5TKWA

1.35 angstrom resolution crystal structure of a pullulanase-specific type ii secretion system integral cytoplasmic membrane protein gspl (n-terminal fragment; residues 1-237) from klebsiella pneumoniae.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
236
structure length
236
Chain Sequence
NKINASPQAMLIVRLAAAQAPLHWQLFAPGEPHHEASGRWPTDDASPFPALAEQYPAWVLIPASDCAFHSLTLPAGLRKPPLQVAPFLLEEQLADDVEATHFALLHRQQAQCEIVAVQRQKMRDWLARCESLSLQPLALTPDVLALPWQPPAWSAVQVDEQWLIRHQPWGGMAAENVWLTELLQSEAEEHVIDSYSPPPAAPGVWREQPAQTLLTLAARHPAAQKLSLLQGEFAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.35 Angstrom Resolution Crystal Structure of a Pullulanase-specific Type II Secretion System Integral Cytoplasmic Membrane Protein GspL (N-terminal fragment; residues 1-237) from Klebsiella pneumoniae.
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
molecule tags Hydrolase
molecule keywords Type II secretion system protein L
total genus 56
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2016-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05134 T2SSL Type II secretion system (T2SS), protein L
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.370 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5tkwA02
3.30.420.380 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5tkwA01
5TKWA 4PHTX 2BH1A 1YF5L 1W97L
chains in the Genus database with same CATH superfamily
2VG7A 3AVAA 3ITHA 2YNGA 5AQZA 1WOQA 3MMVA 1K6YA 3WNGA 3K0SA 2OPQA 3NF6A 3C6AA 4PKHA 1U45A 1SZ2A 4CHOA 1NOZA 2P9PB 3LZJA 2VCPA 4CGGA 1VQ7N 2FBYA 2O4IA 5C2FA 3QEWA 3A5LC 2P9KB 3VEYA 5FPMA 3ZCMA 4JI0K 2WONA 4E7HA 1P90A 3HO1A 3OW2M 3FLCO 4FVUA 4ISGA 1CZ9A 3BF3A 3VEVA 2O8DA 3AVHA 1IBMK 1HPZA 5KPTA 1VSLA 1L3UA 1HNVA 4FZXC 5BRFA 4WFAL 3SUPA 3QB0A 2B4JA 1SV5A 3JS6A 4BC2A 4DR1K 1VSDA 3QEVA 5AQNA 1SQKA 3NVMA 3L2VA 1RBVA 4DR7K 4BDZA 1IV0A 3TPQA 5LMUK 3OTOK 4IG0A 3FZMA 1KD1O 1CZAN 4IOAL 3ZLJA 4CJLA 1RDCA 3AA4A 4CZIA 4C8MA 5AQFA 5BRHA 3AVFA 1T6DA 1VQ8N 3P39A 5B8HA 3KK7A 1NGAA 1RILA 5I3UA 3IRXA 4M45A 1T44A 3KLFA 3MEEA 4KTQA 3CQYA 1VHXA 4JS4A 1EKEA 4Z4GA 4ISEA 4O4GA 1JXEA 1BCMA 3AVLA 1J53A 3CM6A 3T69A 1QQNA 3M8RA 5ELZA 2NZTA 1XHZA 1K73O 3ZSVA 4BRHA 4ILGB 5CZ1A 3CJ9A 2WC9A 4DWIA 2BANA 1XQSC 3BUZB 1XNRK 2DFFA 3VQDA 4YNQA 3K5NA 4FOIA 5CZ2A 3H45C 4C8KA 4W5NA 3IKMA 3KWGA 3M8QA 5AQMA 5GIOA 3S3MA 1ZBSA 4CF8A 3NFAA 4OLAA 4BRMA 2A1RA 1M90O 5AQPA 2OTJN 2IC3A 1LWEA 1XI1A 5JMVA 3K2PA 2YX6A 3LDQA 4CECA 4E19A 1IG8A 1SL0A 4E7IA 4WQ5A 1HMVA 4FW1A 4BR5A 3EZ5A 4K43A 2QWOA 4JHDA 4FK2A 5KPRA 2XY8A 3H1QA 2V51B 4Z0UA 4CEEA 4CIEA 3THWB 3K9KA 3GOIA 3R8EA 1VSFA 5J2NA 1KFDA 4CJUA 4LF7K 4KHQA 1BIZA 1HLUA 3DLGA 3DOLA 3P38A 3VESA 4RTFD 1OH7A 1N32K 3KVGA 2RN2A 3IFRA 4B9VA 1JL2A 3LWLA 4K25A 3OYIA 2F8TA 3DXMA 5AQRA 1U6ZA 3VMFB 3AVNA 3VOVA 3OS0A 1BHLA 1BI4B 2VQEK 1XMQK 4CW7B 1U48A 1QE1A 1A5WA 4DU4A 5AFUA 3L3VA 4GW6A 3ISNC 4DLEA 4O0IA 3NH2A 4IWVA 2P9SB 3PIOL 4U7BA 4X62K 3VEXA 3HP6A 1HYZA 4FYDA 2FLOA 2X74A 2HHQA 2RHKA 1IKVA 3TAMA 1KFSA 2Z1IA 4DV4K 3THWA 3TI0A 3ZT1A 5A2QO 1NWKA 4JN4A 4BRQA 3QETA 3ZX0A 1KSPA 3SV4A 2E6MA 1WNSA 1YT3A 3MWTA 3HRGA 4JI5K 5JS1A 3HXMA 3MDQA 4FJGA 3CCJN 4JNEA 1ZBHA 2G8KA 3DXMB 3OA9A 3CHWA 4RW6A 3M6GA 1BGXT 2NRWA 4H5WA 3OYFA 5LMNK 2YHYA 3CJBA 4CI6A 4B9NA 4KI6A 4YY3K 4A62A 1JL1A 3NF7A 3SUNA 2CH5A 3RMBA 3AO4A 2ZE2A 2O8BA 2DFHA 4H0OA 1NJWA 2NLXA 3D7EO 4MDBA 3CQ8A 3SMSA 4W5QA 1TKZA 1JXBA 3RR8A 1JLGA 3FZKA 1NGBA 1QS4A 3OS1A 3SAFA 1YVUA 3DRRA 4CD3A 4CZEA 1SL1A 5CE3A 5KRTA 1U47A 1T8EA 3IMXA 3R9PA 4KHPK 4DTNA 3VQCA 4CGFA 1C0UA 3IS9A 4MDAA 3VQ5A 2P5OA 5HRNA 4CJFA 1Q9XA 2OA8A 1TVRA 1NJXA 3CMAN 4WQ5C 1RBSA 3VGMA 1Q82O 5KI6A 2OPPA 5KQDA 4C8NA 3DAWA 4DTJA 1OKJA 5AZJA 4DSJA 3WEEB 1ZXOA 3T1HK 5J2PA 3IDHA 3MN9A 5C12A 4E3SA 3WXKA 4DG1A 3N4PA 2V7YA 3WQTA 5SWMA 4DU3A 3VQBA 3OY9A 4PKGA 3CQXA 1C6VA 4FJMA 1MWMA 2HBMA 4BRPA 2D5RA 4FWQA 4FPAA 2P9NA 1Q8IA 1XHXA 2IOCA 2NRHA 1OH8A 2EWSA 2OPSA 3LAMA 4IDHA 2QTDA 3ALYA 1DKGD 3CC2N 4CJ3A 3O9QA 4J2AA 4NXMK 3NH1A 4OPJA 4DQ8A 3ZSOA 4HCBA 3C95A 3HI0A 3HTVA 4FJLA 3U9ZA 4YOVA 3ENBA 4CZJA 4ILHA 4Z94A 1E4FT 3VQ6A 4JYAK 4E7LA 4QS8A 4A57A 2NRVA 2Q2RA 2X6SA 2Q1NA 2HMIA 3VF6A 3MN7A 3MN6A 1WSFA 3BEXA 4HUEA 4KO0A 3T1YK 2OYQA 3A0IX 1LAWA 3FE1A 3AAPA 3SK3A 3V9UA 4JI6K 2VG5A 4H03B 4KAZA 3SMPA 1JLEA 1KVCA 3FZHA 1UA0A 1QHAA 3LPUA 1VQNN 3VA0A 2WTUA 1QHTA 1C0GA 3M8PA 3S3NA 3DLHA 4FVMA 4CGHA 1F21A 4CJWA 4BG8A 3S41A 2FC0A 3EKSA 1UOCA 4B3TK 5AQJA 1XC9A 4YOTA 1BQNA 5DM6L 2GEMA 4M3UA 1S1TA 3ATVA 5M1FA 3O1WA 3AVCA 2KFZA 3F9KA 1UAXA 3BGRA 1TKXA 3CETA 1NGFA 1JLCA 4YFUA 3BDPA 1S1VA 3D2FB 2O8FA 3UKUB 1VQLN 3TWHA 3PLAA 1E3MA 4AHVA 4JI8K 1RDUA 3L4QA 3V9ZA 3O3GA 3E9OA 4LF6K 3VF2A 3AGKA 3EEQA 4MO4A 3OYMA 2YHAA 4HHTA 3RR7A 4GV9A 4GKKK 4KI4A 4CHYA 4OKKA 5GAHP 2P51A 1LCUA 1HX1A 5LL6Z 3AV9A 4CZMA 3O8MA 3OYJA 3ZT0A 3BY5A 1L5UA 3J80O 3QO9A 3VEOA 2YV0X 1WBBA 1MU2A 5FROA 4A2AA 2J4RA 4HUGA 3HSCA 2E2OA 3WXMB 2QKKA 4BWJA 1HNXK 4KPYA 4CGIA 4JKAA 4A2BA 4K8XA 4H5NA 3UB5A 3K5MA 4J8FA 5F1XA 1RTDA 3CERA 2YKMA 4LH4A 3DLBA 4CBUA 3MWPA 3UKUA 3IUCA 2W6LA 4CEBA 3TAQA 2X6NA 5FPNA 1QSLA 1V4SA 1TK5A 4H0YB 4DR5K 3HOTA 2F8SA 1K8AO 3U3GA 3ASMA 3IAYA 4EZ6A 5AQKA 4HWIA 4B3RK 2VYPA 4BWMA 1FKOA 4DKWA 3ZX3A 3A5MC 1RDDA 2FF3B 5AFUH 3CM5A 3DXKA 4M3YA 1IJJA 1WAJA 3ZSXA 3UIQA 3SJHA 3H3OB 3R1XA 1TK8A 2QWNA 2NNWA 5AQUA 2P9LA 3HYFA 1KLNA 2UUCK 4UY8O 3TTDA 1RBRA 1TKDA 1HYSA 2OZSA 4YDUC 4C1NI 3NAEA 3L8BA 3ZEUB 4B08A 5BRDA 4DTMA 1BA1A 4LY7A 3P83D 3OYHA 4LFBK 3K9JA 1NK5A 3G10A 3KHYA 4CGDA 1BIUA 2B6AA 4I2PA 4OKEA 4DV1K 4BREA 3HK2A 1BDGA 4DF8A 2E4LA 4CERA 5FRMA 1DTTA 4DV7K 4CJKA 3P31A 3MX2A 3B6PA 3HZ6A 3KK1A 4CF2A 3H08A 3CCLN 1T3VA 2NRXA 3ULEA 2IAJA 5KPZA 2BTFA 3O6WA 4I9QA 3WNFA 2Q97A 4AHCA 4JRPA 2QA4N 3C6TA 3I0RA 4H4MA 3NF9A 1V4TA 4LF8K 3VQAA 3SI6A 2GTDA 4QS9A 2W42A 1VQMN 1SL2A 2GX9A 3G25A 4AQYK 1MA9B 1N34K 1RTJA 1CZBA 1WSGA 1YUWA 4Q5VA 2FSKA 1LV5A 4DUYK 1S6PA 3SQ2A 1FJGK 5ADXH 2HVHA 4GMJB 3A2FA 4K0KK 4YDUA 3O4WA 3QNOA 2HB5A 4N56A 1KAYA 2XRIA 5HRPA 4B3MK 1KRPA 3V1RA 2DPNA 1BQMA 4FZYA 3AVBA 1L3VA 1ZBUA 5BPNA 1A5XA 1RFQA 1YTAA 5ADXA 5JLHA 1Q18A 4YORA 3NF8A 3QINA 3CFPA 3J81O 1TL1A 5F0XA 4OJRA 5AZJB 3MAQA 1T03A 1NBWA 3AVMA 3HBTA 3P4IA 3NGZA 2YNHA 4E1MA 4JLHA 1QZ5A 4L8RB 3SAGA 2PYJA 3OYCA 3E66A 5H1SQ 4IBNA 1X3NA 4H5RA 3SBGA 3PUFA 1KLMA 4CF0A 4NCBA 2QKBA 5HRSA 3SV3A 3G6EN 4R79A 1FXXA 2P5GA 3MEDA 4I6MA 3ZSQA 1RNHA 4OPAA 4N5SA 1DTQA 1N33K 3QBWA 1BISA 4DS5A 4B9SA 3HPHA 3EYZA 3ZETA 1XMOK 3D0PA 4IFEA 3QNNA 4OPKA 3NDKA 1VSEA 5CHIA 4FK0A 1NM1A 4LC9B 5EU7A 2HMPA 4CFAA 3E9PA 2ZGZA 5EOYA 2BDPA 4DSFA 3TAPA 1S1WA 3AO3A 1TAQA 5M1KA 4FJJA 2OTLN 3CCEN 2AA4A 3OVNA 4KREA 1I94K 3ZYYX 2HHUA 3H6EA 3K58A 4B9QA 1BL3A 4QOZB 1A5VA 2O8CB 2E8AA 2QWMA 1JCGA 4CJTA 1J6ZA 4Z4CA 4NYNA 1NMNA 4M7YA 4CJEA 4IOCL 1KC8O 3MEGA 3HM9A 4JKDA 4I6MB 4NB4A 2Y1JA 2YCHA 4CESA 4GVMA 4ZTJA 1D9DA 3CCUN 3B8AX 4JI3K 2IVNA 2HHVA 2ZF5O 3VEZA 3H46O 3DMJA 1YVNA 4B9LA 1VQON 1D9FA 1YAGA 3O3HA 4O55A 2ZJPL 3CF5L 1X9MA 5BN9A 4F3OA 2BUPA 4O0JA 3L4IA 4E7JA 1B92A 1HKGA 1J9AA 4BC3A 2P9PA 1GLDG 5AQOA 4O8KA 3T3FA 1HNWK 1BOTO 5HLFA 4DSEA 1NK9A 1TUYA 3I8BA 1YJ9N 1GLBG 3ZX2A 3AVKA 4DR4K 1GLAG 2YHWA 4WCEL 4CBXA 2P9NB 4FJ5A 2IDOA 3M3ZA 2YKNA 3DLLL 1HKCA 2P9SA 1HPMA 3SPYA 3O4NA 2D0AA 5C24A 5HRRA 1BCOA 3NVKA 2PBDA 4CK2A 2F4VK 4KH4A 5J2MA 3HJFA 1NK6A 4FJNA 5JICA 3AA5X 2R7YA 1BWFO 3OHRA 1TYQA 2IVPA 1Y97A 4CK3A 5EY4A 2XO7A 5M1OA 3AVJA 1VSIA 4BVOA 1YITN 4YOWA 2HHHK 4CE9A 5DM7L 1MDUB 5AQWA 3O9TA 5EX5A 4M3ZA 4AHSA 3CD6N 3CCMN 4H0PA 4F2SA 4WFNL 3SQ1A 3OYBA 3KJVA 1C0FA 1WB9A 5BPMA 2UXDK 4IZ9A 1RCHA 5I42A 2JGUA 1D8YA 1HNZK 4V19S 1S9GA 2QXLA 1ZBIA 3BZCA 4DQPA 4FLYA 1KQSM 1BG3A 3WNEA 4I7FA 3DWLA 2QWPA 1QZ6A 4CIFA 2QWQA 3KD1E 1WLJA 3THXA 2FBXA 4X65K 1Z05A 3HVTA 3L2RA 3RMCA 3LDSA 5CYMA 4JI7K 1NK7A 4BRLA 1UA1A 4Z4EA 1CXUA 4H0TB 3F9MA 2QW9A 3KIOA 3OBYA 1MWKA 4BRCA 1KCFA 3QFPA 5HBMA 3QBXA 3CI5A 4WF9L 1EP4A 4DSLA 2HBJA 3QIPA 4HTLA 4OX9K 1ZBLA 3RRHA 3KLHA 1GLEG 2A6AA 2E2QA 4BG9A 1RDAA 4I9LA 4Y1DA 4IDKA 2ITGA 4ICLA 5HROA 2UXBK 3VGKA 3OBWA 1ASVA 3QESA 2PY5A 4OPHA 4PWDA 4KTZA 4Z4FA 5CYQA 2BGGA 2RF2A 3V9WA 3EKUA 3WEEA 4DLGA 1RT7A 3LL3A 2HVIA 3D45A 4JKCA 5M1PA 4FJHA 4DFMA 4MO5A 1JLAA 4FWKA 3SUOA 1RBUA 3FZFA 2YHBA 3UKRB 3ENOA 3V81A 4LF5K 4DQIA 3KLIA 2DFEA 3CG7A 4KH6A 4DTXA 1N8RO 3OYAA 4DSIA 3BF1A 1W2BM 3QMLA 4CEDA 5J2QA 3CXCM 5KGWA 4KHWA 5AJ3K 4RW7A 1C1CA 3AARA 3VQPA 4RW4A 4DUZK 2Q36A 4DV2K 3EE9A 3T7ZA 4RW9A 4H5TA 5GINA 2Q0UA 3DJCA 3SAHA 4LF4K 3CJ7A 1GLJO 4XH1A 4RG8A 3SQ4A 4DR6K 1DT9A 1FK9A 3H1VX 2XY7A 4B8CA 2ZQBA 5GADP 2A5XA 1X1PA 2W40A 3DRPA 1S72N 4XH5A 3CPWM 4WYBA 2V52B 4OVLA 4BROA 2LSNA 3AA2A 3B6OA 1QTMA 2VG6A 5CY4A 3AVGA 4LFAK 2P9UB 2FXUA 4BRGA 5IWAK 1WN7A 1NGCA 1ASWA 2D4WA 3CJ1A 3C7NA 3VPZA 1S6QA 4JKBA 4K42A 4KHYA 3BZKA 4BR4A 2D0OA 2ZGYA 4DMNA 2NRZA 4BGBA 3SLCA 4FM2A 1WSHA 5MLCQ 2KW4A 2RKIA 5GAGP 2QXFA 4CVNE 5C2DA 4LSNA 4E0DA 4CZHA 3I56N 1VRTA 4BDYA 3OYGA 3O80A 3FFKB 3LP1A 3N4QA 3VERA 3OYEA 4FJ7A 2Q0RA 2G8IA 3VN5A 3ZEUA 5KGXA 3ID8A 3AVIA 1NGHA 4CEAA 2QK9A 4FO0A 1IH7A 3VGLA 5FRNA 3F2KA 1RBTA 3V6DA 1QQMA 4A59A 4PY5A 1ITGA 4B3OA 2KQ2A 3R6MA 4KHNA 3C7NB 3BP8A 1SAZA 3JAMO 3F5TA 4DR2K 1R0AA 1TAUA 1ATRA 2YHXA 4DQQA 3DLKA 3H3NO 2ASOA 3RWUA 3QDKA 3A8YA 1QQOA 4B1XB 4CZKA 1LWCA 5KTQA 4TSXA 1X9SA 4MLHA 3O08A 3OYDA 1ATNA 5AQGA 4PL7A 4ZHRA 1RT5A 1VQ9N 2E20A 1ZYQA 1ASUA 2QI2A 3MX5A 5K14A 4C23A 2AJQA 3CMEN 3AY9A 4NCAA 4FK4A 3M1FA 1NGDA 1NLVA 3SJJA 1KAZA 3RMAA 2PAVA 4GV6A 5KRSA 4YOUA 2IS3A 3TABA 4JEPA 4PA1A 2GUIA 3DXKB 3MECA 4B1UB 4CGJA 3KLGA 2BH1A 1ATSA 1YF5L 3I33A 4JI4K 4BE2A 3LAKA 3KTQA 1FKPA 4BRKA 4BRNA 1WSIA 4ZTFA 4DTSA 3OYLA 2RE2A 5BN8A 4AILC 2HOEA 4DTPA 4FW2A 5BPLA 4BR7A 2UYTA 1Z26A 4GKJK 4LSLA 3DRSA 3CCQN 3HPOA 3L6QA 1N6QA 3FR0A 2D0PA 2HHSA 2NRTA 2CH6A 2XHBA 1K8KA 5HL7L 4A5BA 3FFIA 4JHDB 4CJPA 3VETA 3GE1A 1RT1A 2IGIA 1QQCA 2GV9A 4DHYA 2D0BA 2G8UA 2CGJA 2CGKA 1R59O 4GV3A 4B3SK 4N41A 4CEOA 4IO9L 3Q7CA 4CFDA 2OZMA 2E6LA 4CK1A 2HNYA 4KH5A 4JKEA 3THVA 3JYTA 2HBLA 4CF9A 1RT2A 2ZD1A 4FCYA 4Z4HA 4JKFA 1GLLO 4HTUA 4CF1A 5D3GA 2P9KA 3EZWA 4MQ3A 2D0CA 3MN5A 2P9UA 3ZSWA 4ELTA 4H5VA 3CJAA 2HNDA 3F73A 4MFBA 1EX4A 4FZZA 4O5BA 3J7AP 4FLWA 2HF4A 4KB0A 3HOSA 2Z1HA 1CXQA 4GY2B 4JK9A 5SZTA 3KKRA 4JK7A 4BQZA 5BR9A 2KLAA 3V9SA 2H3GX 3J7ZO 5AQXA 1EXQA 3QLHA 1EQYA 1NGGA 2GWJA 4CFCA 4O5FA 4B1YB 3EY1A 1S3XA 4IJAA 4HUFA 4BQLA 4AM6A 4KKOA 4E1JA 2UUAK 3CPEA 4GVEA 2VGMA 3DM2A 4DF4A 4ELVA 1TL3A 2GWKA 2YNIA 4FWNA 2G8VA 3VQ9A 1O13A 3DLEA 1P8ZA 1WUAA 4DQRA 4DV0K 3TSPA 4DTUA 1QVFM 3TSQA 4M41A 1QSSA 2WOMA 1JCFA 1G15A 2F7TA 3T19A 1BUPA 5AR0A 3FGUA 3NH0A 4O44A 1RT3A 1EO1A 4MLEA 3VQEA 3QERA 3LM2A 5M1QA 3VF4A 4CJVA 2WBNA 3I8DA 2EX3A 1NGEA 3ZSYA 1JLBA 2QM1A 3TAEA 2B5JA 2HHWA 1VAZA 4FLVA 1J5EK 2F96A 1GLFO 2QWRA 1LWFA 1NKEA 2KKZA 4NO7A 1QSYA 3EO3A 4CCHA 1TKTA 3V9XA 2YNFA 5AZIB 1X3MA 1YJWN 4FM1A 3C6UA 4KV8A 3KK2A 3ZT4A 1SKSA 4FLTA 2O4GA 5AQQA 3D6RA 1SUQA 5FPEA 3T1AA 3AO5A 3D2EA 3LANA 3ZSRA 5JLFA 4AH9A 1H1VA 4CZGA 4QS7A 3PO4A 3NGYA 1NKCA 1C1AA 1VQKN 4DV3K 3QIOA 4OLBA 3KKSA 4DFPA 5FLXO 5CR4A 4NLCA 1WSEA 2WUSA 4FJIA 1LOTB 3S3OA 5AQLA 4RW8A 4M7XA 2W6KA 3J8AA 4YHHK 3G71N 3K59A 2ASMA 4QCLA 4BACA 4W5TA 3LDOA 4KFBA 2P9IA 1EWRA 3AGRA 1VSMA 3SPZA 1S1XA 4KTWA 1JKHA 4NCGA 3PX6A 2G8WA 4LFCK 2ZJQL 2GELA 3U8XA 2HW3A 1TV6A 5AZIA 2BE2A 3CJCA 4DFJA 5LJWA 1W9HA 3RMDA 4F3TA 3TTFA 4JKGB 1Q9YA 5I9EB 2E2PA 1G99A 4FOEA 3JSMA 3THXB 1JLFA 4HCCA 1U04A 1RDBA 1YI2N 4G1QA 5AQSA 2E1YA 4FSVA 4IEIA 4A5AA 4CJ4A 4B1WB 2FF6A 5T7BA 5AQYA 5HOOA 4M63C 4DV5K 4CEFA 1LW2A 1LW0A 2W41A 3VA3A 4FLZA 1NU0A 3P5JA 4C8OA 4DS4A 1D4XA 2X78A 2PZSA 4J2EA 4JD2A 5AQVA 4CZLA 5HP1A 3UKRA 5F2RA 2ZWHA 2P1JA 3THYA 3LDLA 1SKRA 3LALA 1UWBA 4CBWA 1FW6A 2KHOA 4JAXA 3KLEA 4BR9A 3GG4A 2Q3SA 3K57A 1J54A 1X9WA 3KD5E 2AP1A 4KRFA 1EWQA 3AAQA 4E1NA 3O5BA 3DOKA 2F9WA 4PL8A 4HVJA 4BRDA 3PSIA 3UE5A 4Y1CA 3SNNA 4DB3A 1S5JA 4FJKA 2O8EA 4DCHA 2HHXA 1C0MA 3RTVA 1W7AA 2P9LB 2FBVA 5FPDA 3U3YA 5C0YA 4IEEA 2QWLA 4CHQA 1TGOA 1Z25A 2OCEA 4JD2B 3WUHA 2FSJA 4CZFA 4BR2A 4C8LA 3E1YA 3FZLA 4ISFA 3SBTA 4CHZA 4FWOA 1N36K 1Q86O 1NG9A 4OGEA 1VSHA 3MCAB 1BO5O 3HM8A 3MK6A 3S9HA 4K8ZA 4FPBA 1VRUA 3ZT2A 3A5NC 3ULDA 4H4OA 4CJ7A 1WAFA 1YJNN 4CJ5A 4F8RA 3L2QA 4BC5A 3M5RA 4LD0A 2VWBA 3ULEB 3LWMA 5IT9O 3HPGA 2E1ZA 4CEZA 5E84A 2YI1A 4H0VB 4IFYA 3LDNA 4N76A 1XUPO 1OH6A 1HJRA 3V1OA 1ILYA 4AHTA 2NUBA 3VEWA 5DMRA 2KZZA 3EN9A 5JVGL 3RSEA 2HHTA 4KBOA 4FWMA 4NXNK 2A42A 4O8UA 2OPRA 1QVGM 1HR0K 2Y1IA 1L3SA 3IG1A 1HYVA 1OH5A 2A41A 2QEXN 4PKIA 1S1UA 3NHGA 3VQ7A 4Y0WA 4BRAA 3NBPA 1REVA 1JCEA 4FM0A 1BU6O 4IFVA 4OGCA 4JRQA 1IBLK 3O9RA 1SKWA 2I7NA 1RGIA 3PO5A 4EFHA 5TKWA 4IXCA 2KZMA 3VQ4A 4EIAA 4DTRA 3QEIA 2A1SA 2HSTA 4IG3A 4DU1A 2VQFK 3PX0A 1NMDA 4AHUA 3C65A 4JS5A 3K5OA 3LP2A 3HVRA 2DY4A 4B8AB 4EHTA 4GNIA 2P9IB 1Y64A 4F2RA 3I0SA 2UXCK 1DEJA 4BGAA 1VQ5N 4FJXA 4E89A 5J1EA 1YHQN 3TSUA 4KHUA 1U49A 1S9EA 4CHNA 4G9ZA 3LP0A 1VQ4N 3SQ0A 3GL1A 1NK4A 4XEIA 3V4IA 3MXIA 3QICA 1RT6A 5M1NA 3L2WA 5JVHL 1GLCG 2IIRA 2ETJA 3TANA 4R5PA 5BREA 1HJOA 4ID5A 4WE1A 3WT0A 4IO8A 4UQGA 1T05A 4B9MA 2JWKA 4B1VA 3RRGA 1IKXA 3AA3A 1HQUA 3O9UA 3CFOA 1TYQB 4FWPA 5C15A 1O1WA 1OVYA 2HF3A 3ID6A 3QEPA 3WXIA 4DTOA 4EZ9A 5JS2A 4N47A 3K5LA 5C25A 3O1BA 4BDPA 2JWLA 4KHSA 3DYAA 4NLBA 4FJ9A 4FLUA 5LY3A 3TU5A 4M42A 4B1ZA 5AQHA 3ZT3A 4BE1A 4DSKA 3MCPA 1NGIA 2F9TA 3PX4A 1NJIO 3R3LA 1C0TA 4FWLA 3LZIA 2G8FA 3PV8A 2G8HA 1VQPN 4Q0BA 2RPIA 4FJ8A 1X9JA 1Q81O 1VSKA 3HT3A 3E9LA 4JI1K 2FBTA 5EVZA 4CJQA 2I5JA 3ATUA 1IKWA 3G4SN 4X66K 2O8EB 1E4GT 1NGJA 3L2UA 2FSNA 1BI4A 4OO1J 3WNHA 2XY6A 2A3ZA 2OANA 4BC4A 2O8CA 3A5OC 4CJSA 3E01A 3LM9A 2KTQA 1YXQA 1WSJA 3WXJA 1XC3A 4WQ4C 5KQ8A 2HNZA 2XY5A 1KVAA 3P1GA 4NYFA 3O3FA 3SZ2A 4FLXA 3DI6A 3W3DA 2ATQA 1RTHA 1N5YA 4J2DA 4BRIA 2DTUA 4DFKA 4F9OA 4EP4A 1WBDA 4E7KA 4DQSA 4M3WA 1NJYA 1D5AA 1JLQA 3D2EB 3LP3A 1U2VA 3CCVN 4Z4IA 2UU9K 4AM7A 3GBTA 4XIUA 2Z1GA 2ZM6K 4AHRA 3VENA 1EETA 3M8SA 5DK5A 4FWSA 1VSJA 2E88A 3LPTA 3VQQA 1NNEA 4BE0A 3SUQA 1J5OA 5EXWA 2VWKA 3DLRA 4H0XB 1ZBFA 1TK0A 3QEXA 1HNIA 3VTIA 1ESVA 2IVOA 2VWJA 3QFUA 4CIGA 3NMUA 2O8BB 3WQUA 4BR0A 3CIPA 3PSFA 3O4QA 3ZETB 3RVCA 3W0LA 1TUUA 4JI2K 3L3UA 4QAGA 4CFBA 1U2VB 4C1NK 2PYLA 4JKHA 3JXUA 1DGKN 3AO1A 4IKFA 2E5LK 3D2FA 4PHTX 1NOYA 2O8FB 1VK0A 4RWTA 1NK0A 1KAXA 1GOBA 1RTIA 4M3RA 2HBKA 1W0HA 4AF1A 4A61A 4L3QA 1IG9A 3PIPL 2NRRA 1I39A 4JV5K 2WFBA 1B9FA 3EL2A 3U4LA 1Q7YO 1L3TA 1ZC6A 4BY9C 3OJUA 4LF9K 2Q31A 5AQIA 3EE8A 2O8DB 1K8KB 4CEQA 3L0QA 4K41A 1NK8A 3PY8A 2CGLA 4B9UA 3OYNA 3CCRN 4B9TA 4FXDA 4OKJA 2YJFA 4EP5A 1HQEA 1HKBA 1CLQA 1RT4A 3CYMA 1GOAA 4I2QA 4M3TA 2KFNA 1LAVA 4IJNA 1I3AA 5GAEP 3OS2A 4YOXA 3CFRA 5E41A 1YIJN 5BR8K 3CC7N 3V1QA 4ILJA 5GIPA 3G0ZA 3VTHA 3C94A 3NGIA 5C42A 3NCIA 2ZJRL 1YTUA 5LJVA 4WQ4A 4BVPA 4BRFA 3SCXA 2A40A 2PFUA 3KWIA 3CC4N 3SYZA 3TTCA 4WFBL 3OYKA 3TARA 1NJZA 3TR8A 2V7ZA 3C6HA 4YOYA 3HSTB 2JLEA 4RCHA 4M3XA 1Z6RA 3GDQA 1M1KO 1JJ2M 2UUBK 4JKGA 4CJRA 2ITMA 3O9SA 4DV6K 4XH4A 1DLOA 3NE6A 2GUPA 3U6FA 4FWRA 1OVQA 2Z1JA 1SS6A 3VQ8A 2D1KA 2VGNA 1GOCA 4EAHD 3CCSN 4DR3K 5FDLA 1KXPA 2GBZA 1W97L 3RSEB 1IBKK 4ELUA 4LH5A 1T7PA 2E2NA 5AQTA 3J7YP 2I7PA 5TKYA 5C10A 4PQUA 4F4KA 4X64K 3MXMA 1T6CA 1BA0A 2ASPA 3OJSA 1K9MO 1IO2A 4PUOA 1U4BA 3I55N 1B9DA 3LDPA 3C0BA 4CD1A 2EHGA 4CHPA 1KTQA 3KZBA 1VQ6N 3TAFA 3WXLA 1XWLA 4H8KA 3HL8A 3AO2A 3ENHA 3Q7BA 4IOXA 3MXJA 4EHUA 1S22A 5E26A 1NKBA 4U67L 1KVBA 1RDWX 3THYB 3ZSZA 1C1BA 3HP9A 3TAGA 4ID1A 4W5OA 1HUXA 1XNQK 2YJEA 3KK3A 4KB1A 3U9DA 4W5RA 4JK8A 4FL9A 1HRHA 1IKYA 4J2BA
chains in the Genus database with same CATH topology
5FPDA 4J8FA 5F1XA 3CERA 3AARA 5C0YA 4IEEA 2QWLA 4CBUA 3MWPA 5AQZA 1WOQA 3UKUA 3IUCA 2Q36A 3MMVA 3EE9A 4JD2B 3WUHA 2FSJA 3T7ZA 4CZFA 4BR2A 4H5TA 5GINA 2Q0UA 3DJCA 5FPNA 1V4SA 3SAHA 3E1YA 3C6AA 4H0YB 3CJ7A 3FZLA 1GLJO 4ISFA 3SBTA 3HOTA 4FWOA 4PKHA 4XH1A 1K8AO 1SZ2A 2P9PB 5AQKA 4HWIA 1Q86O 1DT9A 2VYPA 2VCPA 3H1VX 3MCAB 4DKWA 1BO5O 3HM8A 3MK6A 3ZX3A 1VQ7N 3A5MC 4FPBA 5GADP 2A5XA 2W40A 1S72N 2FF3B 4XH5A 5AFUH 3A5NC 4WYBA 2V52B 3DXKA 5C2FA 4BROA 4CJ7A 3A5LC 3CPWM 1YJNN 2P9KB 4BC5A 3M5RA 5FPMA 3VEYA 2VWBA 3ULEB 2P9UB 2FXUA 1IJJA 4BRGA 1P90A 2E1ZA 3OW2M 3FLCO 1NGCA 5E84A 4FVUA 2YI1A 2D4WA 3CJ1A 4H0VB 3SJHA 3C7NA 4ISGA 3VPZA 3LDNA 3BF3A 1XUPO 3VEVA 3H3OB 3R1XA 4JKBA 4K42A 2QWNA 2NNWA 1ILYA 5AQUA 5KPTA 4BR4A 3VEWA 2P9LA 2D0OA 2ZGYA 5BRFA 4WFAL 3EN9A 2NRZA 3QB0A 5JVGL 4BGBA 4BC2A 3JS6A 3RSEA 3SLCA 3TTDA 4UY8O 4KBOA 4FWMA 2A42A 4O8UA 4YDUC 5AQNA 4C1NI 5MLCQ 1QVGM 5GAGP 3ZEUB 1SQKA 5BRDA 1BA1A 5C2DA 3NVMA 3K9JA 3TPQA 4CZHA 3KHYA 2A41A 3I56N 2QEXN 4PKIA 3FZMA 1KD1O 4BREA 3O80A 3FFKB 4Y0WA 4BRAA 1BDGA 1CZAN 4IOAL 3N4QA 3VERA 1JCEA 2Q0RA 1BU6O 4CZIA 3P31A 5AQFA 3MX2A 3ZEUA 5BRHA 1T6DA 3HZ6A 3ID8A 1VQ8N 1NGHA 3O9RA 3P39A 4FO0A 5B8HA 2I7NA 1NGAA 1RGIA 3KK7A 3VGLA 4EFHA 5TKWA 3CCLN 4IXCA 1T44A 1T3VA 2NRXA 3F2KA 3ULEA 3CQYA 5KPZA 4EIAA 1QQMA 4ISEA 2BTFA 4A59A 3O6WA 2HSTA 2Q97A 1NMDA 3R6MA 2QA4N 3T69A 3C7NB 1QQNA 3BP8A 3C65A 1SAZA 2NZTA 5ELZA 1K73O 1V4TA 3F5TA 4BRHA 4ILGB 3CJ9A 2WC9A 4EHTA 1ATRA 1XQSC 2YHXA 2GTDA 3BUZB 4QS9A 4GNIA 2P9IB 1VQMN 1Y64A 3H3NO 2ASOA 4FOIA 3QDKA 3A8YA 1DEJA 1QQOA 2GX9A 3H45C 3G25A 4B1XB 4BGAA 4CZKA 1VQ5N 3IKMA 1YHQN 3KWGA 5GIOA 1MA9B 5AQMA 1ZBSA 3TSUA 1YUWA 4BRMA 4MLHA 3O08A 5AQPA 1M90O 4G9ZA 1VQ4N 2OTJN 3GL1A 1ATNA 2FSKA 5AQGA 4XEIA 4PL7A 3QICA 5M1NA 5JMVA 5JVHL 1GLCG 2IIRA 5ADXH 5BREA 2YX6A 1HJOA 3WT0A 3LDQA 1VQ9N 4IO8A 1IG8A 2E20A 2JWKA 2QI2A 4YDUA 4B1VA 3O4WA 3MX5A 4WQ5A 4BR5A 3O9UA 4C23A 1KAYA 1TYQB 4K43A 3CMEN 3AY9A 4FWPA 2QWOA 4JHDA 5C15A 1OVYA 2HF3A 5KPRA 3ID6A 3H1QA 3WXIA 3M1FA 2V51B 1NGDA 1NLVA 2DPNA 1KAZA 2PAVA 3K9KA 4GV6A 3GOIA 5BPNA 4YOUA 3R8EA 4JEPA 1HLUA 1RFQA 3O1BA 5ADXA 2JWLA 3VESA 3DXKB 3P38A 4B1UB 4RTFD 4NLBA 5JLHA 5LY3A 1Q18A 4YORA 2BH1A 3KVGA 1ATSA 1YF5L 3I33A 3TU5A 3IFRA 4B1ZA 5AQHA 4K25A 3MCPA 1NGIA 2F9TA 4BRKA 4BRNA 1NJIO 3R3LA 3DXMA 4FWLA 5AQRA 1U6ZA 2RE2A 3VMFB 5BN8A 3VOVA 5F0XA 5AZJB 2HOEA 1NBWA 3HBTA 3P4IA 5BPLA 1VQPN 4BR7A 2UYTA 1X9JA 1Q81O 5AFUA 1QZ5A 3CCQN 3E9LA 5EVZA 3SAGA 3L6QA 3ATUA 3FR0A 3G4SN 2D0PA 3E66A 2NRTA 2CH6A 5H1SQ 1E4GT 1NGJA 2P9SB 4IWVA 3PIOL 2FSNA 4U7BA 1K8KA 1X3NA 4OO1J 4H5RA 3SBGA 3VEXA 5HL7L 2A3ZA 2OANA 4A5BA 4BC4A 3A5OC 4JHDB 2FLOA 3LM9A 3VETA 1YXQA 2RHKA 3WXJA 3G6EN 1XC3A 4WQ4C 3GE1A 4R79A 5KQ8A 4DHYA 2CGJA 4I6MA 2CGKA 1NWKA 4JN4A 4BRQA 1R59O 4OPAA 4GV3A 3ZX0A 3W3DA 4IO9L 3MWTA 3QBWA 3Q7CA 4BRIA 3HRGA 3MDQA 3ZETA 4F9OA 3CCJN 4IFEA 4KH5A 4JNEA 4JKEA 2HBLA 5CHIA 3DXMB 1NM1A 4LC9B 3D2EB 2HMPA 1U2VA 3OA9A 3CHWA 3E9PA 4JKFA 1GLLO 2ZGZA 3CCVN 5EOYA 2P9KA 3EZWA 3M6GA 4AM7A 3GBTA 5M1KA 3MN5A 2P9UA 2NRWA 4H5WA 4H5VA 3VENA 2OTLN 3CCEN 2YHYA 3CJAA 2AA4A 3CJBA 4FWSA 3ZYYX 4CI6A 2E88A 3H6EA 4A62A 4B9QA 5M1FA 2CH5A 2HF4A 4H0OA 3HOSA 2E8AA 2QWMA 5EXWA 2NLXA 1JCGA 3D7EO 4GY2B 4H0XB 4JK9A 4MDBA 4JK7A 3SMSA 4BQZA 5BR9A 2KLAA 1J6ZA 2H3GX 3J7ZO 5AQXA 3FZKA 1NGBA 1EQYA 1NGGA 4M7YA 4IOCL 2GWJA 1KC8O 4O5FA 4JKDA 4I6MB 3SAFA 4NB4A 3VTIA 2YCHA 4B1YB 1ESVA 2IVOA 3QFUA 4CD3A 1S3XA 4IJAA 4CZEA 3NMUA 4BQLA 3WQUA 5CE3A 4AM6A 4E1JA 4BR0A 3CPEA 3IMXA 3R9PA 3CCUN 3B8AX 3CIPA 2IVNA 2VGMA 2ZF5O 4GVEA 3VEZA 3H46O 3RVCA 3W0LA 3ZETB 2GWKA 4FWNA 4MDAA 1TUUA 1YVNA 1VQON 1YAGA 2ZJPL 3CF5L 5BN9A 1U2VB 1O13A 2BUPA 4C1NK 3L4IA 1P8ZA 1WUAA 3CMAN 4JKHA 1HKGA 3JXUA 4BC3A 2P9PA 1GLDG 1DGKN 5AQOA 4O8KA 4WQ5C 1BOTO 3TSPA 3D2FA 3VGMA 4PHTX 1Q82O 1QVFM 3TSQA 4RWTA 5KQDA 1TUYA 3I8BA 3DAWA 1YJ9N 1JCFA 1OKJA 5AZJA 1KAXA 2F7TA 5AR0A 1BUPA 2HBKA 1GLBG 3FGUA 3WEEB 3ZX2A 1ZXOA 4A61A 4AF1A 4L3QA 3IDHA 1GLAG 3MN9A 5C12A 3PIPL 2NRRA 2YHWA 4WCEL 4MLEA 4CBXA 1EO1A 2P9NB 3WXKA 2WFBA 3N4PA 3EL2A 2V7YA 3M3ZA 3U4LA 3WQTA 3LM2A 5M1QA 1Q7YO 1ZC6A 3VF4A 4BY9C 2WBNA 2Q31A 5AQIA 3EE8A 1NGEA 1HKCA 2P9SA 3DLLL 1HPMA 2QM1A 3CQXA 1K8KB 4PKGA 1VAZA 3L0QA 1MWMA 2HBMA 4K41A 4BRPA 3NVKA 2PBDA 4FWQA 2CGLA 1GLFO 2P9NA 4FPAA 2QWRA 4KH4A 3CCRN 2YJFA 2KKZA 4NO7A 2NRHA 3EO3A 1HKBA 2EWSA 4IDHA 5JICA 2QTDA 5AZIB 1DKGD 1X3MA 3CC2N 1BWFO 1YJWN 3OHRA 1TYQA 2IVPA 3O9QA 4IJNA 5GAEP 5AQQA 4YOXA 5EY4A 3D6RA 1YIJN 5M1OA 3CC7N 4DQ8A 4ILJA 5GIPA 3HI0A 4BVOA 3VTHA 5FPEA 3HTVA 4YOWA 1YITN 3D2EA 5JLFA 5DM7L 2ZJRL 5LJVA 1MDUB 1H1VA 4WQ4A 4QS7A 5AQWA 3U9ZA 3ENBA 3O9TA 5EX5A 4CZGA 4CZJA 4YOVA 1VQKN 4ILHA 4Z94A 1E4FT 4BVPA 3CD6N 3CCMN 4BRFA 4H0PA 4QS8A 4A57A 4WFNL 2A40A 2PFUA 2NRVA 2Q2RA 3KWIA 4NLCA 2WUSA 5CR4A 3TTCA 1C0FA 2Q1NA 5BPMA 1LOTB 3CC4N 4IZ9A 5AQLA 3MN7A 3MN6A 4M7XA 3VF6A 4WFBL 3J8AA 3BEXA 3G71N 2ASMA 2V7ZA 3C6HA 3A0IX 4YOYA 3FE1A 4RCHA 2QXLA 1Z6RA 3AAPA 3GDQA 3LDOA 3SK3A 1M1KO 1JJ2M 2P9IA 4H03B 1KQSM 3AGRA 4JKGA 3SMPA 1BG3A 3DWLA 3FZHA 1QHAA 2ITMA 2QWPA 3O9SA 1VQNN 4XH4A 1QZ6A 2ZJQL 2GELA 2QWQA 2GUPA 3U8XA 1C0GA 1Z05A 4FWRA 5AZIA 4BG8A 3S41A 3CJCA 3EKSA 5LJWA 3TTFA 1SS6A 2D1KA 5AQJA 2VGNA 4EAHD 4JKGB 4BRLA 3CCSN 1KXPA 5I9EB 4H0TB 2E2PA 4YOTA 3F9MA 1W97L 1G99A 2QW9A 1MWKA 3OBYA 3RSEB 4BRCA 3QFPA 4FOEA 5DM6L 2GEMA 3QBXA 3CI5A 2E2NA 4WF9L 1YI2N 3ATVA 2HBJA 4HTLA 5AQTA 5AQSA 2E1YA 4FSVA 4IEIA 2I7PA 3O1WA 4A5AA 5TKYA 2FF6A 4B1WB 5C10A 5AQYA 1GLEG 2A6AA 5HOOA 2E2QA 4M63C 4BG9A 1T6CA 1BA0A 2W41A 1NGFA 3CETA 2ASPA 1K9MO 3VGKA 3D2FB 3OBWA 1D4XA 3UKUB 3I55N 1VQLN 3PLAA 4JD2A 5AQVA 3LDPA 4OPHA 4CZLA 1RDUA 3UKRA 3C0BA 3L4QA 5F2RA 4CD1A 3E9OA 3EKUA 3WEEA 2ZWHA 3VF2A 3LL3A 3LDLA 3KZBA 1VQ6N 4CBWA 3AGKA 4JKCA 3WXLA 5M1PA 2KHOA 4MO4A 4MO5A 3ENHA 4GV9A 4FWKA 4JAXA 3Q7BA 4BR9A 3GG4A 5GAHP 4IOXA 3FZFA 1LCUA 1HX1A 1S22A 4CZMA 5E26A 3O8MA 4EHUA 3UKRB 3ENOA 4U67L 2AP1A 1RDWX 3AAQA 3VEOA 4KH6A 1HUXA 1N8RO 3O5BA 2YJEA 2F9WA 4A2AA 4PL8A 4BRDA 2J4RA 3HSCA 3UE5A 4DB3A 3U9DA 2E2OA 3WXMB 4JK8A 4DCHA 3BF1A 1W2BM 3QMLA 4JKAA 3CXCM 4FL9A 4A2BA 4H5NA 2P9LB 3UB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TKW A;  4PHT X;  2BH1 A;  1YF5 L;  1W97 L; 
#chains in the Genus database with same CATH topology
 2VG7 A;  3AVA A;  3ITH A;  2YNG A;  5AQZ A;  1WOQ A;  3MMV A;  1K6Y A;  3WNG A;  3K0S A;  2OPQ A;  3NF6 A;  3C6A A;  4PKH A;  1U45 A;  1SZ2 A;  4CHO A;  1NOZ A;  2P9P B;  3LZJ A;  2VCP A;  4CGG A;  1VQ7 N;  2FBY A;  2O4I A;  5C2F A;  3QEW A;  3A5L C;  2P9K B;  3VEY A;  5FPM A;  3ZCM A;  4JI0 K;  2WON A;  4E7H A;  1P90 A;  3HO1 A;  3OW2 M;  3FLC O;  4FVU A;  4ISG A;  1CZ9 A;  3BF3 A;  3VEV A;  2O8D A;  3AVH A;  1IBM K;  1HPZ A;  5KPT A;  1VSL A;  1L3U A;  1HNV A;  4FZX C;  5BRF A;  4WFA L;  3SUP A;  3QB0 A;  2B4J A;  1SV5 A;  3JS6 A;  4BC2 A;  4DR1 K;  1VSD A;  3QEV A;  5AQN A;  1SQK A;  3NVM A;  3L2V A;  1RBV A;  4DR7 K;  4BDZ A;  1IV0 A;  3TPQ A;  5LMU K;  3OTO K;  4IG0 A;  3FZM A;  1KD1 O;  1CZA N;  4IOA L;  3ZLJ A;  4CJL A;  1RDC A;  3AA4 A;  4CZI A;  4C8M A;  5AQF A;  5BRH A;  3AVF A;  1T6D A;  1VQ8 N;  3P39 A;  5B8H A;  3KK7 A;  1NGA A;  1RIL A;  5I3U A;  3IRX A;  4M45 A;  1T44 A;  3KLF A;  3MEE A;  4KTQ A;  3CQY A;  1VHX A;  4JS4 A;  1EKE A;  4Z4G A;  4ISE A;  4O4G A;  1JXE A;  1BCM A;  3AVL A;  1J53 A;  3CM6 A;  3T69 A;  1QQN A;  3M8R A;  5ELZ A;  2NZT A;  1XHZ A;  1K73 O;  3ZSV A;  4BRH A;  4ILG B;  5CZ1 A;  3CJ9 A;  2WC9 A;  4DWI A;  2BAN A;  1XQS C;  3BUZ B;  1XNR K;  2DFF A;  3VQD A;  4YNQ A;  3K5N A;  4FOI A;  5CZ2 A;  3H45 C;  4C8K A;  4W5N A;  3IKM A;  3KWG A;  3M8Q A;  5AQM A;  5GIO A;  3S3M A;  1ZBS A;  4CF8 A;  3NFA A;  4OLA A;  4BRM A;  2A1R A;  1M90 O;  5AQP A;  2OTJ N;  2IC3 A;  1LWE A;  1XI1 A;  5JMV A;  3K2P A;  2YX6 A;  3LDQ A;  4CEC A;  4E19 A;  1IG8 A;  1SL0 A;  4E7I A;  4WQ5 A;  1HMV A;  4FW1 A;  4BR5 A;  3EZ5 A;  4K43 A;  2QWO A;  4JHD A;  4FK2 A;  5KPR A;  2XY8 A;  3H1Q A;  2V51 B;  4Z0U A;  4CEE A;  4CIE A;  3THW B;  3K9K A;  3GOI A;  3R8E A;  1VSF A;  5J2N A;  1KFD A;  4CJU A;  4LF7 K;  4KHQ A;  1BIZ A;  1HLU A;  3DLG A;  3DOL A;  3P38 A;  3VES A;  4RTF D;  1OH7 A;  1N32 K;  3KVG A;  2RN2 A;  3IFR A;  4B9V A;  1JL2 A;  3LWL A;  4K25 A;  3OYI A;  2F8T A;  3DXM A;  5AQR A;  1U6Z A;  3VMF B;  3AVN A;  3VOV A;  3OS0 A;  1BHL A;  1BI4 B;  2VQE K;  1XMQ K;  4CW7 B;  1U48 A;  1QE1 A;  1A5W A;  4DU4 A;  5AFU A;  3L3V A;  4GW6 A;  3ISN C;  4DLE A;  4O0I A;  3NH2 A;  4IWV A;  2P9S B;  3PIO L;  4U7B A;  4X62 K;  3VEX A;  3HP6 A;  1HYZ A;  4FYD A;  2FLO A;  2X74 A;  2HHQ A;  2RHK A;  1IKV A;  3TAM A;  1KFS A;  2Z1I A;  4DV4 K;  3THW A;  3TI0 A;  3ZT1 A;  5A2Q O;  1NWK A;  4JN4 A;  4BRQ A;  3QET A;  3ZX0 A;  1KSP A;  3SV4 A;  2E6M A;  1WNS A;  1YT3 A;  3MWT A;  3HRG A;  4JI5 K;  5JS1 A;  3HXM A;  3MDQ A;  4FJG A;  3CCJ N;  4JNE A;  1ZBH A;  2G8K A;  3DXM B;  3OA9 A;  3CHW A;  4RW6 A;  3M6G A;  1BGX T;  2NRW A;  4H5W A;  3OYF A;  5LMN K;  2YHY A;  3CJB A;  4CI6 A;  4B9N A;  4KI6 A;  4YY3 K;  4A62 A;  1JL1 A;  3NF7 A;  3SUN A;  2CH5 A;  3RMB A;  3AO4 A;  2ZE2 A;  2O8B A;  2DFH A;  4H0O A;  1NJW A;  2NLX A;  3D7E O;  4MDB A;  3CQ8 A;  3SMS A;  4W5Q A;  1TKZ A;  1JXB A;  3RR8 A;  1JLG A;  3FZK A;  1NGB A;  1QS4 A;  3OS1 A;  3SAF A;  1YVU A;  3DRR A;  4CD3 A;  4CZE A;  1SL1 A;  5CE3 A;  5KRT A;  1U47 A;  1T8E A;  3IMX A;  3R9P A;  4KHP K;  4DTN A;  3VQC A;  4CGF A;  1C0U A;  3IS9 A;  4MDA A;  3VQ5 A;  2P5O A;  5HRN A;  4CJF A;  1Q9X A;  2OA8 A;  1TVR A;  1NJX A;  3CMA N;  4WQ5 C;  1RBS A;  3VGM A;  1Q82 O;  5KI6 A;  2OPP A;  5KQD A;  4C8N A;  3DAW A;  4DTJ A;  1OKJ A;  5AZJ A;  4DSJ A;  3WEE B;  1ZXO A;  3T1H K;  5J2P A;  3IDH A;  3MN9 A;  5C12 A;  4E3S A;  3WXK A;  4DG1 A;  3N4P A;  2V7Y A;  3WQT A;  5SWM A;  4DU3 A;  3VQB A;  3OY9 A;  4PKG A;  3CQX A;  1C6V A;  4FJM A;  1MWM A;  2HBM A;  4BRP A;  2D5R A;  4FWQ A;  4FPA A;  2P9N A;  1Q8I A;  1XHX A;  2IOC A;  2NRH A;  1OH8 A;  2EWS A;  2OPS A;  3LAM A;  4IDH A;  2QTD A;  3ALY A;  1DKG D;  3CC2 N;  4CJ3 A;  3O9Q A;  4J2A A;  4NXM K;  3NH1 A;  4OPJ A;  4DQ8 A;  3ZSO A;  4HCB A;  3C95 A;  3HI0 A;  3HTV A;  4FJL A;  3U9Z A;  4YOV A;  3ENB A;  4CZJ A;  4ILH A;  4Z94 A;  1E4F T;  3VQ6 A;  4JYA K;  4E7L A;  4QS8 A;  4A57 A;  2NRV A;  2Q2R A;  2X6S A;  2Q1N A;  2HMI A;  3VF6 A;  3MN7 A;  3MN6 A;  1WSF A;  3BEX A;  4HUE A;  4KO0 A;  3T1Y K;  2OYQ A;  3A0I X;  1LAW A;  3FE1 A;  3AAP A;  3SK3 A;  3V9U A;  4JI6 K;  2VG5 A;  4H03 B;  4KAZ A;  3SMP A;  1JLE A;  1KVC A;  3FZH A;  1UA0 A;  1QHA A;  3LPU A;  1VQN N;  3VA0 A;  2WTU A;  1QHT A;  1C0G A;  3M8P A;  3S3N A;  3DLH A;  4FVM A;  4CGH A;  1F21 A;  4CJW A;  4BG8 A;  3S41 A;  2FC0 A;  3EKS A;  1UOC A;  4B3T K;  5AQJ A;  1XC9 A;  4YOT A;  1BQN A;  5DM6 L;  2GEM A;  4M3U A;  1S1T A;  3ATV A;  5M1F A;  3O1W A;  3AVC A;  2KFZ A;  3F9K A;  1UAX A;  3BGR A;  1TKX A;  3CET A;  1NGF A;  1JLC A;  4YFU A;  3BDP A;  1S1V A;  3D2F B;  2O8F A;  3UKU B;  1VQL N;  3TWH A;  3PLA A;  1E3M A;  4AHV A;  4JI8 K;  1RDU A;  3L4Q A;  3V9Z A;  3O3G A;  3E9O A;  4LF6 K;  3VF2 A;  3AGK A;  3EEQ A;  4MO4 A;  3OYM A;  2YHA A;  4HHT A;  3RR7 A;  4GV9 A;  4GKK K;  4KI4 A;  4CHY A;  4OKK A;  5GAH P;  2P51 A;  1LCU A;  1HX1 A;  5LL6 Z;  3AV9 A;  4CZM A;  3O8M A;  3OYJ A;  3ZT0 A;  3BY5 A;  1L5U A;  3J80 O;  3QO9 A;  3VEO A;  2YV0 X;  1WBB A;  1MU2 A;  5FRO A;  4A2A A;  2J4R A;  4HUG A;  3HSC A;  2E2O A;  3WXM B;  2QKK A;  4BWJ A;  1HNX K;  4KPY A;  4CGI A;  4JKA A;  4A2B A;  4K8X A;  4H5N A;  3UB5 A;  3K5M A;  4J8F A;  5F1X A;  1RTD A;  3CER A;  2YKM A;  4LH4 A;  3DLB A;  4CBU A;  3MWP A;  3UKU A;  3IUC A;  2W6L A;  4CEB A;  3TAQ A;  2X6N A;  5FPN A;  1QSL A;  1V4S A;  1TK5 A;  4H0Y B;  4DR5 K;  3HOT A;  2F8S A;  1K8A O;  3U3G A;  3ASM A;  3IAY A;  4EZ6 A;  5AQK A;  4HWI A;  4B3R K;  2VYP A;  4BWM A;  1FKO A;  4DKW A;  3ZX3 A;  3A5M C;  1RDD A;  2FF3 B;  5AFU H;  3CM5 A;  3DXK A;  4M3Y A;  1IJJ A;  1WAJ A;  3ZSX A;  3UIQ A;  3SJH A;  3H3O B;  3R1X A;  1TK8 A;  2QWN A;  2NNW A;  5AQU A;  2P9L A;  3HYF A;  1KLN A;  2UUC K;  4UY8 O;  3TTD A;  1RBR A;  1TKD A;  1HYS A;  2OZS A;  4YDU C;  4C1N I;  3NAE A;  3L8B A;  3ZEU B;  4B08 A;  5BRD A;  4DTM A;  1BA1 A;  4LY7 A;  3P83 D;  3OYH A;  4LFB K;  3K9J A;  1NK5 A;  3G10 A;  3KHY A;  4CGD A;  1BIU A;  2B6A A;  4I2P A;  4OKE A;  4DV1 K;  4BRE A;  3HK2 A;  1BDG A;  4DF8 A;  2E4L A;  4CER A;  5FRM A;  1DTT A;  4DV7 K;  4CJK A;  3P31 A;  3MX2 A;  3B6P A;  3HZ6 A;  3KK1 A;  4CF2 A;  3H08 A;  3CCL N;  1T3V A;  2NRX A;  3ULE A;  2IAJ A;  5KPZ A;  2BTF A;  3O6W A;  4I9Q A;  3WNF A;  2Q97 A;  4AHC A;  4JRP A;  2QA4 N;  3C6T A;  3I0R A;  4H4M A;  3NF9 A;  1V4T A;  4LF8 K;  3VQA A;  3SI6 A;  2GTD A;  4QS9 A;  2W42 A;  1VQM N;  1SL2 A;  2GX9 A;  3G25 A;  4AQY K;  1MA9 B;  1N34 K;  1RTJ A;  1CZB A;  1WSG A;  1YUW A;  4Q5V A;  2FSK A;  1LV5 A;  4DUY K;  1S6P A;  3SQ2 A;  1FJG K;  5ADX H;  2HVH A;  4GMJ B;  3A2F A;  4K0K K;  4YDU A;  3O4W A;  3QNO A;  2HB5 A;  4N56 A;  1KAY A;  2XRI A;  5HRP A;  4B3M K;  1KRP A;  3V1R A;  2DPN A;  1BQM A;  4FZY A;  3AVB A;  1L3V A;  1ZBU A;  5BPN A;  1A5X A;  1RFQ A;  1YTA A;  5ADX A;  5JLH A;  1Q18 A;  4YOR A;  3NF8 A;  3QIN A;  3CFP A;  3J81 O;  1TL1 A;  5F0X A;  4OJR A;  5AZJ B;  3MAQ A;  1T03 A;  1NBW A;  3AVM A;  3HBT A;  3P4I A;  3NGZ A;  2YNH A;  4E1M A;  4JLH A;  1QZ5 A;  4L8R B;  3SAG A;  2PYJ A;  3OYC A;  3E66 A;  5H1S Q;  4IBN A;  1X3N A;  4H5R A;  3SBG A;  3PUF A;  1KLM A;  4CF0 A;  4NCB A;  2QKB A;  5HRS A;  3SV3 A;  3G6E N;  4R79 A;  1FXX A;  2P5G A;  3MED A;  4I6M A;  3ZSQ A;  1RNH A;  4OPA A;  4N5S A;  1DTQ A;  1N33 K;  3QBW A;  1BIS A;  4DS5 A;  4B9S A;  3HPH A;  3EYZ A;  3ZET A;  1XMO K;  3D0P A;  4IFE A;  3QNN A;  4OPK A;  3NDK A;  1VSE A;  5CHI A;  4FK0 A;  1NM1 A;  4LC9 B;  5EU7 A;  2HMP A;  4CFA A;  3E9P A;  2ZGZ A;  5EOY A;  2BDP A;  4DSF A;  3TAP A;  1S1W A;  3AO3 A;  1TAQ A;  5M1K A;  4FJJ A;  2OTL N;  3CCE N;  2AA4 A;  3OVN A;  4KRE A;  1I94 K;  3ZYY X;  2HHU A;  3H6E A;  3K58 A;  4B9Q A;  1BL3 A;  4QOZ B;  1A5V A;  2O8C B;  2E8A A;  2QWM A;  1JCG A;  4CJT A;  1J6Z A;  4Z4C A;  4NYN A;  1NMN A;  4M7Y A;  4CJE A;  4IOC L;  1KC8 O;  3MEG A;  3HM9 A;  4JKD A;  4I6M B;  4NB4 A;  2Y1J A;  2YCH A;  4CES A;  4GVM A;  4ZTJ A;  1D9D A;  3CCU N;  3B8A X;  4JI3 K;  2IVN A;  2HHV A;  2ZF5 O;  3VEZ A;  3H46 O;  3DMJ A;  1YVN A;  4B9L A;  1VQO N;  1D9F A;  1YAG A;  3O3H A;  4O55 A;  2ZJP L;  3CF5 L;  1X9M A;  5BN9 A;  4F3O A;  2BUP A;  4O0J A;  3L4I A;  4E7J A;  1B92 A;  1HKG A;  1J9A A;  4BC3 A;  2P9P A;  1GLD G;  5AQO A;  4O8K A;  3T3F A;  1HNW K;  1BOT O;  5HLF A;  4DSE A;  1NK9 A;  1TUY A;  3I8B A;  1YJ9 N;  1GLB G;  3ZX2 A;  3AVK A;  4DR4 K;  1GLA G;  2YHW A;  4WCE L;  4CBX A;  2P9N B;  4FJ5 A;  2IDO A;  3M3Z A;  2YKN A;  3DLL L;  1HKC A;  2P9S A;  1HPM A;  3SPY A;  3O4N A;  2D0A A;  5C24 A;  5HRR A;  1BCO A;  3NVK A;  2PBD A;  4CK2 A;  2F4V K;  4KH4 A;  5J2M A;  3HJF A;  1NK6 A;  4FJN A;  5JIC A;  3AA5 X;  2R7Y A;  1BWF O;  3OHR A;  1TYQ A;  2IVP A;  1Y97 A;  4CK3 A;  5EY4 A;  2XO7 A;  5M1O A;  3AVJ A;  1VSI A;  4BVO A;  1YIT N;  4YOW A;  2HHH K;  4CE9 A;  5DM7 L;  1MDU B;  5AQW A;  3O9T A;  5EX5 A;  4M3Z A;  4AHS A;  3CD6 N;  3CCM N;  4H0P A;  4F2S A;  4WFN L;  3SQ1 A;  3OYB A;  3KJV A;  1C0F A;  1WB9 A;  5BPM A;  2UXD K;  4IZ9 A;  1RCH A;  5I42 A;  2JGU A;  1D8Y A;  1HNZ K;  4V19 S;  1S9G A;  2QXL A;  1ZBI A;  3BZC A;  4DQP A;  4FLY A;  1KQS M;  1BG3 A;  3WNE A;  4I7F A;  3DWL A;  2QWP A;  1QZ6 A;  4CIF A;  2QWQ A;  3KD1 E;  1WLJ A;  3THX A;  2FBX A;  4X65 K;  1Z05 A;  3HVT A;  3L2R A;  3RMC A;  3LDS A;  5CYM A;  4JI7 K;  1NK7 A;  4BRL A;  1UA1 A;  4Z4E A;  1CXU A;  4H0T B;  3F9M A;  2QW9 A;  3KIO A;  3OBY A;  1MWK A;  4BRC A;  1KCF A;  3QFP A;  5HBM A;  3QBX A;  3CI5 A;  4WF9 L;  1EP4 A;  4DSL A;  2HBJ A;  3QIP A;  4HTL A;  4OX9 K;  1ZBL A;  3RRH A;  3KLH A;  1GLE G;  2A6A A;  2E2Q A;  4BG9 A;  1RDA A;  4I9L A;  4Y1D A;  4IDK A;  2ITG A;  4ICL A;  5HRO A;  2UXB K;  3VGK A;  3OBW A;  1ASV A;  3QES A;  2PY5 A;  4OPH A;  4PWD A;  4KTZ A;  4Z4F A;  5CYQ A;  2BGG A;  2RF2 A;  3V9W A;  3EKU A;  3WEE A;  4DLG A;  1RT7 A;  3LL3 A;  2HVI A;  3D45 A;  4JKC A;  5M1P A;  4FJH A;  4DFM A;  4MO5 A;  1JLA A;  4FWK A;  3SUO A;  1RBU A;  3FZF A;  2YHB A;  3UKR B;  3ENO A;  3V81 A;  4LF5 K;  4DQI A;  3KLI A;  2DFE A;  3CG7 A;  4KH6 A;  4DTX A;  1N8R O;  3OYA A;  4DSI A;  3BF1 A;  1W2B M;  3QML A;  4CED A;  5J2Q A;  3CXC M;  5KGW A;  4KHW A;  5AJ3 K;  4RW7 A;  1C1C A;  3AAR A;  3VQP A;  4RW4 A;  4DUZ K;  2Q36 A;  4DV2 K;  3EE9 A;  3T7Z A;  4RW9 A;  4H5T A;  5GIN A;  2Q0U A;  3DJC A;  3SAH A;  4LF4 K;  3CJ7 A;  1GLJ O;  4XH1 A;  4RG8 A;  3SQ4 A;  4DR6 K;  1DT9 A;  1FK9 A;  3H1V X;  2XY7 A;  4B8C A;  2ZQB A;  5GAD P;  2A5X A;  1X1P A;  2W40 A;  3DRP A;  1S72 N;  4XH5 A;  3CPW M;  4WYB A;  2V52 B;  4OVL A;  4BRO A;  2LSN A;  3AA2 A;  3B6O A;  1QTM A;  2VG6 A;  5CY4 A;  3AVG A;  4LFA K;  2P9U B;  2FXU A;  4BRG A;  5IWA K;  1WN7 A;  1NGC A;  1ASW A;  2D4W A;  3CJ1 A;  3C7N A;  3VPZ A;  1S6Q A;  4JKB A;  4K42 A;  4KHY A;  3BZK A;  4BR4 A;  2D0O A;  2ZGY A;  4DMN A;  2NRZ A;  4BGB A;  3SLC A;  4FM2 A;  1WSH A;  5MLC Q;  2KW4 A;  2RKI A;  5GAG P;  2QXF A;  4CVN E;  5C2D A;  4LSN A;  4E0D A;  4CZH A;  3I56 N;  1VRT A;  4BDY A;  3OYG A;  3O80 A;  3FFK B;  3LP1 A;  3N4Q A;  3VER A;  3OYE A;  4FJ7 A;  2Q0R A;  2G8I A;  3VN5 A;  3ZEU A;  5KGX A;  3ID8 A;  3AVI A;  1NGH A;  4CEA A;  2QK9 A;  4FO0 A;  1IH7 A;  3VGL A;  5FRN A;  3F2K A;  1RBT A;  3V6D A;  1QQM A;  4A59 A;  4PY5 A;  1ITG A;  4B3O A;  2KQ2 A;  3R6M A;  4KHN A;  3C7N B;  3BP8 A;  1SAZ A;  3JAM O;  3F5T A;  4DR2 K;  1R0A A;  1TAU A;  1ATR A;  2YHX A;  4DQQ A;  3DLK A;  3H3N O;  2ASO A;  3RWU A;  3QDK A;  3A8Y A;  1QQO A;  4B1X B;  4CZK A;  1LWC A;  5KTQ A;  4TSX A;  1X9S A;  4MLH A;  3O08 A;  3OYD A;  1ATN A;  5AQG A;  4PL7 A;  4ZHR A;  1RT5 A;  1VQ9 N;  2E20 A;  1ZYQ A;  1ASU A;  2QI2 A;  3MX5 A;  5K14 A;  4C23 A;  2AJQ A;  3CME N;  3AY9 A;  4NCA A;  4FK4 A;  3M1F A;  1NGD A;  1NLV A;  3SJJ A;  1KAZ A;  3RMA A;  2PAV A;  4GV6 A;  5KRS A;  4YOU A;  2IS3 A;  3TAB A;  4JEP A;  4PA1 A;  2GUI A;  3DXK B;  3MEC A;  4B1U B;  4CGJ A;  3KLG A;  2BH1 A;  1ATS A;  1YF5 L;  3I33 A;  4JI4 K;  4BE2 A;  3LAK A;  3KTQ A;  1FKP A;  4BRK A;  4BRN A;  1WSI A;  4ZTF A;  4DTS A;  3OYL A;  2RE2 A;  5BN8 A;  4AIL C;  2HOE A;  4DTP A;  4FW2 A;  5BPL A;  4BR7 A;  2UYT A;  1Z26 A;  4GKJ K;  4LSL A;  3DRS A;  3CCQ N;  3HPO A;  3L6Q A;  1N6Q A;  3FR0 A;  2D0P A;  2HHS A;  2NRT A;  2CH6 A;  2XHB A;  1K8K A;  5HL7 L;  4A5B A;  3FFI A;  4JHD B;  4CJP A;  3VET A;  3GE1 A;  1RT1 A;  2IGI A;  1QQC A;  2GV9 A;  4DHY A;  2D0B A;  2G8U A;  2CGJ A;  2CGK A;  1R59 O;  4GV3 A;  4B3S K;  4N41 A;  4CEO A;  4IO9 L;  3Q7C A;  4CFD A;  2OZM A;  2E6L A;  4CK1 A;  2HNY A;  4KH5 A;  4JKE A;  3THV A;  3JYT A;  2HBL A;  4CF9 A;  1RT2 A;  2ZD1 A;  4FCY A;  4Z4H A;  4JKF A;  1GLL O;  4HTU A;  4CF1 A;  5D3G A;  2P9K A;  3EZW A;  4MQ3 A;  2D0C A;  3MN5 A;  2P9U A;  3ZSW A;  4ELT A;  4H5V A;  3CJA A;  2HND A;  3F73 A;  4MFB A;  1EX4 A;  4FZZ A;  4O5B A;  3J7A P;  4FLW A;  2HF4 A;  4KB0 A;  3HOS A;  2Z1H A;  1CXQ A;  4GY2 B;  4JK9 A;  5SZT A;  3KKR A;  4JK7 A;  4BQZ A;  5BR9 A;  2KLA A;  3V9S A;  2H3G X;  3J7Z O;  5AQX A;  1EXQ A;  3QLH A;  1EQY A;  1NGG A;  2GWJ A;  4CFC A;  4O5F A;  4B1Y B;  3EY1 A;  1S3X A;  4IJA A;  4HUF A;  4BQL A;  4AM6 A;  4KKO A;  4E1J A;  2UUA K;  3CPE A;  4GVE A;  2VGM A;  3DM2 A;  4DF4 A;  4ELV A;  1TL3 A;  2GWK A;  2YNI A;  4FWN A;  2G8V A;  3VQ9 A;  1O13 A;  3DLE A;  1P8Z A;  1WUA A;  4DQR A;  4DV0 K;  3TSP A;  4DTU A;  1QVF M;  3TSQ A;  4M41 A;  1QSS A;  2WOM A;  1JCF A;  1G15 A;  2F7T A;  3T19 A;  1BUP A;  5AR0 A;  3FGU A;  3NH0 A;  4O44 A;  1RT3 A;  1EO1 A;  4MLE A;  3VQE A;  3QER A;  3LM2 A;  5M1Q A;  3VF4 A;  4CJV A;  2WBN A;  3I8D A;  2EX3 A;  1NGE A;  3ZSY A;  1JLB A;  2QM1 A;  3TAE A;  2B5J A;  2HHW A;  1VAZ A;  4FLV A;  1J5E K;  2F96 A;  1GLF O;  2QWR A;  1LWF A;  1NKE A;  2KKZ A;  4NO7 A;  1QSY A;  3EO3 A;  4CCH A;  1TKT A;  3V9X A;  2YNF A;  5AZI B;  1X3M A;  1YJW N;  4FM1 A;  3C6U A;  4KV8 A;  3KK2 A;  3ZT4 A;  1SKS A;  4FLT A;  2O4G A;  5AQQ A;  3D6R A;  1SUQ A;  5FPE A;  3T1A A;  3AO5 A;  3D2E A;  3LAN A;  3ZSR A;  5JLF A;  4AH9 A;  1H1V A;  4CZG A;  4QS7 A;  3PO4 A;  3NGY A;  1NKC A;  1C1A A;  1VQK N;  4DV3 K;  3QIO A;  4OLB A;  3KKS A;  4DFP A;  5FLX O;  5CR4 A;  4NLC A;  1WSE A;  2WUS A;  4FJI A;  1LOT B;  3S3O A;  5AQL A;  4RW8 A;  4M7X A;  2W6K A;  3J8A A;  4YHH K;  3G71 N;  3K59 A;  2ASM A;  4QCL A;  4BAC A;  4W5T A;  3LDO A;  4KFB A;  2P9I A;  1EWR A;  3AGR A;  1VSM A;  3SPZ A;  1S1X A;  4KTW A;  1JKH A;  4NCG A;  3PX6 A;  2G8W A;  4LFC K;  2ZJQ L;  2GEL A;  3U8X A;  2HW3 A;  1TV6 A;  5AZI A;  2BE2 A;  3CJC A;  4DFJ A;  5LJW A;  1W9H A;  3RMD A;  4F3T A;  3TTF A;  4JKG B;  1Q9Y A;  5I9E B;  2E2P A;  1G99 A;  4FOE A;  3JSM A;  3THX B;  1JLF A;  4HCC A;  1U04 A;  1RDB A;  1YI2 N;  4G1Q A;  5AQS A;  2E1Y A;  4FSV A;  4IEI A;  4A5A A;  4CJ4 A;  4B1W B;  2FF6 A;  5T7B A;  5AQY A;  5HOO A;  4M63 C;  4DV5 K;  4CEF A;  1LW2 A;  1LW0 A;  2W41 A;  3VA3 A;  4FLZ A;  1NU0 A;  3P5J A;  4C8O A;  4DS4 A;  1D4X A;  2X78 A;  2PZS A;  4J2E A;  4JD2 A;  5AQV A;  4CZL A;  5HP1 A;  3UKR A;  5F2R A;  2ZWH A;  2P1J A;  3THY A;  3LDL A;  1SKR A;  3LAL A;  1UWB A;  4CBW A;  1FW6 A;  2KHO A;  4JAX A;  3KLE A;  4BR9 A;  3GG4 A;  2Q3S A;  3K57 A;  1J54 A;  1X9W A;  3KD5 E;  2AP1 A;  4KRF A;  1EWQ A;  3AAQ A;  4E1N A;  3O5B A;  3DOK A;  2F9W A;  4PL8 A;  4HVJ A;  4BRD A;  3PSI A;  3UE5 A;  4Y1C A;  3SNN A;  4DB3 A;  1S5J A;  4FJK A;  2O8E A;  4DCH A;  2HHX A;  1C0M A;  3RTV A;  1W7A A;  2P9L B;  2FBV A;  5FPD A;  3U3Y A;  5C0Y A;  4IEE A;  2QWL A;  4CHQ A;  1TGO A;  1Z25 A;  2OCE A;  4JD2 B;  3WUH A;  2FSJ A;  4CZF A;  4BR2 A;  4C8L A;  3E1Y A;  3FZL A;  4ISF A;  3SBT A;  4CHZ A;  4FWO A;  1N36 K;  1Q86 O;  1NG9 A;  4OGE A;  1VSH A;  3MCA B;  1BO5 O;  3HM8 A;  3MK6 A;  3S9H A;  4K8Z A;  4FPB A;  1VRU A;  3ZT2 A;  3A5N C;  3ULD A;  4H4O A;  4CJ7 A;  1WAF A;  1YJN N;  4CJ5 A;  4F8R A;  3L2Q A;  4BC5 A;  3M5R A;  4LD0 A;  2VWB A;  3ULE B;  3LWM A;  5IT9 O;  3HPG A;  2E1Z A;  4CEZ A;  5E84 A;  2YI1 A;  4H0V B;  4IFY A;  3LDN A;  4N76 A;  1XUP O;  1OH6 A;  1HJR A;  3V1O A;  1ILY A;  4AHT A;  2NUB A;  3VEW A;  5DMR A;  2KZZ A;  3EN9 A;  5JVG L;  3RSE A;  2HHT A;  4KBO A;  4FWM A;  4NXN K;  2A42 A;  4O8U A;  2OPR A;  1QVG M;  1HR0 K;  2Y1I A;  1L3S A;  3IG1 A;  1HYV A;  1OH5 A;  2A41 A;  2QEX N;  4PKI A;  1S1U A;  3NHG A;  3VQ7 A;  4Y0W A;  4BRA A;  3NBP A;  1REV A;  1JCE A;  4FM0 A;  1BU6 O;  4IFV A;  4OGC A;  4JRQ A;  1IBL K;  3O9R A;  1SKW A;  2I7N A;  1RGI A;  3PO5 A;  4EFH A;  5TKW A;  4IXC A;  2KZM A;  3VQ4 A;  4EIA A;  4DTR A;  3QEI A;  2A1S A;  2HST A;  4IG3 A;  4DU1 A;  2VQF K;  3PX0 A;  1NMD A;  4AHU A;  3C65 A;  4JS5 A;  3K5O A;  3LP2 A;  3HVR A;  2DY4 A;  4B8A B;  4EHT A;  4GNI A;  2P9I B;  1Y64 A;  4F2R A;  3I0S A;  2UXC K;  1DEJ A;  4BGA A;  1VQ5 N;  4FJX A;  4E89 A;  5J1E A;  1YHQ N;  3TSU A;  4KHU A;  1U49 A;  1S9E A;  4CHN A;  4G9Z A;  3LP0 A;  1VQ4 N;  3SQ0 A;  3GL1 A;  1NK4 A;  4XEI A;  3V4I A;  3MXI A;  3QIC A;  1RT6 A;  5M1N A;  3L2W A;  5JVH L;  1GLC G;  2IIR A;  2ETJ A;  3TAN A;  4R5P A;  5BRE A;  1HJO A;  4ID5 A;  4WE1 A;  3WT0 A;  4IO8 A;  4UQG A;  1T05 A;  4B9M A;  2JWK A;  4B1V A;  3RRG A;  1IKX A;  3AA3 A;  1HQU A;  3O9U A;  3CFO A;  1TYQ B;  4FWP A;  5C15 A;  1O1W A;  1OVY A;  2HF3 A;  3ID6 A;  3QEP A;  3WXI A;  4DTO A;  4EZ9 A;  5JS2 A;  4N47 A;  3K5L A;  5C25 A;  3O1B A;  4BDP A;  2JWL A;  4KHS A;  3DYA A;  4NLB A;  4FJ9 A;  4FLU A;  5LY3 A;  3TU5 A;  4M42 A;  4B1Z A;  5AQH A;  3ZT3 A;  4BE1 A;  4DSK A;  3MCP A;  1NGI A;  2F9T A;  3PX4 A;  1NJI O;  3R3L A;  1C0T A;  4FWL A;  3LZI A;  2G8F A;  3PV8 A;  2G8H A;  1VQP N;  4Q0B A;  2RPI A;  4FJ8 A;  1X9J A;  1Q81 O;  1VSK A;  3HT3 A;  3E9L A;  4JI1 K;  2FBT A;  5EVZ A;  4CJQ A;  2I5J A;  3ATU A;  1IKW A;  3G4S N;  4X66 K;  2O8E B;  1E4G T;  1NGJ A;  3L2U A;  2FSN A;  1BI4 A;  4OO1 J;  3WNH A;  2XY6 A;  2A3Z A;  2OAN A;  4BC4 A;  2O8C A;  3A5O C;  4CJS A;  3E01 A;  3LM9 A;  2KTQ A;  1YXQ A;  1WSJ A;  3WXJ A;  1XC3 A;  4WQ4 C;  5KQ8 A;  2HNZ A;  2XY5 A;  1KVA A;  3P1G A;  4NYF A;  3O3F A;  3SZ2 A;  4FLX A;  3DI6 A;  3W3D A;  2ATQ A;  1RTH A;  1N5Y A;  4J2D A;  4BRI A;  2DTU A;  4DFK A;  4F9O A;  4EP4 A;  1WBD A;  4E7K A;  4DQS A;  4M3W A;  1NJY A;  1D5A A;  1JLQ A;  3D2E B;  3LP3 A;  1U2V A;  3CCV N;  4Z4I A;  2UU9 K;  4AM7 A;  3GBT A;  4XIU A;  2Z1G A;  2ZM6 K;  4AHR A;  3VEN A;  1EET A;  3M8S A;  5DK5 A;  4FWS A;  1VSJ A;  2E88 A;  3LPT A;  3VQQ A;  1NNE A;  4BE0 A;  3SUQ A;  1J5O A;  5EXW A;  2VWK A;  3DLR A;  4H0X B;  1ZBF A;  1TK0 A;  3QEX A;  1HNI A;  3VTI A;  1ESV A;  2IVO A;  2VWJ A;  3QFU A;  4CIG A;  3NMU A;  2O8B B;  3WQU A;  4BR0 A;  3CIP A;  3PSF A;  3O4Q A;  3ZET B;  3RVC A;  3W0L A;  1TUU A;  4JI2 K;  3L3U A;  4QAG A;  4CFB A;  1U2V B;  4C1N K;  2PYL A;  4JKH A;  3JXU A;  1DGK N;  3AO1 A;  4IKF A;  2E5L K;  3D2F A;  4PHT X;  1NOY A;  2O8F B;  1VK0 A;  4RWT A;  1NK0 A;  1KAX A;  1GOB A;  1RTI A;  4M3R A;  2HBK A;  1W0H A;  4AF1 A;  4A61 A;  4L3Q A;  1IG9 A;  3PIP L;  2NRR A;  1I39 A;  4JV5 K;  2WFB A;  1B9F A;  3EL2 A;  3U4L A;  1Q7Y O;  1L3T A;  1ZC6 A;  4BY9 C;  3OJU A;  4LF9 K;  2Q31 A;  5AQI A;  3EE8 A;  2O8D B;  1K8K B;  4CEQ A;  3L0Q A;  4K41 A;  1NK8 A;  3PY8 A;  2CGL A;  4B9U A;  3OYN A;  3CCR N;  4B9T A;  4FXD A;  4OKJ A;  2YJF A;  4EP5 A;  1HQE A;  1HKB A;  1CLQ A;  1RT4 A;  3CYM A;  1GOA A;  4I2Q A;  4M3T A;  2KFN A;  1LAV A;  4IJN A;  1I3A A;  5GAE P;  3OS2 A;  4YOX A;  3CFR A;  5E41 A;  1YIJ N;  5BR8 K;  3CC7 N;  3V1Q A;  4ILJ A;  5GIP A;  3G0Z A;  3VTH A;  3C94 A;  3NGI A;  5C42 A;  3NCI A;  2ZJR L;  1YTU A;  5LJV A;  4WQ4 A;  4BVP A;  4BRF A;  3SCX A;  2A40 A;  2PFU A;  3KWI A;  3CC4 N;  3SYZ A;  3TTC A;  4WFB L;  3OYK A;  3TAR A;  1NJZ A;  3TR8 A;  2V7Z A;  3C6H A;  4YOY A;  3HST B;  2JLE A;  4RCH A;  4M3X A;  1Z6R A;  3GDQ A;  1M1K O;  1JJ2 M;  2UUB K;  4JKG A;  4CJR A;  2ITM A;  3O9S A;  4DV6 K;  4XH4 A;  1DLO A;  3NE6 A;  2GUP A;  3U6F A;  4FWR A;  1OVQ A;  2Z1J A;  1SS6 A;  3VQ8 A;  2D1K A;  2VGN A;  1GOC A;  4EAH D;  3CCS N;  4DR3 K;  5FDL A;  1KXP A;  2GBZ A;  1W97 L;  3RSE B;  1IBK K;  4ELU A;  4LH5 A;  1T7P A;  2E2N A;  5AQT A;  3J7Y P;  2I7P A;  5TKY A;  5C10 A;  4PQU A;  4F4K A;  4X64 K;  3MXM A;  1T6C A;  1BA0 A;  2ASP A;  3OJS A;  1K9M O;  1IO2 A;  4PUO A;  1U4B A;  3I55 N;  1B9D A;  3LDP A;  3C0B A;  4CD1 A;  2EHG A;  4CHP A;  1KTQ A;  3KZB A;  1VQ6 N;  3TAF A;  3WXL A;  1XWL A;  4H8K A;  3HL8 A;  3AO2 A;  3ENH A;  3Q7B A;  4IOX A;  3MXJ A;  4EHU A;  1S22 A;  5E26 A;  1NKB A;  4U67 L;  1KVB A;  1RDW X;  3THY B;  3ZSZ A;  1C1B A;  3HP9 A;  3TAG A;  4ID1 A;  4W5O A;  1HUX A;  1XNQ K;  2YJE A;  3KK3 A;  4KB1 A;  3U9D A;  4W5R A;  4JK8 A;  4FL9 A;  1HRH A;  1IKY A;  4J2B A; 
#chains in the Genus database with same CATH homology
 5FPD A;  4J8F A;  5F1X A;  3CER A;  3AAR A;  5C0Y A;  4IEE A;  2QWL A;  4CBU A;  3MWP A;  5AQZ A;  1WOQ A;  3UKU A;  3IUC A;  2Q36 A;  3MMV A;  3EE9 A;  4JD2 B;  3WUH A;  2FSJ A;  3T7Z A;  4CZF A;  4BR2 A;  4H5T A;  5GIN A;  2Q0U A;  3DJC A;  5FPN A;  1V4S A;  3SAH A;  3E1Y A;  3C6A A;  4H0Y B;  3CJ7 A;  3FZL A;  1GLJ O;  4ISF A;  3SBT A;  3HOT A;  4FWO A;  4PKH A;  4XH1 A;  1K8A O;  1SZ2 A;  2P9P B;  5AQK A;  4HWI A;  1Q86 O;  1DT9 A;  2VYP A;  2VCP A;  3H1V X;  3MCA B;  4DKW A;  1BO5 O;  3HM8 A;  3MK6 A;  3ZX3 A;  1VQ7 N;  3A5M C;  4FPB A;  5GAD P;  2A5X A;  2W40 A;  1S72 N;  2FF3 B;  4XH5 A;  5AFU H;  3A5N C;  4WYB A;  2V52 B;  3DXK A;  5C2F A;  4BRO A;  4CJ7 A;  3A5L C;  3CPW M;  1YJN N;  2P9K B;  4BC5 A;  3M5R A;  5FPM A;  3VEY A;  2VWB A;  3ULE B;  2P9U B;  2FXU A;  1IJJ A;  4BRG A;  1P90 A;  2E1Z A;  3OW2 M;  3FLC O;  1NGC A;  5E84 A;  4FVU A;  2YI1 A;  2D4W A;  3CJ1 A;  4H0V B;  3SJH A;  3C7N A;  4ISG A;  3VPZ A;  3LDN A;  3BF3 A;  1XUP O;  3VEV A;  3H3O B;  3R1X A;  4JKB A;  4K42 A;  2QWN A;  2NNW A;  1ILY A;  5AQU A;  5KPT A;  4BR4 A;  3VEW A;  2P9L A;  2D0O A;  2ZGY A;  5BRF A;  4WFA L;  3EN9 A;  2NRZ A;  3QB0 A;  5JVG L;  4BGB A;  4BC2 A;  3JS6 A;  3RSE A;  3SLC A;  3TTD A;  4UY8 O;  4KBO A;  4FWM A;  2A42 A;  4O8U A;  4YDU C;  5AQN A;  4C1N I;  5MLC Q;  1QVG M;  5GAG P;  3ZEU B;  1SQK A;  5BRD A;  1BA1 A;  5C2D A;  3NVM A;  3K9J A;  3TPQ A;  4CZH A;  3KHY A;  2A41 A;  3I56 N;  2QEX N;  4PKI A;  3FZM A;  1KD1 O;  4BRE A;  3O80 A;  3FFK B;  4Y0W A;  4BRA A;  1BDG A;  1CZA N;  4IOA L;  3N4Q A;  3VER A;  1JCE A;  2Q0R A;  1BU6 O;  4CZI A;  3P31 A;  5AQF A;  3MX2 A;  3ZEU A;  5BRH A;  1T6D A;  3HZ6 A;  3ID8 A;  1VQ8 N;  1NGH A;  3O9R A;  3P39 A;  4FO0 A;  5B8H A;  2I7N A;  1NGA A;  1RGI A;  3KK7 A;  3VGL A;  4EFH A;  5TKW A;  3CCL N;  4IXC A;  1T44 A;  1T3V A;  2NRX A;  3F2K A;  3ULE A;  3CQY A;  5KPZ A;  4EIA A;  1QQM A;  4ISE A;  2BTF A;  4A59 A;  3O6W A;  2HST A;  2Q97 A;  1NMD A;  3R6M A;  2QA4 N;  3T69 A;  3C7N B;  1QQN A;  3BP8 A;  3C65 A;  1SAZ A;  2NZT A;  5ELZ A;  1K73 O;  1V4T A;  3F5T A;  4BRH A;  4ILG B;  3CJ9 A;  2WC9 A;  4EHT A;  1ATR A;  1XQS C;  2YHX A;  2GTD A;  3BUZ B;  4QS9 A;  4GNI A;  2P9I B;  1VQM N;  1Y64 A;  3H3N O;  2ASO A;  4FOI A;  3QDK A;  3A8Y A;  1DEJ A;  1QQO A;  2GX9 A;  3H45 C;  3G25 A;  4B1X B;  4BGA A;  4CZK A;  1VQ5 N;  3IKM A;  1YHQ N;  3KWG A;  5GIO A;  1MA9 B;  5AQM A;  1ZBS A;  3TSU A;  1YUW A;  4BRM A;  4MLH A;  3O08 A;  5AQP A;  1M90 O;  4G9Z A;  1VQ4 N;  2OTJ N;  3GL1 A;  1ATN A;  2FSK A;  5AQG A;  4XEI A;  4PL7 A;  3QIC A;  5M1N A;  5JMV A;  5JVH L;  1GLC G;  2IIR A;  5ADX H;  5BRE A;  2YX6 A;  1HJO A;  3WT0 A;  3LDQ A;  1VQ9 N;  4IO8 A;  1IG8 A;  2E20 A;  2JWK A;  2QI2 A;  4YDU A;  4B1V A;  3O4W A;  3MX5 A;  4WQ5 A;  4BR5 A;  3O9U A;  4C23 A;  1KAY A;  1TYQ B;  4K43 A;  3CME N;  3AY9 A;  4FWP A;  2QWO A;  4JHD A;  5C15 A;  1OVY A;  2HF3 A;  5KPR A;  3ID6 A;  3H1Q A;  3WXI A;  3M1F A;  2V51 B;  1NGD A;  1NLV A;  2DPN A;  1KAZ A;  2PAV A;  3K9K A;  4GV6 A;  3GOI A;  5BPN A;  4YOU A;  3R8E A;  4JEP A;  1HLU A;  1RFQ A;  3O1B A;  5ADX A;  2JWL A;  3VES A;  3DXK B;  3P38 A;  4B1U B;  4RTF D;  4NLB A;  5JLH A;  5LY3 A;  1Q18 A;  4YOR A;  2BH1 A;  3KVG A;  1ATS A;  1YF5 L;  3I33 A;  3TU5 A;  3IFR A;  4B1Z A;  5AQH A;  4K25 A;  3MCP A;  1NGI A;  2F9T A;  4BRK A;  4BRN A;  1NJI O;  3R3L A;  3DXM A;  4FWL A;  5AQR A;  1U6Z A;  2RE2 A;  3VMF B;  5BN8 A;  3VOV A;  5F0X A;  5AZJ B;  2HOE A;  1NBW A;  3HBT A;  3P4I A;  5BPL A;  1VQP N;  4BR7 A;  2UYT A;  1X9J A;  1Q81 O;  5AFU A;  1QZ5 A;  3CCQ N;  3E9L A;  5EVZ A;  3SAG A;  3L6Q A;  3ATU A;  3FR0 A;  3G4S N;  2D0P A;  3E66 A;  2NRT A;  2CH6 A;  5H1S Q;  1E4G T;  1NGJ A;  2P9S B;  4IWV A;  3PIO L;  2FSN A;  4U7B A;  1K8K A;  1X3N A;  4OO1 J;  4H5R A;  3SBG A;  3VEX A;  5HL7 L;  2A3Z A;  2OAN A;  4A5B A;  4BC4 A;  3A5O C;  4JHD B;  2FLO A;  3LM9 A;  3VET A;  1YXQ A;  2RHK A;  3WXJ A;  3G6E N;  1XC3 A;  4WQ4 C;  3GE1 A;  4R79 A;  5KQ8 A;  4DHY A;  2CGJ A;  4I6M A;  2CGK A;  1NWK A;  4JN4 A;  4BRQ A;  1R59 O;  4OPA A;  4GV3 A;  3ZX0 A;  3W3D A;  4IO9 L;  3MWT A;  3QBW A;  3Q7C A;  4BRI A;  3HRG A;  3MDQ A;  3ZET A;  4F9O A;  3CCJ N;  4IFE A;  4KH5 A;  4JNE A;  4JKE A;  2HBL A;  5CHI A;  3DXM B;  1NM1 A;  4LC9 B;  3D2E B;  2HMP A;  1U2V A;  3OA9 A;  3CHW A;  3E9P A;  4JKF A;  1GLL O;  2ZGZ A;  3CCV N;  5EOY A;  2P9K A;  3EZW A;  3M6G A;  4AM7 A;  3GBT A;  5M1K A;  3MN5 A;  2P9U A;  2NRW A;  4H5W A;  4H5V A;  3VEN A;  2OTL N;  3CCE N;  2YHY A;  3CJA A;  2AA4 A;  3CJB A;  4FWS A;  3ZYY X;  4CI6 A;  2E88 A;  3H6E A;  4A62 A;  4B9Q A;  5M1F A;  2CH5 A;  2HF4 A;  4H0O A;  3HOS A;  2E8A A;  2QWM A;  5EXW A;  2NLX A;  1JCG A;  3D7E O;  4GY2 B;  4H0X B;  4JK9 A;  4MDB A;  4JK7 A;  3SMS A;  4BQZ A;  5BR9 A;  2KLA A;  1J6Z A;  2H3G X;  3J7Z O;  5AQX A;  3FZK A;  1NGB A;  1EQY A;  1NGG A;  4M7Y A;  4IOC L;  2GWJ A;  1KC8 O;  4O5F A;  4JKD A;  4I6M B;  3SAF A;  4NB4 A;  3VTI A;  2YCH A;  4B1Y B;  1ESV A;  2IVO A;  3QFU A;  4CD3 A;  1S3X A;  4IJA A;  4CZE A;  3NMU A;  4BQL A;  3WQU A;  5CE3 A;  4AM6 A;  4E1J A;  4BR0 A;  3CPE A;  3IMX A;  3R9P A;  3CCU N;  3B8A X;  3CIP A;  2IVN A;  2VGM A;  2ZF5 O;  4GVE A;  3VEZ A;  3H46 O;  3RVC A;  3W0L A;  3ZET B;  2GWK A;  4FWN A;  4MDA A;  1TUU A;  1YVN A;  1VQO N;  1YAG A;  2ZJP L;  3CF5 L;  5BN9 A;  1U2V B;  1O13 A;  2BUP A;  4C1N K;  3L4I A;  1P8Z A;  1WUA A;  3CMA N;  4JKH A;  1HKG A;  3JXU A;  4BC3 A;  2P9P A;  1GLD G;  1DGK N;  5AQO A;  4O8K A;  4WQ5 C;  1BOT O;  3TSP A;  3D2F A;  3VGM A;  4PHT X;  1Q82 O;  1QVF M;  3TSQ A;  4RWT A;  5KQD A;  1TUY A;  3I8B A;  3DAW A;  1YJ9 N;  1JCF A;  1OKJ A;  5AZJ A;  1KAX A;  2F7T A;  5AR0 A;  1BUP A;  2HBK A;  1GLB G;  3FGU A;  3WEE B;  3ZX2 A;  1ZXO A;  4A61 A;  4AF1 A;  4L3Q A;  3IDH A;  1GLA G;  3MN9 A;  5C12 A;  3PIP L;  2NRR A;  2YHW A;  4WCE L;  4MLE A;  4CBX A;  1EO1 A;  2P9N B;  3WXK A;  2WFB A;  3N4P A;  3EL2 A;  2V7Y A;  3M3Z A;  3U4L A;  3WQT A;  3LM2 A;  5M1Q A;  1Q7Y O;  1ZC6 A;  3VF4 A;  4BY9 C;  2WBN A;  2Q31 A;  5AQI A;  3EE8 A;  1NGE A;  1HKC A;  2P9S A;  3DLL L;  1HPM A;  2QM1 A;  3CQX A;  1K8K B;  4PKG A;  1VAZ A;  3L0Q A;  1MWM A;  2HBM A;  4K41 A;  4BRP A;  3NVK A;  2PBD A;  4FWQ A;  2CGL A;  1GLF O;  2P9N A;  4FPA A;  2QWR A;  4KH4 A;  3CCR N;  2YJF A;  2KKZ A;  4NO7 A;  2NRH A;  3EO3 A;  1HKB A;  2EWS A;  4IDH A;  5JIC A;  2QTD A;  5AZI B;  1DKG D;  1X3M A;  3CC2 N;  1BWF O;  1YJW N;  3OHR A;  1TYQ A;  2IVP A;  3O9Q A;  4IJN A;  5GAE P;  5AQQ A;  4YOX A;  5EY4 A;  3D6R A;  1YIJ N;  5M1O A;  3CC7 N;  4DQ8 A;  4ILJ A;  5GIP A;  3HI0 A;  4BVO A;  3VTH A;  5FPE A;  3HTV A;  4YOW A;  1YIT N;  3D2E A;  5JLF A;  5DM7 L;  2ZJR L;  5LJV A;  1MDU B;  1H1V A;  4WQ4 A;  4QS7 A;  5AQW A;  3U9Z A;  3ENB A;  3O9T A;  5EX5 A;  4CZG A;  4CZJ A;  4YOV A;  1VQK N;  4ILH A;  4Z94 A;  1E4F T;  4BVP A;  3CD6 N;  3CCM N;  4BRF A;  4H0P A;  4QS8 A;  4A57 A;  4WFN L;  2A40 A;  2PFU A;  2NRV A;  2Q2R A;  3KWI A;  4NLC A;  2WUS A;  5CR4 A;  3TTC A;  1C0F A;  2Q1N A;  5BPM A;  1LOT B;  3CC4 N;  4IZ9 A;  5AQL A;  3MN7 A;  3MN6 A;  4M7X A;  3VF6 A;  4WFB L;  3J8A A;  3BEX A;  3G71 N;  2ASM A;  2V7Z A;  3C6H A;  3A0I X;  4YOY A;  3FE1 A;  4RCH A;  2QXL A;  1Z6R A;  3AAP A;  3GDQ A;  3LDO A;  3SK3 A;  1M1K O;  1JJ2 M;  2P9I A;  4H03 B;  1KQS M;  3AGR A;  4JKG A;  3SMP A;  1BG3 A;  3DWL A;  3FZH A;  1QHA A;  2ITM A;  2QWP A;  3O9S A;  1VQN N;  4XH4 A;  1QZ6 A;  2ZJQ L;  2GEL A;  2QWQ A;  2GUP A;  3U8X A;  1C0G A;  1Z05 A;  4FWR A;  5AZI A;  4BG8 A;  3S41 A;  3CJC A;  3EKS A;  5LJW A;  3TTF A;  1SS6 A;  2D1K A;  5AQJ A;  2VGN A;  4EAH D;  4JKG B;  4BRL A;  3CCS N;  1KXP A;  5I9E B;  4H0T B;  2E2P A;  4YOT A;  3F9M A;  1W97 L;  1G99 A;  2QW9 A;  1MWK A;  3OBY A;  3RSE B;  4BRC A;  3QFP A;  4FOE A;  5DM6 L;  2GEM A;  3QBX A;  3CI5 A;  2E2N A;  4WF9 L;  1YI2 N;  3ATV A;  2HBJ A;  4HTL A;  5AQT A;  5AQS A;  2E1Y A;  4FSV A;  4IEI A;  2I7P A;  3O1W A;  4A5A A;  5TKY A;  2FF6 A;  4B1W B;  5C10 A;  5AQY A;  1GLE G;  2A6A A;  5HOO A;  2E2Q A;  4M63 C;  4BG9 A;  1T6C A;  1BA0 A;  2W41 A;  1NGF A;  3CET A;  2ASP A;  1K9M O;  3VGK A;  3D2F B;  3OBW A;  1D4X A;  3UKU B;  3I55 N;  1VQL N;  3PLA A;  4JD2 A;  5AQV A;  3LDP A;  4OPH A;  4CZL A;  1RDU A;  3UKR A;  3C0B A;  3L4Q A;  5F2R A;  4CD1 A;  3E9O A;  3EKU A;  3WEE A;  2ZWH A;  3VF2 A;  3LL3 A;  3LDL A;  3KZB A;  1VQ6 N;  4CBW A;  3AGK A;  4JKC A;  3WXL A;  5M1P A;  2KHO A;  4MO4 A;  4MO5 A;  3ENH A;  4GV9 A;  4FWK A;  4JAX A;  3Q7B A;  4BR9 A;  3GG4 A;  5GAH P;  4IOX A;  3FZF A;  1LCU A;  1HX1 A;  1S22 A;  4CZM A;  5E26 A;  3O8M A;  4EHU A;  3UKR B;  3ENO A;  4U67 L;  2AP1 A;  1RDW X;  3AAQ A;  3VEO A;  4KH6 A;  1HUX A;  1N8R O;  3O5B A;  2YJE A;  2F9W A;  4A2A A;  4PL8 A;  4BRD A;  2J4R A;  3HSC A;  3UE5 A;  4DB3 A;  3U9D A;  2E2O A;  3WXM B;  4JK8 A;  4DCH A;  3BF1 A;  1W2B M;  3QML A;  4JKA A;  3CXC M;  4FL9 A;  4A2B A;  4H5N A;  2P9L B;  3UB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...