5TKWA

1.35 angstrom resolution crystal structure of a pullulanase-specific type ii secretion system integral cytoplasmic membrane protein gspl (n-terminal fragment; residues 1-237) from klebsiella pneumoniae.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
236
structure length
236
Chain Sequence
NKINASPQAMLIVRLAAAQAPLHWQLFAPGEPHHEASGRWPTDDASPFPALAEQYPAWVLIPASDCAFHSLTLPAGLRKPPLQVAPFLLEEQLADDVEATHFALLHRQQAQCEIVAVQRQKMRDWLARCESLSLQPLALTPDVLALPWQPPAWSAVQVDEQWLIRHQPWGGMAAENVWLTELLQSEAEEHVIDSYSPPPAAPGVWREQPAQTLLTLAARHPAAQKLSLLQGEFAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type II secretion system protein L
publication title 1.35 Angstrom Resolution Crystal Structure of a Pullulanase-specific Type II Secretion System Integral Cytoplasmic Membrane Protein GspL (N-terminal fragment; residues 1-237) from Klebsiella pneumoniae.
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
molecule tags Hydrolase
total genus 56
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2016-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05134 T2SSL Type II secretion system (T2SS), protein L
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.370 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5tkwA02
3.30.420.380 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5tkwA01
4PHTX 1YF5L 2BH1A 1W97L 5TKWA
chains in the Genus database with same CATH superfamily
4BACA 1T3VA 2YKMA 3MK6A 2J4RA 1KVAA 3M8SA 4WQ5A 2IGIA 1T8EA 2CH6A 3LANA 4HUGA 3HVTA 4HWIA 3S9HA 3OYDA 5CZ1A 5C15A 5FDLA 4LF4K 4UY8O 3IRXA 3DJCA 4CESA 3LPTA 4F8RA 5F2RA 2V52B 3AVFA 3HM9A 1SL0A 5BN9A 1KTQA 2G8HA 3EY1A 4A5BA 4JI0K 4M3WA 4KHQA 4IFVA 3O5BA 3TWHA 1UOCA 1QHTA 5AQIA 5CY4A 4BQLA 3IAYA 1WLJA 1JLAA 4FJMA 3EE9A 3WXMB 4X64K 3CC4N 1IH7A 3EKUA 2LSNA 4DTUA 4FM1A 4E0DA 2NNWA 5KPTA 4DSLA 1BI4A 4FK0A 3V9SA 3ZCMA 1C1CA 1VSJA 1JLCA 3QB0A 2O8CB 1NJWA 1J6ZA 2WONA 4IWVA 5E26A 3MDQA 3OYHA 3DXMA 3ZX0A 4J2DA 1RT7A 3J8AA 3NGIA 3U9ZA 3VETA 1KFDA 4J2BA 1D4XA 1ASWA 4H8KA 2ITGA 4WCEL 5JVHL 3CFRA 1CXUA 4CJRA 2Y1IA 4B3OA 3F2KA 4AHUA 2WBNA 2P9UA 3QLHA 1NGHA 3KLHA 1GLDG 5M1PA 4FCYA 4DSFA 3CJ1A 4W5QA 4ISGA 1BCMA 2HHUA 1OVQA 5AQWA 4DB3A 1CZBA 3NVKA 5KI6A 3HPOA 3O9QA 3CC7N 4HTUA 3HP6A 2X6NA 4KB0A 4F9OA 2QWRA 4OPKA 1VK0A 1TYQB 1Q9XA 1JJ2M 2P9NA 2OA8A 3E66A 2FSNA 4AM6A 4CJ7A 1QSYA 1KSPA 4OKKA 3NFAA 4E7IA 5I42A 3CCVN 3KJVA 4CJUA 3PO4A 2UUCK 4B9LA 1KVBA 4IG3A 3LP2A 3PIPL 3HT3A 1YJWN 4O0JA 1L3VA 3DLKA 4M3RA 2F9WA 5AQYA 3IMXA 5J2MA 3L2WA 1VSEA 4LF6K 3BF3A 3KHYA 4GNIA 1NG9A 1KD1O 2ZJRL 3G71N 3A2FA 3KZBA 3VN5A 1KXPA 3OJSA 4FXDA 2Z1GA 1NMDA 5EXWA 4C8OA 4NXNK 1WSEA 3OYCA 4AM7A 3KLEA 5GADP 4FJKA 4DTRA 5BR9A 2Z1HA 3CQYA 4RW8A 2CGJA 3CMAN 3HO1A 2DY4A 1XQSC 3MEDA 4Y1DA 4CZMA 1K6YA 1NLVA 3P5JA 4O8UA 2E6MA 3KVGA 3TABA 4B1UB 3QNNA 1ASUA 1JCGA 2KQ2A 4DHYA 3VOVA 4Z4EA 4WQ4A 3OS1A 1W2BM 4I6MA 1NMNA 1BGXT 2ZQBA 4Z4IA 4O5FA 1J5EK 4CGHA 3MN7A 2OZMA 2FSKA 3VF6A 5JVGL 2BE2A 2OPPA 5E41A 5C2FA 4BRNA 4CFAA 3QINA 3V81A 3NGYA 3DLLL 3DXMB 3ISNC 4N47A 3RSEB 1BWFO 3VQPA 4KHNA 3IKMA 1U49A 4BVPA 5HL7L 1D9DA 4AH9A 1YXQA 4U7BA 3LP3A 1K73O 1C0TA 4DUZK 2FF6A 2P9UB 3T1HK 4OX9K 1QVFM 4QS7A 3FZLA 2W6KA 4E7JA 3TANA 3V9UA 4O0IA 4JI7K 4LD0A 4JI1K 2R7YA 4NB4A 4MDBA 3FLCO 3S3OA 3AGRA 3AA5X 4C8LA 3SAHA 4JI8K 3H45C 2VGMA 2QKBA 3KKSA 1TGOA 3DWLA 3CC2N 4FWPA 3PX4A 1IBKK 1N33K 2XRIA 1T6DA 4F2RA 2P9KA 3AVBA 5AZJA 3M3ZA 2GWKA 1YT3A 1SQKA 3RMAA 1VSKA 4OPAA 3AVIA 4B9UA 4JI6K 2NUBA 4M63C 2HHTA 4IBNA 2IVPA 5JS2A 2FC0A 3HTVA 4CGIA 4YOYA 1CXQA 3CFPA 1HUXA 3AVNA 3FZKA 1ZBHA 1XHXA 3L0QA 3H46O 3DLRA 4FZYA 3VGLA 3AVCA 3SJHA 5H1SQ 3ZT1A 2HBMA 3O08A 4NLBA 4O44A 1RT3A 4JKHA 1HNIA 3P38A 4JD2A 3A5MC 3K5MA 3VQ7A 2E20A 1QS4A 3K57A 2BANA 3BF1A 3EZ5A 2D0AA 5CZ2A 2ASPA 3WQTA 4F3OA 5A2QO 1YJ9N 3QBWA 3SAFA 2DFEA 3NMUA 3FZHA 2BUPA 1U04A 5SWMA 3D45A 3L8BA 4BVOA 1O13A 3CQXA 4WQ5C 4FK4A 4FWSA 4MLEA 3J7YP 3L2QA 4LH4A 3PSIA 4I6MB 3ZT3A 4FLYA 1EQYA 2GUPA 3JAMO 3NHGA 3ZSOA 4BR9A 5AR0A 4L8RB 4FJNA 4DG1A 5FPNA 4F2SA 4M42A 1HX1A 4HCBA 4K43A 2E2OA 3OYGA 4X62K 3K5NA 4AF1A 1XHZA 4EZ9A 3V4IA 2Q36A 3DOLA 3TAFA 4EIAA 5FLXO 4KHUA 5HP1A 1XI1A 3UKRA 3E01A 3RRGA 3CCRN 1ATSA 1RTDA 4F3TA 1HNWK 3TPQA 1P8ZA 3Q7BA 1TL1A 2PY5A 3CETA 4CIEA 2UUAK 2Q31A 2WOMA 4BC3A 4FLZA 2HHHK 3NCIA 1WSHA 1O1WA 3HK2A 3ENOA 1OKJA 2UYTA 2A1RA 2I5JA 2IDOA 3MX5A 3C95A 1WN7A 3D2EA 1RILA 3GL1A 2O8FA 3SI6A 3BEXA 3TAGA 3AVHA 2E5LK 1TUUA 3HSTB 5TKYA 5EVZA 4CJLA 2JGUA 5AQHA 3NGZA 3SJJA 2YCHA 4O55A 3NH0A 4CJEA 3ZSWA 2VWKA 3CI5A 1QZ5A 3CJAA 4A61A 2W40A 2D1KA 5AQSA 1L3TA 1VSFA 4BWJA 4CJSA 5KPZA 1ZBUA 3QNOA 1J9AA 4LF9K 3CD6N 2NRZA 4G1QA 3DLEA 4BC4A 4BRCA 4CZIA 3SMSA 3L2RA 1YVUA 2P51A 3G25A 1OVYA 4CVNE 2XY5A 3HP9A 1RDDA 3FFKB 4LC9B 1NJIO 2G8WA 1A5XA 4HUEA 1NJXA 4DTSA 3OBYA 3PIOL 3ZSRA 3SV4A 3EKSA 3I0RA 1DGKN 3BDPA 4KRFA 4B8CA 3F73A 4NCGA 3BY5A 4JI5K 2O8EA 1BG3A 4YOVA 1KC8O 3O4NA 1VQ9N 5C12A 5AQLA 4I2PA 1VSDA 4CIFA 4NCAA 3MCAB 4L3QA 1WAFA 4OPJA 3AVKA 1W0HA 1Y64A 2YHXA 4OLBA 3HSCA 2RPIA 3H6EA 3QEVA 4DUYK 4CJKA 3S3MA 4Q5VA 1Q18A 4BRFA 4Y1CA 3OHRA 2KKZA 4DSJA 4CEDA 3CJBA 2YI1A 4A5AA 3VQ8A 1UAXA 1S3XA 3ATVA 1RGIA 3LP1A 4BDPA 4OJRA 3P1GA 2HHQA 4CZJA 4O4GA 4M3TA 5D3GA 3EO3A 3VQ4A 3ZETA 1QQMA 2FBYA 1VQON 4CF0A 1ILYA 3UKRB 3TAPA 3A5LC 3T3FA 4RWTA 5HRRA 4H5RA 2KTQA 3LP0A 1S6PA 4DR6K 4B3SK 2CH5A 2WUSA 2QI2A 4FZXC 4KHPK 2ZJPL 3CCQN 4DR2K 3LAKA 1EX4A 1NWKA 4DMNA 1IO2A 1B9DA 1Q8IA 3SUQA 1QQCA 2PYJA 3D2EB 4YDUC 4Z0UA 1DT9A 1S9EA 1EWQA 1Z6RA 4U67L 4DSKA 2A1SA 4FZZA 4B1WB 3MWTA 1ZBSA 2RF2A 3SLCA 3J7AP 1NGJA 1RTJA 2QXLA 1BUPA 3PX6A 3DRSA 3I8DA 4B1VA 3E9LA 1X9MA 3UB5A 3QDKA 3DOKA 5J2QA 3WEEB 4CZEA 1RTHA 2VG7A 4MO4A 4E7KA 3SQ1A 1RBUA 4DLEA 2YX6A 1SUQA 3NAEA 1K8KA 2ZM6K 4JKAA 3FFIA 3IDHA 1G15A 3LDNA 3CCSN 4E1NA 3ID6A 4BR7A 1L3SA 1HYSA 1WNSA 3BZKA 4FSVA 2O8BA 3M1FA 1ZBFA 4LSLA 3I0SA 4G9ZA 4LFCK 2ITMA 1GOBA 2QXFA 2Y1JA 2D5RA 3NF9A 1TK5A 4ZHRA 1KAYA 2HF4A 4MDAA 3QMLA 4CBWA 1LWEA 2ZF5O 1N6QA 1JLFA 4CF2A 1FXXA 3EE8A 4FLTA 2PZSA 4B9SA 4DV5K 2E2NA 3QEPA 1T6CA 3PLAA 2YNGA 3P31A 5M1QA 3UKUB 4B9VA 2IOCA 3PSFA 4A59A 1S1TA 3NE6A 4N56A 2Z1IA 5ADXA 4AHRA 1IV0A 4DV7K 5FPMA 4DWIA 3HYFA 4OPHA 2VG5A 1VQ4N 4CFCA 3OYNA 4E7HA 2B4JA 3AO3A 3G10A 3ZX3A 1C1AA 3P83D 4JRPA 3CPEA 3RMDA 4BG8A 5KQ8A 5AQFA 2FSJA 3EEQA 4GW6A 2VCPA 1XMQK 3O3FA 1G99A 3C7NA 4IDKA 3OYBA 2F7TA 4CJ5A 3VGKA 1I3AA 3VEVA 1BA0A 1UA1A 4JAXA 4KBOA 5M1NA 3V1RA 4M7YA 1RBSA 4CF8A 4CHNA 2IVNA 4DQQA 4JKDA 3ZSVA 3RVCA 3AVJA 3HXMA 4IFYA 3WXLA 4BGAA 3C6TA 2F4VK 1Z05A 3ZT2A 2JWKA 2W41A 4B9QA 1JKHA 2AP1A 3AV9A 4JHDA 2O8DB 4M3YA 2E1ZA 1EETA 3TAQA 2WFBA 3LPUA 1NJYA 2NRTA 5J2PA 4H0YB 3CCMN 4ELTA 3D6RA 3A0IX 4DSIA 1GLEG 1WUAA 4LFBK 2YHWA 4ISFA 5HRPA 4ILHA 1D9FA 1WSJA 1SKRA 5CHIA 4K0KK 3KKRA 1IKYA 1IKVA 4I7FA 4FO0A 2W42A 1YITN 2XY8A 5HRNA 1J54A 4M41A 4AHTA 2Q0RA 1TKXA 3OYJA 1VQ5N 5LMUK 1GLFO 1HNZK 3LZIA 2HB5A 1S22A 3CMEN 3O9TA 1JCEA 1RT4A 4CEEA 2QWNA 1HYZA 3VQ9A 3KK3A 4DU4A 2XO7A 4LF7K 2Q97A 3ZEUB 3DM2A 2YHYA 1HKGA 4DQRA 1U47A 3AVAA 3MN9A 3JSMA 1HJRA 2X6SA 3V9WA 4KHWA 4DTPA 3OW2M 3DLGA 2O4GA 4BY9C 4CHZA 2BGGA 4EHUA 4A57A 1SL2A 4PY5A 3BP8A 4FVMA 4KO0A 2F9TA 3SQ0A 2FBVA 4A62A 1JLQA 2EHGA 4H4OA 2BH1A 4DF4A 3SK3A 5FPDA 3THWA 2YHBA 5KPRA 3Q7CA 4CW7B 3OS2A 5CR4A 2AJQA 4FJ7A 1MU2A 2O4IA 1Z25A 4HCCA 4ICLA 4BR0A 3TR8A 3QIPA 1L5UA 3PX0A 3PY8A 4N76A 1YI2N 3NH2A 2DFHA 2HBJA 4IFEA 3K5OA 5DM6L 2FLOA 2HHVA 5HRSA 3ZSYA 4DTNA 1IBMK 3D2FA 3NF7A 3CM6A 1N8RO 5ELZA 4O5BA 4WFNL 1A5WA 1H1VA 1T05A 4CEFA 1BI4B 1TKDA 1ZXOA 4RW6A 4DU1A 3QICA 4FL9A 3J80O 4IEIA 5LJWA 4OVLA 4KTZA 2ZJQL 2V51B 2E1YA 4XH5A 4C1NK 3QETA 4YDUA 4H03B 1FJGK 5AFUA 1IG9A 2CGKA 3VGMA 1S72N 5M1FA 4DR5K 3THYA 3S3NA 4OLAA 3OY9A 2EX3A 1LW2A 4E1JA 4NYNA 3AA4A 3WXIA 1X3MA 1REVA 1W9HA 1VQPN 2HSTA 3C6AA 4J8FA 4EFHA 3IFRA 3OTOK 3W0LA 2Q0UA 4OO1J 2IIRA 1K9MO 1QQNA 3L6QA 3P39A 2DTUA 1HMVA 2NRHA 1RFQA 2GBZA 2KLAA 3SZ2A 1QVGM 4IXCA 3GG4A 1GLBG 3E9PA 3TSQA 4B1YB 3NF8A 1KFSA 1ZBLA 4FWOA 1LWCA 2IC3A 3PV8A 3DI6A 1VQNN 3U8XA 3SUNA 4BRLA 4GMJB 3NF6A 3K58A 3OYMA 5C2DA 3SV3A 4H0XB 2P9NB 2W6LA 4CCHA 4KH6A 4DLGA 1YIJN 2RHKA 3RTVA 5AQNA 2VQEK 3H08A 1LAWA 3MEEA 1TK0A 4DFPA 1JLGA 1X1PA 4Z4GA 3NVMA 1NGIA 3O80A 1DTQA 4IOCL 1DKGD 2RN2A 3ULEA 4BWMA 4DKWA 4H0PA 4IEEA 4DR1K 3THWB 3CYMA 4QS9A 4FYDA 2HHSA 2WC9A 3HVRA 4JI4K 3R3LA 4X65K 4FW2A 3F9KA 3AO2A 4B08A 4PL7A 3QESA 4H0TB 3B6PA 4FWMA 4KI4A 3ZSXA 4M7XA 4CEBA 2B6AA 4FPAA 3MMVA 4ISEA 5C0YA 1RDAA 2ASOA 4YORA 1EO1A 1HPMA 4K8ZA 1YVNA 3DXKA 3D2FB 2D0BA 4ILJA 1P90A 1R0AA 4DTMA 2NRRA 1VQKN 2NZTA 2GX9A 3LAMA 3VA3A 1VHXA 4WE1A 3CJ7A 1NGFA 4BDYA 1LV5A 3MX2A 3MN5A 3O4QA 1BISA 3CFOA 2F96A 1WBBA 2I7PA 4E7LA 4DR4K 2KZZA 1KLMA 3VQBA 4IO9L 5EU7A 3HOSA 2OYQA 4F4KA 1Q7YO 3VF2A 3VQAA 1T44A 1WOQA 5FRMA 4CGFA 2RE2A 3KWIA 1N34K 3K59A 4DTOA 4CK3A 2QA4N 4MQ3A 3C6UA 5CYMA 4YOUA 5GIOA 2HNDA 5GAEP 1JLBA 1BIUA 3VEXA 3RWUA 1HLUA 2YKNA 1HRHA 4CK1A 3O1BA 4BROA 4GVMA 4M3ZA 2KZMA 4CJQA 4CEAA 4HHTA 3RR8A 4QCLA 1SKWA 2JWLA 3LL3A 3SBTA 4R79A 4DS5A 4KHYA 3VF4A 2DPNA 1OH5A 3WNGA 2E2PA 3SCXA 4FJ9A 2Z1JA 3HI0A 4QOZB 2HMPA 1TAQA 2P9KB 1SL1A 4BRKA 5AZJB 4KHSA 4FM0A 3WXKA 1VQ7N 1X3NA 1VQ6N 5AQPA 4H5TA 3VENA 4KTWA 3GOIA 5SZTA 1W7AA 2NRXA 3D7EO 4B9MA 2B5JA 4GV3A 1R59O 2VG6A 3LZJA 1ESVA 1EKEA 1MWKA 3QEWA 4CK2A 2NRWA 1IJJA 3B6OA 4J2EA 4I9QA 2QEXN 4CD1A 1VSLA 3VQDA 2YJFA 1SKSA 3PUFA 3R1XA 5AQKA 4BR4A 2QWLA 4CZHA 5AQRA 2QTDA 5AZIA 4BRIA 4JK9A 4EHTA 4JKCA 4C23A 3JYTA 3OYFA 3THVA 4PA1A 5CYQA 1VQ8N 4JD2B 1NK8A 3V1OA 2ETJA 3GBTA 4CZFA 5AJ3K 1VAZA 2BDPA 5EY4A 4CFDA 4H4MA 5AQQA 5J1EA 4XIUA 1UWBA 3ZSZA 4FJLA 4NO7A 3ASMA 2OPSA 3L3VA 3QFPA 3TAEA 1TK8A 1E4FT 4BQZA 1KLNA 3CJCA 4CJTA 5DK5A 3G4SN 2BTFA 2XHBA 4FWNA 4JK8A 4AHSA 4DF8A 2IAJA 4JLHA 3KIOA 5DMRA 2XY6A 3AO1A 4ZTFA 3UIQA 2PBDA 5KRTA 4BREA 1VQLN 3S41A 1YUWA 2P5GA 2FXUA 1XUPO 2XY7A 1A5VA 2A40A 3LWLA 4DQSA 3OA9A 4QS8A 3ULDA 4EP4A 4JV5K 4JKEA 1E3MA 1HJOA 3ZX2A 1W97L 3CG7A 2P9LA 1NK5A 1HQUA 3ATUA 1XWLA 5AQGA 2FF3B 4E3SA 1J5OA 2D0OA 3WNHA 3HPGA 3O9RA 4GV9A 3AO4A 3AARA 3N4QA 4CJ4A 5LJVA 3WNFA 4FPBA 3DMJA 1MWMA 4ELVA 1U45A 3VEOA 2VQFK 3PO5A 3P4IA 1IG8A 4OKEA 3LDSA 4B9NA 3OYKA 3AVMA 4I2QA 3FZFA 4FK2A 4FJIA 2GWJA 2X74A 3CCJN 1BOTO 2X78A 1QTMA 3HBTA 2O8FB 3OVNA 1BHLA 4FJ5A 3LDQA 1NGCA 3SNNA 3T69A 2QKKA 1YHQN 2NRVA 4CF1A 1RNHA 4YFUA 3OYEA 4JI3K 5AQMA 4BE2A 4OGCA 4BRMA 5GAHP 5KGXA 4LF8K 4YOXA 4Y0WA 2ATQA 1GLCG 3VQEA 4MFBA 3CIPA 4DTXA 2E88A 3V9XA 2F8SA 4FJJA 4DR3K 4Q0BA 1X9SA 1S1VA 3FR0A 3FZMA 2HMIA 1FKPA 4ID5A 1QZ6A 3LDLA 4EZ6A 3RRHA 1ATRA 2OCEA 4BC5A 3R9PA 3MECA 3W3DA 4HVJA 4CHQA 4DFKA 4WFBL 4N41A 1NOYA 2D0CA 2I7NA 4OKJA 4CJ3A 2ZE2A 5KGWA 3H3OB 4NLCA 4UQGA 1S9GA 3WNEA 4GV6A 4ID1A 4AQYK 2O8CA 2GTDA 2O8EB 1RBTA 1UA0A 3B8AX 3M8RA 3O9UA 5JLFA 1B92A 3KLIA 4EAHD 4KPYA 4AHVA 4CGDA 3C65A 4BRHA 1TKZA 4JK7A 2GELA 2VGNA 2ASMA 3ENBA 5AQUA 3C0BA 5HLFA 3MWPA 4M45A 5FPEA 3F9MA 3KTQA 1NK4A 3U3GA 1OH7A 2P9LB 4RG8A 3ZETB 1YTAA 3L3UA 5C42A 2D4WA 4PUOA 4JYAK 3MN6A 3RMCA 5T7BA 3OYLA 4J2AA 1TYQA 3J7ZO 1NGAA 1X9JA 3CPWM 3TAMA 3VPZA 2DFFA 1ITGA 3CHWA 4W5NA 2OTLN 1RT6A 4IO8A 5BPLA 2HHXA 2E2QA 5KRSA 1BQMA 3AA3A 4CGJA 4JS5A 3QEIA 2QK9A 4PL8A 4BR2A 4NCBA 3EL2A 3VA0A 4B1ZA 1NBWA 2HNZA 3BUZB 3U3YA 3VMFB 4CGGA 1WBDA 3O4WA 4CJWA 2HVIA 3AAQA 5C24A 4I9LA 3KWGA 2E4LA 1VSMA 2UUBK 2QWOA 2A42A 5FROA 5M1KA 4RW4A 4CJPA 4XEIA 3A5OC 3NDKA 3WT0A 2HW3A 2P9PA 1S1XA 2VYPA 3O9SA 1RT1A 4JS4A 1KVCA 1JL1A 2H3GX 3E9OA 1EP4A 3K0SA 1NK9A 3T1YK 5KQDA 3GDQA 1K8KB 3O8MA 1WAJA 4H0OA 3IUCA 4CJFA 3AAPA 4WF9L 2O8BB 4Z4CA 1YTUA 3ALYA 1IKXA 1Q9YA 4DV1K 3M8PA 1VRTA 1HQEA 3C6HA 5HOOA 2G8VA 3VTHA 3DAWA 3H1VX 4B3TK 1BQNA 2WTUA 1XC9A 3RSEA 1GLJO 1QQOA 4K41A 3H1QA 2V7ZA 4E89A 4ELUA 3QERA 2P9SA 1KAXA 4BRAA 1LW0A 4DS4A 3I56N 4DQIA 1I94K 1JXBA 2P9IA 4LFAK 3CM5A 4V19S 3I8BA 2QWMA 1K8AO 5GAGP 3ID8A 4DR7K 4KFBA 5JMVA 4CD3A 3GE1A 4IG0A 1Z26A 2E8AA 1CZAN 4BRPA 2OTJN 4PHTX 2CGLA 1RT5A 3MCPA 3CQ8A 3G6EN 4CZLA 3R6MA 1NKBA 3SBGA 1ZC6A 3SAGA 1CZ9A 2HBKA 1YAGA 4JNEA 4CFBA 1NKCA 4K8XA 1KQSM 3O3GA 3C7NB 1ASVA 1HKCA 2G8UA 1SS6A 5HROA 5EOYA 2ZD1A 3WQUA 5AQXA 4ILGB 1IBLK 2AA4A 2YJEA 4IDHA 4W5TA 4IOAL 4H0VB 4PKHA 2FBTA 4C1NI 1CLQA 2A5XA 4YHHK 3TTFA 4JRQA 4AILC 3T7ZA 4M3XA 4XH4A 4TSXA 1BIZA 4FW1A 4JHDB 4CBXA 5LL6Z 5BRFA 1VSIA 4DU3A 4BC2A 4HTLA 3VEWA 1VRUA 3KK2A 2OPRA 5F1XA 2HVHA 4CBUA 3MAQA 4LF5K 2OANA 1GLAG 2QM1A 2P9PB 4XH1A 4FLVA 3I33A 4QAGA 3DLHA 4JKGA 3SPZA 1N5YA 4BRQA 3MXIA 1XMOK 3FGUA 3CERA 3ZT4A 2HNYA 2YHAA 1VQMN 4B1XB 3KD1E 3ZLJA 1U2VA 3IS9A 3VQQA 4FM2A 1HNXK 4FLWA 3HOTA 1RCHA 5AQTA 3QBXA 2ZWHA 4GY2B 4YY3K 1KCFA 5ADXH 4B3MK 3D0PA 3HJFA 1N32K 1MDUB 3TU5A 4FWLA 4W5OA 3TARA 5AQVA 4DQ8A 3E1YA 1V4TA 1NGDA 3M6GA 1XNQK 2YV0X 3EYZA 1YJNN 4HUFA 4WFAL 1U48A 2G8IA 2Q2RA 2P9SB 5KTQA 3VESA 1RT2A 1T03A 3L4QA 1BDGA 1SV5A 2P9IB 3DRRA 3EN9A 3KD5E 1MA9B 3CJ9A 4CECA 3KK7A 5BN8A 1NM1A 3BGRA 2QWQA 2YNIA 1WSIA 1U6ZA 2YNHA 3LDPA 2A41A 4BE0A 3VQ5A 4JI2K 5AQOA 1SAZA 4CEOA 3OYAA 4PWDA 3CXCM 3O1WA 4FWRA 4IZ9A 1RBRA 4R5PA 1C1BA 4FLUA 4IKFA 4FJ8A 1S6QA 3L4IA 4OGEA 1NU0A 1XNRK 5K14A 4FLXA 4JKFA 4DV4K 4LSNA 1TUYA 1E4GT 4RCHA 3VERA 1QE1A 3UE5A 4RW9A 5HBMA 3K9KA 1T7PA 1HKBA 4BGBA 4CI6A 3DLBA 3M5RA 3THXA 5I3UA 2GEMA 3G0ZA 1Q81O 4KV8A 3OBWA 2GUIA 2E6LA 2KHOA 4C8NA 4H5NA 3EZWA 2Q3SA 3LDOA 4FJGA 2G8KA 3TTDA 4DTJA 3F5TA 4DCHA 3SUOA 5FRNA 3BZCA 4JN4A 3WXJA 4GVEA 4GKJK 4GKKK 3OS0A 4JEPA 1L3UA 3JS6A 1S1UA 2YNFA 3CF5L 4DV6K 1NK6A 4JKGB 5DM7L 3T19A 3AVLA 4EP5A 3J81O 1LOTB 3KLGA 2HBLA 3C94A 3SQ4A 1NGGA 3AA2A 1U2VB 3THYB 1HPZA 3RMBA 2JLEA 4KAZA 4CERA 5LY3A 1TKTA 4Z94A 4B9TA 1LAVA 1VSHA 3H3NO 3HRGA 4MO5A 4K42A 4KKOA 1BA1A 4BRGA 5JS1A 4FJHA 1KRPA 3HPHA 1M1KO 1NGBA 2IVOA 3QO9A 1U4BA 3U9DA 4ZTJA 1NK7A 1FKOA 3ITHA 1SZ2A 5MLCQ 1TV6A 2KFNA 1WSGA 5JICA 4KH5A 1JCFA 2VWJA 3N4PA 1FW6A 4A2BA 1GOAA 1GLLO 1RBVA 3VQ6A 3CCLN 3LM9A 3ENHA 1GOCA 3A8YA 5JLHA 3FE1A 2KW4A 4LH5A 4YNQA 3JXUA 3ULEB 2UXDK 1I39A 1NGEA 1NK0A 4YOWA 3RR7A 3O3HA 4FWKA 4FOIA 4H5WA 2OPQA 2PFUA 2V7YA 1RTIA 2RKIA 1J53A 4C8KA 3AO5A 4RTFD 2KFZA 2EWSA 1DLOA 4FWQA 3U6FA 1LCUA 4KI6A 3WEEA 1C0UA 3K9JA 3MXJA 4CF9A 2G8FA 3SQ2A 1QHAA 1BL3A 4KH4A 5IT9O 5LMNK 3THXB 4Z4HA 4M3UA 1C0MA 1JLEA 1NJZA 2P5OA 3VEYA 5AFUH 3DXKB 1HYVA 3U4LA 4FVUA 5EX5A 1BCOA 1ATNA 3MEGA 1B9FA 1DEJA 1RDWX 4YOTA 4CJVA 1EXQA 1RDUA 3TI0A 2HHWA 4B3RK 1NKEA 3QFUA 3LM2A 5BPMA 4BRDA 1BU6O 3K2PA 4K25A 5GIPA 4NXMK 1EWRA 4WYBA 4CZKA 4CHPA 1FK9A 3QEXA 1JL2A 1KAZA 4DV0K 2A6AA 4CEZA 3CCUN 5B8HA 1D8YA 5I9EB 5BREA 4E1MA 4KB1A 5C10A 3T1AA 3VQCA 3UKUA 4BDZA 4C8MA 1WB9A 4DSEA 1HR0K 1F21A 3QIOA 2IS3A 3O6WA 3V1QA 4CZGA 5AQJA 4CHOA 4PQUA 5J2NA 5BR8K 1DTTA 3OJUA 3A5NC 1ZBIA 2A3ZA 2ZGZA 1C0GA 4KTQA 3K5LA 2NLXA 4WQ4C 3KK1A 2VWBA 2P1JA 3ZT0A 1Q86O 4Z4FA 4BR5A 4BE1A 3L2VA 1TVRA 4LY7A 1M90O 1OH6A 3ZSQA 5BRHA 1JXEA 3V6DA 2HOEA 2HF3A 2QWPA 4NYFA 1D5AA 1YF5L 4CE9A 1RDBA 4IOXA 2ZGYA 3LALA 3NH1A 3ZYYX 3DRPA 3L2UA 4E19A 3M8QA 3R8EA 4X66K 3KLFA 5AZIB 3AY9A 1Q82O 5M1OA 2O8DA 3TSPA 4B8AB 1QSSA 4O8KA 3AVGA 5F0XA 2OZSA 1N36K 4CEQA 4DFJA 5CE3A 3MXMA 4AHCA 2UXCK 5GINA 2QW9A 3TSUA 1OH8A 1QSLA 1IKWA 1TL3A 4PKIA 3TTCA 3CCEN 3HL8A 3VEZA 1ZYQA 4JKBA 5AQZA 3DYAA 1S1WA 1TAUA 4DQPA 1XC3A 4FJXA 1Y97A 2UXBK 1HNVA 1BO5O 2D0PA 5C25A 3SYZA 4IJAA 4W5RA 3SUPA 3WUHA 3HM8A 3HZ6A 3OYIA 2FBXA 4CIGA 1NNEA 5IWAK 3LWMA 4PKGA 4FOEA 2PAVA 1RDCA 3I55N 4DV3K 1NOZA 2GV9A 5E84A 1X9WA 4DFMA 4H5VA 4RW7A 5TKWA 4A2AA 2PYLA 4BG9A 4IJNA 1S5JA 3IG1A 3V9ZA 3SPYA 3ZEUA 1WSFA 3AGKA 1V4SA 4CHYA 1LWFA 4MLHA 4KREA 3VTIA 1C0FA 4N5SA 5BRDA 1C6VA 4DV2K 3SMPA 2UU9K 2F8TA 2Q1NA 5BPNA 3NBPA
chains in the Genus database with same CATH topology
1T3VA 4BRFA 4C1NI 3MK6A 2J4RA 3OHRA 2A5XA 2KKZA 3CJBA 2NRRA 3TTFA 2YI1A 2NZTA 2GX9A 4A5AA 4WQ5A 1VQKN 2CH6A 1S3XA 3T7ZA 3CJ7A 1NGFA 3ATVA 1RGIA 4HWIA 4XH4A 3MX2A 3MN5A 5C15A 4CZJA 4UY8O 4JHDB 3EO3A 2I7PA 4CBXA 5BRFA 3DJCA 3ZETA 1QQMA 4BC2A 5F2RA 4IO9L 2V52B 1VQON 4HTLA 3VEWA 1ILYA 5BN9A 3UKRB 3HOSA 5F1XA 3A5LC 4A5BA 4CBUA 3VF2A 1Q7YO 1T44A 1WOQA 2OANA 1GLAG 2QM1A 2RE2A 2P9PB 3KWIA 4XH1A 4RWTA 3I33A 3O5BA 4H5RA 2QA4N 4JKGA 5AQIA 2CH5A 4YOUA 4BQLA 4BRQA 3FGUA 2WUSA 5GIOA 2QI2A 3CERA 2ZJPL 5GAEP 3CCQN 3EE9A 3WXMB 3VEXA 3CC4N 1VQMN 1HLUA 3EKUA 4B1XB 1NWKA 1U2VA 3O1BA 4BROA 3HOTA 3D2EB 5AQTA 4YDUC 3QBXA 1DT9A 2ZWHA 2NNWA 1Z6RA 4GY2B 4U67L 2JWLA 3LL3A 3SBTA 4B1WB 4R79A 5ADXH 5KPTA 5BPNA 3VF4A 2DPNA 3MWTA 1MDUB 1ZBSA 3TU5A 4FWLA 2E2PA 5AQVA 3E1YA 1NGJA 3SLCA 4DQ8A 2QXLA 1BUPA 3HI0A 1V4TA 1NGDA 3M6GA 2HMPA 2P9KB 1YJNN 4BRKA 4WFAL 5AZJB 2Q2RA 2P9SB 4B1VA 3E9LA 3QB0A 1J6ZA 3VESA 3WXKA 1X3NA 4IWVA 3UB5A 5E26A 1VQ7N 1VQ6N 3MDQA 3QDKA 4H5TA 3DXMA 5AQPA 3VENA 3J8AA 3ZX0A 3WEEB 4CZEA 3GOIA 3U9ZA 3VETA 2NRXA 1D4XA 3D7EO 3L4QA 1BDGA 4GV3A 1R59O 4MO4A 2P9IB 4WCEL 5JVHL 3EN9A 2YX6A 1ESVA 1MWKA 1MA9B 3F2KA 3CJ9A 2WBNA 2P9UA 1K8KA 2NRWA 4JKAA 1NGHA 1IJJA 1GLDG 3IDHA 3KK7A 5M1PA 5BN8A 1NM1A 2QEXN 3LDNA 4CD1A 2QWQA 3CCSN 3CJ1A 2YJFA 3ID6A 3R1XA 5AQKA 4BR4A 4FSVA 2QWLA 4BR7A 4ISGA 4CZHA 5AQRA 2QTDA 5AZIA 3M1FA 4BRIA 1U6ZA 4JK9A 4EHTA 4G9ZA 3LDPA 2A41A 4JKCA 2ITMA 5AQWA 4DB3A 4C23A 5AQOA 3NVKA 1SAZA 1VQ8N 4JD2B 3CXCM 3O1WA 4FWRA 3O9QA 1KAYA 4IZ9A 2HF4A 3CC7N 4MDAA 3QMLA 4CBWA 3GBTA 4CZFA 1VAZA 5EY4A 2ZF5O 3L4IA 4F9OA 2QWRA 4JKFA 5AQQA 1TYQB 1JJ2M 3EE8A 1TUYA 2P9NA 1E4GT 4RCHA 3VERA 2E2NA 3E66A 4NO7A 1T6CA 2FSNA 4AM6A 3QFPA 4CJ7A 3PLAA 3UE5A 1E4FT 4BQZA 3CJCA 3P31A 3G4SN 5M1QA 2BTFA 3UKUB 3CCVN 4FWNA 4JK8A 3K9KA 4A59A 1HKBA 4BGBA 4CI6A 3M5RA 2PBDA 4BREA 5ADXA 3PIPL 1VQLN 2GEMA 3S41A 5FPMA 1YJWN 1YUWA 1Q81O 4OPHA 4EHUA 3OBWA 1VQ4N 2FXUA 1XUPO 2KHOA 2F9WA 2A40A 4H5NA 5AQYA 3IMXA 3EZWA 3LDOA 3BF3A 3KHYA 3OA9A 4GNIA 4QS8A 3TTDA 3F5TA 1KD1O 4DCHA 3ZX3A 2ZJRL 3G71N 4JKEA 1HJOA 4JN4A 3WXJA 3KZBA 3CPEA 4GVEA 3ZX2A 1W97L 1KXPA 4BG8A 5KQ8A 2P9LA 5AQFA 4JEPA 3ATUA 2FSJA 2VCPA 1NMDA 3JS6A 5AQGA 5EXWA 3CF5L 2FF3B 4AM7A 5GADP 4JKGB 5DM7L 5BR9A 1G99A 2D0OA 3C7NA 2F7TA 3VGKA 3O9RA 3CQYA 4GV9A 2CGJA 3VEVA 1BA0A 1LOTB 3AARA 3CMAN 4JAXA 1XQSC 2HBLA 4KBOA 5M1NA 3N4QA 4O8UA 1NLVA 1NGGA 4M7YA 4CZMA 1U2VB 5LJVA 3KVGA 2IVNA 4FPBA 1MWMA 4JKDA 3VEOA 4B1UB 3RVCA 3P4IA 1IG8A 5LY3A 1JCGA 4DHYA 3VOVA 4Z94A 4WQ4A 3H3NO 1W2BM 3WXLA 3FZFA 4BGAA 3HRGA 4I6MA 4MO5A 2GWJA 3CCJN 1BOTO 4K42A 1Z05A 4O5FA 1BA1A 4BRGA 3HBTA 3MN7A 2JWKA 2W41A 4B9QA 2AP1A 2FSKA 4JHDA 3VF6A 5JVGL 3LDQA 1NGCA 1M1KO 1NGBA 2E1ZA 2IVOA 3T69A 2WFBA 5C2FA 4BRNA 3U9DA 2NRTA 3DLLL 3DXMB 4H0YB 3CCMN 3RSEB 3D6RA 1BWFO 1YHQN 3IKMA 3A0IX 2NRVA 4BVPA 1GLEG 1SZ2A 1WUAA 5MLCQ 2YHWA 5AQMA 5HL7L 4ISFA 4ILHA 4BRMA 5GAHP 1YXQA 4U7BA 1K73O 5JICA 4KH5A 2FF6A 1JCFA 2P9UB 1QVFM 4QS7A 4YOXA 3FZLA 4Y0WA 5CHIA 3N4PA 1GLCG 4A2BA 3CIPA 1GLLO 2E88A 4FO0A 3CCLN 3LM9A 1YITN 3ENHA 3A8YA 5JLHA 3FE1A 3FR0A 4NB4A 4MDBA 3FLCO 3FZMA 3AGRA 1QZ6A 3JXUA 3ULEB 3LDLA 3SAHA 2Q0RA 1ATRA 4BC5A 1VQ5N 3R9PA 3H45C 1NGEA 3W3DA 2VGMA 1GLFO 4YOWA 4WFBL 3DWLA 3CC2N 4FWKA 4FWPA 4FOIA 4H5WA 2I7NA 1S22A 3CMEN 1T6DA 2P9KA 2PFUA 2V7YA 3H3OB 3O9TA 1JCEA 4NLCA 5AZJA 3M3ZA 2QWNA 4RTFD 4GV6A 2GWKA 1SQKA 2GTDA 2EWSA 2Q97A 3ZEUB 4FWQA 1LCUA 4OPAA 2YHYA 1HKGA 3WEEA 3B8AX 3K9JA 3O9UA 5JLFA 3MN9A 1QHAA 4M63C 4EAHD 2IVPA 4KH4A 3C65A 4BRHA 3HTVA 4JK7A 4YOYA 3OW2M 2GELA 2VGNA 1HUXA 5AFUH 3DXKB 3VEYA 3U4LA 3FZKA 4BY9C 4FVUA 3L0QA 2ASMA 3ENBA 3H46O 3C0BA 5AQUA 1ATNA 3MWPA 5EX5A 3VGLA 4A57A 3SJHA 5H1SQ 1DEJA 2HBMA 1RDWX 3BP8A 3O08A 4NLBA 4YOTA 4JKHA 3F9MA 5FPEA 1RDUA 2F9TA 2P9LB 4A62A 3P38A 4JD2A 3A5MC 3QFUA 2BH1A 3SK3A 5FPDA 3LM2A 5BPMA 3ZETB 4BRDA 1BU6O 2E20A 5KPRA 3Q7CA 4K25A 5GIPA 2D4WA 4WYBA 3BF1A 3MN6A 4CZKA 2ASPA 3WQTA 5CR4A 1KAZA 1TYQA 1YJ9N 3J7ZO 3QBWA 3SAFA 2A6AA 3CCUN 3NMUA 1NGAA 5B8HA 5I9EB 3FZHA 5BREA 2BUPA 1X9JA 4BVOA 1O13A 3CQXA 4WQ5C 3CPWM 5C10A 3UKUA 3VPZA 4BR0A 4FWSA 4MLEA 3CHWA 2OTLN 4IO8A 5BPLA 1YI2N 2E2QA 4I6MB 2HBJA 4IFEA 5DM6L 3O6WA 2FLOA 1EQYA 4CZGA 2GUPA 4BR9A 5AQJA 3D2FA 5AR0A 1N8RO 5ELZA 4PL8A 4BR2A 4WFNL 3EL2A 1H1VA 4B1ZA 3A5NC 1NBWA 3BUZB 5FPNA 2A3ZA 3VMFB 2ZGZA 3O4WA 1C0GA 1HX1A 1ZXOA 4K43A 2E2OA 3AAQA 3QICA 4AF1A 2NLXA 4WQ4C 2VWBA 3KWGA 4FL9A 2Q36A 4EIAA 2QWOA 4IEIA 5LJWA 2A42A 1Q86O 5M1KA 2ZJQL 2V51B 2E1YA 4XH5A 3UKRA 4C1NK 4BR5A 4YDUA 4XEIA 3A5OC 4H03B 3CCRN 3WT0A 1ATSA 1M90O 5AFUA 2CGKA 3VGMA 3TPQA 2P9PA 5BRHA 1P8ZA 3Q7BA 1S72N 2HOEA 2VYPA 3O9SA 2HF3A 5M1FA 2QWPA 3CETA 2H3GX 3E9OA 1YF5L 4E1JA 2Q31A 5KQDA 3GDQA 1K8KB 4IOXA 3WXIA 4BC3A 2ZGYA 3O8MA 1X3MA 1VQPN 2HSTA 3C6AA 4J8FA 3ZYYX 4EFHA 3ENOA 1OKJA 3IFRA 2UYTA 3IUCA 4H0OA 3AAPA 3R8EA 4WF9L 3W0LA 2Q0UA 4OO1J 5AZIB 2IIRA 3AY9A 1K9MO 1QQNA 3D2EA 3GL1A 3MX5A 5M1OA 1Q82O 3BEXA 3L6QA 3P39A 1TUUA 2NRHA 1RFQA 3C6HA 2KLAA 1QVGM 3TSPA 5TKYA 4IXCA 5EVZA 5HOOA 3GG4A 3VTHA 1GLBG 3E9PA 3TSQA 3DAWA 4B1YB 5AQHA 3H1VX 4O8KA 2YCHA 4FWOA 5F0XA 3RSEA 1GLJO 1QQOA 1VQNN 4K41A 3U8XA 5CE3A 3H1QA 3CI5A 2V7ZA 4BRLA 1QZ5A 3CJAA 5GINA 2QW9A 5C2DA 2P9SA 4H0XB 1KAXA 2P9NB 4BRAA 3TSUA 4KH6A 4A61A 2W40A 2D1KA 5AQSA 2RHKA 3I56N 1YIJN 5AQNA 4PKIA 3TTCA 3CCEN 3VEZA 5KPZA 4JKBA 5AQZA 3CD6N 2P9IA 1XC3A 2NRZA 3NVMA 1NGIA 3O80A 3I8BA 4BC4A 4IOCL 1DKGD 1BO5O 2D0PA 4BRCA 4CZIA 2QWMA 1K8AO 5GAGP 3ID8A 4IJAA 3SMSA 3ULEA 3G25A 3WUHA 1OVYA 3HM8A 5JMVA 4CD3A 3HZ6A 4DKWA 3GE1A 4H0PA 4IEEA 4FOEA 4PKGA 2E8AA 2PAVA 3FFKB 4LC9B 4QS9A 1CZAN 4BRPA 3I55N 5E84A 4PHTX 1NJIO 2WC9A 2OTJN 2CGLA 3MCPA 4H5VA 3R3LA 5TKWA 4A2AA 3OBYA 3PIOL 3G6EN 4CZLA 3R6MA 3EKSA 4BG9A 3SBGA 1ZC6A 1DGKN 3SAGA 4IJNA 2HBKA 1YAGA 4JNEA 4PL7A 1BG3A 4H0TB 3ZEUA 1KQSM 3C7NB 4YOVA 4FWMA 1KC8O 3AGKA 1HKCA 1VQ9N 5C12A 4M7XA 5AQLA 1V4SA 1SS6A 3MCAB 4L3QA 4MLHA 5EOYA 1C0FA 3VTIA 4FPAA 5AQXA 3WQUA 3MMVA 4ISEA 5BRDA 5C0YA 2ASOA 4ILGB 4YORA 3SMPA 1EO1A 2AA4A 1HPMA 1Y64A 2YJEA 2YHXA 1YVNA 3HSCA 4IDHA 4IOAL 3H6EA 3DXKA 3D2FB 4H0VB 2Q1NA 4PKHA 4ILJA 1P90A 1Q18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHT X;  1YF5 L;  2BH1 A;  1W97 L;  5TKW A; 
#chains in the Genus database with same CATH topology
 4BAC A;  1T3V A;  2YKM A;  3MK6 A;  2J4R A;  1KVA A;  3M8S A;  4WQ5 A;  2IGI A;  1T8E A;  2CH6 A;  3LAN A;  4HUG A;  3HVT A;  4HWI A;  3S9H A;  3OYD A;  5CZ1 A;  5C15 A;  5FDL A;  4LF4 K;  4UY8 O;  3IRX A;  3DJC A;  4CES A;  3LPT A;  4F8R A;  5F2R A;  2V52 B;  3AVF A;  3HM9 A;  1SL0 A;  5BN9 A;  1KTQ A;  2G8H A;  3EY1 A;  4A5B A;  4JI0 K;  4M3W A;  4KHQ A;  4IFV A;  3O5B A;  3TWH A;  1UOC A;  1QHT A;  5AQI A;  5CY4 A;  4BQL A;  3IAY A;  1WLJ A;  1JLA A;  4FJM A;  3EE9 A;  3WXM B;  4X64 K;  3CC4 N;  1IH7 A;  3EKU A;  2LSN A;  4DTU A;  4FM1 A;  4E0D A;  2NNW A;  5KPT A;  4DSL A;  1BI4 A;  4FK0 A;  3V9S A;  3ZCM A;  1C1C A;  1VSJ A;  1JLC A;  3QB0 A;  2O8C B;  1NJW A;  1J6Z A;  2WON A;  4IWV A;  5E26 A;  3MDQ A;  3OYH A;  3DXM A;  3ZX0 A;  4J2D A;  1RT7 A;  3J8A A;  3NGI A;  3U9Z A;  3VET A;  1KFD A;  4J2B A;  1D4X A;  1ASW A;  4H8K A;  2ITG A;  4WCE L;  5JVH L;  3CFR A;  1CXU A;  4CJR A;  2Y1I A;  4B3O A;  3F2K A;  4AHU A;  2WBN A;  2P9U A;  3QLH A;  1NGH A;  3KLH A;  1GLD G;  5M1P A;  4FCY A;  4DSF A;  3CJ1 A;  4W5Q A;  4ISG A;  1BCM A;  2HHU A;  1OVQ A;  5AQW A;  4DB3 A;  1CZB A;  3NVK A;  5KI6 A;  3HPO A;  3O9Q A;  3CC7 N;  4HTU A;  3HP6 A;  2X6N A;  4KB0 A;  4F9O A;  2QWR A;  4OPK A;  1VK0 A;  1TYQ B;  1Q9X A;  1JJ2 M;  2P9N A;  2OA8 A;  3E66 A;  2FSN A;  4AM6 A;  4CJ7 A;  1QSY A;  1KSP A;  4OKK A;  3NFA A;  4E7I A;  5I42 A;  3CCV N;  3KJV A;  4CJU A;  3PO4 A;  2UUC K;  4B9L A;  1KVB A;  4IG3 A;  3LP2 A;  3PIP L;  3HT3 A;  1YJW N;  4O0J A;  1L3V A;  3DLK A;  4M3R A;  2F9W A;  5AQY A;  3IMX A;  5J2M A;  3L2W A;  1VSE A;  4LF6 K;  3BF3 A;  3KHY A;  4GNI A;  1NG9 A;  1KD1 O;  2ZJR L;  3G71 N;  3A2F A;  3KZB A;  3VN5 A;  1KXP A;  3OJS A;  4FXD A;  2Z1G A;  1NMD A;  5EXW A;  4C8O A;  4NXN K;  1WSE A;  3OYC A;  4AM7 A;  3KLE A;  5GAD P;  4FJK A;  4DTR A;  5BR9 A;  2Z1H A;  3CQY A;  4RW8 A;  2CGJ A;  3CMA N;  3HO1 A;  2DY4 A;  1XQS C;  3MED A;  4Y1D A;  4CZM A;  1K6Y A;  1NLV A;  3P5J A;  4O8U A;  2E6M A;  3KVG A;  3TAB A;  4B1U B;  3QNN A;  1ASU A;  1JCG A;  2KQ2 A;  4DHY A;  3VOV A;  4Z4E A;  4WQ4 A;  3OS1 A;  1W2B M;  4I6M A;  1NMN A;  1BGX T;  2ZQB A;  4Z4I A;  4O5F A;  1J5E K;  4CGH A;  3MN7 A;  2OZM A;  2FSK A;  3VF6 A;  5JVG L;  2BE2 A;  2OPP A;  5E41 A;  5C2F A;  4BRN A;  4CFA A;  3QIN A;  3V81 A;  3NGY A;  3DLL L;  3DXM B;  3ISN C;  4N47 A;  3RSE B;  1BWF O;  3VQP A;  4KHN A;  3IKM A;  1U49 A;  4BVP A;  5HL7 L;  1D9D A;  4AH9 A;  1YXQ A;  4U7B A;  3LP3 A;  1K73 O;  1C0T A;  4DUZ K;  2FF6 A;  2P9U B;  3T1H K;  4OX9 K;  1QVF M;  4QS7 A;  3FZL A;  2W6K A;  4E7J A;  3TAN A;  3V9U A;  4O0I A;  4JI7 K;  4LD0 A;  4JI1 K;  2R7Y A;  4NB4 A;  4MDB A;  3FLC O;  3S3O A;  3AGR A;  3AA5 X;  4C8L A;  3SAH A;  4JI8 K;  3H45 C;  2VGM A;  2QKB A;  3KKS A;  1TGO A;  3DWL A;  3CC2 N;  4FWP A;  3PX4 A;  1IBK K;  1N33 K;  2XRI A;  1T6D A;  4F2R A;  2P9K A;  3AVB A;  5AZJ A;  3M3Z A;  2GWK A;  1YT3 A;  1SQK A;  3RMA A;  1VSK A;  4OPA A;  3AVI A;  4B9U A;  4JI6 K;  2NUB A;  4M63 C;  2HHT A;  4IBN A;  2IVP A;  5JS2 A;  2FC0 A;  3HTV A;  4CGI A;  4YOY A;  1CXQ A;  3CFP A;  1HUX A;  3AVN A;  3FZK A;  1ZBH A;  1XHX A;  3L0Q A;  3H46 O;  3DLR A;  4FZY A;  3VGL A;  3AVC A;  3SJH A;  5H1S Q;  3ZT1 A;  2HBM A;  3O08 A;  4NLB A;  4O44 A;  1RT3 A;  4JKH A;  1HNI A;  3P38 A;  4JD2 A;  3A5M C;  3K5M A;  3VQ7 A;  2E20 A;  1QS4 A;  3K57 A;  2BAN A;  3BF1 A;  3EZ5 A;  2D0A A;  5CZ2 A;  2ASP A;  3WQT A;  4F3O A;  5A2Q O;  1YJ9 N;  3QBW A;  3SAF A;  2DFE A;  3NMU A;  3FZH A;  2BUP A;  1U04 A;  5SWM A;  3D45 A;  3L8B A;  4BVO A;  1O13 A;  3CQX A;  4WQ5 C;  4FK4 A;  4FWS A;  4MLE A;  3J7Y P;  3L2Q A;  4LH4 A;  3PSI A;  4I6M B;  3ZT3 A;  4FLY A;  1EQY A;  2GUP A;  3JAM O;  3NHG A;  3ZSO A;  4BR9 A;  5AR0 A;  4L8R B;  4FJN A;  4DG1 A;  5FPN A;  4F2S A;  4M42 A;  1HX1 A;  4HCB A;  4K43 A;  2E2O A;  3OYG A;  4X62 K;  3K5N A;  4AF1 A;  1XHZ A;  4EZ9 A;  3V4I A;  2Q36 A;  3DOL A;  3TAF A;  4EIA A;  5FLX O;  4KHU A;  5HP1 A;  1XI1 A;  3UKR A;  3E01 A;  3RRG A;  3CCR N;  1ATS A;  1RTD A;  4F3T A;  1HNW K;  3TPQ A;  1P8Z A;  3Q7B A;  1TL1 A;  2PY5 A;  3CET A;  4CIE A;  2UUA K;  2Q31 A;  2WOM A;  4BC3 A;  4FLZ A;  2HHH K;  3NCI A;  1WSH A;  1O1W A;  3HK2 A;  3ENO A;  1OKJ A;  2UYT A;  2A1R A;  2I5J A;  2IDO A;  3MX5 A;  3C95 A;  1WN7 A;  3D2E A;  1RIL A;  3GL1 A;  2O8F A;  3SI6 A;  3BEX A;  3TAG A;  3AVH A;  2E5L K;  1TUU A;  3HST B;  5TKY A;  5EVZ A;  4CJL A;  2JGU A;  5AQH A;  3NGZ A;  3SJJ A;  2YCH A;  4O55 A;  3NH0 A;  4CJE A;  3ZSW A;  2VWK A;  3CI5 A;  1QZ5 A;  3CJA A;  4A61 A;  2W40 A;  2D1K A;  5AQS A;  1L3T A;  1VSF A;  4BWJ A;  4CJS A;  5KPZ A;  1ZBU A;  3QNO A;  1J9A A;  4LF9 K;  3CD6 N;  2NRZ A;  4G1Q A;  3DLE A;  4BC4 A;  4BRC A;  4CZI A;  3SMS A;  3L2R A;  1YVU A;  2P51 A;  3G25 A;  1OVY A;  4CVN E;  2XY5 A;  3HP9 A;  1RDD A;  3FFK B;  4LC9 B;  1NJI O;  2G8W A;  1A5X A;  4HUE A;  1NJX A;  4DTS A;  3OBY A;  3PIO L;  3ZSR A;  3SV4 A;  3EKS A;  3I0R A;  1DGK N;  3BDP A;  4KRF A;  4B8C A;  3F73 A;  4NCG A;  3BY5 A;  4JI5 K;  2O8E A;  1BG3 A;  4YOV A;  1KC8 O;  3O4N A;  1VQ9 N;  5C12 A;  5AQL A;  4I2P A;  1VSD A;  4CIF A;  4NCA A;  3MCA B;  4L3Q A;  1WAF A;  4OPJ A;  3AVK A;  1W0H A;  1Y64 A;  2YHX A;  4OLB A;  3HSC A;  2RPI A;  3H6E A;  3QEV A;  4DUY K;  4CJK A;  3S3M A;  4Q5V A;  1Q18 A;  4BRF A;  4Y1C A;  3OHR A;  2KKZ A;  4DSJ A;  4CED A;  3CJB A;  2YI1 A;  4A5A A;  3VQ8 A;  1UAX A;  1S3X A;  3ATV A;  1RGI A;  3LP1 A;  4BDP A;  4OJR A;  3P1G A;  2HHQ A;  4CZJ A;  4O4G A;  4M3T A;  5D3G A;  3EO3 A;  3VQ4 A;  3ZET A;  1QQM A;  2FBY A;  1VQO N;  4CF0 A;  1ILY A;  3UKR B;  3TAP A;  3A5L C;  3T3F A;  4RWT A;  5HRR A;  4H5R A;  2KTQ A;  3LP0 A;  1S6P A;  4DR6 K;  4B3S K;  2CH5 A;  2WUS A;  2QI2 A;  4FZX C;  4KHP K;  2ZJP L;  3CCQ N;  4DR2 K;  3LAK A;  1EX4 A;  1NWK A;  4DMN A;  1IO2 A;  1B9D A;  1Q8I A;  3SUQ A;  1QQC A;  2PYJ A;  3D2E B;  4YDU C;  4Z0U A;  1DT9 A;  1S9E A;  1EWQ A;  1Z6R A;  4U67 L;  4DSK A;  2A1S A;  4FZZ A;  4B1W B;  3MWT A;  1ZBS A;  2RF2 A;  3SLC A;  3J7A P;  1NGJ A;  1RTJ A;  2QXL A;  1BUP A;  3PX6 A;  3DRS A;  3I8D A;  4B1V A;  3E9L A;  1X9M A;  3UB5 A;  3QDK A;  3DOK A;  5J2Q A;  3WEE B;  4CZE A;  1RTH A;  2VG7 A;  4MO4 A;  4E7K A;  3SQ1 A;  1RBU A;  4DLE A;  2YX6 A;  1SUQ A;  3NAE A;  1K8K A;  2ZM6 K;  4JKA A;  3FFI A;  3IDH A;  1G15 A;  3LDN A;  3CCS N;  4E1N A;  3ID6 A;  4BR7 A;  1L3S A;  1HYS A;  1WNS A;  3BZK A;  4FSV A;  2O8B A;  3M1F A;  1ZBF A;  4LSL A;  3I0S A;  4G9Z A;  4LFC K;  2ITM A;  1GOB A;  2QXF A;  2Y1J A;  2D5R A;  3NF9 A;  1TK5 A;  4ZHR A;  1KAY A;  2HF4 A;  4MDA A;  3QML A;  4CBW A;  1LWE A;  2ZF5 O;  1N6Q A;  1JLF A;  4CF2 A;  1FXX A;  3EE8 A;  4FLT A;  2PZS A;  4B9S A;  4DV5 K;  2E2N A;  3QEP A;  1T6C A;  3PLA A;  2YNG A;  3P31 A;  5M1Q A;  3UKU B;  4B9V A;  2IOC A;  3PSF A;  4A59 A;  1S1T A;  3NE6 A;  4N56 A;  2Z1I A;  5ADX A;  4AHR A;  1IV0 A;  4DV7 K;  5FPM A;  4DWI A;  3HYF A;  4OPH A;  2VG5 A;  1VQ4 N;  4CFC A;  3OYN A;  4E7H A;  2B4J A;  3AO3 A;  3G10 A;  3ZX3 A;  1C1A A;  3P83 D;  4JRP A;  3CPE A;  3RMD A;  4BG8 A;  5KQ8 A;  5AQF A;  2FSJ A;  3EEQ A;  4GW6 A;  2VCP A;  1XMQ K;  3O3F A;  1G99 A;  3C7N A;  4IDK A;  3OYB A;  2F7T A;  4CJ5 A;  3VGK A;  1I3A A;  3VEV A;  1BA0 A;  1UA1 A;  4JAX A;  4KBO A;  5M1N A;  3V1R A;  4M7Y A;  1RBS A;  4CF8 A;  4CHN A;  2IVN A;  4DQQ A;  4JKD A;  3ZSV A;  3RVC A;  3AVJ A;  3HXM A;  4IFY A;  3WXL A;  4BGA A;  3C6T A;  2F4V K;  1Z05 A;  3ZT2 A;  2JWK A;  2W41 A;  4B9Q A;  1JKH A;  2AP1 A;  3AV9 A;  4JHD A;  2O8D B;  4M3Y A;  2E1Z A;  1EET A;  3TAQ A;  2WFB A;  3LPU A;  1NJY A;  2NRT A;  5J2P A;  4H0Y B;  3CCM N;  4ELT A;  3D6R A;  3A0I X;  4DSI A;  1GLE G;  1WUA A;  4LFB K;  2YHW A;  4ISF A;  5HRP A;  4ILH A;  1D9F A;  1WSJ A;  1SKR A;  5CHI A;  4K0K K;  3KKR A;  1IKY A;  1IKV A;  4I7F A;  4FO0 A;  2W42 A;  1YIT N;  2XY8 A;  5HRN A;  1J54 A;  4M41 A;  4AHT A;  2Q0R A;  1TKX A;  3OYJ A;  1VQ5 N;  5LMU K;  1GLF O;  1HNZ K;  3LZI A;  2HB5 A;  1S22 A;  3CME N;  3O9T A;  1JCE A;  1RT4 A;  4CEE A;  2QWN A;  1HYZ A;  3VQ9 A;  3KK3 A;  4DU4 A;  2XO7 A;  4LF7 K;  2Q97 A;  3ZEU B;  3DM2 A;  2YHY A;  1HKG A;  4DQR A;  1U47 A;  3AVA A;  3MN9 A;  3JSM A;  1HJR A;  2X6S A;  3V9W A;  4KHW A;  4DTP A;  3OW2 M;  3DLG A;  2O4G A;  4BY9 C;  4CHZ A;  2BGG A;  4EHU A;  4A57 A;  1SL2 A;  4PY5 A;  3BP8 A;  4FVM A;  4KO0 A;  2F9T A;  3SQ0 A;  2FBV A;  4A62 A;  1JLQ A;  2EHG A;  4H4O A;  2BH1 A;  4DF4 A;  3SK3 A;  5FPD A;  3THW A;  2YHB A;  5KPR A;  3Q7C A;  4CW7 B;  3OS2 A;  5CR4 A;  2AJQ A;  4FJ7 A;  1MU2 A;  2O4I A;  1Z25 A;  4HCC A;  4ICL A;  4BR0 A;  3TR8 A;  3QIP A;  1L5U A;  3PX0 A;  3PY8 A;  4N76 A;  1YI2 N;  3NH2 A;  2DFH A;  2HBJ A;  4IFE A;  3K5O A;  5DM6 L;  2FLO A;  2HHV A;  5HRS A;  3ZSY A;  4DTN A;  1IBM K;  3D2F A;  3NF7 A;  3CM6 A;  1N8R O;  5ELZ A;  4O5B A;  4WFN L;  1A5W A;  1H1V A;  1T05 A;  4CEF A;  1BI4 B;  1TKD A;  1ZXO A;  4RW6 A;  4DU1 A;  3QIC A;  4FL9 A;  3J80 O;  4IEI A;  5LJW A;  4OVL A;  4KTZ A;  2ZJQ L;  2V51 B;  2E1Y A;  4XH5 A;  4C1N K;  3QET A;  4YDU A;  4H03 B;  1FJG K;  5AFU A;  1IG9 A;  2CGK A;  3VGM A;  1S72 N;  5M1F A;  4DR5 K;  3THY A;  3S3N A;  4OLA A;  3OY9 A;  2EX3 A;  1LW2 A;  4E1J A;  4NYN A;  3AA4 A;  3WXI A;  1X3M A;  1REV A;  1W9H A;  1VQP N;  2HST A;  3C6A A;  4J8F A;  4EFH A;  3IFR A;  3OTO K;  3W0L A;  2Q0U A;  4OO1 J;  2IIR A;  1K9M O;  1QQN A;  3L6Q A;  3P39 A;  2DTU A;  1HMV A;  2NRH A;  1RFQ A;  2GBZ A;  2KLA A;  3SZ2 A;  1QVG M;  4IXC A;  3GG4 A;  1GLB G;  3E9P A;  3TSQ A;  4B1Y B;  3NF8 A;  1KFS A;  1ZBL A;  4FWO A;  1LWC A;  2IC3 A;  3PV8 A;  3DI6 A;  1VQN N;  3U8X A;  3SUN A;  4BRL A;  4GMJ B;  3NF6 A;  3K58 A;  3OYM A;  5C2D A;  3SV3 A;  4H0X B;  2P9N B;  2W6L A;  4CCH A;  4KH6 A;  4DLG A;  1YIJ N;  2RHK A;  3RTV A;  5AQN A;  2VQE K;  3H08 A;  1LAW A;  3MEE A;  1TK0 A;  4DFP A;  1JLG A;  1X1P A;  4Z4G A;  3NVM A;  1NGI A;  3O80 A;  1DTQ A;  4IOC L;  1DKG D;  2RN2 A;  3ULE A;  4BWM A;  4DKW A;  4H0P A;  4IEE A;  4DR1 K;  3THW B;  3CYM A;  4QS9 A;  4FYD A;  2HHS A;  2WC9 A;  3HVR A;  4JI4 K;  3R3L A;  4X65 K;  4FW2 A;  3F9K A;  3AO2 A;  4B08 A;  4PL7 A;  3QES A;  4H0T B;  3B6P A;  4FWM A;  4KI4 A;  3ZSX A;  4M7X A;  4CEB A;  2B6A A;  4FPA A;  3MMV A;  4ISE A;  5C0Y A;  1RDA A;  2ASO A;  4YOR A;  1EO1 A;  1HPM A;  4K8Z A;  1YVN A;  3DXK A;  3D2F B;  2D0B A;  4ILJ A;  1P90 A;  1R0A A;  4DTM A;  2NRR A;  1VQK N;  2NZT A;  2GX9 A;  3LAM A;  3VA3 A;  1VHX A;  4WE1 A;  3CJ7 A;  1NGF A;  4BDY A;  1LV5 A;  3MX2 A;  3MN5 A;  3O4Q A;  1BIS A;  3CFO A;  2F96 A;  1WBB A;  2I7P A;  4E7L A;  4DR4 K;  2KZZ A;  1KLM A;  3VQB A;  4IO9 L;  5EU7 A;  3HOS A;  2OYQ A;  4F4K A;  1Q7Y O;  3VF2 A;  3VQA A;  1T44 A;  1WOQ A;  5FRM A;  4CGF A;  2RE2 A;  3KWI A;  1N34 K;  3K59 A;  4DTO A;  4CK3 A;  2QA4 N;  4MQ3 A;  3C6U A;  5CYM A;  4YOU A;  5GIO A;  2HND A;  5GAE P;  1JLB A;  1BIU A;  3VEX A;  3RWU A;  1HLU A;  2YKN A;  1HRH A;  4CK1 A;  3O1B A;  4BRO A;  4GVM A;  4M3Z A;  2KZM A;  4CJQ A;  4CEA A;  4HHT A;  3RR8 A;  4QCL A;  1SKW A;  2JWL A;  3LL3 A;  3SBT A;  4R79 A;  4DS5 A;  4KHY A;  3VF4 A;  2DPN A;  1OH5 A;  3WNG A;  2E2P A;  3SCX A;  4FJ9 A;  2Z1J A;  3HI0 A;  4QOZ B;  2HMP A;  1TAQ A;  2P9K B;  1SL1 A;  4BRK A;  5AZJ B;  4KHS A;  4FM0 A;  3WXK A;  1VQ7 N;  1X3N A;  1VQ6 N;  5AQP A;  4H5T A;  3VEN A;  4KTW A;  3GOI A;  5SZT A;  1W7A A;  2NRX A;  3D7E O;  4B9M A;  2B5J A;  4GV3 A;  1R59 O;  2VG6 A;  3LZJ A;  1ESV A;  1EKE A;  1MWK A;  3QEW A;  4CK2 A;  2NRW A;  1IJJ A;  3B6O A;  4J2E A;  4I9Q A;  2QEX N;  4CD1 A;  1VSL A;  3VQD A;  2YJF A;  1SKS A;  3PUF A;  3R1X A;  5AQK A;  4BR4 A;  2QWL A;  4CZH A;  5AQR A;  2QTD A;  5AZI A;  4BRI A;  4JK9 A;  4EHT A;  4JKC A;  4C23 A;  3JYT A;  3OYF A;  3THV A;  4PA1 A;  5CYQ A;  1VQ8 N;  4JD2 B;  1NK8 A;  3V1O A;  2ETJ A;  3GBT A;  4CZF A;  5AJ3 K;  1VAZ A;  2BDP A;  5EY4 A;  4CFD A;  4H4M A;  5AQQ A;  5J1E A;  4XIU A;  1UWB A;  3ZSZ A;  4FJL A;  4NO7 A;  3ASM A;  2OPS A;  3L3V A;  3QFP A;  3TAE A;  1TK8 A;  1E4F T;  4BQZ A;  1KLN A;  3CJC A;  4CJT A;  5DK5 A;  3G4S N;  2BTF A;  2XHB A;  4FWN A;  4JK8 A;  4AHS A;  4DF8 A;  2IAJ A;  4JLH A;  3KIO A;  5DMR A;  2XY6 A;  3AO1 A;  4ZTF A;  3UIQ A;  2PBD A;  5KRT A;  4BRE A;  1VQL N;  3S41 A;  1YUW A;  2P5G A;  2FXU A;  1XUP O;  2XY7 A;  1A5V A;  2A40 A;  3LWL A;  4DQS A;  3OA9 A;  4QS8 A;  3ULD A;  4EP4 A;  4JV5 K;  4JKE A;  1E3M A;  1HJO A;  3ZX2 A;  1W97 L;  3CG7 A;  2P9L A;  1NK5 A;  1HQU A;  3ATU A;  1XWL A;  5AQG A;  2FF3 B;  4E3S A;  1J5O A;  2D0O A;  3WNH A;  3HPG A;  3O9R A;  4GV9 A;  3AO4 A;  3AAR A;  3N4Q A;  4CJ4 A;  5LJV A;  3WNF A;  4FPB A;  3DMJ A;  1MWM A;  4ELV A;  1U45 A;  3VEO A;  2VQF K;  3PO5 A;  3P4I A;  1IG8 A;  4OKE A;  3LDS A;  4B9N A;  3OYK A;  3AVM A;  4I2Q A;  3FZF A;  4FK2 A;  4FJI A;  2GWJ A;  2X74 A;  3CCJ N;  1BOT O;  2X78 A;  1QTM A;  3HBT A;  2O8F B;  3OVN A;  1BHL A;  4FJ5 A;  3LDQ A;  1NGC A;  3SNN A;  3T69 A;  2QKK A;  1YHQ N;  2NRV A;  4CF1 A;  1RNH A;  4YFU A;  3OYE A;  4JI3 K;  5AQM A;  4BE2 A;  4OGC A;  4BRM A;  5GAH P;  5KGX A;  4LF8 K;  4YOX A;  4Y0W A;  2ATQ A;  1GLC G;  3VQE A;  4MFB A;  3CIP A;  4DTX A;  2E88 A;  3V9X A;  2F8S A;  4FJJ A;  4DR3 K;  4Q0B A;  1X9S A;  1S1V A;  3FR0 A;  3FZM A;  2HMI A;  1FKP A;  4ID5 A;  1QZ6 A;  3LDL A;  4EZ6 A;  3RRH A;  1ATR A;  2OCE A;  4BC5 A;  3R9P A;  3MEC A;  3W3D A;  4HVJ A;  4CHQ A;  4DFK A;  4WFB L;  4N41 A;  1NOY A;  2D0C A;  2I7N A;  4OKJ A;  4CJ3 A;  2ZE2 A;  5KGW A;  3H3O B;  4NLC A;  4UQG A;  1S9G A;  3WNE A;  4GV6 A;  4ID1 A;  4AQY K;  2O8C A;  2GTD A;  2O8E B;  1RBT A;  1UA0 A;  3B8A X;  3M8R A;  3O9U A;  5JLF A;  1B92 A;  3KLI A;  4EAH D;  4KPY A;  4AHV A;  4CGD A;  3C65 A;  4BRH A;  1TKZ A;  4JK7 A;  2GEL A;  2VGN A;  2ASM A;  3ENB A;  5AQU A;  3C0B A;  5HLF A;  3MWP A;  4M45 A;  5FPE A;  3F9M A;  3KTQ A;  1NK4 A;  3U3G A;  1OH7 A;  2P9L B;  4RG8 A;  3ZET B;  1YTA A;  3L3U A;  5C42 A;  2D4W A;  4PUO A;  4JYA K;  3MN6 A;  3RMC A;  5T7B A;  3OYL A;  4J2A A;  1TYQ A;  3J7Z O;  1NGA A;  1X9J A;  3CPW M;  3TAM A;  3VPZ A;  2DFF A;  1ITG A;  3CHW A;  4W5N A;  2OTL N;  1RT6 A;  4IO8 A;  5BPL A;  2HHX A;  2E2Q A;  5KRS A;  1BQM A;  3AA3 A;  4CGJ A;  4JS5 A;  3QEI A;  2QK9 A;  4PL8 A;  4BR2 A;  4NCB A;  3EL2 A;  3VA0 A;  4B1Z A;  1NBW A;  2HNZ A;  3BUZ B;  3U3Y A;  3VMF B;  4CGG A;  1WBD A;  3O4W A;  4CJW A;  2HVI A;  3AAQ A;  5C24 A;  4I9L A;  3KWG A;  2E4L A;  1VSM A;  2UUB K;  2QWO A;  2A42 A;  5FRO A;  5M1K A;  4RW4 A;  4CJP A;  4XEI A;  3A5O C;  3NDK A;  3WT0 A;  2HW3 A;  2P9P A;  1S1X A;  2VYP A;  3O9S A;  1RT1 A;  4JS4 A;  1KVC A;  1JL1 A;  2H3G X;  3E9O A;  1EP4 A;  3K0S A;  1NK9 A;  3T1Y K;  5KQD A;  3GDQ A;  1K8K B;  3O8M A;  1WAJ A;  4H0O A;  3IUC A;  4CJF A;  3AAP A;  4WF9 L;  2O8B B;  4Z4C A;  1YTU A;  3ALY A;  1IKX A;  1Q9Y A;  4DV1 K;  3M8P A;  1VRT A;  1HQE A;  3C6H A;  5HOO A;  2G8V A;  3VTH A;  3DAW A;  3H1V X;  4B3T K;  1BQN A;  2WTU A;  1XC9 A;  3RSE A;  1GLJ O;  1QQO A;  4K41 A;  3H1Q A;  2V7Z A;  4E89 A;  4ELU A;  3QER A;  2P9S A;  1KAX A;  4BRA A;  1LW0 A;  4DS4 A;  3I56 N;  4DQI A;  1I94 K;  1JXB A;  2P9I A;  4LFA K;  3CM5 A;  4V19 S;  3I8B A;  2QWM A;  1K8A O;  5GAG P;  3ID8 A;  4DR7 K;  4KFB A;  5JMV A;  4CD3 A;  3GE1 A;  4IG0 A;  1Z26 A;  2E8A A;  1CZA N;  4BRP A;  2OTJ N;  4PHT X;  2CGL A;  1RT5 A;  3MCP A;  3CQ8 A;  3G6E N;  4CZL A;  3R6M A;  1NKB A;  3SBG A;  1ZC6 A;  3SAG A;  1CZ9 A;  2HBK A;  1YAG A;  4JNE A;  4CFB A;  1NKC A;  4K8X A;  1KQS M;  3O3G A;  3C7N B;  1ASV A;  1HKC A;  2G8U A;  1SS6 A;  5HRO A;  5EOY A;  2ZD1 A;  3WQU A;  5AQX A;  4ILG B;  1IBL K;  2AA4 A;  2YJE A;  4IDH A;  4W5T A;  4IOA L;  4H0V B;  4PKH A;  2FBT A;  4C1N I;  1CLQ A;  2A5X A;  4YHH K;  3TTF A;  4JRQ A;  4AIL C;  3T7Z A;  4M3X A;  4XH4 A;  4TSX A;  1BIZ A;  4FW1 A;  4JHD B;  4CBX A;  5LL6 Z;  5BRF A;  1VSI A;  4DU3 A;  4BC2 A;  4HTL A;  3VEW A;  1VRU A;  3KK2 A;  2OPR A;  5F1X A;  2HVH A;  4CBU A;  3MAQ A;  4LF5 K;  2OAN A;  1GLA G;  2QM1 A;  2P9P B;  4XH1 A;  4FLV A;  3I33 A;  4QAG A;  3DLH A;  4JKG A;  3SPZ A;  1N5Y A;  4BRQ A;  3MXI A;  1XMO K;  3FGU A;  3CER A;  3ZT4 A;  2HNY A;  2YHA A;  1VQM N;  4B1X B;  3KD1 E;  3ZLJ A;  1U2V A;  3IS9 A;  3VQQ A;  4FM2 A;  1HNX K;  4FLW A;  3HOT A;  1RCH A;  5AQT A;  3QBX A;  2ZWH A;  4GY2 B;  4YY3 K;  1KCF A;  5ADX H;  4B3M K;  3D0P A;  3HJF A;  1N32 K;  1MDU B;  3TU5 A;  4FWL A;  4W5O A;  3TAR A;  5AQV A;  4DQ8 A;  3E1Y A;  1V4T A;  1NGD A;  3M6G A;  1XNQ K;  2YV0 X;  3EYZ A;  1YJN N;  4HUF A;  4WFA L;  1U48 A;  2G8I A;  2Q2R A;  2P9S B;  5KTQ A;  3VES A;  1RT2 A;  1T03 A;  3L4Q A;  1BDG A;  1SV5 A;  2P9I B;  3DRR A;  3EN9 A;  3KD5 E;  1MA9 B;  3CJ9 A;  4CEC A;  3KK7 A;  5BN8 A;  1NM1 A;  3BGR A;  2QWQ A;  2YNI A;  1WSI A;  1U6Z A;  2YNH A;  3LDP A;  2A41 A;  4BE0 A;  3VQ5 A;  4JI2 K;  5AQO A;  1SAZ A;  4CEO A;  3OYA A;  4PWD A;  3CXC M;  3O1W A;  4FWR A;  4IZ9 A;  1RBR A;  4R5P A;  1C1B A;  4FLU A;  4IKF A;  4FJ8 A;  1S6Q A;  3L4I A;  4OGE A;  1NU0 A;  1XNR K;  5K14 A;  4FLX A;  4JKF A;  4DV4 K;  4LSN A;  1TUY A;  1E4G T;  4RCH A;  3VER A;  1QE1 A;  3UE5 A;  4RW9 A;  5HBM A;  3K9K A;  1T7P A;  1HKB A;  4BGB A;  4CI6 A;  3DLB A;  3M5R A;  3THX A;  5I3U A;  2GEM A;  3G0Z A;  1Q81 O;  4KV8 A;  3OBW A;  2GUI A;  2E6L A;  2KHO A;  4C8N A;  4H5N A;  3EZW A;  2Q3S A;  3LDO A;  4FJG A;  2G8K A;  3TTD A;  4DTJ A;  3F5T A;  4DCH A;  3SUO A;  5FRN A;  3BZC A;  4JN4 A;  3WXJ A;  4GVE A;  4GKJ K;  4GKK K;  3OS0 A;  4JEP A;  1L3U A;  3JS6 A;  1S1U A;  2YNF A;  3CF5 L;  4DV6 K;  1NK6 A;  4JKG B;  5DM7 L;  3T19 A;  3AVL A;  4EP5 A;  3J81 O;  1LOT B;  3KLG A;  2HBL A;  3C94 A;  3SQ4 A;  1NGG A;  3AA2 A;  1U2V B;  3THY B;  1HPZ A;  3RMB A;  2JLE A;  4KAZ A;  4CER A;  5LY3 A;  1TKT A;  4Z94 A;  4B9T A;  1LAV A;  1VSH A;  3H3N O;  3HRG A;  4MO5 A;  4K42 A;  4KKO A;  1BA1 A;  4BRG A;  5JS1 A;  4FJH A;  1KRP A;  3HPH A;  1M1K O;  1NGB A;  2IVO A;  3QO9 A;  1U4B A;  3U9D A;  4ZTJ A;  1NK7 A;  1FKO A;  3ITH A;  1SZ2 A;  5MLC Q;  1TV6 A;  2KFN A;  1WSG A;  5JIC A;  4KH5 A;  1JCF A;  2VWJ A;  3N4P A;  1FW6 A;  4A2B A;  1GOA A;  1GLL O;  1RBV A;  3VQ6 A;  3CCL N;  3LM9 A;  3ENH A;  1GOC A;  3A8Y A;  5JLH A;  3FE1 A;  2KW4 A;  4LH5 A;  4YNQ A;  3JXU A;  3ULE B;  2UXD K;  1I39 A;  1NGE A;  1NK0 A;  4YOW A;  3RR7 A;  3O3H A;  4FWK A;  4FOI A;  4H5W A;  2OPQ A;  2PFU A;  2V7Y A;  1RTI A;  2RKI A;  1J53 A;  4C8K A;  3AO5 A;  4RTF D;  2KFZ A;  2EWS A;  1DLO A;  4FWQ A;  3U6F A;  1LCU A;  4KI6 A;  3WEE A;  1C0U A;  3K9J A;  3MXJ A;  4CF9 A;  2G8F A;  3SQ2 A;  1QHA A;  1BL3 A;  4KH4 A;  5IT9 O;  5LMN K;  3THX B;  4Z4H A;  4M3U A;  1C0M A;  1JLE A;  1NJZ A;  2P5O A;  3VEY A;  5AFU H;  3DXK B;  1HYV A;  3U4L A;  4FVU A;  5EX5 A;  1BCO A;  1ATN A;  3MEG A;  1B9F A;  1DEJ A;  1RDW X;  4YOT A;  4CJV A;  1EXQ A;  1RDU A;  3TI0 A;  2HHW A;  4B3R K;  1NKE A;  3QFU A;  3LM2 A;  5BPM A;  4BRD A;  1BU6 O;  3K2P A;  4K25 A;  5GIP A;  4NXM K;  1EWR A;  4WYB A;  4CZK A;  4CHP A;  1FK9 A;  3QEX A;  1JL2 A;  1KAZ A;  4DV0 K;  2A6A A;  4CEZ A;  3CCU N;  5B8H A;  1D8Y A;  5I9E B;  5BRE A;  4E1M A;  4KB1 A;  5C10 A;  3T1A A;  3VQC A;  3UKU A;  4BDZ A;  4C8M A;  1WB9 A;  4DSE A;  1HR0 K;  1F21 A;  3QIO A;  2IS3 A;  3O6W A;  3V1Q A;  4CZG A;  5AQJ A;  4CHO A;  4PQU A;  5J2N A;  5BR8 K;  1DTT A;  3OJU A;  3A5N C;  1ZBI A;  2A3Z A;  2ZGZ A;  1C0G A;  4KTQ A;  3K5L A;  2NLX A;  4WQ4 C;  3KK1 A;  2VWB A;  2P1J A;  3ZT0 A;  1Q86 O;  4Z4F A;  4BR5 A;  4BE1 A;  3L2V A;  1TVR A;  4LY7 A;  1M90 O;  1OH6 A;  3ZSQ A;  5BRH A;  1JXE A;  3V6D A;  2HOE A;  2HF3 A;  2QWP A;  4NYF A;  1D5A A;  1YF5 L;  4CE9 A;  1RDB A;  4IOX A;  2ZGY A;  3LAL A;  3NH1 A;  3ZYY X;  3DRP A;  3L2U A;  4E19 A;  3M8Q A;  3R8E A;  4X66 K;  3KLF A;  5AZI B;  3AY9 A;  1Q82 O;  5M1O A;  2O8D A;  3TSP A;  4B8A B;  1QSS A;  4O8K A;  3AVG A;  5F0X A;  2OZS A;  1N36 K;  4CEQ A;  4DFJ A;  5CE3 A;  3MXM A;  4AHC A;  2UXC K;  5GIN A;  2QW9 A;  3TSU A;  1OH8 A;  1QSL A;  1IKW A;  1TL3 A;  4PKI A;  3TTC A;  3CCE N;  3HL8 A;  3VEZ A;  1ZYQ A;  4JKB A;  5AQZ A;  3DYA A;  1S1W A;  1TAU A;  4DQP A;  1XC3 A;  4FJX A;  1Y97 A;  2UXB K;  1HNV A;  1BO5 O;  2D0P A;  5C25 A;  3SYZ A;  4IJA A;  4W5R A;  3SUP A;  3WUH A;  3HM8 A;  3HZ6 A;  3OYI A;  2FBX A;  4CIG A;  1NNE A;  5IWA K;  3LWM A;  4PKG A;  4FOE A;  2PAV A;  1RDC A;  3I55 N;  4DV3 K;  1NOZ A;  2GV9 A;  5E84 A;  1X9W A;  4DFM A;  4H5V A;  4RW7 A;  5TKW A;  4A2A A;  2PYL A;  4BG9 A;  4IJN A;  1S5J A;  3IG1 A;  3V9Z A;  3SPY A;  3ZEU A;  1WSF A;  3AGK A;  1V4S A;  4CHY A;  1LWF A;  4MLH A;  4KRE A;  3VTI A;  1C0F A;  4N5S A;  5BRD A;  1C6V A;  4DV2 K;  3SMP A;  2UU9 K;  2F8T A;  2Q1N A;  5BPN A;  3NBP A; 
#chains in the Genus database with same CATH homology
 1T3V A;  4BRF A;  4C1N I;  3MK6 A;  2J4R A;  3OHR A;  2A5X A;  2KKZ A;  3CJB A;  2NRR A;  3TTF A;  2YI1 A;  2NZT A;  2GX9 A;  4A5A A;  4WQ5 A;  1VQK N;  2CH6 A;  1S3X A;  3T7Z A;  3CJ7 A;  1NGF A;  3ATV A;  1RGI A;  4HWI A;  4XH4 A;  3MX2 A;  3MN5 A;  5C15 A;  4CZJ A;  4UY8 O;  4JHD B;  3EO3 A;  2I7P A;  4CBX A;  5BRF A;  3DJC A;  3ZET A;  1QQM A;  4BC2 A;  5F2R A;  4IO9 L;  2V52 B;  1VQO N;  4HTL A;  3VEW A;  1ILY A;  5BN9 A;  3UKR B;  3HOS A;  5F1X A;  3A5L C;  4A5B A;  4CBU A;  3VF2 A;  1Q7Y O;  1T44 A;  1WOQ A;  2OAN A;  1GLA G;  2QM1 A;  2RE2 A;  2P9P B;  3KWI A;  4XH1 A;  4RWT A;  3I33 A;  3O5B A;  4H5R A;  2QA4 N;  4JKG A;  5AQI A;  2CH5 A;  4YOU A;  4BQL A;  4BRQ A;  3FGU A;  2WUS A;  5GIO A;  2QI2 A;  3CER A;  2ZJP L;  5GAE P;  3CCQ N;  3EE9 A;  3WXM B;  3VEX A;  3CC4 N;  1VQM N;  1HLU A;  3EKU A;  4B1X B;  1NWK A;  1U2V A;  3O1B A;  4BRO A;  3HOT A;  3D2E B;  5AQT A;  4YDU C;  3QBX A;  1DT9 A;  2ZWH A;  2NNW A;  1Z6R A;  4GY2 B;  4U67 L;  2JWL A;  3LL3 A;  3SBT A;  4B1W B;  4R79 A;  5ADX H;  5KPT A;  5BPN A;  3VF4 A;  2DPN A;  3MWT A;  1MDU B;  1ZBS A;  3TU5 A;  4FWL A;  2E2P A;  5AQV A;  3E1Y A;  1NGJ A;  3SLC A;  4DQ8 A;  2QXL A;  1BUP A;  3HI0 A;  1V4T A;  1NGD A;  3M6G A;  2HMP A;  2P9K B;  1YJN N;  4BRK A;  4WFA L;  5AZJ B;  2Q2R A;  2P9S B;  4B1V A;  3E9L A;  3QB0 A;  1J6Z A;  3VES A;  3WXK A;  1X3N A;  4IWV A;  3UB5 A;  5E26 A;  1VQ7 N;  1VQ6 N;  3MDQ A;  3QDK A;  4H5T A;  3DXM A;  5AQP A;  3VEN A;  3J8A A;  3ZX0 A;  3WEE B;  4CZE A;  3GOI A;  3U9Z A;  3VET A;  2NRX A;  1D4X A;  3D7E O;  3L4Q A;  1BDG A;  4GV3 A;  1R59 O;  4MO4 A;  2P9I B;  4WCE L;  5JVH L;  3EN9 A;  2YX6 A;  1ESV A;  1MWK A;  1MA9 B;  3F2K A;  3CJ9 A;  2WBN A;  2P9U A;  1K8K A;  2NRW A;  4JKA A;  1NGH A;  1IJJ A;  1GLD G;  3IDH A;  3KK7 A;  5M1P A;  5BN8 A;  1NM1 A;  2QEX N;  3LDN A;  4CD1 A;  2QWQ A;  3CCS N;  3CJ1 A;  2YJF A;  3ID6 A;  3R1X A;  5AQK A;  4BR4 A;  4FSV A;  2QWL A;  4BR7 A;  4ISG A;  4CZH A;  5AQR A;  2QTD A;  5AZI A;  3M1F A;  4BRI A;  1U6Z A;  4JK9 A;  4EHT A;  4G9Z A;  3LDP A;  2A41 A;  4JKC A;  2ITM A;  5AQW A;  4DB3 A;  4C23 A;  5AQO A;  3NVK A;  1SAZ A;  1VQ8 N;  4JD2 B;  3CXC M;  3O1W A;  4FWR A;  3O9Q A;  1KAY A;  4IZ9 A;  2HF4 A;  3CC7 N;  4MDA A;  3QML A;  4CBW A;  3GBT A;  4CZF A;  1VAZ A;  5EY4 A;  2ZF5 O;  3L4I A;  4F9O A;  2QWR A;  4JKF A;  5AQQ A;  1TYQ B;  1JJ2 M;  3EE8 A;  1TUY A;  2P9N A;  1E4G T;  4RCH A;  3VER A;  2E2N A;  3E66 A;  4NO7 A;  1T6C A;  2FSN A;  4AM6 A;  3QFP A;  4CJ7 A;  3PLA A;  3UE5 A;  1E4F T;  4BQZ A;  3CJC A;  3P31 A;  3G4S N;  5M1Q A;  2BTF A;  3UKU B;  3CCV N;  4FWN A;  4JK8 A;  3K9K A;  4A59 A;  1HKB A;  4BGB A;  4CI6 A;  3M5R A;  2PBD A;  4BRE A;  5ADX A;  3PIP L;  1VQL N;  2GEM A;  3S41 A;  5FPM A;  1YJW N;  1YUW A;  1Q81 O;  4OPH A;  4EHU A;  3OBW A;  1VQ4 N;  2FXU A;  1XUP O;  2KHO A;  2F9W A;  2A40 A;  4H5N A;  5AQY A;  3IMX A;  3EZW A;  3LDO A;  3BF3 A;  3KHY A;  3OA9 A;  4GNI A;  4QS8 A;  3TTD A;  3F5T A;  1KD1 O;  4DCH A;  3ZX3 A;  2ZJR L;  3G71 N;  4JKE A;  1HJO A;  4JN4 A;  3WXJ A;  3KZB A;  3CPE A;  4GVE A;  3ZX2 A;  1W97 L;  1KXP A;  4BG8 A;  5KQ8 A;  2P9L A;  5AQF A;  4JEP A;  3ATU A;  2FSJ A;  2VCP A;  1NMD A;  3JS6 A;  5AQG A;  5EXW A;  3CF5 L;  2FF3 B;  4AM7 A;  5GAD P;  4JKG B;  5DM7 L;  5BR9 A;  1G99 A;  2D0O A;  3C7N A;  2F7T A;  3VGK A;  3O9R A;  3CQY A;  4GV9 A;  2CGJ A;  3VEV A;  1BA0 A;  1LOT B;  3AAR A;  3CMA N;  4JAX A;  1XQS C;  2HBL A;  4KBO A;  5M1N A;  3N4Q A;  4O8U A;  1NLV A;  1NGG A;  4M7Y A;  4CZM A;  1U2V B;  5LJV A;  3KVG A;  2IVN A;  4FPB A;  1MWM A;  4JKD A;  3VEO A;  4B1U B;  3RVC A;  3P4I A;  1IG8 A;  5LY3 A;  1JCG A;  4DHY A;  3VOV A;  4Z94 A;  4WQ4 A;  3H3N O;  1W2B M;  3WXL A;  3FZF A;  4BGA A;  3HRG A;  4I6M A;  4MO5 A;  2GWJ A;  3CCJ N;  1BOT O;  4K42 A;  1Z05 A;  4O5F A;  1BA1 A;  4BRG A;  3HBT A;  3MN7 A;  2JWK A;  2W41 A;  4B9Q A;  2AP1 A;  2FSK A;  4JHD A;  3VF6 A;  5JVG L;  3LDQ A;  1NGC A;  1M1K O;  1NGB A;  2E1Z A;  2IVO A;  3T69 A;  2WFB A;  5C2F A;  4BRN A;  3U9D A;  2NRT A;  3DLL L;  3DXM B;  4H0Y B;  3CCM N;  3RSE B;  3D6R A;  1BWF O;  1YHQ N;  3IKM A;  3A0I X;  2NRV A;  4BVP A;  1GLE G;  1SZ2 A;  1WUA A;  5MLC Q;  2YHW A;  5AQM A;  5HL7 L;  4ISF A;  4ILH A;  4BRM A;  5GAH P;  1YXQ A;  4U7B A;  1K73 O;  5JIC A;  4KH5 A;  2FF6 A;  1JCF A;  2P9U B;  1QVF M;  4QS7 A;  4YOX A;  3FZL A;  4Y0W A;  5CHI A;  3N4P A;  1GLC G;  4A2B A;  3CIP A;  1GLL O;  2E88 A;  4FO0 A;  3CCL N;  3LM9 A;  1YIT N;  3ENH A;  3A8Y A;  5JLH A;  3FE1 A;  3FR0 A;  4NB4 A;  4MDB A;  3FLC O;  3FZM A;  3AGR A;  1QZ6 A;  3JXU A;  3ULE B;  3LDL A;  3SAH A;  2Q0R A;  1ATR A;  4BC5 A;  1VQ5 N;  3R9P A;  3H45 C;  1NGE A;  3W3D A;  2VGM A;  1GLF O;  4YOW A;  4WFB L;  3DWL A;  3CC2 N;  4FWK A;  4FWP A;  4FOI A;  4H5W A;  2I7N A;  1S22 A;  3CME N;  1T6D A;  2P9K A;  2PFU A;  2V7Y A;  3H3O B;  3O9T A;  1JCE A;  4NLC A;  5AZJ A;  3M3Z A;  2QWN A;  4RTF D;  4GV6 A;  2GWK A;  1SQK A;  2GTD A;  2EWS A;  2Q97 A;  3ZEU B;  4FWQ A;  1LCU A;  4OPA A;  2YHY A;  1HKG A;  3WEE A;  3B8A X;  3K9J A;  3O9U A;  5JLF A;  3MN9 A;  1QHA A;  4M63 C;  4EAH D;  2IVP A;  4KH4 A;  3C65 A;  4BRH A;  3HTV A;  4JK7 A;  4YOY A;  3OW2 M;  2GEL A;  2VGN A;  1HUX A;  5AFU H;  3DXK B;  3VEY A;  3U4L A;  3FZK A;  4BY9 C;  4FVU A;  3L0Q A;  2ASM A;  3ENB A;  3H46 O;  3C0B A;  5AQU A;  1ATN A;  3MWP A;  5EX5 A;  3VGL A;  4A57 A;  3SJH A;  5H1S Q;  1DEJ A;  2HBM A;  1RDW X;  3BP8 A;  3O08 A;  4NLB A;  4YOT A;  4JKH A;  3F9M A;  5FPE A;  1RDU A;  2F9T A;  2P9L B;  4A62 A;  3P38 A;  4JD2 A;  3A5M C;  3QFU A;  2BH1 A;  3SK3 A;  5FPD A;  3LM2 A;  5BPM A;  3ZET B;  4BRD A;  1BU6 O;  2E20 A;  5KPR A;  3Q7C A;  4K25 A;  5GIP A;  2D4W A;  4WYB A;  3BF1 A;  3MN6 A;  4CZK A;  2ASP A;  3WQT A;  5CR4 A;  1KAZ A;  1TYQ A;  1YJ9 N;  3J7Z O;  3QBW A;  3SAF A;  2A6A A;  3CCU N;  3NMU A;  1NGA A;  5B8H A;  5I9E B;  3FZH A;  5BRE A;  2BUP A;  1X9J A;  4BVO A;  1O13 A;  3CQX A;  4WQ5 C;  3CPW M;  5C10 A;  3UKU A;  3VPZ A;  4BR0 A;  4FWS A;  4MLE A;  3CHW A;  2OTL N;  4IO8 A;  5BPL A;  1YI2 N;  2E2Q A;  4I6M B;  2HBJ A;  4IFE A;  5DM6 L;  3O6W A;  2FLO A;  1EQY A;  4CZG A;  2GUP A;  4BR9 A;  5AQJ A;  3D2F A;  5AR0 A;  1N8R O;  5ELZ A;  4PL8 A;  4BR2 A;  4WFN L;  3EL2 A;  1H1V A;  4B1Z A;  3A5N C;  1NBW A;  3BUZ B;  5FPN A;  2A3Z A;  3VMF B;  2ZGZ A;  3O4W A;  1C0G A;  1HX1 A;  1ZXO A;  4K43 A;  2E2O A;  3AAQ A;  3QIC A;  4AF1 A;  2NLX A;  4WQ4 C;  2VWB A;  3KWG A;  4FL9 A;  2Q36 A;  4EIA A;  2QWO A;  4IEI A;  5LJW A;  2A42 A;  1Q86 O;  5M1K A;  2ZJQ L;  2V51 B;  2E1Y A;  4XH5 A;  3UKR A;  4C1N K;  4BR5 A;  4YDU A;  4XEI A;  3A5O C;  4H03 B;  3CCR N;  3WT0 A;  1ATS A;  1M90 O;  5AFU A;  2CGK A;  3VGM A;  3TPQ A;  2P9P A;  5BRH A;  1P8Z A;  3Q7B A;  1S72 N;  2HOE A;  2VYP A;  3O9S A;  2HF3 A;  5M1F A;  2QWP A;  3CET A;  2H3G X;  3E9O A;  1YF5 L;  4E1J A;  2Q31 A;  5KQD A;  3GDQ A;  1K8K B;  4IOX A;  3WXI A;  4BC3 A;  2ZGY A;  3O8M A;  1X3M A;  1VQP N;  2HST A;  3C6A A;  4J8F A;  3ZYY X;  4EFH A;  3ENO A;  1OKJ A;  3IFR A;  2UYT A;  3IUC A;  4H0O A;  3AAP A;  3R8E A;  4WF9 L;  3W0L A;  2Q0U A;  4OO1 J;  5AZI B;  2IIR A;  3AY9 A;  1K9M O;  1QQN A;  3D2E A;  3GL1 A;  3MX5 A;  5M1O A;  1Q82 O;  3BEX A;  3L6Q A;  3P39 A;  1TUU A;  2NRH A;  1RFQ A;  3C6H A;  2KLA A;  1QVG M;  3TSP A;  5TKY A;  4IXC A;  5EVZ A;  5HOO A;  3GG4 A;  3VTH A;  1GLB G;  3E9P A;  3TSQ A;  3DAW A;  4B1Y B;  5AQH A;  3H1V X;  4O8K A;  2YCH A;  4FWO A;  5F0X A;  3RSE A;  1GLJ O;  1QQO A;  1VQN N;  4K41 A;  3U8X A;  5CE3 A;  3H1Q A;  3CI5 A;  2V7Z A;  4BRL A;  1QZ5 A;  3CJA A;  5GIN A;  2QW9 A;  5C2D A;  2P9S A;  4H0X B;  1KAX A;  2P9N B;  4BRA A;  3TSU A;  4KH6 A;  4A61 A;  2W40 A;  2D1K A;  5AQS A;  2RHK A;  3I56 N;  1YIJ N;  5AQN A;  4PKI A;  3TTC A;  3CCE N;  3VEZ A;  5KPZ A;  4JKB A;  5AQZ A;  3CD6 N;  2P9I A;  1XC3 A;  2NRZ A;  3NVM A;  1NGI A;  3O80 A;  3I8B A;  4BC4 A;  4IOC L;  1DKG D;  1BO5 O;  2D0P A;  4BRC A;  4CZI A;  2QWM A;  1K8A O;  5GAG P;  3ID8 A;  4IJA A;  3SMS A;  3ULE A;  3G25 A;  3WUH A;  1OVY A;  3HM8 A;  5JMV A;  4CD3 A;  3HZ6 A;  4DKW A;  3GE1 A;  4H0P A;  4IEE A;  4FOE A;  4PKG A;  2E8A A;  2PAV A;  3FFK B;  4LC9 B;  4QS9 A;  1CZA N;  4BRP A;  3I55 N;  5E84 A;  4PHT X;  1NJI O;  2WC9 A;  2OTJ N;  2CGL A;  3MCP A;  4H5V A;  3R3L A;  5TKW A;  4A2A A;  3OBY A;  3PIO L;  3G6E N;  4CZL A;  3R6M A;  3EKS A;  4BG9 A;  3SBG A;  1ZC6 A;  1DGK N;  3SAG A;  4IJN A;  2HBK A;  1YAG A;  4JNE A;  4PL7 A;  1BG3 A;  4H0T B;  3ZEU A;  1KQS M;  3C7N B;  4YOV A;  4FWM A;  1KC8 O;  3AGK A;  1HKC A;  1VQ9 N;  5C12 A;  4M7X A;  5AQL A;  1V4S A;  1SS6 A;  3MCA B;  4L3Q A;  4MLH A;  5EOY A;  1C0F A;  3VTI A;  4FPA A;  5AQX A;  3WQU A;  3MMV A;  4ISE A;  5BRD A;  5C0Y A;  2ASO A;  4ILG B;  4YOR A;  3SMP A;  1EO1 A;  2AA4 A;  1HPM A;  1Y64 A;  2YJE A;  2YHX A;  1YVN A;  3HSC A;  4IDH A;  4IOA L;  3H6E A;  3DXK A;  3D2F B;  4H0V B;  2Q1N A;  4PKH A;  4ILJ A;  1P90 A;  1Q18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...