5TK4A

Crystal structure of uncharacterized cupredoxin-like domain protein from bacillus anthracis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
91
Chain Sequence
PIASAKVIEVELNDDYFNPNVITIPINESTTLLLKNKGKSEHTFTIKKLGIDVVVESGKEKNITVKPKSAGTYELIRYHLLKGMEGKVIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Uncharacterized Cupredoxin-like Domain Protein from Bacillus anthracis
rcsb
source organism Bacillus anthracis str. ames
molecule tags Oxidoreductase
molecule keywords Cytochrome B
total genus 21
structure length 91
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5tk4A00
5PCYA 3C75A 2XV0A 4G7RB 2FQGA 3NSCA 4DPCX 1JXGA 5I6PA 1F56A 1TKWA 2H3XC 4KOCA 3QQXA 3SQRA 3OM3B 1GR7A 3OQRA 1PF3A 5F7BA 6PCYA 4YVNA 1T5KA 3MX0B 1MZYA 1OCOB 2VSMB 1X9UA 2PP7A 1AQ8A 4E9XA 5I5IA 3H56A 1ZPUA 2EIMB 2PPCA 1BQ5A 2VSKB 3FSWA 1AZRA 2FT7A 1AZBA 1ZIBA 2QDWA 1NPJA 1E5YA 4YSEA 1ZDQA 1J9TA 3AZUA 2OV0A 3GDCA 1ILSA 1OCCB 4E9SA 1B3IA 2OCCB 3NJJA 1MZZA 4G70B 1KV7A 3TA4D 3HEIB 5D4JA 1AG6A 1N70A 1URIA 1NWOA 3T6VA 4PCYA 4L0PB 1PLBA 1RZQA 4EF3A 4A66A 1ADWA 1SDDB 2DV6A 1BXAA 1FFTB 4GP5B 1CYWA 4DP0X 2PCFA 1BQKA 1A4AA 1W8EA 1GY2A 2ZXWB 2FWLB 2YARA 1I53A 2XV3A 3S3BB 2VM4A 5D4HA 5TK2A 4NB7A 4ENZA 1WA2X 1ZV2A 2PCYA 3V9CA 3UGEA 1NTDA 2XV2A 2I85A 4HCGA 2GC7C 1JVLA 4HHWA 1JZIA 3WKPA 3CDZB 1AG0A 1PLAA 2GHZA 3CDZA 1L9TA 4M4RB 4G7SB 2XYBA 1PNCA 4E9VA 4HALA 4BK5C 5I6NA 4GP8B 3BVDB 2CJ3A 4N8UA 3FU8A 4KNUA 1M56B 1NIEA 4E9RA 3CVBA 1X9RA 4BDVA 4AKPA 1AIZA 3FPXA 3QJUB 5EHFA 1AZCA 1XB6A 2IWKA 3NJFA 2PPEA 3ABMB 5I5JA 4DPAX 3GYRA 2VN3A 4DP5X 1FA4A 2JXMA 3N55A 1OCZB 5ANHA 3QJSB 2BP0A 1JZHA 4A67A 4FAAB 2OJ1A 3ABGA 3WI9A 1CYXA 2PP8A 2BW4A 1ASOA 1WAEA 2YQBA 1V54B 3NP4A 1E67A 1XMEB 3CVCA 3PAUA 3L45A 3PLYA 4AKOA 2VW7A 2YAPA 3SBRA 2J5WA 5B7EA 1V10A 1IUZA 2N0MA 3NP3A 1JERA 2I7OA 3AW5A 1KBVA 1GS7A 2GSMB 4AKQA 2R7EB 3FQ1A 4A2GA 5TK4A 4W9ZA 3N2JA 4P5RA 4A2HA 3U25A 1RCYA 5D4IA 2EIJB 2UX6A 4DP9X 1ZIAA 4WTQA 3S3CB 5B1JA 4GYBA 4BWUA 1AR1B 2W88A 2YAHA 1NICA 1SDDA 4A2FA 4YL4A 1NPNA 1HFUA 3IE9A 4YVUA 3UABA 1GS6X 2IDQA 2Y1AA 4HCFA 5A7EA 3KW8A 2X87A 3ZDWA 1TEFA 2BP8B 4UANA 2DY2A 2HXAA 3AG1B 3ASOB 1L9PA 2YXVA 1KBWA 1L9QA 3AG4B 4YSSA 1OE1A 1EZLA 2VM3A 4GY4A 4N4YB 3T6ZA 2XLLA 4YSPA 2WO3B 2AZUA 2DYSB 2IDUA 3AG2B 2FJSA 4ZK8A 1JOIA 2HX9A 4JHUA 2PLTA 4KO9A 2EINB 3CZUB 1A4BA 1MDAA 2CAKA 1JXDA 1ET5A 1OF0A 5B7MA 1L9RA 7PCYA 2GB2A 4HIPA 1CC3A 5I26A 2IWFA 2HRGA 3IEAA 3NYKA 4GP4B 1E65A 1AAJA 2IH8A 3OMNB 3V9EA 2DWTA 4WKXA 2A3TA 4YSTA 1DZ0A 4CSZA 3OD3A 3QJRB 1SJMA 4RH4A 3DIVA 1RKRA 3EH5B 3X1BA 4GXFA 1PZCA 2UXGA 3X1EA 2EILB 2ZONA 1PMYA 2VW4A 3FQYA 3CG8A 1JZEA 1W6WA 2NRDA 4KNSA 2VMJA 1CURA 2AANA 3WNIA 4YSUA 2QDVA 1SHXA 4E9YA 3FU7B 1JZGA 4YSOA 2UXVA 3QPKA 3FYEB 4BXSV 2HX8A 2GI0A 3T71A 4E9QA 3EH4B 1ASQA 5IY5B 1A4CA 1JVOA 1TEGA 2XXFA 2BW5A 4KO5A 1IKOP 2J56A 3EF4A 3FSZA 2J57A 4X4KA 1CUOA 1BAWA 2DYRB 4K9JA 3NSYA 3ABLB 2BO0A 1PLCA 4KO6A 1E30A 3WKQA 1YLBB 3FU9A 5B1BB 2UX7A 3SBPA 5AFAA 2QT6A 4AZUA 4KO7A 3WIAA 1AZUA 2FQFA 2TSBA 2HLEB 3UADA 1AACA 3NJGA 3SBQA 1EHKB 4JKNA 1KYAA 3NJHA 4TXVB 2Q5BA 2YAFA 1PZBA 1SNRA 1ZDSA 3X1FA 2BZCA 1JZFA 2LLNA 4W1TA 2CCWA 2YAMA 1PCSA 2JKWA 2AFNA 3H4HA 1ET7A 2XUWA 3X1GA 2HX7A 1A8ZA 4Q8BA 3S3DB 1PY0A 1FWXA 4BWTA 3S8FB 4HHGA 1OCRB 1NDTA 2UXFA 4G7QB 3PPSA 1PAZA 1BYOA 1KDJA 5B1JC 1ILUA 1XB8A 3WG7B 2I7SA 3ZX1A 2PP9A 2ZWNA 5PAZA 2HRHA 3FU7A 1KDIA 2FT8A 2XU9A 1BEXA 4F2EA 2EIKB 1N68A 2H47C 4YSAA 4YSCA 4DP4X 1WA1X 5B1KA 2MRYA 3NJIA 4KNTA 1SFHA 2CUAA 8PAZA 2XX0A 1A65A 1PNDA 2GBAA 3FPYA 1L9OA 1HAUA 3FQ2A 4G71B 3ZIYA 2FTAA 2P80A 3PAVA 4UF7C 4QKTA 2Q9OA 1BXUA 2B08A 4JHVA 2B3IA 5I6LA 3ABKB 4A2EA 2R7EA 3DTUB 2IAAC 2IH9A 1SF5A 3WNJA 2AVFA 2BWDA 2FT6A 4DP1X 5FC9A 2FQEA 3IN0A 4DPBX 2IWEA 2Y69B 2YAOA 1SHWA 1VLXA 3UAEA 1IBYA 2CALA 2UXTA 1NIAA 3T6XA 2MTAA 2H5UA 1GYCA 1SFDA 1NIDA 3QJTB 3JTBA 2AZAA 3CVDA 1A3ZA 4HAKA 1MG2C 5E9NA 2QPEB 2YXWA 3NJKA 1J5CA 1J9QA 1BYPA 3BQVA 4P5SA 4A68A 5I5MA 3TASA 3NSDA 3FSVA 1AS7A 3AY2A 1JXFA 1ETJA 4YSRA 2CBPA 1QNIA 1RZPA 3ERXA 1J9SA 1OOWA 2ZOOA 1QHQA 3MBWB 1PZAA 3QJVB 4DP7X 3UAAA 1NIBA 2BWIA 2JFCA 1AS6A 1AS8A 3RYMA 1DYZA 2GC4C 1UATA 3KW7A 3NJMA 2HZHA 1JZJA 4MFHA 1IBZA 3NSFA 2VW6A 3QJQB 4YSQA 4YSDA 3PAZA 5B1AB 1BXVA 4F7KA 5B3SB 4DP2X 4KOBA 2YAEA 3EH3B 2XX1A 4HCIA 1AOZA 2PPAA 4A2DA 4E9TA 4QLWA 1R1CA 4AX3A 2TSAA 9PCYA 2XXGA 2BZ7A 3IBOA 4F2FA 3T9WA 1KCWA 1V55B 1WS8A 1ID2A 1ET8A 2E86A 3PCYA 3S8GB 1IC0A 2X88A 1OE2A 3AG3B 3FSAA 3ZBMA 1HAWA 4CSPA 4NAJA 2XWZA 1QLEB 2FNWA 4PAZA 3TBCA 3NJLA 4BWWA 1MG3C 2PPDA 1NWPA 3OMAB 3G5WA 5B7FA 1AZNA 2IDSA 2WO2B 4UAHA 3GXUB 2RACA 3NT0A 5F7AA 5I6OA 2BP8A 4HZ1A 3IN2A 4G72B 3X2QB 5I6KA 1SF3A 1GS8A 1WA0X 3T6WA 1WS7A 1TU2A 5LDUA 5I28A 2QPDB 4DP6X 1OE3A 5I6MA 1L9SA 1BQRA 4Q89A 3HB3B 2XVBA 4FA7B 2FQDA 3X1NA 1NINA 3DKHA 4NERA 4E9WA 2W8CA 1GW0A 1GSKA 5AKRA 2WSDA 3NJNA 1NZRA 4BXVA 1AANA 1E5ZA 2BP0B 1J9RA 2IDTA 2PPFA 3TU6A 1M57B 2YAQA 2DWSA 1M9WA 3OMIB 1OV8A 2BHFA 3FS9A 3EHBB 5AZUA 3D12B 6PAZA 2GIMA 4M3HA 1KCBA 1NIFA 1KGYE 2J55A 3FT0A 3TBBA 1GY1A 1W6LA 1ASPA 1J5DA 3FYIB 3H4FA 3ASNB 4AI7A 7PAZA 4BDVB 3PXLA 2P80D 1XB3A 2IDFA 4DP8X 3JT2A 3UACA
chains in the Genus database with same CATH superfamily
1KTLB 3FFCE 3MRLA 4ZAKD 4ONFH 1G7HA 2RR3A 5HPOA 3WJMB 4I88A 3KLLA 4MSWA 2ICWB 1F56A 3INUH 4X6FB 1D9KD 2Z35B 3IJ8A 1UD5A 5SWSD 3REVA 3IXAA 1GYVA 4N0YL 4LFHG 3MA9L 5E5RB 4DGWC 4PGCB 2H32H 1BOGA 2I9LB 4S1QL 2FJGB 1UH3A 1EEYA 5GJTL 3OHXB 3H7BB 1WBZB 1N64H 4PJFF 3CFJA 4Z1PA 2FZ3A 3HC3H 4XCEB 2EIMB 1BQ5A 4O2CB 1CLZL 1IC4H 4BGDA 3PXHA 1CDHA 4PBDA 1OANA 3TO4A 1Q1JH 1IEAB 2HFEA 3BISA 4BE6A 4YSEA 1SXBA 1TO4A 2CJUH 3ZU8A 5JHLH 3UDWA 3ARUA 1KENL 1S7WB 1A0QL 4NWUL 5T3ZE 2ZE0A 2E9GA 2PXYA 1OAYH 5IW6B 1IEBB 1MZZA 1BFSA 1NBVH 1S7SB 5I1LA 1URIA 5DD3H 4F9PA 2OJZL 3T6VA 3O0LA 1CD9B 4EZMA 3MV9D 3LSOA 4IKNA 1ACYL 3SE8H 3QRGH 5AVUB 1RH8A 4HH9B 4APQB 1VADA 3MNVB 2XWBA 3V4PB 3X12B 2EXSA 2OMYB 1UENA 1A4AA 2XXCB 3FCUB 5TPWL 3BQUB 3LHPH 3LRMA 1G7PB 3QWOB 4JW3A 3I84A 1KJVB 1M6OB 4XOAA 2HFGH 4BHUI 3K6OA 4XGZA 2NY3D 2F58L 4LLAA 4YBQD 4UNIA 1RIUH 2Z8VC 1GAFL 4LBAA 3O6LL 2EDHA 4P5KB 1UZ6F 3L3JB 4XN2A 1NPUA 1N0XH 1MJUL 1T2JA 2GPZA 4K7FB 2BVPB 2YRBA 4PJ6A 2NTSP 4G7SB 2XWTA 4HEMA 3VAEA 1C8QA 5F9JA 2CU9A 4MB4A 1Q94A 1QPPA 1X5ZA 1NGYB 1E9OB 4GIOA 1B0IA 4KKCC 3GKWL 2QPFA 1I8AA 1NIEA 4E9RA 3CVHH 2SEBA 1J18A 1WG3A 1OQXA 5JQHC 4LAJH 5DVMA 3MJGX 3UBHA 3CLFH 4N2GA 3ULSB 4TLSA 1HCVA 7FABL 1SEQH 4Z7NE 4FQXA 5EG6C 4HUCA 3FFOA 1IX2A 1MCFA 3QEUB 4M02A 1FN4A 1VKXA 1QBBA 1NOFA 5KSBF 1VGKB 2BS9A 1OCZB 3TN0B 2VLRD 5AAWC 4XPTL 1JHKH 2A6IB 4K8RD 1QBLH 4LU5H 3N44F 3ABGA 3QI9C 4Q4IA 4DH2A 4PRPD 4AJVA 2IXQB 3FUMA 5K9KA 4JG1H 4QGYA 3PLYA 3TPUA 2R23A 4Z7WA 2UY7A 1BCIA 2DQCL 5IV2B 2Y06H 1KBVA 4XX1E 2E6QA 1WIPA 1RXLA 3E2HC 5KS9B 2JKTM 4A2GA 3ARBA 4KUCF 2PO6C 1V3KA 2JKRM 4L4VA 4W9ZA 5TK4A 1HHHA 1RCYA 4OZHB 1DQVA 4NQDA 4GBXA 1I7ZA 1NICA 1ZVSA 5HDBE 4HH9A 1MJ8H 5D2NE 3U0TB 1CU4L 2DMKA 4XMKH 1A14H 2D0HA 1FFOB 3T65A 2W60A 2E9WA 2NYZA 4L48A 4WKZA 2EC8A 5A7EA 1A64A 3IKKA 1MLCA 4TL4A 3ZDWA 3ELQA 2BP8B 3QORC 2DL2A 2HXAA 3K72B 3PWJA 3B8YA 2WSKA 1JGIA 1T1ZB 4FXLA 2DLTA 3HS0B 3T8XB 1KOAA 1F58H 3WEMA 3DARA 1BWMA 1S5HB 4MXWH 4MWFA 3W1ZA 2J8UF 4K3JL 5AZ2H 3DOHA 3GBNH 4FNLL 2OW6A 2WXHA 4ETQA 2AC0A 3RUGA 5FGSA 1CG9A 1L0XA 2WSPA 5CD5D 3AY4C 2PLTA 5K9QI 3QAZC 2J43A 4JPIB 3KGSA 1A4BA 1DJXA 5KANI 1BP3B 2DQIH 4L3CA 5DEGA 4NN7B 2CLRA 2DBLL 4NC2B 4ZFFB 2LQRA 4JRXA 3WTVA 1H19A 5GSVB 5KBKA 2H26A 3Q8AA 1VFBA 4F7CB 4Y9FA 1H3PH 1QW8A 2XWCA 1WYJA 3MNDA 3D4CA 1F41A 2IPTL 4CA4A 3JWNH 2Z91A 3DGDA 4MMXA 5IUSA 4OCWH 4Z7OE 2HH0L 1OAUL 1NCWH 1YEFH 3K0YA 4ICWA 4K94L 3WKYA 4PU2A 4GXFA 1KN4H 4CVZA 2ARWA 3N04A 4NZJA 2BDNH 3Q6FB 4GO8A 4N68A 3LH9A 4S0SD 2WNKA 4KNSA 3WNIA 1JGEA 1HWGB 2ODIA 3W2DH 1Q90A 1OB1A 5IHUH 2XBTA 3RUGF 3KXFD 4C58B 4KRMB 5A2CA 5FYLD 4NHUB 5IB3A 3EOTH 4N87A 5IY5B 4A55A 1INQA 2X6VA 2WLLA 1TEGA 2HWZL 5MEND 1J0KA 1YN7B 3VFSB 2BXYA 1EJOL 2F54B 3LPPA 1RP8A 5DGRA 2FECL 4QIRA 2R0WL 4R9HA 4Y1SA 1SEQL 1PLCA 4ZO9A 4M7KL 3WTUA 1UUNA 3K5RA 3BDYL 1LK3H 4KRNA 4MX7A 4PM1A 1KFAH 1JV2B 1IGJA 4YPGA 2OYKA 4FDWA 1FV1B 1LP9B 2F7RA 3MYZA 3BIKB 3WS6C 1P69B 1CF1A 2BCMA 4JKNA 4XTRC 2W9DH 4IS6A 3B83A 3BUYA 3RHWK 2Q5BA 1AI1L 3PP3H 2YAFA 3LDBC 1ZK5A 1HHIB 4I9XA 4HIXL 2MMXA 1P4LA 1T6WA 5BV7H 3H9YA 4PJGA 3N6YA 4ABQA 5I1HL 4PH8A 5F6HJ 3UO1L 3QXAA 2FX7L 3JWNE 1RZIB 2ZKXA 4IRJA 1COBA 4TQEH 5F1NA 1IAKB 1OP3H 3PPSA 4WO0A 5F21B 1CXFA 1G9NL 2F1EA 4JL1A 1H15B 1SPDA 6CGTA 4ILDA 4JPWL 4B9JA 5GGQH 1MWAB 2D03H 3IJ7A 3FN3A 1N5AA 2PP9A 3EW3B 5T5FH 2OSWA 2YGVA 2QTVA 1IGIH 1BZ7A 2FT8A 3FTYA 3MLXH 1Q1PA 1UOVA 3D52A 5F93C 5HI5D 4YDIL 5TF0A 4ZMPA 1WA1X 3H55A 3OKYA 4OJYA 1UM4H 2AEQH 2W38A 3GO1L 2VXSL 4O02A 2VDQH 2XX0A 4U6YA 4W9GC 1DBAL 1PNDA 3IFPB 3TA3A 1HH6B 3F01A 4JO2H 1ORQA 2NW2B 2R1WB 4N86A 1NCNA 1UGNA 2QHLA 1GGBL 2A77H 2Q2EB 1XR8A 2P5WB 1LO3L 3FH5A 3PDGA 1DQTA 3GJFH 2FQEA 3BD5A 2R1YB 1MQKL 2CLZB 2PYFA 2XKNB 2YPVH 4R7XA 5CJOH 2YAOA 5E7FA 1SOSA 2VOTA 4Q2ZB 4F7TB 2VLKA 3BAJA 3VQ2C 3T6XA 4RGND 1ZSDB 3DURA 3TL5A 2O4EA 1T0PB 2B14A 1ZLDA 5D1QC 3SOTA 3PU7A 4X4MA 2XV6B 4HFWA 3V6OC 1WRFA 1YEWA 4PUBL 3MBEB 3T0WA 4BFBD 3MNZB 5CN3A 2JCCE 1AQDA 3KPMB 3ARFC 2W9EL 2CDFB 4KTEH 5D2LB 1GGBH 1PKQE 2KS0A 2MFNA 3KL0A 5DQJB 3ARGA 2JKSA 4Z3TA 3VW3L 3I50H 1QFWL 2IH3B 1N7MH 1JHTB 3MCKA 5FAAA 1FDLH 3RVTD 1YDPA 4KI5F 4F8NA 1OOWA 5I18L 1QHQA 2P49B 1C9SA 2ZUSA 2YSSA 1CDBA 1PZAA 2D3VA 4WSKA 5MHSD 3VFRB 4DP7X 1NKGA 4ZFZA 4UU9A 4UB0H 4Z7UE 3DI3B 1KJ2B 5EUOA 1CZ8L 1AS8A 1IQWH 1NGZB 2DKMA 4UQCA 1G6RA 3VCLB 4HPOL 1VCAA 3PS6A 4JZJA 4BSWB 3K3QA 3FUDA 5GSVA 4Z77B 4MD4B 4AV5A 1OAKL 4S0TD 3ZKXB 2DMBA 3NCYS 1MW2A 1WEJL 3PNRB 1JBJA 2OTWA 4UV7H 2MNUA 5HYJA 5LDSA 1YN6A 2B39A 5BMFH 1P1VA 1J8HA 2UWEA 2Z1KA 3KPRA 4KJQC 2K9UA 4HBCL 4OLUH 5DYFA 3UTZA 5I19L 5I76B 3ZE1F 1MFEL 5I0XA 2CGYA 3A4EA 4JCWA 5F1IA 2K1MA 3V6OA 4RDQG 4PJDA 2E86A 2WKOF 2WO4A 4OH2A 5HVGB 3G5ZB 3F85A 1KIQA 2BVUA 2PUQT 4KK9C 4APQC 2ENYA 1HAWA 4LEOB 4M4PA 3RWIB 1LO4H 5IBUG 3BPLC 4H44C 3BP6B 2BVOA 2ARJQ 1PZ2A 2LT9A 2W60B 3F7QA 4KHTL 4TV3A 4E5XA 2FD6L 4XMXA 3UJTL 3NZHH 3V4VH 3Q5OA 3VSVA 5IUCA 2ZXCA 1EZVX 1XCXA 4HZ1A 5KSAA 1OW0A 3IN2A 3NCJL 2E4FA 4IKIA 1SF3A 4R97B 5LNGA 4JFZH 4BH7A 3T6WA 1JTPA 1TOXA 2XA8L 2L7UA 2D7TL 4HJGB 4PCKA 5JHDA 1T89C 4KBPA 2HTLD 5GRYA 5KS9A 3S4SG 3HB3B 5T3ZL 3CHRA 1TJGL 3B9EA 4B53A 5IV2A 3MGAA 1B0GA 3H0TA 1TVHB 1A3RH 2PW2B 4FNSA 4BSVA 1RJYB 4U1IB 4D0DB 1IQDA 4J8QA 5J5EA 1U91A 4ODXA 1R3JA 3DYMA 4ELME 1X5AA 3B2XA 4APXB 3PUUA 1J9RA 2IDTA 5JUEH 5EULV 3TN0A 2EUZA 5MP6L 2PWDA 4PRID 2HFFA 4KU1A 3VFPB 2NQDA 5HHXL 3ZTCC 3TBVB 1RPUA 3SKMA 5I74B 5CEXB 4X7EC 3HZVA 4KAQH 2NTFB 3T77A 3HI6L 1R47A 1NC4A 1U58B 5EU3A 2CR3A 3D9AH 4UBDC 4BA0A 5EDSA 3RL2A 1LO3H 1PPIA 1A7PL 4OBRA 1OARL 5DS8A 4NO0A 4XRCA 5DD5H 3RX5A 3TX4A 2Q3ZA 4PRHA 5HHMD 2EUXA 1KJMA 2VISB 2DQEH 5ANMA 3DJZA 3W9DA 3F04A 1MWAH 4QHKJ 1MPAL 4K5LA 4P5KA 5HDLA 3H85A 5AW1B 1HC1A 3CQQA 1AR1C 5CNHA 1IC4L 3BEWB 4AYDC 3ATDA 3JTTA 1M6OA 2ITDB 3LZOA 4GIAA 4B3VA 3LS5L 4N5EC 3QWOA 5CFHA 1R9FA 5LAPA 3CNKA 4R4FH 3MOQA 2HT2D 1EFXB 4UZUA 2Y07L 3PQYB 5FYKL 1OTTD 5CR8A 3RURA 2P8MB 3FBKA 4K71B 3GZKA 2BOBB 3Q8FA 2FT7A 1E27A 4JY6A 5CJQL 4J8RB 2A9CA 5A2AA 1MRCH 3B6SA 4HU2A 3CXHK 3GD1C 4JDVB 4OI7A 4AE1A 1NL0L 3RBSA 1H0DB 1ILSA 3ZDYF 4HJJL 3DVGA 4GMTH 1UWGH 2GUOA 2BLFA 2JJSA 3ELAT 3TN0D 4RFOH 2HKAA 4G70B 3DOSB 2F6AA 2PXYB 4TNWF 4L8DB 3ETBJ 4KDVA 1YMME 5ALBL 5D1ZD 3V4UL 4ZDHA 2VXQA 1E9QB 2Z7UA 1PU0A 4ZODA 1Z9NA 4A66A 1NFDB 4RMVA 4U6VL 1I31A 2ZCHL 2J5LC 1A4KA 4KX9A 2GITA 5FECB 4N0UB 4AEIL 2PR4L 3GXFA 2JCCA 4PD4J 1ES0A 3CFTA 1XGQB 3AUVA 2KPWA 1DBMH 1VJSA 1CDIA 2ED6A 3G5XB 4PPTA 4RGOL 2CKBB 1I82A 3QC5X 4MJID 1UM6H 4A7TA 3CSTA 3IXAB 3UX9B 4XHJC 3TYFA 2AABL 2QSQA 1J1PH 1MRFH 2HVJA 2HCZX 3SPHA 4L8CB 2KI6A 1JUFB 3IMVA 1NQBA 1U92A 2VDLB 1G7HB 3CPLA 2AVGA 3T8VA 4P2RA 1T1WB 5JYLA 5IT2L 2J1YA 2FRGP 1NGPL 1IVTA 3GMPB 2GFBA 2OI9B 3LAFA 3MLUH 3OKEB 4K9EH 3QIWB 2ITCB 4WHYG 3MACL 5DJDB 5E9DB 2NSQA 3OAUL 1Z5HA 2CO7B 5EU4A 1SDYA 3QJUB 2ADGA 3WIHA 5KAQF 4FQHA 3FULA 3RNQB 4QRTB 2BCKB 4S0HA 2R27A 5D1ZI 1DN0B 4JJ5A 4PJEF 4ZTEA 2NR6C 2JXMA 1RIHH 4WWOA 4K9EC 2G0KA 3RB5A 4D8PA 4GMSL 2FEDC 4OZIE 5C08B 4AYGA 1X5XA 3M88A 4PGDA 3DYOA 1LMKA 1UQSA 3B3IA 4RGNE 1NUFA 2VJ8A 1DFBL 2FJFA 5FO8B 5I24A 5C07A 2XN9E 1U95B 5B7EA 3GMMA 1U30A 1F4XH 3JYBA 3VTAA 1WO2A 1RJLB 2PWEA 4HKBB 4X7SH 4N0FB 3AUWB 5DJ2B 3TIEA 2VR4A 4CN1A 2XY1A 4R4ND 5DS2A 4DPRA 4PJFA 4WTZG 3L9RB 3RY5A 3ULUC 2GJ6D 4KXCA 4P5MA 3FFCA 1AGDA 1WFIA 3HI1A 1IFHH 3U9UA 2PXYD 2PTTB 4U4BA 4HDIA 3KPPB 4GKNA 1VFAA 2W59A 1RV6X 3OAZK 4HH8A 4MJIB 4X8JA 1TZGH 1CBVL 1BXXA 1U8QA 1V3JA 1KLUB 3C5SA 3FCTA 4JFFA 3W57A 4ZX6A 4F2MB 4LEXL 4N2NA 4RZCB 1YEGH 4Q0XH 1D6EB 3CH1A 5I0ZA 4GW4B 1YNKH 2BSRB 2KBGA 4YAQA 4W81A 4LPWA 3LPFA 1C5CH 1E28A 3X3GH 3DPDA 2EDKA 3BKJL 4QAWA 1E9PA 5F7MC 1S9VA 4ALAC 3PG2A 3BFQG 4G6KH 3PWVB 2BHZA 4XNXH 3L5WA 4PTUB 1CFQA 4ICXA 4DVRL 4M43L 5FX3A 4IDLA 4DJMA 4HJEA 4Y2OA 1MF2L 4FFVC 1O9WA 4XNBA 2R69L 5ECGA 2EUVA 4HQQL 2IPTH 4FQ2L 4LVHB 3BZFB 1W9XA 1EO5A 4WFFE 3NIFB 3QS2A 4WEBH 1NFDE 4WV1A 5EA0L 4EUPH 4C56B 4HHAB 4KUZH 1GXEA 2ZWLT 3FF7A 3OMNB 3BQUC 1CFSA 4O2EA 3CFKB 2DWTA 4GXVH 4L23A 4XB8A 2ZCZA 5GRUL 4YSTA 1CXEA 4ONFL 1OP5H 1B3JA 3BAIA 4J28A 3QI9B 3NIGB 2ITEA 4NT6A 3RWDB 3CHXA 4IRSD 4LVNB 2NNAB 1EHXA 1MUJB 3PWUB 5GGRA 5TFSH 2CGRL 2X2IA 4KVPA 5HGGS 3RY6A 3B2MA 3UTSA 5F3BB 4FHBD 4P2RD 1JZEA 2ZUXA 3EJPA 3HC0A 1FHGA 3BX7C 3EBGA 4IOSD 4PYHA 1B6DA 1RUAL 4BKSC 2GTWA 3W81A 2KUTA 1KCVL 1N8ZB 3AU1B 3AU0A 5LXGL 1GW6A 1BD2D 4MB1A 4JQIH 4X4ZA 5BO1H 2IOMA 1K4DA 5ETUB 4BV1A 3L5HA 3NTCH 1BZ9A 3PIQA 4MAZA 2M1KA 5DC2A 3RPKA 1DCLA 2ZG3A 4KAQL 1KGXA 5F9OH 5C3LD 4WDIA 5A3ID 4WW2A 1YMMD 1YMMA 4MAYC 1X5KA 4WU7A 5K1VA 1W0WB 3Q5YA 4F8PA 4GXUN 2ZNWA 5L88H 2WGXA 3VXPA 2CXGA 5T1LD 3H53A 3W37A 3ROLA 3HHMA 5DK3A 2QADD 4Y2DD 4NENA 3LTVA 3DX7B 5CM1A 4OF0A 4NM8L 1ACYH 2OQJA 4UDUA 1XWVA 2P47B 5CIPB 1RERA 3JV6A 3TFKC 1LEIA 4UQ3A 4DKFL 2IFFH 2XG4A 1BF2A 3INUL 5JPMA 2WB1A 2PO6B 2E7LA 3CC5A 4GKSA 3WY1A 1BQSA 4R84A 4GKLA 5D7LD 5FS5A 4ODTL 4CVXA 1S9WB 1A9EA 1JGUL 4OFQA 1QRND 1OTSC 5EBLA 3FO0L 1O0VA 3CC1A 2GW5A 1RQ5A 4WWKD 3ARPA 1INDL 3HC3L 4RMSA 4MXVF 1H3VA 4JZJC 4RNRB 2A9AA 5CU5A 4P4RB 1UWGL 3EJJX 4OR1A 2BIHA 4H25A 3GSNH 1KXTB 2LGNA 3G6AA 4JQXC 4FQJL 5CJXA 3PL6A 3ZT5A 3F7YA 1HOCA 4LHUG 1NCGA 5BZXA 3J27A 3A4AA 5JDJA 4FJZA 2YD0A 5HJDA 3MCLH 3O3DB 3QP3A 4NKDA 1V05A 2ENPA 3ARQA 1AP2B 1Z9LA 5FFGA 4NFDA 4XMLH 5AUMB 1DQDL 4OGXL 4Y88A 1VFOA 3QO1B 3FRPG 3PAVA 1ZAGA 4YR6B 1FL3B 2ZYSA 4QXGL 4M8RA 2Y5QA 2OMVA 2DQFA 2ZXAA 4M8UA 4FFZH 3MRDB 3RZCB 5C0CD 4XH2B 3G6DH 2ORBL 1WFJA 5I8KL 3D18B 2IIJA 1F18A 4J3TA 1SFDA 4UT9H 2D8KA 1U41A 3QCTL 4WTZA 1MCDA 3WN6A 3UYPB 1YYML 2X7LB 3IK2A 2WQWA 4MRBA 5FYKU 2NW3B 2P8PB 5HHPB 1J5CA 1LEGB 2ZOKA 1I7TB 3JTSA 1DBBH 4JKKA 4WY7L 5GHWH 2IAMB 5C8JB 2LTQB 4HCRA 4AYBA 4YMPA 4AH2A 1AZZC 3ZE2F 3TEZA 2YA2A 3OXSA 2CBTA 2R4RL 3R06B 4F8TA 3O81A 1OGAB 1GGIH 2DQGH 2X1XR 3FQTB 3SODB 4X7DC 5DVOA 3I9GH 1FYHB 1TZHB 2Q3AA 3FQNB 3UAAA 4NN5C 3HG2A 3S88L 4MJ4A 2HLFC 4UV7L 2OP4L 1CQKA 1MFAH 3FMGH 5ABAA 3DX8B 1LMIA 1JZJA 2X9WA 2WNWA 5ECJE 3LJ3A 3PABB 3LNGA 1BXVA 3D3VB 4Q14A 4F7KA 1TQVA 3FAXA 3CXFA 1NBZA 4L8BA 4TSCH 3DVNB 2F5BL 3LB6D 3EH3B 2DPKA 3LIZL 4XPTH 4KXDA 1JVKA 1G9MH 5H37H 1OGAD 4LPUA 1FVDB 2AEPL 1DBJH 3CFNA 2GT9A 3HNTL 1KXVA 1WZAA 4JO4H 3TM6A 3ARDB 1JFHA 3WL9A 1A7QL 1MIML 2WBJA 1XF2B 4EZLA 1AXTL 4BHUA 1TTRA 4UYPA 4IMKC 3CBRA 2XWZA 3UO8B 4MS8D 4NM4L 3NJLA 3B9KD 1Q9KB 2UY6A 2F8XC 3S96A 3IFOA 5CLYA 3CZLA 3AQDA 5JXEA 3HE6A 2P5EE 1OW0C 1OIOA 4NKMB 3OJDA 2VR3A 4LSQL 5D7LE 5IREA 4WI0B 2K8MA 3NIDE 4N1EA 4H7VA 4AENA 2FUTA 2V2TB 4ORZC 3ZRSA 1MCOL 3N42F 3MCG1 1B4LA 1G0DA 5E8OA 2QFRA 1QP1A 3O11B 1NFIB 1RZJH 2BHUA 3IJEA 5D72H 4Z76A 1P5VB 5ADOL 2FQDA 4ODVH 2OJEA 3WEOA 2B16A 4PS4H 1IKFL 5EF0A 4AIZB 4ZOEA 3OJ2C 5MERB 1OK8A 3FO1B 3BGMA 5E6IA 1Z9MA 4M6ML 4XWOC 5EF2A 3K8KA 1YUHA 2O5ZL 1CICA 3F83A 5ABZA 5D5ME 1C12B 2KZKA 3OMIB 2PW1B 1B9KA 3DBXB 3T0AA 4OQTA 1X4XA 4DEWA 4Y1TA 4JGJA 3OKNB 4KK9D 5EZIL 4A7VA 5C0CA 6PAZA 3SGJA 1L3NA 3E8VA 4CMHB 3TVMB 5AYUH 3IMBA 4Z6AT 1N2RA 3BSHA 1QSED 3RVUD 3P4NB 5ALCH 4HBQA 4JANA 5JQIB 3TNNB 4PBWD 4XHQA 1BLNA 3S97C 1JN6A 1FIEA 5ID1B 2YGOA 4KKNA 5ACMA 4G7RB 3GJFK 1FHNA 1KBKA 4LOFA 3MJ9L 4IOFD 1QSFB 3AC0A 3ZMRA 1NOLA 3LN5A 3RB7A 2AJVL 2EE6A 5IB4A 1KZQA 4KVNH 4HGMA 1YYMH 4Y1AA 3QZWG 1KN2L 4PJBA 4PJXB 3N1MC 4X99A 4ENED 4ODUA 3MX0B 1FZOA 4ZZKA 2G5UA 3KLDA 5C6PB 4UI2A 3QHZL 4HZAA 4OGZA 1NCAL 5KJRL 1ZT1A 1BBJB 1CICC 1DUZB 4UOW0 3FSWA 3HPLA 3I85A 4H26B 3UZEA 3ESUF 4I1RA 3GJEA 4FI7A 2J2ZB 1WPCA 2DIEA 1N5YH 1IGIL 2AW2A 3MLXL 2GCYA 3QJFA 1INEH 1BFVH 4I0KA 1OSEA 4GT7A 5F6IB 4KXBA 4YFDB 5JDSA 5JOPD 1UM4L 2VYRE 3DUSA 3UZQB 3CDFA 5C09D 1B3IA 1UKTA 2P5WE 5IB4B 5DMIL 2IFFL 1MJJA 2L4OA 4HUUB 5I6NA 3F58L 3O3UN 2VDNB 4L0PB 4NN7C 4OGYL 4G82A 2B2XL 3DNKA 2CNYA 1PLBA 4PS8A 1IZKA 1J87A 1OAZL 2PCPB 3SGDI 1HT6A 4M6NH 5JHDD 2HJFB 2APWA 4HCRL 4U6TA 2P7TB 5LCVL 5IGXH 2VL4A 4WLCA 2B15A 1BQKA 2WBWB 3Q3GA 1JYNA 4CU8A 3ZQ9A 5IEKB 5DJYA 3P3YA 3S3BB 5BV7L 2OW7A 5D4HA 3VXSB 2X4PB 3TBSB 1C7SA 1CMOA 1ZV2A 2QGCA 5CBEA 4AGLA 4Z7VB 2G9HA 3NCXA 3GHBH 3K6DA 2I85A 2XACC 4OCSL 1UM5H 1IM3B 3RIAF 2Q6WB 5CUSL 2FYVA 4NQCB 1LD9B 2CZNA 1O6VA 2DWDA 2ILLA 4FYQA 4WUUB 5EIQA 4PJEB 3VXRA 2XYBA 1S9YA 2NUPB 4IOSA 3C60A 3QAQA 4KDTC 5BRQA 4AIZA 4NRZB 3I9PA 1EGJL 3TP4A 3LD8C 5F71A 2DD8H 4X6CB 3GPSA 2E7BA 4YZFF 2Q3XA 2FHFA 2O5NA 1ZTMA 1T6VN 5TQ0L 5KJ4A 2WJ7A 1L3WA 5GRWA 5AVSB 1JI1A 3DRQA 5ITBH 1HHGB 3HC4H 4C54A 5IQ9B 2H32B 3L4XA 3TBYA 1GKOA 3CFQA 3KYNB 3UAJA 3VWKA 3UFIA 1OM3H 1CYXA 5HYSA 5C0AA 3NP4A 3RGVA 1ID5I 3L45A 3EGSA 1HSBA 4JM2A 5AYQA 1JF5A 4ELKB 4ZS6D 3EHBD 1MQ8A 3NFNA 1AMYA 4HEME 4Y5VA 2P46B 2P5EA 3K7UA 4KZ0A 3AW5A 5CZRA 4GAYA 1K8DB 2D7MA 3D05A 3TZVA 4O5LH 1R3KB 2E7CA 2KH2B 1XGYL 2K9FB 3D2UB 1C08A 2A4EA 2FDBP 2GSIB 3I50L 4FQ1H 3T2PA 2YS4A 3ARSA 3VXUA 4BZ2H 3QDGA 2X38A 3P0VH 4QHMB 4A6YB 2D7PA 4PRHE 2YHGA 1URLA 3QFJE 3OKLB 2IDQA 4HCFA 4LHJB 4WK2B 4Y19A 3PABA 4OCNC 3VGAB 1G43A 1AHWA 1NANI 4L8SA 4ZAKC 4NQQA 5KG9B 1AD9B 3BAYA 3DO3A 2VDKL 4LCUB 4S1RL 1YY8B 3KVPA 5E94A 3MRPA 2AV7B 3FTGB 4JHWL 4A1RA 3QIWD 4LESA 2XLLA 3T6ZA 5L2KD 1I9JH 1K8IB 1UZ8B 5IESH 4YHML 2AZUA 2C9VA 2E74C 3CK0H 2DYSB 4JRFA 1KYOK 3TJHC 1N6QH 1HE8A 4NUMA 3Q2NA 2ZYHA 5K93A 5TDPA 3EO0A 4JO1H 4PB0H 3CZUB 5TQ2H 1A6WL 1IT9H 1GOHA 1KXHA 1WICA 2VUYA 4FL4C 4RRPG 3TF7C 5IF0A 4AG4L 5IHBA 3A6CH 2L8AA 1ZXQA 1NCIA 3GSOB 5SWQA 3CH8A 1KG0A 4QY8A 2X7LA 4GAJL 5T3XL 2WOYA 1KJ2H 7PCYA 2MPVA 1Q72L 3T3PE 4ZOBA 1GMEA 5IMKB 3CSYB 2NYKA 1JG9A 1QPXA 1ZTXE 1WIUA 3B9DA 2OMZB 5GGTA 3R0NA 1UJ3B 2HA1A 2IH8A 1BD2B 4PVLA 2YSTA 5E9DD 4MA1B 3UPCA 2NY3C 4YBQC 4G8AC 3GMNB 3AXLA 1NAMB 4JPWH 1F45A 5IEHA 5HJBA 2G5BB 3MV01 4JFQB 4IM8A 4ZMWA 1SYSA 2F1BA 3HBZA 1KB5H 5EUKB 5HJ3B 2XDHA 4GH7B 1VZGA 5IKCB 4LPTA 2ZXEB 5D2NB 1YUKB 3FQYA 4M6MH 2NRDA 4L1SA 1ECYA 3GSOA 3REWA 3F7VA 1QFWM 3C5ZD 3D48R 3NZUA 1AGEB 5F9AC 5IBLC 3VXNB 4X9IA 1ZHBB 2Y2TA 1F3JA 3QPQC 3L3OB 4F37K 4YSOA 2FYYB 3Q44A 5EZPA 1HL8A 5HPMB 3L3HA 2HX8A 1A6UH 2ZX6A 1UKSA 2EDXA 4QRRE 3I74A 4UZGA 3PHAA 3ATAA 1GJUA 1PVHA 4G7YH 2XXFA 5GZND 3ZR6A 2R2BA 2HTKC 5I1KL 3GF8A 1BVLA 1N64L 3GTTA 2FNBA 3DSNB 4F9PC 4DN4L 3NSYA 4OZGE 25C8H 2CUMA 4R7DA 1YLBB 2DKSA 3FU9A 1VACB 2AXGB 4TQHA 1J5OH 5J6GB 1UYWL 1OKEA 4F9LA 2AJVH 2F8VA 1RAMA 4EI6B 5GGTH 3JV4B 1SLVA 3K6SA 4FNUA 2ICCA 3CMOH 3KPTA 4KNQA 1OM9A 3RKPA 4L3AA 2HT4D 1D5BB 3TCXA 1NCAH 3II1A 5KJRH 1G7MA 4LQFH 1FSKC 3IGLA 1PCSA 3PHOB 5J1AA 3H4HA 1W0WA 4KK6C 3QIBB 1ZD6A 1HSBB 5DRWB 3D0VB 2GSGA 4KROD 4Y5YC 3TO2A 4H0GA 3VWKB 2BXZA 1P4IH 4OCYL 3CXDH 2X4UA 3FFDA 3DRQB 3KYMB 4NYLB 5B1JC 2KHAA 1ILUA 4M48L 3FT4A 3I6LE 4R2GC 2AK4A 3SQOH 5I1AB 4XPFL 3TWCH 5BCAA 1KDIA 2JIXD 2GTWB 4NLHA 4AJYV 2A6DB 5HI4D 2V7HA 5D70H 5B1KA 4PJ9B 3AAZB 3APNA 4HYTB 4KNTA 2IQ9L 5SX5H 3I9AA 2NZ1A 2QV4A 1IC5H 2GBAA 2C9UA 5DDHA 5BJTA 2FTAA 2P80A 2ALWA 2HB0A 5KOVC 5HYSG 5C0AE 2A4ZA 3QI9A 2DYPB 3U2SB 4YHMH 3SE4A 4XPHL 1XCQA 3L3DB 1S9YB 2NUPA 3UPRB 3HMWH 4XNQA 3NFSH 4XCFH 4BM7A 3ZE2B 2Q6WA 2EE9A 3HNSH 4OZFB 1NIAA 3AS2A 1ZV9A 3BWUC 3CZJA 1YNLL 1S7TB 4PJ5E 2AZAA 3UCRA 5DJCB 4BFFA 2Z7YA 1X3DA 2VRQA 4I5BA 1G84A 3NJKA 1CDYA 2OL3L 4QRSA 1TETH 4XP1L 2YWYA 1SJXA 1AYRA 4QHNA 2BMKB 1JPTH 2BNUA 2EKSA 3QZWB 3MNWB 2HJFA 4PMFA 1EZVY 4ZW3A 3ARBD 2AMGA 4L4VD 4PJDE 3PWVA 2YPVA 3A6BL 2KQMA 5DK0A 4XP5L 2VR9A 4RISH 4NNXB 2WVVB 3B34A 4G7VH 1OZTG 4G43B 1DZBA 1F4WL 2B1AL 3BO8B 3VTTA 2VMDA 3LEXB 3MACH 4M7LT 4QLRA 3BUBA 1OY3B 3QORB 5C0AD 4XNZC 5ITBL 4MFHA 4HEPG 3WY2A 3TNMB 5JIHA 2BJMH 3BP5A 1KTJA 3RWCA 4YSDA 1XBRA 5B3SB 3E6HA 3S5LG 4ABWA 1UOLA 3EGDA 4FP8L 4DP2X 2NY6C 2BC4B 1PKOA 3GJEB 3AMKA 2AJ3B 3SDYH 3JBG7 4BFGA 3PWLB 4AX3A 4X42A 5GS0H 4JG0L 3L9RA 1RU9L 9PCYA 4MNGE 1W0YT 15C8H 3X14B 2KYIA 1V55B 1BVLB 1IBHA 5F7EL 4M5YL 3II3A 4JRYE 3UJTH 2X0VA 2FSDA 1HSAB 2OKMA 3OB0H 4Y1AB 1BLIA 1WE5A 3W56A 3WD5L 3HZMB 4NO2B 4ELMA 5FUZL 2XETA 4TQPA 2XG5A 3U46A 1F0LA 1QRNE 3B7YA 5KVGL 4MDJA 4D9RD 1J12A 1ZHBA 2R4SL 5D96C 3UIZA 5C86A 2ZXBA 1Y0LA 3L3GB 4DO6A 4XNUL 1USQA 15C8L 3BAEL 3WIIL 4UQEA 5I6KA 1DDHA 1DN2A 1F3DH 3WHXB 1GS8A 4JJ5B 1NKOA 1WS7A 4M5YH 5HGHA 5CEZE 4WW1A 5GSRB 1G7QB 2IF7A 3EFOA 4HUNB 4L4JA 1AFVL 3V0GA 3BC9A 5HI5C 1USZA 4PGZA 4UQAA 4JO1L 3VRLF 4NERA 4HMDA 3O6FC 3WMQA 1T1YB 3ARGD 3DTDA 4OGAD 3OKDA 4IBLT 1AO7A 2XIDA 4N2KA 4ODWB 43CAA 1J0ZA 4AIEA 4U6VH 3LRLA 3DSFH 5E2JA 4OTXH 1AANA 2R15A 5HYQB 3UBGA 4EMZA 4M7LH 2EDOA 4XP4H 1JDDA 4J7RA 4PY7B 5ISZD 3MLPA 2GIMA 5AW6B 1KCBA 3MMEB 1NCDH 1A1MA 2W80C 1WT5A 2JKLA 4NX0A 1E3FA 1IGFH 4RMRA 4S1SH 4FE9A 3S36X 3HRPA 4AK2A 5DLMH 4DGYL 1NUGA 2GITB 1GHFH 1SJEB 4I9WD 3UYOD 2H3NB 3WHE1 5J1SC 1KN2H 1E9QA 3ECWA 1OAJA 4JKMA 1EAQA 1D7CA 3MBEC 1YNTA 3NSCA 4PLKC 3BDYH 2Y1VA 3N0AA 3LKRB 4NRYA 3V6FA 2ADJB 5C7XH 2OX5A 1BBDL 4L3EE 1EHNA 3CQPA 3PY9A 2HT3D 4GKZA 1NCHA 3KJ4B 5DSCB 3DIDA 3MRRA 5FKAA 4EQ3A 3MRRB 5FKAB 1MHPH 1G6RL 1Z9SA 1CR9L 2OPCA 5BRZE 5DZLA 4KKAC 4GAYB 2BSTA 4TLTA 2WBJD 5IW1A 3NPSB 2Z34A 4UWQB 5DRNA 3LHAA 4Y5VB 1ZIBA 2UV3A 4KQ4H 1U9KA 2BS8A 1EUTA 2GBTA 2LTQC 4DQAA 3AZUA 4MJJA 5IHHA 3GDCA 5T5NF 3HRZB 1UOWA 2NNRA 3KYNA 2KZ1B 4PLJC 2OCCB 3TBYB 1A47A 2HFGL 1BVOA 2WP3T 3HEIB 3RL1A 4XAKD 2WTOA 4P99A 1KJMB 2VISA 3V4PH 3S34L 3OHMB 2E0PA 1XIWC 1HL9A 3OXSB 2P52A 4A7SA 1IIIA 1P4UA 4JRYD 3RPIA 3QDMD 1A1MB 2QEJA 3M1OA 4NQVA 2ORBH 3H9ZA 1I9IH 4GP5B 1E42A 1NC4B 1UT1A 3BH9A 5JOPE 4J12A 4K0OA 1MHCA 4KMLB 1UJ3C 5I1DB 1QACA 2ZXWB 4ZSOB 4X2UA 1DDTA 2AXFB 2PN5A 3IDYC 3MXVH 5TE4H 3FAWA 5HHPA 4UT9L 3VGDA 3ML8A 4XPBH 2J3SA 2F19H 1NM9A 1XR9B 1BVKB 2P26A 4JK0D 4EI5B 1MFMA 4HOZA 1I3UA 4PUBH 2V9QA 3V4PL 1DEEB 2ERJB 2GHZA 5C0EB 5ISZB 5I66B 3DO7B 4J2XA 4BFIA 1E0OB 3B2UD 4Y9GA 2FAUA 3OQ3B 2APSA 3IMRA 4M43H 2DQFB 3FOMB 4XBGA 3T8MA 1M56B 1D5ZA 4KV5F 4OSUL 1ND0B 2ADFL 4MCZA 1IV8A 1ZWIB 1U4FA 1M53A 2O61B 3L2NA 3ARED 4OGXH 2Z1PA 3M1BB 3SPJA 3O3DA 1I9RL 3NJFA 5CGTA 2YIHA 1ZLVH 2H9GB 3CVHB 4ONGH 4KX8A 3BN9D 4YFEA 1JNLH 3QWRD 5CINH 3B2DC 1FAIL 3GYRA 1JZ2A 2JB5H 1W8OA 2K3HA 3ULVH 4Y7OC 43C9A 1UB6A 4F8LA 5ANHA 2Q86A 3KBHE 4G8EB 1HSAA 3D33A 3FB7A 1DVFB 1LNUA 5D7IF 2VW7A 2FB4L 1JPTL 3N5AA 5C08E 4OZIB 2RAMA 2RBLA 3IF1A 3L6FB 4OF7A 4YHPB 4WFGD 2BRRH 3F7KA 3PWLA 4OUOA 4K23H 4NZRH 5CN2A 3GI8H 1BBJA 1WD9A 1P7QD 2HMID 4AGNA 1QVOB 3GSQB 3IDXH 4KMTH 2BC4A 1PGRB 3DPBB 3BT0A 4L9LB 4LFHD 2P42B 3OF6A 1FSKB 2EXTA 2NLJB 1GKEA 1P4BH 1RUQH 2Z65C 1EHLH 4ZW6A 1IO4C 2HPOA 2EEAA 2J8OA 3EFDH 3NEOA 3RFZA 3BUDA 4NENB 1IL1A 1BYNA 3LS5H 1RJZA 3KJ6L 3UABA 4IIQB 4UBDD 3IFNH 2DQIL 4Z77A 2X87A 5TF1L 2DY2A 3Q1EA 1L9PA 3GBEA 2YXVA 1KJ2A 1NCCL 1L9QA 1C5BL 5ILTH 2VM3A 4L2LA 3ASWA 3X13A 2WO3B 4ODHL 4BZ1H 3VWJB 3M17A 3LKOA 1K4DB 3HZKB 4Y1AD 4PJXF 5B38G 4H0LC 5M94B 1YMHB 4ZS6C 5HHOE 2VRAA 4AW4A 2V17L 2NZIA 1OF0A 4L37A 4HWUA 4ZPVA 4LLDA 1X5MA 5E00B 1A5FH 2MH4A 2ZAIA 2GB2A 5IJKA 2LOEA 4XNMA 2Y9RT 4HOWA 1BZDA 2KC0A 1TR7A 1FNSH 1JL8A 3S6CA 3VE0A 1KB5L 3LCYA 4K7PH 4F37F 2NX5A 5GZOC 2R1YA 1TYRA 5CCJA 4FQ2H 5IIEB 3EYSH 4I0PD 3D50A 4CBZA 4L0YA 3TN0C 2JJSC 4XHJD 3L3IA 5J6HA 3BVTA 1NFIA 4K2UL 4FNRA 1TJHL 4HIJA 1HH9B 1HH6A 1S7UA 1IZJA 4WK4B 1O7DC 4Y16D 5D1ZC 3SJVA 3G5YA 5EBWA 3K6NA 2ZONA 4WI0A 2X3BA 4U6YB 1AHKA 5HDQL 3D4YA 2IANB 3SY0B 4IQHA 3FFDB 2IOIA 3KYMA 1IM9B 2F58H 4PVMA 5FYLH 4EDWL 4DP8X 4LAQL 1M7DA 1R3LA 5A2JH 3FTXA 2NY5C 3P77B 1JZGA 2OI9C 3OHXC 5LNDA 1N5AB 1QFUH 3C6SA 1PQZA 1OVZA 2C9SA 4PTUA 3K81A 3NA9H 1UKQA 4HWZA 1CI5A 3VXRE 5KSBB 1FVCB 1I85A 3L7FB 3OAUH 2XTSA 2PYEE 2YUXA 3N85L 4LNRA 3AS0A 5FKPA 2BSRA 4X6BB 5ABDE 2FL5A 4R4FL 4QRRB 3RA7L 3KXFA 4J1UB 2XVKA 3F64A 4WU5B 1KLUA 4H0IA 2NXYD 2HG5A 4UT9A 5GHWL 1ZLEA 3T0EB 5AVRB 1QEWB 1U8CB 5HHVH 2YRLA 5KS9F 1OZUA 4AM0B 1QTYT 1SVZA 2GTZB 3FC8A 1H6FA 1PKQA 4X5WB 4Q9BA 4XAWL 4LPYA 2FVNA 4TUJB 3IT8D 3BIKA 1EO7A 1IGJB 4X4YA 4DT2A 2J88H 2Y4SA 4LK4A 3TCLB 2J6WA 2Q8BH 2PR4H 3TIEB 1B0RB 1JZFA 4W1TA 1UZ6E 1QOKA 2H2SC 2ZCHH 3ZR5A 4TLUA 5AVYB 5L0QC 3R06A 2AP2A 3ES6B 3L3KA 2G60L 3X1GA 4FEMA 2CO1A 3K80A 1E5AA 4HWBL 2WKOA 4CGTA 2HG0A 5HVFB 5J11B 1JHLH 3F7VB 3VXNA 1UXLA 3MCYA 4HG4K 1J0JA 3SYOA 2FR4A 5I30H 1MREH 4UINH 1CXIA 5DQDH 3WSQL 4O4YL 5E2TL 3BSZA 4PB9L 1Q0XL 1BFOB 1INEL 3OSVA 4LDEB 5HJ3A 3ALXA 2ZWSA 2JIXA 2X28A 2XRAH 2MRYA 5IVOA 5EOTB 1JMXA 1O5PA 2X6MA 1UXSB 4AUJA 3Q6FA 8PAZA 1S3KH 3RZCA 1JJUA 3QIWA 5IT2H 1H9DA 1KZYA 1YPZA 3GSNL 2GFBB 3QNXB 4QKTA 3T0EA 1HQRA 1MI5A 1TEYA 3MLUL 2PTVA 5FM5O 2IH9A 1QPKA 2CHNA 1AGFA 1L0QA 3IS1X 3O0RH 4Z95L 5AZEH 3LMJH 3ZTEA 4RSVA 2ODHA 5FC9A 3UH8A 5AUMA 2NY5H 1WITA 3D07A 3VXTA 4AVKA 1AP2A 2FL5B 4CC0A 1KG0B 4QY8B 5T1JA 1P9MC 3VFOB 3MNMA 2DF3A 3SDCA 3U7YL 5IF0B 1A5FL 2DZEA 4MNGB 5IVZB 4P2YA 1GTFA 1VDGA 2WVSA 3EO0B 4HC1A 2NY2C 3CHOA 4PJ9D 1J8KA 4LCVA 1YEKH 4LIQH 2EEFA 4K55A 5DI8A 4KJYB 5AKSA 1SXCA 2Y36H 2Q7AA 4O5LL 3QZMA 4KZDL 1IM9A 3ZL2A 1GOGA 2CBPA 5HHME 3DGGB 3RUGB 4P57A 4CSSA 1EMTH 4L3EB 2HH0H 2ZOOA 4FJ6A 1CO1A 1AHWB 4L8SB 4C4KO 1YQVL 5K39B 5ITFA 1AS6A 2BK8A 3T8XA 2ZP8A 3TPKA 2QHRL 2XWRA 4WK0B 2IG2H 2HZHA 5LBGA 2DI7A 3R0MA 4RX4D 4ZUWA 2ZX8A 4ZFOB 1MLCB 4MAYA 4M9OA 4QR7A 4KZEH 5DD1H 5TTRA 3VE0B 3D2UA 4OFKA 3V5DB 1R3KA 1E27B 2FGWH 4JY6B 3UMTA 4ZQTA 4NAMA 4TVSa 1J0HA 1VPOL 2LABA 2VO8A 3QDMB 3IXTA 1OGTA 3S37L 4LE8A 2W9LA 1A66A 3SO3B 4Y2DC 2X1OA 3SJVD 1K3IA 3P4LA 4MXQD 4P48A 4UT6L 3LKPA 3MYJA 1WBXB 2XKUA 4M7JL 4AK1A 5DA4A 3G6JA 3MRNB 1OHQA 4MCNA 3M17B 4G8FA 1Y07A 5KAQG 4DZBA 1G9HA 3MJ7A 1QYGH 3ZQXA 4LP8A 5F97E 1MG3C 2NNFA 1LK3L 4YHOH 4C8XA 3LD8B 3N0PB 4MAYD 1HIML 5DD0H 3UC0H 4N2OA 4K3DH 4ISVB 3P1VA 1DLFH 4QNPE 1A7QH 2OSYA 3VM5A 5IB1A 4C56E 4GXUM 1OTSD 4KKLD 4R7NB 4Z3JA 4H2AA 1JNJA 1AXTH 5CLTA 1UWEL 3VH8A 3QSKB 3X2QB 3UPAA 3M7FB 1HKFA 5CILL 3RZWA 3EYOB 3NZ8A 2NTFA 4KC3B 4NRZA 4Q4EA 4XNYH 3P0YH 3RJOA 5E4EB 1XD1A 4IRJC 4K94H 1FVEA 2YMOA 3UBXG 2A0LD 3QNYA 3UZVB 3V52L 2UWEF 3HJEA 5BO0D 1Q94B 3C2AH 3MUJA 3G04A 4APXA 3K8LA 1W72B 3MN8A 5GGQL 4WV1B 5T5FL 1E5ZA 2Z4QA 3FN0H 3PREA 1IAIL 1H8NA 1LNUB 1Q0XH 4P46B 3K2KA 3RWHB 3UJJH 3FB7B 3QUMA 2R29H 1CFNB 2NUTB 4KJWD 3VRJB 3FS9A 2GY5A 5IM7A 2P7TA 4WJ5B 2VZOA 1UB6B 2YXFA 1Z0MA 5DK2A 4ABUA 4N3UA 3MLVH 5DJ8A 1M05B 4Z5RA 5H4YA 3TA3D 2QGBA 1NDMA 1A6VH 4KZCA 3O6MH 4P9HC 4L1BA 4KVNL 3O2WH 3U7WH 5GGSB 4G80A 3CH1B 4JN1H 5F89A 3C75A 4TMPA 4RZCA 4HWBA 4F58H 2JV6A 4MCZB 2OMTB 2XN9B 4Z3HA 2X9ZA 1BMZA 2F53E 3BP6A 3L48A 1JXGA 4V11A 2H3XC 2WAHA 4ZJ9A 2C3GA 3NABL 4J3OF 4U7MA 4HJIA 5I1CL 1J05B 4YBLB 3RX7A 1R0AL 4NC1E 4PJDB 3G04B 3ARGC 4FMVA 3NRQA 2HLFD 4NO0D 4GAFB 4P5MB 1OCOB 3ZHFA 3ZKMD 1OD7A 4W9LC 4YDJB 3DECA 1YEIH 3QULA 2IAMD 1KGCD 1Z9PA 3GXPA 3BDXA 3G08A 1JI2A 4X99B 1U3HA 3RG1C 1F02I 1HJBC 1EX0A 1E5YA 1E4WH 3IDNB 5FW6A 5AWNH 3S36L 3UAFA 5FO8A 4FG4A 2FJFB 3QRFM 4R3SB 5D5MB 5GJSL 4MD4A 1PD6A 5EO1B 4AVIA 2LVEA 4OM1H 4ANUA 1P2CB 3IAGC 4LSSL 3ZTNH 3T2QA 5EBMB 2Y7QB 4UM9D 4HLZH 3REVB 1MEXH 2F5AL 1EUUA 3T04D 1BLNB 2X0UA 3TNNA 2YSSB 4JO4L 3VDAA 4BJLA 5GGTL 1M42A 4DZBB 4RRPM 3P0VL 3S37H 4MQTB 5HDOA 2R8SL 4JPKH 1ZHLA 3P4MA 4DP0X 5DJDA 4FHKA 3DBXA 4B0MM 4WHYH 4A38A 2FWLB 1K9TA 1OGTB 2BIMA 2H2PD 3GRGA 3LB6C 4JRYA 4Z18A 3VWJD 5TK2A 3MODL 3QZOA 1N0LB 3SDXE 3UGEA 3DURB 1XSIA 3FO1A 4JHAH 4OD3L 4HHWA 1YPZF 1MKFA 1JUFA 4Z3IA 3KLHD 2EZ0D 2HVJB 2FD6H 2WYZA 3VSQA 2J73A 4XI5C 5CZVH 2FEJA 3Q2WA 2KKQA 1PNCA 1W0VB 4E9VA 1CQYA 2ADJA 2R4RH 3AXIA 3JYCA 1EHAA 2CA3A 1SXAA 2B8OT 3A6BH 4GP8B 4PV1C 5ITFB 2CRYA 4JDTH 5E8OB 4AT6A 4F57H 1NGWB 1TKWB 4X8XA 3QFJB 5HYEA 5ENWB 2E76C 2BY1A 3P9LB 2Y1YA 3EUUA 4BDVA 4N0UA 1AGCB 4YN3A 3DGGA 4W9IC 2HSIA 1KV3A 3TV8A 2VITB 4X9FA 3L4ZA 4JR9H 1T7ZA 4M1DH 2AQPA 32C2B 2QPSA 4MQ7A 3GDBA 3Q06A 1E40A 1KBGL 2UY6B 1HCFX 4RMTA 1MWAA 3VD1A 1Y18A 3PNWA 1J0YA 4RMWA 4TSAH 1YY9C 5D2LF 3SO3C 4FI6A 1BJ1H 4WEEA 1ASOA 2VDOL 1WAEA 3T5WA 3HG1A 1WEJH 3IJ9A 2D9QB 2GJPA 3U0WL 1O5DT 4K5PA 1EHLL 5CBAA 3HE6C 1THAA 2O6CA 4MZ2A 4AKQA 5KTEH 4EQ2A 3PDOB 2I60L 3A5VA 4U49A 4JFDA 3KPNA 1KGWA 2R0KH 4N2EA 2ZOWA 3U6RA 4N0CC 4KQ3L 5E4OA 1WISA 1ZHLB 1Z5LB 4KK8D 3ZE0E 1G7QA 2FATL 5GSRA 3LKQA 2IPUK 1NPNA 3QIBC 2WY3B 4LSQH 4FFWC 2E6JA 2XN9D 5E23A 5FUOL 1G9MC 1FIGL 4TUKL 1HK6A 1GS6X 2EIEA 2R69H 3KW8A 3VI4F 2AQTA 4NXKA 3FQTA 5CP7A 2XWXA 5KBNC 1FRGH 2P8LA 4OW6A 2VN5A 3LH2H 5B1CA 5DS8B 4MDJB 1MCEA 4IOFC 1QX1A 5CMAA 3EJTA 3AG4B 1GZPA 3LNDA 2XG5B 4R3SA 5D5MA 1NAMH 1IBFA 4K3EL 4TQ8A 1A7BA 3CFEB 4GW5A 3PF2A 2FJUB 1BFVL 4U2ZA 4YZWA 4IBVA 5SWZE 1TJGH 1QBML 2E5EA 4MJ2A 4NHUA 3BJ91 3W39A 1JOIA 5ADOH 4KO9A 4P8QA 1B0RA 3P11L 3KWWA 4Y2DB 1OEZW 2XPGB 4PP2A 3HKZA 1YYCA 4Z78A 3EAKA 1LQBC 3TCLA 5LCVA 4WIQA 1N67A 1TENA 4KHXH 4YDJA 3WFHA 3C5JA 1GCFA 5I26A 4TUJA 3NPSC 4PWJA 2WUCL 4B6ZA 2ZOTA 3VMNA 4YX2H 2YMTA 4OCLC 2V5TA 4Z7QE 5LXVA 5DZNA 1KWGA 5BUPA 2EICA 2OMTA 3SZKC 1TUPA 3PFQA 3M46A 2ZKHH 3T2OA 3C09C 4LLUA 4DOHB 2ZUTA 2WVVA 3K4ZA 2PWGA 3FU3A 5CLWA 1R46A 2F54D 4JG9A 5F0MB 4G8GB 1E7VA 5JORA 2Q76B 4F5CE 1ZVYA 4MQSB 4C56D 3S37X 4P4RA 2RQ8A 3ESNA 4PQXA 2DM4A 3D09A 5DEGB 3VFMA 2K4AA 3OLGA 1PJWA 4JCMA 1E6JH 4L4TE 3QJOA 5C71A 4NPYB 2NUTA 2UXVA 2ZJSH 1FNGB 5KS9E 4LF3A 1KFAL 1M2VA 3IB4A 2VABA 4ZT1A 5L9DL 1BVNP 3S5LB 4WNQA 4JN2B 2XTLA 4DUWA 1L7TH 1KF9B 2GHWB 4QCIA 4KQ4L 5D71L 1S5HA 4V1DA 2ZKMX 1D9KC 4KX7A 2VH5H 2J1KA 5GGVY 1KCUH 4LDLB 2IGFH 4JR9L 4IMLB 1HDMB 1XH0A 4ODTH 5IQMA 5CCHE 4V2BA 2NY4C 3E38A 5AOKA 2CKNA 2CR6A 5B1BB 3Q1SH 1RIHL 2XZQH 5FIEA 1AACA 3ILQD 3VI3B 3ZHKA 2B2XH 4XNMB 4XZUA 4R7NA 4OCMC 1XF3B 5DMIH 2QVKA 4QPEA 2Q20A 2Y1ZA 2X70A 1HHHB 1RURL 5J89A 1P53A 4HKJA 4UU9B 4I9WE 1SMOA 3SKNA 5FYJL 2K6YA 1J7VR 1IE5A 4N2BA 2E27H 4PY8J 3X13B 3FBQA 5K1JA 2XSKA 4BWTA 4CU6A 2CDFA 5CD3B 4IBTA 5IFJB 4QXGH 4HHGA 4HC1H 3B7UX 5D6DA 4TTGA 3MBEA 3BD4A 1K2DB 3KH3A 4JG0H 3UBXB 3IXTB 5ESAA 1UM6L 3WG7B 2DI8A 2QGEA 4IIQA 3VI3A 1E90A 2K0RA 3FU7A 4HSCX 4FXGC 2CDEA 3DDFA 4YSAA 3TJHD 4MMZC 1IKNC 5M95B 3RPBA 2BVTA 2NXYC 3TOPA 4FKEA 3FQUB 5B3NA 4ZUWB 5B4MD 3DHMA 4EUPG 4FYRA 5HHQA 1QVOA 1VACA 1OK0A 4IIQC 3BUQA 3V0WL 3ZYJA 4PGEA 2NW2A 2R1WA 2IWGA 4A2EA 4FYTA 5C1MB 1D6VL 1NDGA 2IAAC 5I6LA 1S5IL 2XZZA 3AQXA 3BKML 2AVFA 2BWDA 5F9JB 1EJ6A 2XWTB 4HHAA 4RWYH 4K7FA 3S5LA 2VABB 3C5ZB 3N3EA 4O00A 4P2OD 4KH9A 1ACCA 1GYCA 2O5XL 3QCVH 3TZVC 3QJTB 3JTBA 3N9GH 3E9UA 5E9NA 2WZ6A 4QTFA 2GABA 1LP9E 3L5WB 3BQUA 4K23L 2NR6D 3ML9A 2J6EH 2VZSA 3IDIB 4HIIB 4CRPA 5I5MA 3CVHA 4KMTL 1UD6A 4U6XA 3NSDA 4YAQB 5DCCA 2VDRL 3V6OE 2WLMA 4P07A 3F6LA 1BQHG 3FTSA 1CDJA 2LR4A 4MMZA 3MBWB 1AGFB 4JFFB 3FO2B 5TFSL 1J11A 3SIKA 2J1WA 3QUYA 3LNEA 2WTPA 4ALAH 1OB0A 4KROB 3FOMA 4H1LB 4HDIB 5IW6A 5D7IE 3GMNA 1VGEH 5M7QA 4NJAH 5HHMB 2XZAH 2WK2A 3FFCB 3NSFA 3OMZA 3DYPA 2LLLA 5DURB 2JIXB 1FAIH 1TZGL 2PO6D 4FFZA 1V7ML 3HFMH 1BFOA 1E4XH 3KNBA 3QDJE 1AKJA 3SOBL 4HV8A 3H6AA 4YUEH 4ODHH 1TJIH 1AOZA 4PRPB 4N0FA 4A2DA 1JRHH 3AT0A 1QNZL 2PXYC 3NACH 4M8QA 3H7BA 5E24E 2FHCA 1YEHH 3I9IA 3FU5A 4F2FA 1KCWA 1U8MB 2F54A 3SGKC 3TBVA 3VFSA 3RDTC 1GZPB 1BOGB 3BYYA 4JM0A 3WS3A 1MRDH 2BP5M 5JIQA 3RHWF 5KVEL 4XBEH 3JV5A 4XC1H 3MA9H 1IC0A 1K6QL 5JNYB 1F11A 4CSPA 4MDIA 5BPPA 2NX5D 3BVNA 5I6XC 2WQRA 1ZT4B 3S98A 2AV7A 3ARXA 1VZIA 1AZNA 4Q6IB 3WJMA 4UQ9A 3RTLA 3SYAA 5JHLA 4GSQA 4NUPA 5CEZL 4X4YB 5AOIA 3R19A 3RNQA 4PRDA 5JOFA 4S1DC 3HLKA 1I1CA 4DEUA 1L9NA 2GTZA 3CU1A 5I1JH 1CK0L 4JFWA 5DHDA 3GSRA 1IARB 1XSJA 3QUYD 2C9PA 3TBWA 3CBKB 5I28A 4QHMA 3AB0B 3ZL4H 5EEVA 1A4JA 3UTQB 1NLDL 4PJ7B 5HP5A 3EO9H 1MFUA 3AGVA 1T66C 1Z9SB 2RH0A 4X5XA 4P9HL 1U92B 3CDCA 5CSZA 1G87A 4KPHL 2MEJB 4W70A 4B5ZA 4QRRA 1UH2A 1FZMA 1MCKA 4JFOA 4E9WA 4QHLA 4Z23A 3BQUD 2EH7L 1Z5YD 2CK2A 1H5BA 3QRGL 5FXCH 4YXHH 3MRCB 2CM5A 1G0YR 4D3CL 4DCQB 2J72A 2WCPA 3AABA 1MCSA 4PJHF 1MCPH 2VDMB 3DIFA 3V5HB 4NRYB 4GLRH 1PAMA 1ACZA 5GGUB 4URTB 2JI3A 2OMNA 3PE9A 1ES0B 4PBXA 2L7JA 4RDQF 3QDGD 4QKXB 1A4KB 1W15A 1RUML 3Q13A 1G7IB 4RGMC 3W5MA 2ZKHL 4PLNC 3CHPA 5LLIC 25C8L 4X6DE 2YQ3A 4K5OA 1F1AA 2B59A 3HHSA 4OT1L 1XB3A 1QWNA 1HHJA 1N10A 4FFZL 4WO4C 4MQXC 4BE5A 3MMEA 3H54A 3OKMA 3INOA 4TL5A 5DFTA 4PCTA 4PJ5D 4GFXA 4HMEA 4IGBD 4S1QH 3CFCH 2P5ED 4Y4KB 5EIIB 4QXUL 4LCWB 5ICXA 1KIRA 3I6GB 1OAQH 3ARBC 3BKYL 3L95B 3QQXA 4CBPA 4Z7OF 1Q9OB 3TESA 4XOEA 3VUAA 2AJUH 4YNYB 4AW7A 3C60B 1U8KA 3NFPB 1QA9B 3LH8A 3MBXH 4PJEA 4FABH 4MXVE 43CAB 2A0LC 3OKDB 2EO1A 1EFXA 1V3LA 1IC7L 3SQBB 2IBZY 1A0QH 3N41B 4NWUH 3W3BA 4YEFA 1AE6L 1P1ZA 1S2EA 1I8UA 2VH5L 3VGFA 4TF4A 2XKSA 1AZBA 3L2MA 3RWGB 2UYLB 3TT3H 2AJUL 2QELA 3ZTJG 1PZSA 3DI2B 3EIFA 1KSRA 2XZQL 1CJYA 1OCCB 1FLRH 4U05A 2WYIA 4GAGL 5K69A 4FXKC 4H40A 1S3KL 2C3XA 5CZKA 4ZUUA 5GPRA 4AWJC 2WPGA 4PRNA 2DIJA 4ZQKB 5BV7B 3BPOC 4WWKC 4NQCD 4PVBA 3NGBC 4NO2A 1CBVH 1RZGB 1XAUA 2QLVB 1RZQA 3BESR 3RZCC 5J13C 1JGVL 3LRHA 5DC9B 5BZWB 1PEZA 4L9LA 4H4NA 4HMCA 4N9GB 4XPHH 5C09E 4H8PA 4RFNB 2X6CA 1FLRL 2VM4A 1GYWA 2JF1A 3GRWH 1RIVL 4NB7A 1WA2X 3V9CA 1Z2KA 4EEEA 3FO9A 4QO1B 3IF1B 1E5BA 3KBFA 1G5GA 2XV2A 3L6FA 4YHPA 2Z0UA 2CIKA 1R3JB 2OULB 5FCUH 5KUKA 1JZIA 5AW2B 4JVUA 3D30A 1SN5A 4MZIA 2AJZA 3TH3T 3BP5B 4CJ1A 4XZ4A 4A7UA 2Q8AL 4NQXA 2MKLC 2E59A 1FGNH 1U8NB 3RGBA 1HYRC 4BK5C 3L9YA 3BPNC 1EMTL 3R4RA 2APTA 1QSEB 3CDYA 4RSYA 3T0DA 2YKKA 2CDGA 4NFBA 1I1YB 5A2BA 3MLTA 3IJYA 1S5IH 4PS7A 4F8QA 1ZE3H 2Y2WA 3MRBA 4JM4H 5BXFA 1I1RA 3M1BA 1OT4A 4IU2B 2BMKA 2BNUB 2BJML 2EKSB 3ABMB 2BFGA 3QZWA 3BCDA 4K7PX 4PP1C 2VE6B 3M8OL 3VGBA 5TE7H 1UWFA 3AADB 3TVMA 1I9EA 4F1SA 3UTTB 1BAFH 1D7BA 3DX9B 2ZX7A 3P9WB 3RVTC 2OJ1A 3OAYK 1PIFA 1DCEA 3PAUA 2WJ5A 2F74B 2DTSA 2X3AA 4CC4A 3GTVA 4B0MB 4BZ1A 1E8WA 3N1QC 4JVWA 5INCB 3KPLA 4M7JH 3GBDA 4QXTA 2VLME 3EFDL 3FUNA 5E6IB 1YN6B 3TONA 1XR9A 4ZD3L 4QEGA 2DAVA 3IU4L 4O51B 4XCEA 2FZ3B 2BFVH 4ZMNA 1M2OA 1VIWA 5I1DA 3BAWA 5D4IA 1MHCB 5DDHB 1NC4D 4LLWB 1OL0A 5JIKA 3S3CB 4RBPK 3BKJH 2FWOB 1RJCA 4PJ9A 4A2FA 4RAVB 2BY3A 5A1AA 2JVUA 3S3JA 1NUNB 3ULAB 2I24N 4X6FA 2ZP9A 1T20A 5I16A 4KV5E 2YZ1A 2WQSA 4KKBD 5JW5A 4UTAH 3HCVB 3LV3A 4JQIA 4P5TA 3LN9A 4WI6A 4WUUD 1Q72H 5J4MA 1OPOA 4PRAB 4BUQA 2IH3A 5HVWA 2GJ6A 4K8RH 5JQ6H 5CN1A 4IJTA 5HD8D 3QEHA 2VXQH 4YSPA 1D5RA 2XJLA 1YY9D 2A9NL 3MAWA 3PHOA 1FBIL 4HFWB 3C87A 2WBJB 1J86A 1KMGA 3CSFA 3H7LA 2V5YA 3FN0L 1GAFH 4PJAB 4E41A 1ZSDA 3LNHA 1UFGA 5CGMA 3OR7B 2QADB 2VDRB 1AGBB 2LFGA 4GFTB 4UTAL 1ORSB 2Q7YA 1SUJA 3I3BA 4TNEA 2HLAA 4Y4HA 2HRGA 4JO5A 1AY1H 2OX5B 4P3CH 3UXFA 1DO5A 1AAJA 1E43A 4FULA 1NBZB 5K39A 1NSNL 4N0CD 5IG7B 3ZSTA 5SWSE 4ZFGL 4R8WL 5HDBF 3VFTA 3E6FA 2X4SA 1UA6L 4WKXA 4PWKA 5H2BB 4FFWD 4P57B 3RFZC 4U1MA 4IKKA 3QXDB 4Y4KC 4NKIL 4TULH 1LWRA 1SJEA 5GRJH 3ARFB 3B2UC 4YS4A 2Q7NA 1IAOB 3DX2A 1RZFH 1L0YA 3WU1A 2BVQA 4D3CH 5FYJD 4BSJA 5SX5K 1IAKA 2JJVA 2P28B 3L3OA 3FQWA 4YE4H 1SQ2N 4KXZI 4NN5B 4PY7A 3SDCB 2OTUB 3CVHL 4XPAL 4QJ3B 5EC2B 2Z31D 4H2CA 4CL7A 4OLWH 2EH8L 4YZFE 3UBXI 3LKSB 4M03A 4WFEE 3S9DB 2RA1A 4WI9A 1F8TH 3A4DA 4M62L 5E6UB 3IDUA 2WC7A 2R0ZH 1RZ8B 5EV7A 4NCC1 1XDTT 1BD2A 4OZHF 3RIKA 3VDCA 4HPYL 3KCPB 3ULUL 3LQZA 4CAGA 9CGTA 1ERNA 3RI5F 1F2XK 3EYVA 5C09A 5FFOA 3I75A 1G4RA 3F05A 4OCYH 1NA8A 2HMIC 3N1PC 4GIPD 1RLBA 2VWEC 4MHHG 4TXVB 3M86A 2H0PA 4XVUC 5F7UA 2AQSA 4DKEL 4TN9A 5HVHC 2IO5A 3WYRA 2VLLA 4XNZB 4GRLA 4PIBA 3BZ4B 3CMGA 3KPOA 3MODH 1JWMB 1A9BA 1CFTB 3QHFH 1V5JA 2X44D 5DD1L 4HX1B 3ISRA 2X89D 5IROA 4HJSA 5TE4L 1PZ5A 2DBLH 4ZO8A 3BOVA 2G75A 3BGAA 5KG9A 4CVXB 2NY3B 4PJ7E 6TAAA 4EDXB 1MCHA 4PS3A 4HBCH 5I19H 1KYUA 3GS0A 3QZNA 4DKTA 4UM9B 2FCBA 1NMAL 2J1XA 1KGCE 1OPGL 4YSCA 4IGBA 3EGDB 3LS4L 5AZEL 2DQHL 4G5ZH 3WTSA 1Z1WA 3QG7L 1B4TA 1ADQA 3FB5B 2FE0A 4WU5A 3ZO9A 5E2WH 5T33H 3ESPA 1U8OB 1U93A 2X1WL 5HGDB 3HUJB 5E8EB 1A6AA 1QKZH 3DHUA 3BPOB 4WWKB 4X6BA 1MVYA 2CKBH 4Q56A 4Z7VF 2A9NH 1NBYB 1ZJAA 2X4OB 3FZUD 4PWGA 1EZUA 4PGBA 4NNXA 2ARJB 4WHCA 4ZTOL 1HTYA 1PSKL 1UD3A 1QLFA 2V3EA 3VRIB 1SVBA 4OZFG 4JFTA 3ZIMA 2Y69B 4BQCA 5EZJB 4CNIB 2CALA 4Q9QH 5EU6A 3ULVL 4TVPE 3V6ZB 3WAJA 1R3LB 2TRYA 4UUJA 1M7DB 4O58H 2BSED 4P2CG 3U7AA 4F20A 2H32A 3S5ZA 3O0RL 4Z95H 5ETUA 1TIUA 2QPEB 2YXWA 4EKXA 5CAYB 2NY5L 2K6WA 3ZGIA 4GBXD 5CZXD 4X6CF 4YIQB 4B7IA 4BRJA 3K2MC 2CK0L 4M5ZL 1KBPA 1T5WA 3NZSA 4H8QA 2WMPB 1ZPLA 4H8WC 4NIKB 4A6YH 1HH9A 1O9VA 4WWNA 5AYTA 1P7QA 2H8PA 4HIJB 4YSRA 5EEYA 3L17A 2VERN 3ERXA 5J6HB 3MJ8B 3NCFB 1AXSB 3BUIA 3NSJA 3KYOA 3SO5A 4CN4A 3J07A 1R34A 2BWIA 3EHBC 2Z92A 3RYMA 2J8HA 4Z3FA 5B4MC 1D2PA 3IYLW 1JRHL 2Y22A 2FUQA 4O2EB 1D5MB 5TH2A 3OGOE 2WXQA 1NCJA 5F70A 4XBPA 4KOBA 3F6IA 5CGYC 4R4NC 4PRBB 1Y7VA 2G9HB 5DZAA 4DAGH 3VI4A 1IMHC 3FT4B 3VXSA 4E9TA 1ZVHA 2LAAA 4P05A 2X4UB 2XXGA 2NY4B 4JJOA 3T9WA 2ZT9C 5FDWA 3MDJA 1ZLSL 4JZOA 3FTWA 3Q8EA 5F96L 1KC5H 2RJMA 2A6KB 1OAXL 1NANH 1K5NA 4LOVA 2NCMA 3PCYA 1OE2A 2V2WB 1A7OL 1HWWA 1QLEB 1E28B 3NIDF 1AYOA 5SWSB 4N1CA 1D9KB 1KGIA 3KLQA 3BPCA 3O6KL 4QOKB 1Q9LB 3R7QA 5I6OA 1S78D 5KN5A 4Z7UF 1T0NB 1J48A 1CD1B 2J2ZA 3O4OB 3RGVC 3UG4A 1KC5L 4IK6A 2AXGA 4YHOL 2QPDB 4YXHL 5KSAC 4PJCE 1UXWA 1U6AH 4PJHE 4AMXA 1DSWA 2X4NB 4C83B 5MP6H 1EBAA 2R29A 2BVPA 3I6SA 5GS3A 2AV1B 3BMWA 3GZPA 1IM9D 3PV6A 4OF6A 1TQCB 1X7QA 2QKSA 3HAEB 1N8OE 3NG5A 5CS7A 1RJLA 4J27A 2ALAA 3BXNA 4MNQE 1M9SA 2XRAL 1VRSA 3SZ6A 1NZRA 4P06A 3U9PL 4IK7A 5I5RA 1E4JA 2YN3A 2NSMA 3NBNA 3CTTA 2XI9A 2FBJL 1CN4A 2FYYA 3H9SD 3D1MC 4G1EB 5J11C 4XXWA 2BY2A 2H9GA 3FH8A 2XWBB 3VX0A 4M3HA 1NIFA 1VADB 4PN6A 2OTPA 1ASPA 1W16A 3H4FA 4GO9A 2AMUA 4LLVB 1I1AD 3RTQD 2DQ6A 4QRPA 3UYRH 5LBVA 1DQIA 1QI4A 3QI9D 2VNCA 5T1LB 4FQHB 1SYSB 1KT2A 5E6IC 3RNKA 5FB8B 6FABL 3LPWA 4OIBA 5JHBA 4BQBA 1HXKA 3S4SB 4PJAF 5GZNC 3BEVA 5JMRA 3GUTA 5I66A 5I6PA 3SQRA 2J88L 4I18B 3V8OA 2G3MA 1OCWL 5J8OA 2N4IA 3CSYA 3ECQA 3WTXA 3KPSE 5IB5A 5D2NC 1BMWA 5C0RH 1BVKA 2OL3H 1LXMA 1XGUA 2V5SA 3FK3A 3BAKA 4OLUL 3WAKA 3OKKA 3CFJB 3D69B 3TWYA 2FK9A 3EYUH 3OHXA 3SDCC 1NL0H 3MRKA 1AQ8A 4LMQE 1DANU 1H3GA 2C9QA 1EEYB 3MUGB 1ZPUA 2YD3A 2ZOLB 3G9AB 2NY2B 4NQSA 4OUUA 1L7TL 2R51A 4XCNB 1L7IL 2DQGL 3IRPX 1BGXH 3MUGA 4R2GB 5FF6B 2A4CA 5LGJA 1MIEL 5ALBH 2EP6A 3D69A 2HT4C 4NZTL 1L9MA 2L04A 1H3TA 1OAKH 2ZF9A 4AYMC 2OV0A 3HS8A 4DERA 5L6YH 1GZQA 3FTGA 3V0EA 3BFOA 1NFDA 4L2YA 4X7SL 2JI2A 1J8RA 5LG1A 3LKNB 2CLVB 3MFFA 4HK3J 4MA8H 4YQXL 1XGRA 3HRZA 1F2QA 3HHSB 4XCYA 5I73C 2OCJA 1JPFB 1NJ9A 3N40F 1AO7E 4KUCD 2W95A 1T2XA 3O2DH 2GJZA 3FTVA 5K9JH 2R59A 4EF3A 2IBZX 4A6YA 3DVGB 3GMOB 5E51A 1SDDB 2E7HA 1WH0A 2H0FA 2YC1A 3HR6A 1O7SA 1JP5A 4JE4B 4ZG1A 2VDKH 1L6ZA 2MCAA 3SDAC 1GY2A 1OAXH 2B7DT 4JPQA 2XFGB 4KKLC 3OJMB 1CTMA 4HZLB 2EYTB 4NM4H 2P5EB 4QTHB 4EAEA 1YNKL 5GIRB 1AIFB 4EN3B 1OXYA 2VERA 1JVLA 3NFNB 3O4LE 3Q43A 4POZC 2ROXA 1CE6A 4QYOB 3WKPA 3LKRA 5KVMC 2J6EL 3RDTB 1RHFA 5F7DB 1SY6A 4ZW8A 1UWXH 1VZHA 2ITDA 2JB5L 1TQSA 3MC0A 3VG0H 1RULL 3KHQA 1PFOA 5JPNA 1MCNA 4RLDA 5DHYA 3K91A 4XMPL 3PV6B 3IGKA 2Y24A 1E4KC 1OSZB 3GB7A 2ISDA 2X1QA 4PRHB 3OLDA 5J06A 5FWQA 3R8BB 5EHFA 1WGOA 4ZTOH 3A4FA 3DTXB 2DJSA 4LQ1A 1NC2D 1F6AA 4AGQA 3STZB 2YLKA 2ZOKB 2GAZA 4W6YB 5KN5B 2BNRE 1NFKA 2IC2A 5DZPA 4DW2H 4U1LB 4KTGA 3DROB 4XMZA 1JZHA 1VPOH 5E7BA 1JPSH 4AIXA 3VFPA 1IKNA 4I8DA 1TO5A 2CSPA 3GIZL 5D1ZB 5I8EB 1UT2A 1G4MA 2YAPA 4QUOA 3ZY7A 4IBZA 2H0JA 4YFLF 1DJIA 4FXKB 1SHSA 1D5XB 4KRPC 5E5MB 1G7JA 3VFUB 2COVD 4U1IA 3UOAB 3CFBA 4XVSH 3V4LA 2UX6A 3Q3GB 3H0TB 3DWTA 2F61A 1I9JL 3B7TA 1XIWB 4XT1C 5LGHL 2YO3A 1F6LL 3NZHL 3VD7A 2R1XB 2O6PA 4MA7H 3OB0K 2AGJH 3O3EB 1HOCB 3IE9A 5JIDA 3PHSA 1D5MA 4YOKA 3LZRA 3FHEA 4E36A 4HIHB 5J3HD 3P0YL 3OF6D 3HZMA 3Q8CA 3ATFA 3EO9L 4PJEE 3NAAH 3QUXB 3BH4A 1A7NH 4YGAB 3V95A 1KBWA 1LL1A 1FFPB 4XN4A 4JDZB 2GCYB 4KHXL 3QQ9D 1G6RH 1PDKB 1DBML 4O9HL 5LAXA 3QCUL 3AG2B 3HPLB 2FIRT 5C07D 4IOIB 4L4TD 4DQOH 2X4QB 2QQLH 4NFCA 4NRXB 4JCLA 1I8IA 4IIZA 5DEFA 1ZHNB 4JE0A 1XV8A 1NAML 3QW9A 4XOBA 1V3MA 2C4XA 3EDEA 4S2SB 1SUHA 2B5IB 5CIPA 4NUJA 3MJWA 3TNMA 3NYKA 3OL2A 4W9KC 2NMSA 3QORA 2CCLA 4HUVA 3QXWA 5AB9A 4UCFA 1L5GA 2WKLA 5BOZG 2YBRB 2NXZC 3DX3A 2VC2L 5FA3A 1JYWA 3CWGA 4AQAB 1J1OL 4U1HA 4EO5A 1KYFA 2IQ9H 4ZMXA 3OD3A 2QQLL 4D0BA 3VACA 1X5YA 5TDOA 3D0LB 3IJHB 1LE9A </