2EILB 5F7AA 3ZX1A 4BDVB 4A66A 1BYPA 4BWWA 2LLNA 1OE1A 1JXDA 2HRHA 3NJGA 4N8UA 3V9CA 1GW0A 3S3CB 1ASQA 5A7EA 1PMYA 2CUAA 4UF7C 1BXVA 1ZDQA 1FFTB 2BP0B 3AG2B 4HALA 4KO6A 1ASPA 1N70A 2ZWNA 2BWDA 1CUOA 1WAEA 1NPNA 2QPEB 3EHBB 3JTBA 1V54B 3KW8A 1NPJA 4BWUA 4YSAA 3ASNB 4AX3A 1ID2A 1GS8A 5EHFA 1DZ0A 3BVDB 2UXGA 4DP8X 2UXVA 3EF4A 4DPBX 3NJHA 3CVBA 4KNTA 3FQYA 3T9WA 2BHFA 4A2GA 1IC0A 2B3IA 3OM3B 1E30A 3NJNA 1KDJA 3FU7B 2CBPA 1SF5A 2MRYA 2FNWA 2IH8A 4M4RB 3ERXA 1AZUA 2BP0A 2GB2A 2FTAA 1OF0A 2HXAA 3FSZA 2WO3B 4DP5X 2OV0A 2UXFA 2VW6A 1QLEB 4DP6X 1SJMA 3FU8A 3H56A 4BXSV 2FQFA 2PCFA 2Y1AA 3T6XA 1A4BA 1OE2A 1E5ZA 2XXFA 3X1NA 2PPCA 3SBRA 2BZ7A 3WI9A 3UAAA 2IWKA 1PZBA 2EIMB 6PAZA 1NINA 3FYIB 2JFCA 3NT0A 4DPCX 4CSZA 1PLCA 5AKRA 2W8CA 3QJUB 3EH3B 4P5SA 4KO9A 4HAKA 3FT0A 1GS7A 6PCYA 4BK5C 1PZAA 1KBWA 3N55A 4GP5B 2XXGA 1SHWA 3IBOA 3NJFA 4F7KA 3IN2A 1IKOP 2PP7A 2VW4A 5B1JC 3TBBA 1UATA 2IDSA 2XLLA 3FU9A 4X4KA 5D4JA 2XV0A 2VN3A 1M9WA 1BXUA 1GR7A 1TEGA 3QJSB 5LDUA 1RZPA 5F7BA 4E9WA 4E9SA 1R1CA 3NJMA 1BQRA 4L0PB 2I85A 1KDIA 4GP4B 1CYXA 4BWTA 5I6PA 5B3SB 1EHKB 4DP1X 3NP4A 1NIEA 2HRGA 4AKPA 3X1FA 1AG6A 2W88A 2HLEB 1WA2X 2RACA 1YLBB 4M3HA 2AANA 3AG4B 1PNCA 1URIA 1PY0A 1BAWA 1W6WA 2FT8A 3AZUA 4KOBA 4E9QA 2BO0A 2PPEA 2P80D 4E9VA 4NAJA 3FS9A 4ZK8A 4YSEA 1ET7A 1CYWA 3WKPA 1SHXA 3V9EA 2DWSA 3C75A 2Q9OA 3NJIA 1NZRA 2OJ1A 5I28A 4GY4A 2PPAA 5I6OA 2DYRB 1SDDB 3CVDA 2UXTA 1ETJA 2NRDA 1NIBA 3OQRA 3WNIA 2GBAA 1ZDSA 1ET5A 4G70B 1PAZA 2IDUA 7PCYA 4F2EA 3CZUB 1WS8A 1JVLA 2XV3A 2Y69B 5D4HA 3GXUB 3QJQB 4QKTA 4G7SB 1QHQA 3QJVB 2VMJA 3T6VA 2QDWA 3ZBMA 1CC3A 3NYKA 1XB8A 2BP8B 5E9NA 4JHUA 3NJKA 2IDFA 2DWTA 2I7OA 2HZHA 1ET8A 1EZLA 3TASA 1CURA 1OOWA 3IEAA 4WTQA 3JT2A 1SF3A 1X9RA 1JVOA 2AZUA 1GYCA 1MG2C 1AZNA 4BDVA 1PF3A 1SDDA 4A2DA 3OMAB 1AR1B 1AAJA 3EH4B 5D4IA 3NP3A 1KCWA 2X88A 1AG0A 2J56A 2FT7A 1IBYA 2YARA 2PCYA 3ZIYA 5B7MA 1J9QA 1W8EA 3IE9A 4NB7A 5TK4A 4KO7A 3S8GB 2BP8A 3UGEA 4DP4X 3S3DB 1NIAA 3NJJA 3PLYA 4YL4A 2YXVA 1J9RA 1DYZA 1TU2A 3UADA 3CDZB 9PCYA 1GY2A 1KV7A 1L9QA 4YVUA 3UAEA 5PAZA 1TKWA 4G7QB 1BQKA 1L9RA 2BWIA 2YAFA 2H47C 2YXWA 3AG1B 1B3IA 2EIJB 1AOZA 2PLTA 3FU7A 3PXLA 1ZIBA 2H3XC 1M57B 1ZIAA 3AY2A 5I5MA 3MBWB 1AS8A 1JXGA 2DV6A 2TSBA 1KGYE 3FSWA 1A8ZA 2VSMB 5I6NA 2I7SA 4A2EA 3DKHA 1NTDA 7PAZA 3D12B 4GP8B 4PCYA 3TU6A 4A2HA 1ILUA 3ABGA 2E86A 3UABA 1A3ZA 4YSQA 4KNUA 4TXVB 2IWFA 4F2FA 1J9SA 1NIFA 3X2QB 2GSMB 3SQRA 3ABMB 2IWEA 1AQ8A 1OCOB 1VLXA 2YAOA 2VM4A 3AG3B 4UANA 2Q5BA 1XB6A 5B7FA 2XUWA 2BW4A 2AZAA 4UAHA 5TK2A 3CDZA 2GC4C 5B1JA 1NWOA 1NICA 2P80A 1KBVA 3DIVA 3FPXA 2ZOOA 1WS7A 2XX1A 2CAKA 4HZ1A 2AFNA 4K9JA 1PLBA 2AVFA 1RKRA 3RYMA 2XX0A 2N0MA 4DP0X 3MX0B 1L9PA 3DTUB 2YAQA 4GYBA 1ILSA 3PAZA 2GIMA 4A2FA 2J55A 5IY5B 3SBPA 4HCFA 3UACA 1KYAA 1FWXA 1BYOA 2IDQA 3T6ZA 1BEXA 1V55B 2IH9A 3OMNB 1MG3C 1GY1A 2CJ3A 1E65A 2GC7C 3G5WA 1HAUA 4W9ZA 4DP7X 2R7EB 2CALA 3ABLB 3T6WA 5I6KA 1HFUA 2JKWA 3QPKA 3WNJA 1WA0X 3PPSA 1ASOA 2FJSA 1L9OA 5I5JA 4AKOA 2FWLB 1E67A 4YSRA 3ZDWA 2J57A 2A3TA 1BQ5A 4AKQA 3OMIB 3FQ1A 1N68A 5I26A 1AZBA 1JZEA 2FQEA 1OE3A 1MZZA 4E9YA 2XWZA 3PCYA 4HHWA 2XVBA 1FA4A 4G72B 1GSKA 1NDTA 2YAPA 4YSOA 4HCIA 1W6LA 2R7EA 4DP2X 3IN0A 2YAMA 3CVCA 1T5KA 4N4YB 2DYSB 1AZCA 3HB3B 1NIDA 2HX7A 3WKQA 4ENZA 3TBCA 1PLAA 1GS6X 2HX9A 3ASOB 4MFHA 1JZFA 4PAZA 4WKXA 2VSKB 5PCYA 4HCGA 4A67A 4YSSA 1SFDA 5B7EA 1AANA 1HAWA 1SFHA 2YAHA 1OCRB 3WIAA 4G71B 4DP9X 3NJLA 4A68A 3ABKB 4HHGA 2FQDA 4YSDA 1PNDA 3NSDA 1ADWA 2FT6A 4YSUA 1OCZB 3BQVA 3NSYA 5AZUA 4FA7B 3QJTB 2QT6A 3QQXA 2B08A 2J5WA 1WA1X 1XB3A 2FQGA 2VW7A 3TA4D
chains in the Genus database with same CATH superfamily
2W9EH 4L2LA 4TSBH 1HCFX 5BO0D 3PIQB 3ARYA 3QG7H 3S8FB 1L9MA 1MFUA 4FQ2L 4ZSOE 1UWGH 4G5AA 2GITA 1KN2H 1HQRA 1MI5A 3ILEA 4BFNA 1FQ9C 4JCMA 4DPAX 2ZONA 1N18A 2B2XL 2P43B 4G8GA 4JFED 4JQIA 5F89A 4AWJC 1A6TA 3T04D 1I85C 2ZKHL 3GI8L 4X8JA 4UILL 2J1ZA 3QUZB 1FC2D 3GPSA 4XO5A 2A4ZA 5EDSA 1FCGA 4O5LL 4AENA 4ZFZB 1BMWA 4LEOA 1WD8A 4FP8L 4HKZB 5BZWB 2A83B 3LH9A 2Y4SA 5GRUL 2BSTA 3D0LB 1A21A 2ZUTA 2DWEB 5D4QA 1H5BC 5ISZB 2WKLA 4H8HA 4BUGA 2BNRA 5GZNA 1IILE 3K71B 1QFWH 4DGUA 2O4EA 1ZOXA 2W1NA 1JWSA 2PPDA 3OZ9H 3MDJA 2CBOA 5I1LA 4OF3A 3W9DA 2XBTA 2IANE 5C9JA 3LNDA 3MOAL 2Y24A 1QNIA 5A6IA 1RUMH 2K6YA 3D09A 1XZWA 5IHZA 1UH4A 3FPYA 5B38A 1NKRA 3RTQB 4L8BB 2BCMA 1S3KL 3ECQA 5EBWA 1DVFC 1N64L 3MLUL 2ATKB 2LV4A 4IIQA 3DBXA 4XNDA 3DHMA 3RIFK 2ZCHL 1AQDA 2CWRA 2UX7A 2I60H 2ITEA 4IGBB 2WSDA 4UV4H 5GS1B 5KZCB 3NIGB 4CC4C 2JXMA 4QTFA 3GMNA 5HHVL 2GPZA 3T2PA 5JIQA 3WCYA 3ZDXE 4XHQA 4WEUD 2TAAA 1FNGA 3SPVB 4M02A 5I1GH 3BP5A 3EJQA 4HEPA 3UTQA 2IAAC 4R7VA 5DURD 4WV1B 1BFVH 4HUWB 3WKNA 1JK8A 3DXAE 4N0CD 3BQUB 1JV2B 4RMBA 3IPBA 4FZEH 4GW4B 3QJOA 3RPIA 4KHTL 3OAWA 3NUKA 2IOIA 3UTTE 3FH7A 3LN4B 4RFNC 5DD0H 4PJXA 2CBTA 2BY2A 4A63A 4AC4A 3VRLE 1NMBL 3LKOA 5HI4C 1SXCA 4MSWA 2CUAA 2XICA 5KYXA 1I8UA 2BP0B 4HALA 3V0GA 4X4ZA 2FWUA 4BHUA 3WFCL 1J8HB 3S2CA 5E6ZA 4PJGA 2X28A 3EHBB 3KJ6L 4NKMB 1I8KA 2I32A 4MXVE 3ZOAA 4JO3L 5I1AB 2F74A 1HSAA 1CGTA 3TBTA 4AX3A 3A6BH 3Q5TA 3MV7E 2BVUA 1RJCA 2XWTB 4X99B 5IB3A 3KLAA 3RP1A 4P5TB 4RX4D 2ADGB 1H0DB 3VXMB 4ZW5A 1INDH 1K2DA 3D52A 4DPBX 2W91A 3CSPA 5B1CA 1CL7H 3IU3A 3GDBA 4P99A 4M00A 4F5CA 3CVBA 3P0VH 4KNTA 3T9WA 1P6AB 2A6DA 2B3IA 4P9HC 4UTAL 1NFDB 3T0EA 4YXKL 3IU4H 3WO4B 2CBPA 1JK9B 3OLGA 4Y16B 3L4UA 5LNDA 5DD3L 3FL7A 4NUGL 3UXFA 3GBMH 2GB2A 4HEME 1RJZB 3VJ6A 4KZDH 2VXVH 4ZW8A 4OCWH 3DI3B 3GSXB 3NG5A 3O3BB 5A16A 4XPBL 2UXFA 2DWXA 4OV5B 1YY9C 1H6UA 5AVTB 1Z2KA 4LVOB 4U0QB 3VFGL 5E6IA 1UWEL 2GSGA 2GIYA 2PCFA 2XWBB 5A2FA 5FO7A 1MJUL 2PXYC 2FH8A 1O7VA 1F3JB 4HULB 3PP4L 4L1DA 5DRZA 5HPMA 2NZ9C 3FFCE 2JJUA 2XQYG 1AZVA 2G2RA 3C5SA 4F1ZA 2FX8H 4HWBH 4OJEH 1CBJA 1FFNB 4HH9A 4BKLA 4F15C 4TRPL 3RU8L 2AERT 3TZVA 3BYYA 2Y0SA 4V2CB 3NCFB 3IETB 2E3VA 3AWFA 4AVHA 3IBOA 1RV6X 2APWA 1XH3A 4WFGD 3IN2A 3VWJC 2MWCA 2PP7A 1RZGA 2VW4A 3CBKB 3U0PB 3PGCB 1RY7B 3SBWA 3ZT5A 2NY5C 1RJLA 4LCCB 4GKZA 4FABH 4FTVA 1SOSA 4NZUH 2ZKXA 3RIFF 2WXLA 5BPPA 5AKVA 3NJMA 3WDHA 1QA9A 1FHNA 4YC2C 3T3PE 2DQCH 1P7QD 3P4LA 4P59L 3ZKND 4AMXA 1YNLH 1H6EA 4NNXA 1E3FA 3A6CH 3B3IA 1T83C 1J0JA 1NCTA 1ZT4B 3N1FC 3DGCR 3QDGA 5T1KB 4PWHA 1MY7A 3WS6C 4DFIA 1IBGL 4I2XA 4X80H 4ONGH 1CFVL 4XO4A 1O75A 4UM9B 4LSVL 2J6EH 3FS9A 3MBEC 5FYJL 2YOAA 4LDOB 1F42A 2X3AA 1FO0L 4EZMA 1EFQA 4O02H 3G5YA 4HIEA 3EJPA 1FO0B 4LLQA 4GY4A 5T3XE 3ECBB 2OLDA 3MRHA 1A4KB 3RPKA 2QKIB 3ARBB 3C60A 2BP3A 2GEEA 3BUYB 1Q94B 2O26U 1C08B 5DK0B 5CD5D 1NIBA 4JE0A 4H8WC 1ZDSA 3BLKA 1NOLA 4FJ6A 4K9EH 4M6OL 1KWGA 5D9SB 4TULH 1BZ9A 3NK4A 1DLHA 3FDWA 1J1XL 5KYYB 1ZK9A 4PJ9A 3W81A 4OQTL 4GS7C 4TQIA 4XN5A 1EAPB 2C3GA 1N2RA 3KPOB 5HHMD 1B2WL 2BNQE 3MLSL 5HHQB 2AMUA 4P46D 3LS5L 1WV7T 3IJHB 1IKFH 4G7VL 4GO6B 3M8OH 5DFVC 4TL4A 2AJXL 5SWSA 5EZOL 3T2NL 1SYVA 1A14H 2IGTA 1P0SE 4QHKJ 1EEQA 4JFYA 8FABA 3SGKC 3ULSB 3F64A 4HF5H 3HFML 1EJ6A 1MVFA 4MAYB 3PXHA 3TO4B 5I0ZA 3ZO9A 3BAYA 3QQ3A 4X9GA 3SODB 4JANA 1TMQA 1U8MB 4L8CB 5FUOH 3V5KA 5DEGB 3ZIYA 2VL5A 5JHAA 3VFSB 3GJFK 2AEOA 1QACA 2WVSA 3HG1B 1FL3A 2CKNA 3R0MA 3S35X 4AIXA 5I1CH 3RWFA 4YUEH 1LP9E 1N8OE 1HJBC 5GISH 3HHRB 3T65A 2J8UB 5BVPL 1IQDB 3KBEA 3LDBC 5F71A 3BZFA 2EDXA 3OQ3B 1PJ9A 3NCJH 4IDJL 2ESVE 4MLIA 5FYLD 5LB1A 5C2BL 1AKJA 5CKGA 2VN6A 4YHNB 3KWXA 3UC0H 2BOCB 4H25B 4Q97A 5JHLA 4G7QB 1ZJBA 3V7AG 2FX7H 1DBML 3LRLA 3GUTB 4NQDB 5E9DA 4IJTA 4ZNEA 2H3XC 2HFFB 5FCUH 5IR1A 1ITBB 4WU5B 4DW2H 3KBHE 3K5RA 4XAKD 3S88L 1VENA 3D9AH 1R24A 4I3SH 4LIQE 3RWHB 1CDJA 2XFXB 3O3DA 1KB9K 3IDYB 3TWYA 5JHMA 3CV5A 1KYDA 4NN7B 2GSMB 1DCEA 1G87A 3ZHDA 5JMRA 5I75C 1T20A 5INCB 3RWIB 4TOYH 2EE0A 3IJEA 4PJDA 4XNUL 1KBVA 1N0XH 3C8DA 3K4ZA 1U36A 2W07A 2YEQA 1T04B 2XJLA 4U3SA 1PIFA 4KUZH 1D7BA 2G2NA 4MD0A 3EOTH 4KK5D 4G8FA 1H3GA 1OGAA 4UINH 3G6JE 5HHOD 1U3HC 4KK6C 3RX8A 2VIRA 2WIIB 4EKJA 2YQ2A 1CB4A 1IM9A 2GC7C 2K70A 1F3DH 3V6BR 2HTKD 1GHFL 1G5AA 1EMTL 3G04B 2VQ1B 5DD1H 5ALBH 1F58L 4BELD 1IL1A 1DVXA 3ARWA 4JX0A 1XF4B 4UOQA 2F19L 5EO0A 5D71H 3GI9H 5HD8D 1WA0X 5EF0A 1YC7A 4RISH 1DBAH 3D3VA 4Q9QL 4IMKC 3KXFD 4PJ8D 1RU9L 4KROC 1L9OA 1BVZA 3DURA 4A38A 3MJ9H 1UXWA 3UTOA 3JWNH 1U8JA 3KM1A 1F41A 2EKSB 4MWFA 2EIDA 5I9QC 2W9DL 5HY9A 4P2QE 2GI7A 4IKJA 5D7IA 4YLQT 2L0DA 3LZNA 2APSA 3ALPA 1Q9LB 4P4KD 3C5ZC 2NQCA 3VFVA 4D2NA 4UIKL 1E9OA 3LPPA 1CFSA 4X4XB 1REIA 1NDMB 3QEUA 1N3NA 4UTCA 2HKHH 2PO6D 3AT9A 1IBHA 3L9EA 4R8WL 3MLPA 4YZWA 4HWNA 4WW2A 3OJ2C 2QHLA 1S7WB 5CCKH 2R51A 4L8DB 5J13B 3RZCA 2EUWA 3NN8A 5DQDL 1LO0L 2WZPD 4XN2A 3HB3B 4L1BA 4FQXD 5TQ2L 3TBCA 3KPPA 1T66C 3UERA 1ORQA 3VRIA 1QW8A 2UZYB 2GITB 4OZHE 1OT1A 1L7TH 3QCUH 5TE4H 4S1RH 3NRFA 5TQ0H 5DUPH 1ADQA 4G8GB 3HJ0A 5F89B 1A6TB 3PGFH 3NJLA 4MNGA 3V79C 1UASA 4B3EA 1CT8B 2ADFL 1OCZB 4WGWB 4AZ8B 5JTWA 1JD7A 1FFQA 4N8CH 5D7SH 5CIPH 4X4YB 5ELIA 4I1RA 1W0VA 1AHWB 4IRZL 2HUHA 4FHBD 2JKNA 1IC4L 1LGVA 1Q0YH 3B9VA 3G6AA 3GO1H 2WLYA 5E6UB 4OFYA 1L3WA 4K5NA 4OLWL 3CG8A 4HFWA 5AB0A 5LVEA 4J3SA 1HSBA 1MREH 1U21A 4PRHE 2YSSB 4K2UH 2J4WH 2VE6B 1FYTE 3MVSA 2DLFL 1JG9A 4M03A 5I1LB 3W9DB 3UBXA 3IJSB 1EHAA 1F4YL 1INQB 4IK7A 1TTBA 1WEJH 3MGOA 4JN2A 5C0AB 2ZF8A 4OUUA 4U6YA 1YEEH 3CBRA 3D87B 4NP4H 3BPCA 2FK9A 5B1AB 3PAYA 3I3BA 2J1YA 4LEEA 1X9UA 1MELA 3KW7A 1HJCA 4IIQB 3DBXB 2J20A 4GXVL 2Y2YA 1TQBC 3V0HA 3VQMA 2VLKD 5D2LA 1PZCA 2N7AA 2IMNA 2D3VA 2X12A 4XVJL 1XBRA 4FNSA 4AEHH 1FNGB 2VMDA 3CFDB 3ULVE 4QYAA 1L3NA 1JZJA 4U6VH 3BP5B 4M6NL 3UTQB 2J5LC 1TNNA 1WGOA 1PJWA 2H32B 5E0FA 5SWZB 1AJ7H 2J1XA 2XN9A 4XBGB 5ILTH 2HX8A 3ETSA 4HGWB 3C08H 5HVGB 1JK8B 2OK0L 4P3CH 3RPIB 4PRIB 5KVDH 3VD1A 4E42A 5K5YA 1Z9NA 2BIIA 4RMQA 4A2MA 1KJ3H 1O7SA 4Y19D 4NCC1 4BQCA 2XY1A 4XBEL 1YAZA 4G2AA 1MUJA 1CDHA 4V1DA 4NM4H 2JCCA 3LKOB 3SQOL 4MSWB 5T3ZE 3F7PC 4LCWA 4A37A 1AHMA 3EO1A 4DQAA 3SDXA 1J5CA 4EN3B 1A4CA 2WD0A 3NPSC 4G6KL 3KLKA 4JEGB 4PJGB 4CVUA 1J8SA 1QVOA 3RDTB 2Z0UA 4CN4A 5A6LA 1DVUA 5JR1L 1SEQH 2F74B 1HSAB 3TBTB 3V6ZA 5AD0B 5EU5A 1X5JA 3D39E 3GZOA 4W9DC 4UT6A 3KLAB 4BXVA 3RWCA 4F58L 1C9SA 3KLLA 3Q43A 2CHNA 2L7UA 3P4OB 3ZX1A 2A6JB 3O0LA 1UB6A 3IU3B 5KSAA 3BC9A 5BCAA 3D69A 1HESA 1I7TB 2A6DB 5E1QA 2R0KL 3V0VB 4PW3A 3WNPA 1MLCA 1GW0A 1M1XB 1G7HA 2OQJA 3WSQL 4ODBD 3WGUB 4HIHB 1UM6L 1WF5A 4FEIA 3AB0C 3ULVC 3N43F 3UPRB 3VJ6B 3K8MA 2BWDA 3QUYD 1NPNA 4N0FB 2R1XB 1XF2A 3FRPG 5A16B 2EH8L 2YR3A 3FH8A 2D7PA 3I3EA 5E6IB 4OLZH 3OAYK 3F84A 1AGDA 2GSGB 2PCFB 3E2HB 4QNPF 2BPBA 1FZMB 2N1TE 5FO7B 3K81A 3VGAC 5GS0H 5JORA 3T09A 2IG2H 5HDOA 2IPTL 3DPDA 3MLTA 4MXWL 1Z1WA 2G2RB 3FQYA 1NLDL 5J6HA 2OR7A 4D3CL 1DJHA 2FX9L 2G2PA 2X70A 4OFQA 3SE3C 4G6ML 4ZS6D 3IYLW 2X1XR 3L48A 4HIIA 2HLFC 2K6WA 1XH3B 3GJEA 1EAJA 3H3BC 3RQ3A 5CLWA 3A4FA 1RZGB 2HXAA 3GJFB 2HVKA 3D0AA 5CILH 1I9RH 5KJ7E 1RJLB 4D0BB 3WDIA 4FTVB 4WI0B 4XN8A 4XB8A 5I71C 1GMIA 4FI6A 5DVLA 3M46A 4JY4A 4OZFB 1A4BA 4ZUSA 1R3IL 5IUSA 3IFPA 2F61A 2BZ7A 2NNAA 2H0JA 3MLRL 5AYQA 3PNRB 3CFNA 1KTLB 3MQIA 4GRLC 3V4UL 1SJXA 2A9NH 4HG4K 1FNAA 3LPGA 4NNXB 4XNBA 1YMME 3B3IB 4XC1H 1RUKL 1I85A 1VGEL 1HH6A 2FEEL 1A6UL 2BHYA 3CXFA 3PUUA 5FA4A 5IVNA 3QDGB 1E4KC 4HJ0D 1PYWA 3ZHKA 1S5IL 1KBWA 3BH9B 1WSST 2WZ6A 3F7YB 1A1OB 5EIIG 1UT1A 3B9KC 4GMSH 5SV3A 2FO1A 4MJIB 1TVDA 3VB9A 4ZDHB 2BHZA 2IMMA 2JTYA 4FMFA 1YPZF 2OMTA 3G5YB 3IKCB 4JG1L 3B6SB 5KVEH 1SOKA 3B8SA 5JPMC 4JKPH 4RA3A 3MRHB 5E2UL 2D0FA 2ZE0A 1U8HA 4M93C 4QOKE 4X0NA 4QGTA 2V2WA 3NP4A 1BQHG 2C4FT 4WZ9A 1DP0A 3HC4L 2EC9U 1HL4A 2R23A 4MQTB 3QO0A 1G7IA 5SX4H 1T2XA 1BZ9B 1HWWA 3CSGA 4OD1L 5DS1A 4AVIA 1DLHB 1TVHA 1YLBB 4H20H 1V3JA 3MLXL 4GRMA 4XNQA 3HI6H 5DUJA 2JI3A 3JTTB 4HC1H 4EIGB 5IHLB 5EU3A 3TF4A 4HSQA 3SYAA 3ETBF 4Q9BA 2BO0A 5E2VH 1DVFA 2BXZA 4N8VG 3GM0A 1CLOH 3K4AA 1ID5I 3MO1B 2XN1A 1C5DB 4NFCA 4QXWA 2ENQA 1KXVC 4AL8H 3FT4B 3L3IA 5IGXL 5SWSB 3KNBB 1UM4H 4QGYA 1AHKA 4JFXA 4ERSH 1CDBA 4N87A 3C75A 2OJ1A 2ZKYA 4CW1B 4EQ2A 4ZX5A 3GMLB 1R0AH 4QRFA 3TX4A 3U6RB 4Z7UE 5EN2A 2ZYHA 4KVNL 4XWGL 4DH2A 5JHDD 2ZUSA 3H9ZA 5CUSH 2FEDC 1OSPL 4G70B 2D7TL 4L9LC 5I30H 5HDLA 1T0NA 3H9SD 1ZVYA 2EDLA 1E8YA 2ALAA 3HLKA 2K4WA 4JN1H 4XMXA 3VXNA 3GIVB 3V5KB 1K8DB 4CA4A 4FLOA 4ODVH 4K07A 2QDWA 3CIQA 2E75C 5IVOA 4HSAC 5I8OL 1NMCC 2ITCA 4JHUA 4NXSA 5DRXA 5AW9B 5TE7L 4LCYA 3MA9H 3TASA 4JW3A 4Q7DA 5HHXL 4XP1L 3MRQB 4K94L 1DFBL 3FQNB 3IEAA 3T65B 5I8KH 3MN8A 4ZOBA 1MLBA 4ZTPH 2MNWA 1GYCA 1YJDL 5JHLL 4HUVA 3H0TA 1IC1A 1AKJB 1E6OH 4PRAB 4OGXH 4XNAA 2IANA 5ERWA 3CVIH 4GQ9H 5T5FA 3WAJA 4XAWH 3U7YH 1M2VA 4PREB 5E8OB 4BA8A 3FN0L 1IGML 5E9DB 2AAAA 3TJEL 4MJ5B 1XH1A 1EZUA 1WBXA 4FXGC 2X88A 4HVBA 3TIEA 4D0DA 4N5ED 5IR1B 5I2IB 3VXTB 1NBZA 2JMRA 3VE0A 4UV7H 5CFAA 5CEZE 1J9QA 1DDHB 2NXZC 4M5YL 3S8GB 3X17A 4HWEL 5LGHH 5GHWL 1JHLL 3O3DB 1URZA 4KI5D 4N24A 4DP4X 3S3DB 4YGAB 3IXAA 4H26B 3ZYZA 2O5NA 3L9BA 4XXWC 5CM1A 4PS7A 2E76C 2DD8H 3BD4A 3CHRA 3KPMB 1ZAGA 3G3LA 3IJEB 2P7TA 2OM5A 4PJDB 4Y4KB 4HS3A 2K9UA 1ITCA 2W07B 3E9UA 5DJ0A 3PQYE 5E00A 1UCBL 1G7JA 4K3JL 5ADOL 4IOSA 1JZ5A 2L04A 4PJCE 3UTTA 2PXYA 1VFAA 4U3SB 5FLUA 1JNNH 1KLGA 4MD0B 5DYOA 5BS0A 3AY2A 1BJ1H 3QZWG 1LK2A 2H8PA 3L7FA 4U0RC 3FSWA 2YC1B 4X9BA 2BXYA 5LAXB 4DQOL 1MRCH 1H3WM 4YR6A 1A8ZA 3GNML 3MRFA 3BDBA 2VIRB 3V6OE 1Y6MR 1JIBA 2NY0D 4FRWA 5CBEA 3EH1A 2EZ0D 5HYQA 1FUNA 4C4UA 1S9XA 2ZTBA 2IAMD 3CBJB 1QNZH 3X2QB 3SQRA 4PY7A 4YDLB 1U2YA 4JHAH 4M9OA 3ZL4L 4O9HH 3RB7A 3HE6C 5F1KC 4P23C 4UNIA 3VWJA 1JDDA 3BVTA 3MV7A 4NOFA 4DKDC 3W3BA 2NSMA 3GK8L 3OB8A 1RZ8A 3T1WA 3D3VB 4F91B 3FAXA 4FFWC 2AFNA 1FNEA 4MVBC 2WQSA 4TUJB 2ZXBA 1WITA 5D5ME 1RKRA 2YQ3A 5HHNA 3W5NA 1UXWB 1Z3GH 2N0MA 5GGRB 4Y9CA 3QPQC 2YUZA 2YAQA 4GYBA 5F0MB 2GK2A 3M7FB 3AM8C 5BQ7A 4AK1A 1AOHA 5AAPA 1WWAX 3V55A 4QPEA 1KGXA 1N59B 1EO7A 2RCSL 2K9FB 2LR4A 4UDUA 1RIVH 1S7QB 5FHBL 1RHHA 3QIUB 1AFVL 1T83A 2BSSA 3VFVB 3WMQA 1T89C 3D25A 1E9OB 4HEMA 4MJJA 5AW6B 1KOAA 2ZPKL 4P4RA 4UWQB 3VNZA 3WS6A 1HAUA 3NEOA 3Q9PA 3TFKD 2Z1PA 3OKLB 3NN8B 1YPZB 1IBDA 1OTTC 2JKWA 3K3QA 3MBEA 5IB5A 4ODHH 3SDCD 3PPSA 3GQFA 2WUCL 3KPPB 5DJ6B 3CFBB 3II1A 3U6XS 2JQAA 3INOA 3VRIB 4ZAKD 4CMHC 4ZMWA 1XSKA 4NC1E 4AKOA 4YSRA 4JZJC 3AAZA 1RZJL 4L4TD 3JV4B 1QI5A 1ADQL 3FFCA 5C7XL 4WFHD 5KSBE 2NCMA 4FYTA 2FRGP 3V6OC 5DUBA 3ARGD 3FQ1A 5JZ7D 3VYNA 4GT7A 5B8CA 5KAQF 4KHXH 2JJTA 2FLMA 4M1DH 3BUBA 5JMOC 3BSGA 2VWEE 3TA3D 2Y7SA 4HPOH 2ED7A 3BEWA 4KI1A 1S7XA 4TVPE 2EIEA 2A0LD 3TNNA 1FE8L 4LNRB 4MMXB 3G6AB 3KS0H 2YAMA 4AGMA 2RQ8A 1DE4A 1TZAA 4E5XB 5L4FA 1QATA 4BZ1H 4BZYA 4HFWB 3VO0A 2VSKB 2HCZX 2OCJA 2CPUA 3OLEA 2Q8BL 2QLVB 4M8QA 4MX7A 2M26A 2JB5H 4Q0XH 1SFDA 4PJEE 3SGKA 2E9JA 1BBDH 1M7UA 2EYSB 1BX2A 1FYHB 3HZVA 3MJWA 1NCCH 3B5TA 3EBAA 3MGOB 3SGJA 2BH0A 3BN3B 1UB5A 4WJKB 3S34L 2B0SL 1G4RA 2Z65C 4L5FE 2FT6A 2VDPL 4KRNA 4Z5RA 3V6FA 5BOZG 2G9HB 1UA7A 2UZIL 4WHCA 3GMPB 3L3JB 2VDPB 43C9A 2P47B 1QUNA 1CR9H 5D2LB 3AJ7A 4NC1C 1JRHL 5J9PA 5KSUA 4WK4B 2H1LM 1T7ZA 5F1IA 5AL8A 2CSPA 3OPZH 4F7EA 1OV8A 4FN0A 3BXNB 4LHJB 4A7TA 5FO2A 4KGLA 4DFHA 4FLSA 1FORL 1IARB 1MJ8L 4KO5A 5EOQH 5FM8A 3PWVB 1ANUA 3EAKA 3ZDZE 1M9SA 4U05A 1T0MA 1HINL 2O5YL 4G8EB 3ESPA 1T6VN 3K2IA 3VWKB 3BD5A 3FSAA 1LWJA 2QADD 3K4DA 2VWEC 3UGXA 2J88H 4TSBL 1WQVT 3GMOB 3M45A 4O4YH 2E47A 2BNQA 2W59A 3QG7L 1YQVH 4F3FA 2CHWA 3O4LD 2Z7YA 3VSQA 1UWGL 4G59C 5A3ID 2JCCB 1PG7W 2Q8AH 4ZMOA 1KN2L 2XWJA 2OMWA 4WDIA 5DHYA 2WW8A 4BRJA 5JO5B 2JNZA 5TGBA 5C0JB 1RP8A 4AYFB 2P8MA 1M4KA 3NK3A 1QVOB 3SOTA 3U25A 4JPVH 2DJ4A 4NERA 4OZ4A 5CHNB 1N19A 3OXRA 4UT6L 2GHZA 4NQEE 2G4GA 3RVUD 4Z0XB 3IM1A 1NFKA 2XNAB 3NSCA 2OYPA 3CN3A 4N25A 1Q0EA 5ICYB 4QRSA 2YLHA 1Q4NX 3RWCB 4KV5F 2IJ0C 5IROC 4LOEA 4Z7IA 3VDAA 5CIPA 1ONQB 1QSEA 2F58H 2F18A 1YEFH 4KH2A 4BK4A 2CO7A 4PVNA 3CX5J 2D7NA 3D69B 2FL5B 4G42A 5AWNH 2NX5B 4CSPA 5HGGS 4FAAB 2QR0A 1ZHBA 4MHHI 3LKRA 2OQJB 5K9JH 1U3HA 4I85A 4TLTA 5IFJA 1LP9A 1HCYA 5F0PB 1V10A 1OPGH 3OZ9L 3LIUA 5K59E 4M3JA 2ODHA 1EVTC 3STLA 4PG2C 4BSWB 4YHZH 2VM3A 1XF2B 3P0YL 2ESVA 1SHSA 4QHNA 5GSVB 4WEBH 4H8QA 1RUML 1IO4C 4X6DE 4FG6C 3N1GC 1AGDB 3MJ8B 5CNHA 3FQUB 4L05A 4NQSA 3MUJA 4OKVA 4CU8A 2WLMA 5KVGL 2HG5A 2I60L 1JF1B 2Z93A 4TTDD 4QEGA 1A1NB 2O61A 2C7UA 4BDVB 1MNNA 1MHCB 2LLNA 2QSCL 3O2WL 4FTDA 4NUPA 1A4JB 2CLZB 1B0IA 1G9MH 1N8ZB 4LVNB 3C5ZA 1GCFA 1BFVL 3B9DA 4UF7C 5FOJA 3K2MC 3HCVB 4EZJA 2ZP8A 3FTGA 3GJEB 1S7UB 5F1SA 4FZEL 2FGWH 4WO0A 1U92A 2NXYC 2DM4A 3BW9B 1P4IH 4HUNB 1JZ6A 5D1QD 1CYGA 3A4AA 4F2MA 1KXQA 2QSQA 4HS6A 3MODH 2MCG1 1QLFA 4HT1H 4ZUSB 4DP8X 2FZ3A 3IFPB 5I6XC 2HKAA 1W8NA 3OTTA 4QRRE 3T3MF 4U1GB 1CBVL 1OKEA 1A7PH 2C9UA 2NNAB 3G6JA 5DHVH 1OL0A 1A64A 4J7RA 5IB4A 3O41B 2XIBA 4XCFH 3SCMC 3VSVA 3K2KA 2XDHA 1E4XH 1KG0A 1NM4A 1KDJA 5FA4B 5C6TH 4BZ2H 5HVHB 3A6BL 1BZQK 4FKKA 5K39B 2YGVA 3ERXA 5JOPE 3VI4A 1INDL 4HWZB 4ZFGH 4WUKH 1A3QA 2JKSA 2CK2A 3MRNB 1CL7L 4KJQD 1RI8A 1QRND 4WI2A 4WO4B 4AGLA 5KANI 4B9IA 2YA0A 3GSVB 2OMTB 4ODWB 4YK4C 2MPAH 2QTEA 2FEJA 3GS4A 4CKQA 4YIQA 1OK0A 3SBRA 1U8HB 2AV7A 4P2QA 2V2WB 3UAAA 4KKLC 3GBML 4KZDL 3GUFA 4ODXA 4JBSA 2G75A 2R23B 3QO0B 4Y9GA 1CGYA 4CSZA 2XQYA 3FFDB 1TVHB 3EH3B 3R1GL 1HHKA 4HISA 1MDTA 3UJIL 4ABUA 4P2RD 2YBGA 4BHUI 4N90E 5EU3B 2NUPA 5L6YH 4DO4A 4Z6AT 1RIUL 3HS0C 4LCVA 1UXLA 4XO3A 2RAMA 2PWDA 3LZPA 2XLLA 3MA7A 3BMVA 4APXA 3RGVC 3SJVE 5DJZA 4N1HB 3KL0A 1AGEA 1ZWIA 3L3IB 4UUJB 15C8H 2FX8L 1T1WA 4OZHA 4JFXB 5CJXA 4Y9FA 5FF6A 3LRGA 2J12B 4L0PB 1EUUA 3BT0A 3BDYL 1RZKH 3QUMH 7CGTA 3PWPD 1NEPA 4FNLH 1PX8A 1HCZA 1UA3A 2YSTA 1AQKH 4UDTB 4FFVC 1NIEA 4FNTA 3STZB 4AUYA 1DQML 5DJAB 2H0FA 1YRKA 1C5CH 3FQXA 3ORJA 5D1ZD 3TV8A 2XN2A 1DJXA 1EHLH 1T0NB 5GJTH 1FH5H 4PJ5E 4RFNB 5MI0B 5E24E 1CXKA 3VXNB 3QO1B 1PY0A 1AD0A 1KIUA 3AZUA 3FONA 4JB9H 2ITCB 5D1XE 3V52H 2OZ4H 3H2PA 4E9VA 1FFPB 4LCYB 4BJLA 3DV6A 3IMTA 4YSEA 3GT6A 1UM5H 4F1SA 2E56A 2XXCB 3LH8A 1YNLL 5KTEH 1N6UA 2YUXA 3PS6A 4PRHA 1J0YA 4RDBA 2QZQA 4IBTA 4KJYA 1FYTA 4AQEA 1GOGA 4HUVB 5I28A 1G43A 3H0TB 4O2EA 5ERWB 2IANB 3UPAA 4G9FE 1U95A 1KIRA 4PGBB 4URTB 3WNIA 3JQOB 2GBAA 4R7XA 2JTDA 4MDJB 1WBXB 3KR3L 2GJRA 3TIEB 2VZUA 1IEBA 3O9WD 1NBZB 2IPUG 2P5WD 2Y69B 4O02L 4FA8A 3VE0B 3F5WB 4YHIB 3UX9B 4O02B 5LHDA 4QR7A 1KPVB 3N41F 3SY0A 3IXAB 5GGUA 4QTIH 4LPXA 1MHEB 3LXBA 1QLRA 4Y2OB 4G1MA 3CFIC 1T4KA 1SF3A 4K9EL 4RGNB 4E2OA 3LQZA 1EXHA 4TULL 3NCBB 3NFPB 2AZUA 1XD1A 2P7TB 2PYEE 5DQ9B 2ZXQA 3T0AA 1X4ZA 2E0PA 4RDQF 5HYSG 5E00B 3CLWA 1G7JB 4DGYH 1ERNA 1JXKA 4NJAH 2X4RB 2YRZA 1VFAB 2ZWZA 3T8XB 1FAIH 3KBPA 1KYOK 4JAMA 1KLGB 3IDXH 5D4IA 5DYOB 1T3FA 5I0YA 5F6HJ 3PABA 3M8OL 5BS0B 5D1XC 2AXWA 3TT1L 4E41B 3CSBA 3RVTD 1ZRUA 1K4CB 4HLZH 4JRFA 3SE3A 4K8RD 5CBEB 3QIBC 1Y0LB 2VZ3A 2ERJC 3ZQWA 4F33A 3IS0X 1XR9B 3JV6A 1JGVL 5KJRL 4HF5L 3GMMA 4PY7B 3K2UL 4YBLB 3TV3H 1K72A 4N8PA 4AE1A 4Z23A 4Q52A 2CGYA 4H1LG 3V4VH 2BSCA 2NY5L 4X2UA 2OTWB 3NZUA 4PPTA 3MV7B 1CTNA 5EC2A 4NAQA 3UZVA 9PCYA 5L2KD 1OWRM 3D39A 3CMGA 3JTSA 5T1LA 3IFNH 1TR7A 5ANME 4WNQA 2BNUB 3N85H 4YHLH 2FSEA 1E40A 2W65A 5FUOL 1FNEB 1MH5B 4HXBH 4WSGA 1JAEA 1AI1H 3TJPA 4AUJA 3KYOA 2O5XH 5AL0A 1L9RA 4K7FA 4QHKI 3VI3F 1FZJA 3K5SA 3GINA 5I1CL 1UFUA 4YUEL 5DCCA 1DQLH 3D2UB 4QWWC 4I48A 5DSCA 5BQ7B 3ARQA 3P40A 1L5GA 3WFEH 3QNYB 3U4BH 5GISL 4OGZA 5C0NC 4UMSA 3TNMA 4JKLA 3U4KA 3CE1A 4DEPB 1RHHB 3KLHD 1NL0H 1G1KA 3D25B 3NCJL 1ETA1 5E94B 5FECA 2F8XC 1TTFA 4NXKA 3APCA 4BH8A 4QHPA 5F70A 1QR4A 3UC0L 3MUY1 4N2IA 1ZLUH 3SYCA 1UZ6F 2FX7L 2JKJA 2YAOA 3S5YA 4KXZI 4BQ8A 2AZAA 4HWUA 4NEHB 5E5RB 3ELAT 3MBEB 3EGXA 5FCUL 3FPXA 4LFHD 1WS7A 1TSRA 4DW2L 1CMOA 2BSED 3D9AL 3L1FA 4HD5A 4JDEA 2VUKA 1FG9C 1ILSA 2V9TA 1BOGA 4NQCE 3OV6A 2Z8VC 3WAKA 4G7YH 3QS2A 3CZKA 3L1OH 2VRKA 5DWUL 1BGXH 5B8CB 3TIDA 2LABA 3B9EA 4TOYL 3SYQA 4P9MH 4R4NC 1DQDH 3HMXA 1N0XL 3MRJA 4FERA 1E42A 4GG6E 3V0WH 2XZZA 1WVZA 3G5WA 3BRDA 1VGKA 3OR7B 2F7RA 3QSKB 1HE7A 5A1AA 4WGKA 3I6KA 3C2AH 4KUZL 2VXQA 2X4SB 4DETA 4YXHH 4J28A 3VI4F 3FU5A 2KPNA 2CHXA 3O4OC 5C08B 3WNJA 1M7DA 1TTAA 2DQEL 4U3CA 5LGYA 1JGEB 1KXVA 2H1PH 5I5JA 3EYFA 4M8QB 2D9QB 3W0WA 3F6JA 5IMLA 3MJGX 2W94A 1DJWA 2XT1B 1N4XH 4UMGA 4EN2A 1ZK5A 3DC0A 2C34A 1YMMA 3IF1A 4XWOD 5GGVH 3S96A 3HZVB 4R2GB 1CPUA 1BX2B 1NOAA 3DARA 4WTWA 5HI3C 4BH7B 1XIWC 3B4NA 4NN6C 5ALBL 1I7RA 5E4EC 4Y2DD 5F93C 4DNLA 2XC8A 1MZZA 2XWZA 5D71L 3GI9L 4L9LA 2XVBA 3I74A 4RISL 4XHJC 5I1HH 3MREA 3V6FB 1GSKA 2VLMD 1AY1H 4HUMB 4PY8J 2OKMA 4HCIA 1NGZA 5D55A 3MJ9L 3QNZB 43C9B 2SODB 1QUNB 5DMJB 3RIKA 2XI9A 4LARH 4DP2X 4R7DA 1GTFA 4K5MA 5KSUB 3OKEA 1D5IH 4LCIH 3L8QA 3QUKB 4DCQB 1PLAA 2HX9A 3DX2A 2JCWA 2IQ9H 1JZFA 3NZHH 4Y5YC 4C56E 2DI8A 4QHMA 4QOKA 4L0YA 1L9NA 5HI5C 3G5XA 4UZGA 4A67A 5JIDA 3O3EA 1WFIA 2AC0A 4EI6A 2VLJD 1GYWA 1T0MB 2HKHL 2YIHA 1XF5A 1HAWA 4F8QA 5CCKL 1P6FA 3CNKA 4G71B 4DP9X 3BWZA 2YXMA 1KXHA 2C26A 4JKWA 4WUUE 4XP4H 4BIKA 3AXLA 4Z7QE 4FXGA 5C0FB 2Z64C 4F3FB 3N41B 1QBMH 4JY6A 4TM9A 4PJAE 3SE8H 2OMWB 2Q76A 2DTML 3CSYB 4WDIB 2J5WA 1L7TL 5TGBB 5G4NA 5TE4L 4S1RL 5F7UA 3RL2B 2WBKA 5DUPL 4ZRGA 1K8IB 4XXWA 1JZHA 4IDLA 5AVQB 4HETA 1E7UA 2OJZH 5DJYB 4Z7UA 3U46A 1KCVL 5I5RA 2PP8A 3QDAA 5LO7A 1LO5A 2C9RA 4MQ7A 3TYGH 4F27A 4NYLA 1ES0B 5MENB 2GJ6B 1FL6A 1ZTMA 2NCEA 1E5YA 1RLWA 2ZICA 2D8KA 5CIPB 1QSEB 1Q0YL 3CZGA 4G42B 3ZR6A 4JM2D 4K5PA 2QR0B 3LKRB 3LSOB 4KBPA 1U3HB 1MREL 5IFJB 3MJ7A 3DPBA 4K2UL 2VLRE 1BOYA 2J4WL 4FMVA 5C0DA 3P3RA 1IE4A 3QI9C 1BVLA 2H7WA 5IMMB 1D5ZB 4G43B 2OCCB 4NSKA 3WTYA 4IBVA 2B16A 4IRSC 2F53E 1WEJL 4YFEA 1CIUA 1WK0A 4HJJH 4TKWA 3ZSSA 3HE6A 4NP9A 3ATDA 3QUXC 3NACL 1ZVSA 4P23A 4LLMA 4RESB 1FH2A 1YN6A 4NP4L 4R5XA 4DKFH 3VI3B 3KPSE 4HOZA 1IQWH 3AWEA 2E9WA 3NMEA 4E9XA 4KROB 3HAEA 1G4MA 5I6MA 1J5HA 2O61B 3D18B 2C7UB 4JHVA 4ZO9A 3AM8A 2Z4QA 3U9UA 3CDFA 4QRPB 4U6VL 3EJYC 4UT9H 4HIPA 1AJ7L 4H5SB 1T89A 4JZNB 5ILTL 2L8AA 4B50A 3FTGB 3H2QA 2VXSL 1X5GA 2NQ3A 5KVDL 2FATH 2YAEA 4NAMA 1KN4H 2B9AA 1JGDA 3PQYA 3QUZD 1AZZC 2NYKA 4F2MB 5CCGE 4K5LA 1R17A 1NWPA 3BUPA 1KJ3L 4PJCA 1SUJA 4HS6B 4ZPVA 1N26A 3RWGB 3UBXI 1KB9J 3NA9H 1TZOA 3CFQA 4WFEE 4JO1H 5F2FA 3PAUA 4ONFH 5AQ0A 2FZ3B 2PUQT 3FUKA 1BMZA 5FO8A 2EILB 5D7LE 1Z3RA 3T5WA 2MPVA 1F6LL 1MFCH 1GTNA 2CO4A 2YUWA 4GT0A 3V6OA 3VMNA 1VFOA 5C0BE 3ARFC 3LRHA 5ISZD 4HD9A 1NAMA 1SEQL 2G9KA 5L0QB 2FJFA 3UBFA 3UMNA 1JGIA 2H6UA 1LEIA 1RFDH 4LCUA 5LGJA 2VXTH 4K3GA 3VI4B 1WAEA 2GJPA 1A66A 1RZIB 3FRPA 5DRWB 4J4PD 5A2CA 3TVMC 3QDMA 5D5MA 2VN4A 1S6NA 3RTQD 4YDVB 4JO5A 4WU7B 5AAMC 4YIQB 1II4E 5CKAA 3D30A 1EV2E 4N2NA 4BFFA 3EFDH 5KZCD 2UXVA 1HEZA 3EF4A 4IGBD 3MRGA 2CGRH 2G75B 5D7JC 4AIZB 1I1AB 4PB9L 2OX5B 3NJNA 1R3LA 3BH8B 3DYPA 3ZK0A 2JJSA 2V33A 3MV11 4OLZL 5C71A 3ARXA 2NY6C 4F9PC 2WQWA 4JFDE 2Q7YB 2NUPB 3WENA 1M7IA 4S0TD 1UXSA 3BQUD 5GS0L 1PQZA 1I7ZA 1GYAA 1GW6A 1HILA 2X4TA 3GLZA 1ZE3C 3MA7B 3O6KH 4KK8D 4APXB 3BVNB 1E6JL 4APQC 1AGEB 1OSZA 4IRJD 3LEXA 3OF6D 3OJVC 3N44B 4PMEA 5FF6B 2XN0A 3PFQA 3FUDA 3NRQA 4L3EE 4MMYB 5C3TA 3LKPA 5KSBA 4ACPA 3WJLC 2J5LB 4QTHA 3ATFA 3X1NA 1FVEA 4N2KA 4ABWA 1PZBA 1DBKL 4LHUB 5IBUB 1NBCA 1J8HD 3BH4A 3O0RL 3EHBD 4DPCX 1YYMH 5CILL 1I9RL 5DWPA 1UFGA 3I50L 1TVBA 4HAKA 3CWGA 3QHZH 1DEDA 1IGCH 1U91B 3W11C 2OULB 2ZX6A 4KRPC 5EF1A 1IGYA 2VYRE 1AD0B 1KIUB 4P5TD 1SHWA 4ELKA 3VXMD 3FXIC 1DANT 1HXYB 2DJUA 3WS3A 5F8QC 5EIIA 4YN3A 2A9NL 5GS3A 4AMWA 1JHTA 2HRPL 1F5WA 4XC1L 3EJRA 4YFLF 5DHVA 3O6FC 1S7RA 1PKQE 4KJYB 1FYTB 2J1KA 3HRZB 3UZEC 4PJEA 3VXRD 4X7EC 3EYOA 4Y16D 1AGBB 4NWTH 3G08A 4FDWA 1TIUA 5FPIA 2FH6A 1U95B 1I8LC 2FYVA 2ADJA 3P4MA 3HBZA 5DU7A 3SO5A 3TJHD 4GMSL 3PJSA 5IROA 1BQHA 4AKPA 3M88A 3SPGA 3P2DA 3DA0A 2RACA 3G9VA 4J1UA 1I8MA 4XO8A 1HU8A 4X5WB 1CXIA 5A2LH 1IEBB 5AW8B 4MJ2A 3UIYA 4AJYV 3DBSA 1FPTH 5KVEL 1BAWA 4QKXB 4QRTA 1SJEB 4WY7H 5LJYH 1L0PA 2WNWA 4LSQH 4M4PA 3K8KA 4P3DA 2OJEB 3FN3A 4N8VA 5ACMA 5GGUB 4BK8A 4PI2A 1QLRB 3ASWA 5JUEL 3LQZB 3E6HB 4PG2A 4DEWA 3QQ4A 5EUOF 4JL2A 3TCXA 4AGPA 5C7ZA 2JJVA 2DH2A 3CD4A 1BEYH 1IM3A 1LO3L 3FHQA 5E2VL 4AT6B 3VGAB 1AD9B 3QHTC 2OXGA 1CLOL 3WE6A 4OLVH 2AGJH 1T3FB 1JZDC 4A7SA 2B5IC 3PABB 4PJFE 1AVAA 2WWKO 3O81A 3QJFB 4ZW7A 1PPIA 1ORSB 3NOIA 1EZSA 3II3A 1UM4L 4GQZA 4G7SB 1XGYL 3VU1A 5E8EA 1YC8A 5DMIH 4J3BA 4NUJA 2P46B 5E9NA 4GAAA 3U9PL 4PG9A 3C8KA 4F33B 4OZGE 4YFDB 3GMMB 3QUMA 3SPJA 4NQEA 5HYEA 3QQDB 5DMGC 1XR8A 5CUSL 5EC2B 2YD8A 5I30L 3AGVA 2W0FA 3D39B 3JTSB 5T1LB 2VMFA 4ISVA 4WNQB 5T1KD 1M42A 3QPXH 3MRMA 4JN1L 2W65B 5LBVA 4ODVL 4G6JH 1B0GA 3KYOB 2IH1B 4UM9D 1KIPA 1S9WA 1N0LA 1FZJB 1MCEA 4HUXB 3UZQA 3A4DA 3B5HA 2E4FA 5H4YA 4QXGH 3MA9L 4G1EA 5DSCB 4L29A 5DMKA 4LLYA 3B2PA 4LP4A 3X11A 2WZ0A 1D6EB 3RUGA 3MRRA 5FYJD 1IBYA 1JSYA 25C8H 3KWWA 3TNMB 4P49A 1DVZA 3CQPA 4M5ZL 4ZTPL 3SCMA 4J3WA 4K71C 3PWJA 5TK4A 1YECL 5FECB 1E6OL 3ARBD 4OGXL 4EI5C 3BKYL 3HC3H 4TVSa 3IXTA 5ALCH 1OP3H 3U7YL 2ZWKA 4D9RD 2ITFA 2C4FU 3ETBJ 3DJSA 4LLDA 3MYZA 5HGHA 3B2VH 1F18A 4HV8A 4X6DA 3VX1A 1J9RA 3OJDA 1XCQB 4ENEC 4B6ZA 4HKJB 2VMEA 2DMHA 4B41A 3MCKA 5JW5B 4PJHF 1HHIB 1I1RA 4ETQA 3FCTB 4RMUA 5LGHL 4JDEB 3Q8EA 1BOGB 4M93B 3V2AR 5DVOA 4CMMA 1AR2A 1ZKAA 2NLJA 4ZUTA 3HMXL 1IGFH 2DD8L 4S1SH 4MJ6A 4WKZA 3TN0B 4EJ1C 5C6PB 2OMZB 3KCWA 4A2HA 1HIMH 1PKOA 5BV7C 3TH2T 3HZMB 3HE7C 3D5OF 4KJWD 5CGTA 1IT9H 3IS1X 3FQRA 2R4SH 4X5XA 3P4NB 3I6KB 4MAYD 2WVVB 2BW4A 3V0FA 3HS0A 4KKBD 3CDZA 2EEBA 4ANKA 1PS3A 4X7DC 5JXEA 1NWOA 1M7DB 5CR1A 4JKKA 3RGVA 5C09B 1MRCL 1WGVA 5GGSA 3TBVA 2WXNA 4DOHB 4QRRA 2O6DA 2X9WA 1PLBA 3W0WB 4FNQA 1TYJA 2F1EA 4DP0X 3HG1D 4NJ9H 2WQVA 3B5GA 5FXCH 3IF1B 5DC4B 2J55A 3SBPA 4JUSA 2EH7L 2OFQA 1QTYT 4O00A 4O9HL 4F9LA 4UNVA 3DMMB 3NDYE 2J3SA 4U2YA 1JFQH 1JNJA 1SJVA 2EC8A 2V7HB 3OMNB 4G6FB 3ATBA 5HDRA 5KSVA 5MERA 4OCSH 3PP3H 3O3UN 4JFEE 1NGZB 1UGKA 5E5MA 3BN9D 1W15A 1RZFH 4NQDD 4HG4J 5ICUA 3ZO0A 1NMCB 1L7IH 4I0PC 1NM9A 3OKEB 4FKEA 4PQXA 4GQQA 4JREB 5F7DB 1RIVL 1XCWA 2AJZA 4PUBH 5H37G 4JFTA 2IXQA 4OJDH 3VFUA 4NO5A 4GRWH 4NKDB 4EI6B 1YUKB 2YUVA 3E7JA 1XZ0A 2QPUA 2V8MA 3O6MH 2Y2WA 4MA8H 5ENWA 5E03A 4AVKA 5B39G 1DCLA 2O1AA 5TPWH 1XVSA 1HK6A 2ZAGA 4ODHL 4AK2A 1S7SB 3ROLA 1QEWB 3FO2A 4O2FB 5DJ8A 4B5ZA 2NXZB 3SJVA 1HOCA 3I85A 3UYPA 3GTNA 4PV8A 5TFSH 5E99H 5CZXD 5J4MA 3D07A 5EUOB 3ZE1F 2XG5B 1GZQA 2Z3FA 3C87A 3U46B 3HBPA 5F97E 3MRPA 2W0KA 4M1DL 1LO5B 5CD3A 2Y7QA 3CN4A 2AHIA 4JPWH 3DRTA 3SGEI 1T22B 4PJ5A 4WVRA 3FOLB 3AS1A 1J48A 4JLRA 1DN0A 1T7WA 5LKNA 5D1XA 1KBKA 3FU6A 3PFUA 4HUCA 3MJ7B 3DPBB 3LOWA 1C7TA 5DO8A 5E95B 2JB5L 5EZLA 5GGTA 5C0DB 4Q0XL 4K3DH 2VW7A 1IGJA 2VUYA 4GIPD 3TA4D 4ANXA 5LQBL 3RX5A 1NCCL 3IBEA 1PZUB 3EZ8A 4LAJH 4X0KB 3S37X 4LLMB 4G9FA 1YN6B 4I3RH 4IKNA 2EIKB 4FNRA 1UD3A 4GI8A 2WB7A 3WJMB 1MJ7H 4BYHA 5E70A 3VXQA 5CEZL 1CR9L 3BWUC 1GGCH 3NZSA 2P28B 4IKIA 4RAUB 2VXUL 4FJZA 1CK0H 3FH5A 2M83A 3A67H 5MEOA 3H3PH 2Q10A 4FCHA 2XVKA 3Q6FA 2X89D 2Z4QB 5D7HA 3MBXH 3W1ZA 4YS4A 3SBQA 2MQ0A 3P9WB 2ETWA 2NT1A 4M7LH 3KYKL 3GTVA 4K55A 1A7RH 5EOQL 2X38A 1JL8A 2H26A 3MKGA 3VFPA 1BBJB 2QQLH 1G0YR 5C97A 2UZPA 1QFUL 1ZT7A 4M9PA 4G8GD 5D96C 2PYEA 3JWOC 1J9TA 3EOYG 2Y7MA 4UAOB 1JGDB 4IQHA 3PQYB 4E0RA 4PJHB 1MSPA 4O4YL 4PJCB 5K1NA 4AQEB 5FW6A 4ZMTA 4FL4C 5BOJA 3KPLA 5L4IA 1QSZA 2KZWA 2Q8AL 5CSBA 1ZLUK 4BFJA 3ZGHA 1TSHA 4N0CC 3WN5C 1DTUA 1NAML 2E9BA 4Q89A 1W80A 4OF0A 1WH0A 3ESNA 1NAMB 5AFAA 5EH1A 1JYVA 1ZS8A 3G5VA 4PLKD 3FOMB 4FQIH 1JXFA 3SDYH 3B7YA 3CUPB 3VXPB 1LEIB 4OLXH 5LWYH 1KBGH 2I5YL 4ZFOA 2MTPA 3GSQA 4Y7OC 4P2CG 1ZANL 4R7NA 1AE6H 4UOW0 5ANMA 2WINB 2F58L 1YEFL 3FRPB 5C0AD 5AWNL 3QDMB 1Z7JA 1QO3B 1CGSH 1IUZA 2UX6A 4DT2A 4WFGE 4CAGA 1JWMA 2DH3A 2XXMB 3X1EA 5ESVB 2R0LH 3V5DA 2VISA 1CO1A 2NY4B 3FT2A 5H35A 1HEZB 4TYUA 1OPGL 5K9OA 1HYRC 5ESAA 1I1FA 5CR8A 3TXAA 5KS9E 4LK4A 1PVHA 1P5UC 4DERA 1KB5A 4KPHH 4LSTH 3HTLX 2WBXA 3IJYB 5SWZD 3QIWA 5B3JF 4K3EH 1U8CB 4Q9CA 1J1PH 4M8VA 1UXSB 4KFZC 1PQZB 4HPYH 2R83A 4NRZA 4D8PA 1ZLDA 4NQVA 4PRID 1FFOB 1HILB 4F7MA 1BSIA 2BP5M 4N85A 4WWKB 2EUVA 3IGAA 1OSZB 2DQUL 3MCG1 3LEXB 3D51A 4N2HA 3O3AA 3WMSA 4LRNH 4JFVA 4Y5YA 1G9ML 2WP3O 1DEEB 3GB7A 1FVEB 4EN3D 5KVMC 4AG4H 3UO1H 2QHRH 4B53A 5INDA 2ATPB 3RDTD 4D0CB 4X4ME 4GG6A 4TVPL 3RBGA 3QJXA 3UTSA 3QXWA 4HT1L 1TF4A 1UD2A 2ZXAA 5TE6H 4GAYA 3WS3B 5IUCA 1A7PL 5EIIB 3ZE1B 4ADGA 1VSCA 3RWDA 4XCFL 4HJ1A 2OI9C 5DHVB 3H56A 5JUEH 5HHME 1E4XL 3CFCH 3H3KA 1M1SA 3L3HB 4GG8A 5HGAA 3KYAA 2Y1AA 4Q2ZB 5C6TL 4BZ2L 2JKXA 3L5XH 4ZXBB 1VRSA 4BFGA 1FVCA 2PPCA 2CXGA 4PS3A 5IIEA 4CSSA 4L5FL 3H1ZA 1YNTA 4PHXA 4ZFGL 3ZKNC 1BQHB 1RL1A 3V8CA 5AKRA 1IAOA 2R0ZH 4LSDA 1I8MB 3VACA 5MEQA 2IDCA 5EIVA 2MPAL 3IJ9A 4AIEA 3KH3A 4F7PA 3ZTNH 1GC1C 1MOEA 4N1EA 2HFEB 2NY1B 4P3DB 3IFLL 3QAQA 4AW7A 2X44D 3FU9A 1IGIH 3HZYB 3D05A 1X6NA 3FT9A 4C56A 3WFDH 1BXUA 4OM0L 5E6SB 2Y1YA 3QQ4B 2AQ3A 3H6JA 3LY6A 3QEHB 5I76A 4FFZA 3U1PA 1I31A 2EDTA 4H0HB 5C86A 5I6PA 1NEUA 5L6YL 1FNLA 1SXNA 4WUUA 5CD5C 3LYRA 2OXGB 5GIRB 3WE6B 3L17A 1JPGA 1WFMA 5FYLE 1MRFL 3OWRA 4FTVD 1FRGH 3IFOB 4X8GA 1ZTXE 1T80A 4PJAA 4PWEA 5I18H 3EJSA 1H15A 2EYTA 2I9TB 4J27A 5LCVA 2EADA 1KIQA 1RZKL 3CDYA 3QUML 4NUJB 1OQOA 2B1OA 2I69A 2H6PB 4FNLL 4JPIA 5HP5A 4N68A 1AQKL 3QUMB 4P46C 1ZLWK 1WFOA 3L5IA 5IBTH 2AITA 4Z3FA 2CDFA 3ZL2A 1XR8B 1C5CL 1UVQA 1N5YH 3WN6A 3I6GA 5GJTL 1FH5L 1NZRA 3WLBA 3QDGD 1SDAB 1UC6A 4FQ1H 1XWVA 1B0GB 5B22A 5FOBB 2KLRA 2NRDA 4B9JA 1KIPB 3P30H 1S9WB 4I4WA 5DGRA 3V52L 3Q2CA 4MJID 5I6XB 3TTYA 4G1EB 2Y36H 3U9WA 3W57A 4Z7WF 3FTZA 3KYNB 5DMKB 4Y1AD 5ID0A 5KTEL 3RUGB 1WZLA 4XPAH 2Q2EB 4QKTA 5CP7A 1KCUH 2DICA 1HVXA 2ZOTA 1QSFB 2GHWB 2AK4D 2LLGA 2NNXA 3QH3A 1N5AB 1T5XA 3IDMA 1W72H 2I7OA 5FEBA 2F53A 4YWGH 4XPHH 1KCRL 1GZPA 3CLEH 5HHOE 4FQQA 3QG6B 1BG9A 1I1YA 3OJDB 1HL9A 4EZKA 3KPSA 3MCKB 3P9LA 4ALAC 1RUQH 3TVMA 1PF3A 1SDDA 1I3UA 5AKSA 5HYSA 4RIRA 5DEJA 3EJZD 4ETQB 3C09B 5AAMA 3L6FA 5ITFA 3HR5A 4LPVA 4RZCB 3EH4B 3LS4L 4QTIL 1YEJL 3KXFE 2J56A 4K7PH 4ZUTB 4MDIB 2PWGA 4MJ6B 3PV6A 3QZWB 4WKZB 5SWSD 1A5FH 2FIKB 3IRCA 5FYKD 4I88A 5IHBA 1RHFA 1J05A 2ROXA 4Z78A 1XDTT 5GGSY 2Y7LA 4DGYL 4F9PA 5GS2H 3F58H 3PJNA 4UQ2A 2UVFA 2YXVA 4MHHG 3T4AC 3IDXL 4H1LA 3CDZB 2B2XH 3KYMA 3QC6X 5I66A 5D7KD 1VFUA 2ZKHH 3GI8H 4APQA 35C8H 3TBVB 1MN4A 2PYFA 2BDNH 4O51B 4O5LH 3Q1SH 1SN2A 2VR6A 4PJIA 3GS7A 5C0BA 5I8EA 3WJLA 2B3RA 1ZIBA 4O58H 5EZJB 3V4VL 2TSBA 4KK5C 2EDHA 4PIBA 4NWUH 5H37H 2CO2A 5F6HI 3IFNL 3V4VB 1IFHH 3TU6A 4JY5L 2A74A 2EDEA 3OHXC 5MERB 3E8UH 4X6FA 3K1DA 1NIFA 5E5MB 5FGCE 2O5XL 1U8OA 2PKDA 5C07B 5TJWK 1P1ZA 1R5VA 1XEUA 1YEWA 5EU6B 2HTKC 1QBLH 1XB6A 1F11B 2E6JA 1DQLL 4F8PA 1T1XB 1BVKA 3OKKB 5DFTA 3WFEL 3ZTJG 2RALA 2B4CC 5AB9A 4XNXH 1XF3A 4QMEA 2JQZA 4YAQA 5HD8C 4I1NB 5L4MA 3H55A 3O6FA 5JNYB 4PJ8C 4MD4B 4QF1B 5CZVH 3VFUB 3UZEA 4RAVB 4AYBA 1L9PA 1XZ0B 5ENWB 1KPRA 4PRNA 2EDNA 1T7YA 1KYAA 1NGQH 3PGDA 5KBLA 1I8LA 3UTPD 1JZ2A 4OFKA 3PL6A 1KZYA 5JW3H 4XP6H 4MJHA 4Y4KD 2IGFH 4JFDA 3DGDA 4P4KC 2X9YA 2YEZB 2ED8A 1L4IA 1VACB 2LTQB 2QVTA 1QFWM 3B2UD 5DJ8B 4FXKC 2AEIT 3GGWA 3NH7H 4PLOB 1AXTH 4L48A 2PO6C 2BVQA 2CALA 3CZLA 3RKDD 1QFOA 4PV8B 3T6WA 3UYPB 4G7YL 1X4YA 4KHTH 2OYMA 3BO8A 3QPKA 1BGXL 2DIAA 1G7PA 4P8QA 4G9DA 12E8H 4Z3TA 1GZQB 3B2DC 2CLRB 4P9ML 3DETD 2ZOWA 1DQDL 4FQXC 4L1LA 4S1DD 1QWNA 2FWLB 2VLKE 4CILA 3MRPB 4HEPG 5E2TH 1TTGA 5DA4A 5LG6A 2VZSA 5CD3B 2Y7QB 1NMBH 3C9NB 5KANG 4CN1A 3DRTB 5DTFB 3UC2A 3ZJAA 3OMIB 1LE5A 2VQUA 1WT5A 2WTPA 2J73A 1AZBA 4NBZB 1OM9A 4Z7VE 1LEGA 4YXHL 3WFCH 4TQHA 3QISA 2FR4B 4LESA 2X7LA 1BF8A 1WWBX 2JIXD 3KJ6H 5GGVY 5C92A 5AVYB 2VKWA 4Q56A 2V8LA 3RJOA 5D1XB 4JO3H 4A7GF 3VD0A 2H1PL 3DSNA 2WWNA 1LO4H 5GGVL 1IGJB 4MZIA 3CSFA 3KJ4C 1PKQA 4H88L 4Y19E 1B4JH 2HX7A 4XB3A 3L81A 3QIUD 3NGBC 2FO8A 1H8LA 4MZ3A 1NGWA 4ACTA 1BIIB 4JFOA 1JF5A 4FQJH 5E08H 4PCSA 1KEGL 1AY1L 2A4EA 3JBG7 3U4AA 5DD3H 3QA3A 4LARL 2E7LC 3EO9H 2HJLA 1MVUA 4RRPM 3F04A 4LCIL 3KDPB 2X1QA 3Q6FB 3QFJA 4NHUA 4XMPH 3Q2WA 1LM8V 2AEWA 3EADA 3NAAL 3VFGH 5IG7A 3QJTB 5AZEH 3INUL 4JFFD 4OGAD 3UMTA 5T1DL 2H26B 2R1WA 2HT3D 1WAAF 3QXAA 2Y9RT 4TUOA 2DQFA 4MYWB 4PY8I 5IM7A 3U79A 1ZT7B 5I23A 4R0LB 4JFZH 5HYIA 1TZHA 4U1IA 2YXFA 4MA7L 2HJFA 3VSUA 3KGRA 1FGNL 4L1SA 5JQIB 1A65A 2EDYA 5K93A 3NFNA 3RU8H 3D0VA 1QBML 5IMKB 2N4IA 4OQ1A 3I9AA 1EXUB 2WWOA 3SE8L 4PJFA 2UZXA 2EVIA 2HPTA 2AXGA 5IT2H 2WO2B 3EUUA 3MGTA 2OJZL 3G5VB 4Z3JA 4QJ3B 3GIZH 4OZGA 4FHJA 1MF2H 4PHZA 2YD6A 4XPTL 1KYOJ 4F24A 3GSQB 3UYRL 1BECA 2VB5A 3FQ2A 1T5WB 4NO0A 4KOCA 1JZIA 2KZBA 4FQHA 4MMZB 4P5KB 4G7RB 4X7CC 5HGBB 4ZFQA 3UBHA 2VZOA 4R7LA 3ARDB 4ZMNA 1MFDL 4ZMXA 4YPJA 1I8IA 3SQBA 3IVKA 2UWEF 3QXTA 5DUMH 3DO4A 3GBEA 2IEPA 3L4WA 2XV2A 2L7EA 3CFTA 4AYDC 3H42H 1KB5L 5ESAB 1I1FB 4E9LA 1JVKA 2A6IA 2XZAH 2ZCZA 3FK3A 3NCXA 1KB5B 4NN6B 4HJJL 3QORA 4W68A 2Y25A 2ZKMX 3QIWB 4JVPA 4DKFL 2FSDA 1S9KC 3WNOA 1GOHA 5E51A 1BM3H 2ICWJ 1XHHA 2KQMA 1D5XB 3GDCA 3VWKD 4YHPA 4D8PB 4WRLA 4F7MB 5IESH 2DY2A 3QUYC 2B7DT 3N50A 4I0PA 1NPUA 4PR5A 4M6OH 1ZV2A 2LW3A 4JGMA 3DLQR 1S7VA 3ZTCC 4A1RA 1KXTA 2WXRA 2EDDA 1NC4A 2X40A 4OQTH 3HOGA 1JCVA 2X1OA 3ISYA 3PP3K 4IJ3C 4UT9L 2A6KA 3GB7B 5EMYA 1B2WH 1EFXA 3MLSH 1MFMA 5ICXB 1WZAA 4A66A 1TQUA 5HTSA 3K6FA 5INDB 1OE1A 1P9MC 4G7VH 1IZJA 4LL9A 2FATL 2D7MA 3FQTA 5F9WB 1KN4L 4ONHA 1K5NB 3BCDA 4ERSL 2FJHB 4ZS6C 4AYSA 1TQWA 3T2NH 3UTSB 3NA9L 4JO1L 3LB6D 1K6QH 4ONFL 1IGTB 4EEEA 1JI1A 5F3FA 4HW6A 3FULA 3SD2A 1NPJA 1MFCL 3OLDA 4LXFA 4KQ0A 3RWDB 4W9LC 2C1PA 2AJSH 2NX5D 2ADYA 1F6AA 1AO7D 3N3EA 5JIKA 3WHE1 4HKXB 3KPRD 4HQQL 2FJUB 2L4OA 3IAQA 1RFDL 2QGBA 3Q01A 4QO1A 1LDSA 5C0RH 3ZW3A 1YNTB 1TKWB 4ZMLA 1X9QA 3NIFF 1JN6A 2ZOUA 1IAOB 2X0UA 5MEQB 4JFEA 1SF5A 4KMLB 3ZL1A 4NLAA 2IOOA 2FNWA 1HHHA 2VDKL 3FTUA 4NC2B 2B1HL 4IDJH 4HJ0C 4F7PB 2OSXA 4XXCC 4YO0B 5JHDE 2VDKB 3EFDL 1UEMA 2FHFA 3SDAA 4W81A 3MNWA 3FSZA 2R0WL 3H9SE 1WPCA 1J87A 1MCFA 2CGRL 3GBDA 4OCXL 3K1KC 3S97C 4N0UE 3FU8A 4X6CF 4LAQH 4UB0L 1NFIA 1TZGL 1ZA6A 4GW5B 5BNXD 1EAOA 4JG9A 1VADB 2V9QA 3S88H 1I4FA 4HCRA 5IJDC 1YHPA 2LAAA 4KKRA 4RFOH 4F7CB 3TC9A 4FF9A 4LEXL 3ENEA 1JPGB 4Z7QB 4M1CD 3O6KL 4OZIF 3HNVH 4Y4FB 4BFOA 1GRWA 1FV1A 2AJ3A 2OP4H 2WXOA 3SYOA 3FT0A 3FNKA 4U1SA 2ENSA 3LIZH 2EVHA 1H15B 2EYTB 4XNUH 3GXDA 3BZ4B 1PZAA 4EIUA 1KIQB 1A6AA 2WMPA 3LHPL 1GGBH 4J6RH 1AXIB 4JPIB 1SVZA 4IOIA 5H2BA 2H41A 3L4CA 4RBPH 2X2YA 4RMRA 4K73A 5KN5B 1TFPA 3LPFA 4HSCX 4N2LA 1YYML 3MXVL 4AC2A 1UVQB 5I74C 4DEUA 4WEEA 4WQOA 4KI5E 3QHZL 1CYXA 1CE6A 1IGCL 3QEQB 2ZNXA 1OQXA 2CO6A 1CXEA 4N2BA 4ZQKB 1TPXB 1UWXH 3ZHNA 1KYUA 1NGXB 1E5UI 5ID0B 3QT2A 4WO4D 3ARSA 3WN5A 1OAYH 4Z7OE 1KTDB 3WUWB 1UH3A 5CP7B 1BA9A 1THAA 5A2AA 3ZZQA 3FO9A 3RRQA 1NDGB 1NCAL 3ECVA 3IDMB 1SM3L 4CNIB 4NIKB 1OT2A 4NOBA 4I1PA 1HHGA 2EXWD 3C6LA 1FIEA 4JDVB 3WTSA 3FTXA 3CZEA 3LXUX 4YDKH 2PR9A 1B4RA 4GRWF 2BIPA 4KAQH 2ZOLB 2EEDA 5BQDA 3A24A 1V3MA 3QE5A 2UWEB 1KY6A 1D2PA 1SDDB 4P3WA 5HYSB 4MASA 4RIRB 2LFEA 4PGEA 3ETTA 3PNWA 3HR5B 4LSQL 4D9QD 1GA2A 1ET5A 3Q13A 2QFPA 4QT5A 1G0DA 4RX4A 1VA9A 4F2EA 4NLHA 4XBPA 1WS8A 1Q0XH 1WFNA 3GHBH 2N7SA 1M71A 3GXUB 4JO4H 3QJVB 1J05B 2CIIA 2X9ZA 3B7SA 4N5EC 3FFOA 5TQ2H 4Z78B 2COQA 1HCVA 1CC3A 5IMOA 1MHHA 4B0MB 5JW4Q 3D85B 1BAFH 2WLIA 4JJOA 4I89A 2XRAH 1BEYL 2IBZX 4KI5C 4UQ2B 2VJ8A 5CMAA 5F9JB 2HSIA 4JQIH 2GG1A 4GLRI 4QY8A 3MLVH 4OLVL 4XCYA 5F7EL 4TPRL 3KYMB 4KXBA 5I66B 2ZXCA 1KPUB 4NGHL 4NKOB 3Q8BA 4C4KT 2ARJQ 1AZNA 1MCQA 3GSRA 4JRXA 3SKOA 2JSFA 5D8JH 1ECZA 4AQ1C 5DMIL 1DANU 1A9EA 5LAPA 3GZKA 4PJIB 3N0PB 5C0BB 3S3SA 5I8EB 1KCWA 1YMHB 4PYGA 3TWCL 5FYJU 3V5HA 4OLWH 5JIHA 4L4TE 3HBGA 4MBOA 1P1VA 4M48L 3S37L 3QPXL 2A74B 4WFHE 5B3NA 2NY0C 1S5HB 5BVJB 2EZ0C 4G6JL 4QYOA 4X6FB 1NIAA 5HYJA 3MACH 2ILLA 1P1ZB 1R5VB 1GPOL 1Q1JH 1YA5A 2IAMC 1Q9OA 4Q6YA 2PNDA 4GO8A 4IMLA 4QXGL 3KH4A 4JO8A 25C8L 1A3LH 1XF3B 4YAQB 3B9AA 1KT2A 3F7LA 3VCLB 1OOAA 4C47A 4IHOA 3BZ5A 5KS9A 3HC3L 1Y07A 1RQ5A 3FU7A 4PRNB 3NIFB 3BAEH 4WNJA 3EGSA 4GXVH 2OMUB 4LASH 2C9XA 1P7QA 4RGND 3PL6B 4XMUA 1YY9D 1QBAA 2BZDA 2AABH 1WRFA 4HLEA 4UI2A 1U58A 4M6NH 2FJGA 2MOVA 1ETZA 4RAHA 3ABMB 1AQ8A 4PRPB 2ZX8A 3D33A 1ED3B 3QVAA 2BVQB 2P26A 3W2DH 1S9YA 2OK0H 5IOPA 4XNMA 1QWHA 4PP2A 3TFKC 2CKBA 5BS0D 2J2ZB 2JLPA 1G7PB 1IGFL 4RGMB 4S1SL 4E41D 2XX1A 1ZLEA 3F12A 4WI8A 4PIRF 1P5VA 3SDCC 2WANA 2F8OA 4K9JA 5A7BA 4QAMB 2BIQA 2KPWA 1HIML 2P5ED 4ZAKC 4TQPA 4BGDA 1AIFA 2LLLA 1C1EH 1J18A 1BD2A 2H3NB 3LZQA 3DTDA 3ESVF 4G80A 4C83A 4EXKA 1DJGA 2G5UA 3SQOH 2G0LA 3HZ3A 1IT9L 4X4MA 2ID5A 5MEPB 3UCQA 2R4SL 4OZIB 2V5YA 5AW5B 1RZ7L 5CS7A 1U2HA 4O2CB 1LEGB 3ARGC 5JZ7C 1C8QA 3MRDA 2DWDA 3Q3GB 2X7LB 3ZHLA 2J25A 3U36A 3LRSA 3OKMB 1MWAA 1PCXA 4FI7A 5I73B 4JHZA 1J9CT 1RK1A 3TA3C 4NJ9L 3VFMB 3MI6A 2WCSA 2Z34A 3AMKA 1PTZA 3D2UD 2A0LC 3C8HA 3D4CA 4J3OG 2YJQA 4M7KH 4HGMA 4P07A 1E8XA 1DJZA 4P46A 3O4LE 4PRDA 1G7LB 4RSVA 2HG0A 5DZVA 3FB5B 3RJDA 2OR8A 1JFQL 1UKSA 4AJVA 3E0GA 1J1OH 1VHPA 4ZFFA 2CRIA 5EU4B 1JTPA 1RZFL 3QA3B 4K3HA 2EUZA 3NIDF 3VXOA 2HJLB 1CICB 1L7IL 1NQBA 1MVUB 1T6BX 3GBNH 1OM3L 2R9HD 4Z77A 3QFJB 4NHUB 2PWHA 2PWEA 1TYEB 3W39B 2EH8H 3E38A 5I8CA 1X5MA 2WJ5A 3D8MA 2FUQA 5ETUB 4PUBL 4QRQA 1W6LA 3FF8A 3LKSA 2GUOA 3QXAB 4HK0A 3O6ML 5EEVA 4MA8L 4ODUA 4GRWB 1T5KA 2IFGA 5FW8A 1SOQA 4NRXA 1TZHB 2WYZA 4U1IB 2HJFB 2F7PA 4MXWH 1CI5A 1NCUA 1TYRA 1SLUA 2CUMA 3BKJH 5IJKC 3CHPA 3D0VB 3IDIA 1VERA 3QULA 2NY3B 2Y5TB 3Q6GH 4PBDA 1JNHA 5IW1B 4CVWA 3EDKA 1YEIH 2AXGB 5TFSL 2C9SA 2DKUA 5E99L 2QADC 2Z31B 4CC1A 5C08D 3MGTB 4XVSH 5KG9A 2LT9A 2GBTA 3FSOA 2EICA 4FA7B 3SKUD 2B08A 4BFIB 4JO2H 5A3IC 1BVOA 1FNSL 2VM9A 3ROOA 2B39A 1R3IH 4JPWL 2Q0ZX 5GXBB 2ATAA 4X7FC 4R2GD 4Z7NB 4FQHB 5JLZA 4YEFA 1SEBA 3V4UH 1BAGA 2G5BB 1HXKA 5IQ7H 1QFWI 3SE9L 1RUKH 4J8RA 1I8IB 3FBQA 3RVUC 5DJXA 1Z9SA 2ZX7A 4LFHG 1XXDC 5HDQH 1B0RA 1XSOA 1S5IH 3BWAB 4HJTA 4YSPA 4FCAA 2WTOA 4K3DL 5D1QE 4B60A 2D31A 1AGFB 1B9KA 1W2KT 2H5UA 3K91A 2X4OA 3FSVA 4MD5A 4U3HA 1U8KA 3T1FA 2GTWB 1KY7A 3QORB 3VD4A 1NC2A 1GIGH 2ALWA 3PWNB 4G6AD 5CGBA 3NDZE 4NNYA 5HHOA 1DSYA 3IMUA 2EAEA 3X1BA 1V05A 1NJ9B 3L7EB 1ZGLP 1MJ7L 5GRXG 1S7TA 3AREA 3WTXA 4K5OA 1F2XK 5FDWB 1GGCL 2DIJA 4RH4A 3AXIA 1Q9KB 3DI2B 1CK0L 3QRGH 3A67L 4PR5B 4YDJA 1S7VB 1KXTB 3MBXL 3MFFB 3KBFA 1FLTX 2WO4A 4OJFH 4QXVA 4MYPA 2X9XA 3X11B 4M7LL 5L9DL 2A6KB 5EBLA 2PP9A 2GSIA 4EVNA 1A7RL 1I9JL 1QRNE 2J1WA 3KXFA 1U8LB 1GL4B 2R2EB 2YPKB 4NM8L 3I2CL 4I77L 4TTDC 3ULUH 4IU2A 5IVXF 2BS71 4ONHB 3BP7B 3BGMB 1FN4A 1KGUA 5IGXH 4KXZH 4EBQH 2ITDA 5EF3A 2P8LB 1LQSR 1M05B 5B1KA 4AXWA 1SLWA 3L9RA 5TH2A 4P4KA 4RFEB 4ZX3A 5MEND 2GJ6D 4PBVC 1L9TA 2AK1H 4JCLA 1LO2H 3DX0A 2DWYA 2YGQA 4FXKA 4JS7A 1HDMA 1QSED 4E9RA 2PO6A 4P2RE 3HUJE 2CCWA 1F6AB 1OSPH 1T2JA 2D7TH 3PJLA 4XC3H 3SSGA 1HE8A 4QJ4B 3HPJB 1G1OA 5D1QC 3Q8AA 2WZPA 3ZYJA 4HXAH 4Y1SA 1O9VA 1XGTA 1IAKB 2MTAA 4FQXA 5GJSH 3SDYL 4QJ5B 1N6VA 4OLXL 4TS6A 1KBGL 2Q6WB 3LZOA 2VERN 1FIGL 4QO1B 1D5BA 1X5ZA 4AIOA 5I8OH 4EUPA 4R26L 1AE6L 5HDBF 4ECNA 1H8OA 2CBQA 1DFBH 4NDMA 4XRCB 3PWPE 5IOKA 1S78C 3ZTDC 3APNA 1OARH 3IB4A 4W9EC 4DF9A 4N2OA 1HHHB 4OIFA 5JHLH 1SMDA 3K74B 4KO6A 2X4NB 3SDAB 1E43A 1IAIM 1UJ3A 2ZUQC 3FN0H 2EO9A 1IGMH 2FYYA 2IC2A 5DD6B 1AXSB 1QQDB 4KJQC 4QRPD 1JDAA 1ZA6B 4BKTC 4HCRL 4MNHB 4LLVA 1J1PL 1VDGA 3NIDB 4L9DA 3NJHA 4HPYL 1N67A 1GGTA 2XPGB 2BHFA 4A2GA 5I15H 3AQDA 4AYID 3OM3B 4JDTH 4WWNA 3TEWA 1HNYA 2MHAB 1SN5A 4U1SB 1XH2A 2XACC 1OAKH 2MRYA 3LKQA 2BRRH 1LD9A 1X7TA 5E5UB 2VDQL 1ML0A 1ZHKB 1A6AB 1L6ZA 1PSKH 2FTAA 2WMPB 3V0EA 1BPVA 4LPCA 1UCBH 3NCMA 3ML8A 4K3JH 1JS4A 4IOIB 1A7OH 3VGDA 1K4DA 2Z92B 4AG4L 2P5WE 3UO1L 1Y18B 3JWOL 2KBGA 5F7YC 4YNYA 4U1HB 5CN1A 2VLKA 2XBZA 1NUNB 2BMKB 3S8WA 2V0AA 1J8RA 4KVPA 3QHFH 3DIFB 5DVKA 3GNMH 2XXFA 4HUKB 2P1YA 5F7LB 5JIMA 1JBJA 4Z7VA 2ICEB 2NW3A 2CO6B 3WFZA 5TE6L 2BERA 3VAEA 3MJ6A 2AQQA 4AH2A 5J5EA 2VH5H 3ILQD 3WN5B 5SWQA 5D1ZC 1EBAA 3FRUA 1JMZA