5TKWA

1.35 angstrom resolution crystal structure of a pullulanase-specific type ii secretion system integral cytoplasmic membrane protein gspl (n-terminal fragment; residues 1-237) from klebsiella pneumoniae.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
236
structure length
236
Chain Sequence
NKINASPQAMLIVRLAAAQAPLHWQLFAPGEPHHEASGRWPTDDASPFPALAEQYPAWVLIPASDCAFHSLTLPAGLRKPPLQVAPFLLEEQLADDVEATHFALLHRQQAQCEIVAVQRQKMRDWLARCESLSLQPLALTPDVLALPWQPPAWSAVQVDEQWLIRHQPWGGMAAENVWLTELLQSEAEEHVIDSYSPPPAAPGVWREQPAQTLLTLAARHPAAQKLSLLQGEFAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.35 Angstrom Resolution Crystal Structure of a Pullulanase-specific Type II Secretion System Integral Cytoplasmic Membrane Protein GspL (N-terminal fragment; residues 1-237) from Klebsiella pneumoniae.
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
molecule tags Hydrolase
molecule keywords Type II secretion system protein L
total genus 56
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2016-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05134 T2SSL Type II secretion system (T2SS), protein L
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.370 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5tkwA02
3.30.420.380 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5tkwA01
2BH1A 1W97L 4PHTX 1YF5L 5TKWA
chains in the Genus database with same CATH superfamily
1NGDA 2O8BB 2ITMA 3V9SA 2YI1A 2P9IB 4GVEA 3ZSYA 5C24A 5BRHA 1O13A 4FXDA 3SQ2A 3E9PA 4NLBA 1Z26A 2VCPA 4F8RA 3D2EA 1RDWX 3DXMB 5J2QA 4IWVA 1C0UA 3NAEA 3Q7BA 3VERA 4CD1A 2AP1A 2WOMA 5C25A 3BUZB 3RRGA 1OKJA 3CCLN 4M41A 1QVGM 3ZEUB 1RT5A 4LF7K 2HHTA 2Z1IA 2HNYA 5CZ2A 4CJEA 1G99A 4J8FA 4QS9A 1LOTB 4YDUC 3AA3A 4B08A 4XH1A 4WE1A 3L3UA 2W40A 4YFUA 4RG8A 4E89A 4KI4A 2WTUA 1N5YA 3CJCA 2OTJN 1QHAA 3KK2A 1U49A 2P9LA 3DOLA 2D4WA 1FK9A 3QFPA 1VQKN 4QAGA 4CZJA 3MX5A 1GOAA 3VEYA 5C0YA 4LF4K 4C8OA 4CZGA 4IFEA 4FJMA 4BRNA 4FK0A 1WLJA 1J6ZA 2QWPA 3WEEA 1SL1A 5IT9O 4BY9C 2QKKA 3J80O 1VAZA 2OPPA 2PYJA 4M3ZA 3P5JA 5KQDA 3KTQA 4FJIA 1JCFA 5AQKA 1W97L 2HBKA 1A5XA 1KFDA 4CFAA 4FJLA 3LL3A 1G15A 3EN9A 3DYAA 3L3VA 3LP3A 4CHZA 3AVLA 2P9UA 3U4LA 4RW7A 4E7HA 1IV0A 1HUXA 1UWBA 3VQ4A 3AVHA 3OYFA 4FWKA 4WF9L 1XHZA 4YDUA 5C10A 4CIEA 4AM7A 1TL3A 3QICA 2B5JA 1VQPN 1MDUB 1RDAA 4KPYA 4NYFA 2PBDA 1C1CA 3MAQA 4FLUA 2FC0A 2A1SA 3CQ8A 4I2QA 1TAUA 2E20A 1S1UA 1WSIA 2OA8A 3B8AX 4Z94A 3KVGA 4ELVA 3VETA 2YCHA 5AR0A 3P38A 2UU9K 5HRSA 2IIRA 2VQEK 3UE5A 4CZKA 4KTQA 3DRSA 1HKBA 3HOSA 2I5JA 5JS2A 4CW7B 5BPNA 4CEDA 1K73O 4DSKA 4E1JA 1RGIA 3SAGA 1WBBA 4CGIA 2P9KA 4FW1A 4PUOA 4IEIA 4CK3A 4DR1K 1SZ2A 5HROA 3I0RA 4H0XB 1QSYA 5GIPA 2X6NA 4JKGA 4BRKA 1EX4A 5BRFA 3D6RA 4KTZA 5FPDA 1ZXOA 3SNNA 1QTMA 1N8RO 3TSUA 1KVCA 3GDQA 1QSLA 1QSSA 3MECA 1J5EK 1NGEA 3RSEA 2A3ZA 1OVYA 2P9KB 3V9XA 3AA2A 2PYLA 1KVAA 1VQ6N 3L8BA 3DLLL 3HL8A 4KHPK 2XHBA 3OBWA 4M45A 4JI0K 3ZETB 2HVHA 3OY9A 1S3XA 3DXKB 3HVTA 2F9TA 4JI8K 2DFFA 4CK2A 1RCHA 3FFIA 4CZHA 1C0GA 1P8ZA 5J2NA 3QEXA 3NFAA 2BUPA 1ZBHA 2E6MA 2ZQBA 1BGXT 1KLMA 3EL2A 4ILJA 4FZZA 3K5NA 3D2FA 3FR0A 1JXEA 2P9SA 4BROA 3K57A 4JKCA 3QEIA 1E3MA 2D0OA 3VTHA 5BRDA 1HYSA 4MLHA 2X78A 1Q81O 5AQFA 4FLZA 1ZBLA 4XIUA 1C1BA 1EP4A 5I3UA 2F9WA 3HM9A 3M5RA 2RN2A 1VRUA 5J1EA 3ENOA 1D9DA 3DLBA 1WN7A 4NYNA 2YJEA 4GNIA 2XRIA 4N41A 4CJQA 1NGCA 3ZT4A 5JLFA 3HM8A 2W42A 3EO3A 4XEIA 4JHDB 3M1FA 2CH5A 3PSIA 4DKWA 3G6EN 1VQNN 5H1SQ 3CQYA 4CJRA 4JI7K 3TSQA 3N4PA 3SUQA 1KFSA 1J54A 3E01A 4YOUA 5HOOA 3MXMA 5GAHP 5DM6L 1ZYQA 3M6GA 2GELA 4LY7A 5EOYA 4FVMA 1HYZA 4PKHA 2UUCK 4BC3A 4CZIA 2YHXA 3ENHA 5A2QO 4H8KA 1Q9YA 3WEEB 2EHGA 3FFKB 4C8LA 3T3FA 1BI4A 4B9MA 2VYPA 3QNOA 3R8EA 1WSJA 3DMJA 3MEEA 5LJWA 3DRRA 4DTNA 4BG8A 1X9MA 4DF4A 1IBMK 1W2BM 3WQTA 3VTIA 3NH2A 3EYZA 4FZYA 5AZJA 2OPQA 1JLQA 1WUAA 5MLCQ 3AV9A 3QERA 1NJZA 3QLHA 1W0HA 3EZ5A 5F2RA 3DLHA 2V52B 3ZT3A 3DLEA 3NGZA 2HHXA 1QQMA 4JKDA 3CERA 2A42A 2RE2A 3JSMA 3LANA 1JCEA 4C1NK 3VQQA 4FJGA 4L8RB 5FRMA 3ZEUA 3LM9A 4BQLA 2A1RA 3V9ZA 5KQ8A 2O8FB 4FWPA 1IG8A 4FWMA 4AHRA 3E9OA 4BVOA 4I6MA 5LL6Z 3CIPA 2PZSA 4M3WA 3KKSA 3A2FA 4M42A 3HSCA 3JYTA 3VEZA 1L3VA 4KHSA 2DFEA 1BIZA 4ICLA 1NNEA 1GLBG 4FK2A 1D9FA 1LCUA 3K2PA 3RVCA 1ILYA 1OH6A 3D7EO 2QWLA 1BQMA 4ID1A 3ZSXA 1ZBIA 3WNHA 4H4OA 4CJUA 1RBSA 2HHHK 4LH4A 4JHDA 4NB4A 2D5RA 2Q1NA 4OO1J 1KXPA 2R7YA 1B9FA 5BR8K 4DQ8A 3UB5A 3DAWA 3LAKA 1BU6O 1E4FT 4Q0BA 2HHUA 2NUBA 4B9LA 3PIPL 3SMSA 4JRQA 4WQ5A 4BE2A 2PY5A 4BRDA 3HP6A 1RTIA 3DLKA 3OHRA 4CJTA 1S72N 1GLLO 4O5BA 4F9OA 3VEOA 1SKWA 3AVNA 1CZ9A 2WFBA 3K58A 4C8KA 3MXIA 3G10A 4C23A 3I8DA 4CFCA 2H3GX 1VK0A 1T6DA 1TAQA 3OYGA 1YJNN 4F3TA 3O9TA 3SPYA 4IOAL 3HSTB 3DWLA 4B1YB 2RKIA 2IAJA 1QZ6A 2XO7A 3CM5A 4BRQA 1LWEA 3LDQA 5CYQA 5EXWA 3VQ7A 1ZBFA 3KZBA 4FJHA 4FJKA 4JD2A 1NOYA 4BREA 3H1VX 1YTAA 2HSTA 2ZGYA 4DLEA 3BP8A 2WBNA 5FROA 3WT0A 4X65K 1Q18A 2G8UA 1GLJO 1VSDA 1K8KA 3SUNA 5AJ3K 4F2RA 2XY6A 4CF0A 3L2WA 4OLAA 1HNZK 1TGOA 1Q86O 1NK8A 2QEXN 3RR8A 5M1NA 3RWUA 4JKBA 1WNSA 4BE0A 3IKMA 2QTDA 3OVNA 4IG0A 4CHQA 4DSIA 4B8CA 1BUPA 4CJPA 1YUWA 3CETA 4BR0A 3TPQA 3BY5A 5AQHA 2G8KA 4PWDA 3BDPA 4DQPA 1TYQB 2P5GA 4KB0A 1C1AA 4BC5A 4OGCA 4FK4A 1TYQA 4DWIA 2G8WA 1C0FA 2JWKA 2VWKA 3VQAA 5KPTA 1RTHA 3ZLJA 4CBXA 5SWMA 1OVQA 3KD5E 4M7YA 1NKCA 3NF8A 5E41A 1X9SA 4JRPA 3OS2A 3H46O 3PUFA 2IVOA 2YJFA 2NRRA 1RT3A 2G8VA 1KCFA 3MK6A 1BWFO 3ITHA 5FRNA 4GW6A 1RT1A 1L5UA 3TAMA 3CC7N 5HP1A 4H5TA 4BG9A 4DUYK 4LSNA 4CJ4A 1VSLA 1DTTA 4UQGA 2P9PA 4B1UB 2PFUA 3V4IA 3LWMA 5C15A 4FOIA 5AQQA 4RW4A 4F3OA 4AHTA 1KAYA 3LDSA 4BACA 2KTQA 3CQXA 4FM2A 2ATQA 4NLCA 3TI0A 4JNEA 4CFBA 1VQLN 5AQYA 2KHOA 1NGAA 3EEQA 1S1VA 4CGGA 4FPAA 3OJUA 1Q7YO 2Q0UA 3ZT1A 1YJ9N 5EU7A 1JLCA 3THWB 1A5VA 5DK5A 3KLIA 3OYJA 4FJNA 4AM6A 5T7BA 4RW8A 3O6WA 3ZCMA 3OYCA 5BR9A 4DU1A 5CZ1A 1M90O 4JS5A 5CYMA 2LSNA 3U8XA 2G8FA 2BTFA 1JLGA 4CCHA 1RT4A 1TKZA 3E1YA 1ATNA 4J2BA 4CJVA 1F21A 3ZX3A 3ZSZA 4CF9A 3MDQA 5CR4A 3L2QA 5GINA 3L4QA 1U2VB 3ID6A 5HRRA 1EXQA 1HNVA 3CJ9A 5GADP 4B3MK 3WXKA 3TAFA 3NF6A 5KGWA 2P9PB 1Z05A 1C0TA 2ZJPL 4DTRA 4PA1A 4BRMA 4CGHA 2V7ZA 4FWNA 3ULEB 4KB1A 3ATVA 3VQ8A 4DR6K 1R59O 3JXUA 3VMFB 3E66A 3QFUA 5AQXA 4Z0UA 4O4GA 1MWKA 3CFOA 3I33A 4XH4A 3UKUB 4FM1A 1VSIA 1SUQA 1XMQK 3AY9A 4JLHA 3TU5A 2P51A 2EX3A 4PKGA 3P39A 4CZMA 4A5BA 2YKMA 3NH1A 4ISEA 4YOYA 3A0IX 2IVPA 5AQIA 1XI1A 2QWQA 2DY4A 3NBPA 4YOVA 3H45C 3THXA 1HR0K 1LAVA 1VQ5N 3O4WA 1YXQA 3T1YK 4I7FA 2QK9A 4FLXA 1U6ZA 2E1YA 5ELZA 3OYEA 4CVNE 1NOZA 3DRPA 3PY8A 4E0DA 4ZTFA 1VSMA 3C65A 1TK5A 3T1AA 3SQ1A 1NK0A 4BQZA 3CXCM 4CEQA 4DSFA 4PHTX 4IO9L 3MXJA 4V19S 1WSHA 4XH5A 4MFBA 4N56A 5I42A 3KLHA 1VQMN 4FCYA 4IDHA 1J5OA 4QS8A 4K8XA 2E8AA 4GKJK 3U3GA 3UIQA 3L6QA 3VF4A 3O08A 2HB5A 1XNRK 4GV6A 3QIOA 4DR5K 1LW2A 4EZ6A 3O9UA 1BCMA 1JLBA 2UYTA 3K59A 3AVAA 3AVFA 3SUOA 4O8UA 2Q2RA 3CHWA 4DCHA 3AVCA 5DM7L 3O9RA 1BOTO 3QBXA 4OVLA 3TABA 2CGKA 1M1KO 4HCBA 1RBVA 2NRVA 2PAVA 3TARA 3AO3A 4FJ5A 4JKGB 1RBRA 5M1QA 3C7NA 1Q8IA 1D8YA 3HTVA 2G8HA 4BRFA 1KAZA 1FXXA 3ZSOA 4HUEA 4HTLA 1I3AA 3PIOL 4BDPA 3ZT2A 2E2OA 4J2DA 1SQKA 3NH0A 3SBTA 4CJ7A 4IJAA 4DG1A 1NK7A 2O4GA 3THXB 2EWSA 4ELTA 4AF1A 2FBXA 3M8RA 3VQ9A 4KH4A 3VQCA 3A5LC 1I94K 4QCLA 4AHCA 3KK7A 4R5PA 3L2VA 4IEEA 4U67L 3HXMA 3RTVA 2OYQA 1N33K 1D4XA 4CJFA 3BGRA 2YNIA 2FXUA 3QO9A 5AQLA 4DR2K 1N34K 1MWMA 3E9LA 4B9SA 4HUFA 3F9KA 3IDHA 3DLGA 4CZLA 2Y1JA 1NU0A 1GLFO 1QQCA 2ZD1A 3AO1A 3W3DA 3OYNA 2ASOA 5FDLA 3AO5A 3ASMA 4LF6K 4HHTA 1ASWA 5K14A 5HLFA 3HJFA 1CXQA 1NWKA 5FLXO 2WONA 4IFVA 2KFNA 3VQ5A 2ZE2A 2VGMA 2B4JA 1BIUA 4AILC 1HPMA 2OPSA 4KHWA 4K0KK 1VQ4N 3CJ1A 2A5XA 4DSEA 2OZSA 4CIGA 4DTXA 1DTQA 3HPHA 3VGLA 4IKFA 4DTJA 2FBVA 1OH8A 1DLOA 4WFAL 1S1WA 1NGHA 4L3QA 3DM2A 1JL2A 1HQEA 3T69A 1C6VA 3LDOA 4FZXC 3SJJA 1YF5L 4OKEA 3OYMA 3DJCA 3ENBA 2O8DA 3THWA 1NG9A 4E1MA 4PQUA 2VWJA 5KPRA 2P9SB 3EE9A 3D2FB 1RT7A 4DTUA 3MEGA 3L2UA 3J81O 3THYB 3R3LA 5B8HA 4YORA 2HMIA 4DV2K 3SZ2A 1T44A 4CEFA 1HNWK 1Y64A 4JK8A 4NCAA 4KV8A 3EE8A 4WQ4C 3DI6A 3SV3A 3S3NA 3IS9A 5FPNA 1HNIA 2HBLA 4WQ4A 2OPRA 2Y1IA 4A62A 5BPLA 2Q0RA 3HBTA 1WSFA 2BGGA 4BDYA 4CI6A 2ITGA 3CCVN 1V4SA 4CJ3A 3SPZA 3THVA 3U3YA 1Q9XA 1T7PA 3WUHA 3TANA 5AQVA 4DS5A 3CJBA 1WAFA 1RDBA 1JLEA 4DTOA 3G0ZA 4X64K 3ZYYX 1DEJA 2DTUA 3KJVA 5GIOA 3L4IA 2J4RA 4CZEA 3WXIA 5BREA 1HKCA 3FE1A 3JS6A 4FM0A 3O4NA 2W6LA 4BRPA 1IJJA 1QQOA 1V4TA 3VA0A 4CFDA 2IC3A 3DLRA 4BR9A 4LFBK 1LWFA 3MN5A 1YHQN 4BRIA 3DXKA 3F2KA 4U7BA 4FLVA 1LW0A 5HRNA 3SLCA 3PO5A 3KLFA 3SJHA 3MEDA 1EWQA 3ZX0A 5M1OA 4BC2A 5AFUA 4DFMA 5TKWA 1ASVA 4FWLA 2E2QA 1NKEA 2O8EB 2BDPA 2YHWA 4IBNA 1LWCA 4IOXA 4NCGA 1NMDA 2G8IA 1REVA 2HHSA 2Q36A 3HZ6A 1U47A 1HRHA 4BC4A 3L0QA 4PY5A 1U48A 3LALA 2HOEA 1EQYA 4F4KA 4PL8A 1U4BA 3ZETA 5AZIA 3C6UA 5CE3A 1D5AA 3C6HA 4CHYA 3D2EB 4RW6A 4H5VA 3JAMO 4EP4A 4JKAA 1J9AA 1IKWA 4GVMA 3KKRA 4KH6A 5EVZA 3AVBA 4FL9A 2ZJQL 4JI4K 3SK3A 4B9NA 2Q3SA 1VQ9N 3CYMA 4HWIA 1NGFA 4NO7A 1Z25A 1VSKA 3F5TA 5J2PA 1QZ5A 2HBMA 4KREA 3MN7A 3ZSQA 5BN8A 2P5OA 2KFZA 4M3RA 4H5RA 4QS7A 4LH5A 3J7ZO 1HKGA 3CI5A 4J2AA 4KHYA 1NGBA 4WFNL 4N76A 2O8CB 1W9HA 2QWMA 2F8TA 2A6AA 4W5TA 4BWMA 1L3UA 5SZTA 2E6LA 3V6DA 3RMCA 1W7AA 4CEZA 1LV5A 3C6TA 4K42A 1E4GT 2YHYA 1YTUA 1NMNA 3P83D 1NJXA 3P1GA 3V9UA 3CM6A 3SYZA 4DTSA 3ZSWA 4Z4EA 2HNDA 5AQUA 3LP0A 4Y1DA 1U04A 3KLGA 3O5BA 3DOKA 1N36K 4OX9K 3H3OB 4CHPA 3HYFA 2P9NB 4DV4K 2QA4N 2IDOA 3M8SA 2HF3A 3BF1A 2QXFA 4A2AA 4B8AB 4BGAA 3SQ4A 4AHVA 2KZMA 4LF5K 4E19A 4EZ9A 2A41A 4JV5K 4BGBA 3H1QA 2GEMA 3NMUA 4ISGA 4CEBA 3BZKA 3TTFA 4BRGA 3FZFA 4OPAA 3EKSA 1CXUA 3HOTA 2WUSA 1VQ7N 4FYDA 4CBWA 4M3UA 3TAPA 2QM1A 1RDDA 3A5OC 4I2PA 2ZJRL 3G25A 4DTPA 4CERA 2QKBA 1IKYA 3A5MC 4DR4K 1BO5O 4GV9A 3N4QA 2UUBK 1YVNA 3HO1A 4KH5A 2X74A 4OPKA 1JLAA 3O1WA 3CC2N 3VEXA 4X66K 4DV3K 4KHNA 4JN4A 1KQSM 2Z1HA 3KHYA 2XY7A 4FPBA 4FLWA 3PV8A 4O44A 3OS1A 3FGUA 3U6FA 1IBLK 1VHXA 3LDLA 3VEWA 3ZSRA 3K9KA 1HJRA 3NHGA 5JVGL 2OCEA 4EP5A 1K9MO 1NLVA 2YHBA 4KBOA 1HNXK 1X3MA 3CPWM 1CLQA 4Z4FA 3LAMA 4PKIA 4KKOA 4CESA 5BPMA 3V1OA 3K5LA 1YAGA 4HCCA 3O8MA 3ZX2A 1QS4A 3R9PA 2HBJA 5KGXA 4JI1K 2NNWA 3QMLA 3CCUN 4K8ZA 1YJWN 3NGIA 3VN5A 4CF8A 3C95A 3AA4A 4CJKA 3IAYA 4Y0WA 3IUCA 1QE1A 2NZTA 4EIAA 3BEXA 1T8EA 3LZJA 3QDKA 1XQSC 5KI6A 4JI3K 4ILGB 4E7KA 4LF8K 1C0MA 2NRZA 2KKZA 4CJWA 1VSFA 1SKSA 4B1XB 4RTFD 2A40A 1LAWA 1EKEA 1ATSA 2VG5A 3AGKA 4O8KA 3CCRN 4DV0K 1GOBA 1VSHA 3LPUA 1B92A 2D1KA 4GMJB 4JYAK 3LDNA 3MN6A 3NE6A 2NRXA 2W41A 5AQSA 4CF1A 2KQ2A 1S5JA 3H6EA 3VF2A 3AARA 3V1RA 1KSPA 1T3VA 3LZIA 5F0XA 4B9UA 3QEWA 1IO2A 1WSGA 1NGGA 4JK7A 4BRCA 1ZC6A 3CCSN 3OBYA 4W5QA 1T6CA 3HRGA 4M3YA 1RILA 4OKKA 3O1BA 4FLTA 2CGLA 3VESA 1YI2N 4KI6A 2D0PA 2ZM6K 4CJSA 4DV5K 4DHYA 2ZWHA 2QWRA 4HTUA 4CHOA 4FWQA 1XC3A 5GAGP 3ISNC 4DU3A 4FJXA 4PL7A 4B1WB 3CJAA 2W6KA 4M63C 1WSEA 2QI2A 1YVUA 1S1XA 2ZGZA 4HVJA 1HLUA 5FPMA 4R79A 2XY8A 1S6QA 5CHIA 4GV3A 3M8QA 1U2VA 4FWOA 2HVIA 3O9QA 1CZAN 2QWNA 4DLGA 5EX5A 4DTMA 4K43A 4JI2K 1TUYA 2QXLA 4BRHA 4KO0A 5JMVA 1UOCA 4H5WA 1DT9A 3GE1A 5AZIB 2F8SA 1KTQA 4NCBA 5AQWA 4CF2A 4EHTA 3B6PA 3K0SA 4BVPA 3NGYA 3KWGA 5AZJB 3HVRA 5LJVA 4B1VA 4JKEA 3VQ6A 4OLBA 4Z4CA 4B3SK 3UKRA 4CGFA 5C2FA 2Q31A 2V7YA 3FLCO 2I7PA 1GLAG 1IKVA 1GLCG 3FZMA 5LMNK 4DS4A 5LY3A 1ESVA 2IGIA 4YHHK 3NVKA 2P9IA 3RMBA 3C94A 4Y1CA 4YY3K 3AA5X 4E7LA 4O0IA 1VRTA 4ISFA 1TUUA 4FW2A 5AQGA 3RMDA 1XUPO 2OZMA 2HMPA 3O80A 3B6OA 1X3NA 4E3SA 3V1QA 2F4VK 4BR4A 4DB3A 2VG6A 3QBWA 2AA4A 5AQOA 4OJRA 3FZKA 5C42A 4M3TA 4DUZK 2O8FA 3U9ZA 4BR2A 3HT3A 2D0CA 3HI0A 4IO8A 3TAQA 1HQUA 2FF3B 2DFHA 4FSVA 3G71N 4B3TK 5J2MA 3NF9A 1NK4A 4FO0A 3GOIA 3HPOA 3QETA 3J7AP 3PX6A 1NK5A 2GWKA 4O5FA 3IRXA 1SS6A 4WQ5C 2OANA 1RFQA 3HPGA 5JICA 3AVKA 4MO5A 1OH7A 4DV6K 1RTDA 4LF9K 1BQNA 4UY8O 1BDGA 1EETA 1EWRA 4Z4HA 4IG3A 2NRWA 3TTCA 1MA9B 4FOEA 3ULDA 3GG4A 4A59A 1H1VA 5AQMA 3AO4A 4OGEA 4H0TB 3LDPA 3D0PA 3OYBA 5IWAK 5AQZA 1VSEA 1RDCA 1HMVA 1DGKN 3DXMA 4CK1A 4GY2B 3MWTA 3PSFA 4ZHRA 5AQPA 2E5LK 4DFJA 3J8AA 2E1ZA 3NDKA 3VA3A 5AFUH 4KHUA 3I0SA 5GAEP 4OKJA 4IOCL 1WAJA 4IFYA 1XC9A 2ASPA 1YT3A 3OYKA 4E7JA 1UA1A 1NGJA 4H0YB 1VSJA 2VWBA 3MN9A 2GTDA 5EY4A 3OS0A 3BZCA 2F96A 4I9LA 3ZSVA 1Z6RA 3A8YA 1TL1A 3ULEA 2UXDK 1U45A 3PLAA 4AH9A 2XY5A 1TK0A 2ZF5O 3KK3A 1RBTA 2HNZA 5AQRA 4FLYA 1WBDA 2FBTA 2AJQA 1TV6A 3WNEA 3F73A 2E88A 4N5SA 4KRFA 3LPTA 3HK2A 4M7XA 4H0VB 2I7NA 4IXCA 4BR7A 1K8AO 1XHXA 4LC9B 2YHAA 3CFPA 1IBKK 3QNNA 1SL2A 4RCHA 2GWJA 4FWRA 1VQ8N 2VG7A 2NRTA 1BL3A 1BCOA 1HX1A 4CJ5A 4B9VA 1SL0A 1QHTA 4FJ8A 1RBUA 3I56N 1NGIA 1RNHA 2IOCA 4FWSA 3O4QA 3M3ZA 2YNFA 1NK6A 3SCXA 4BRLA 4DR7K 2F7TA 2BANA 3O3HA 2KZZA 4MDBA 4Z4GA 2YKNA 1JXBA 4LSLA 1QVFM 3R1XA 4MDAA 4YOTA 3SMPA 3AAQA 1KC8O 3TWHA 4NXNK 3QB0A 2E2PA 2IS3A 3AVMA 3RSEB 2FSNA 1BI4B 4BE1A 1YITN 4AHUA 4CGDA 4CGJA 4WCEL 4ZTJA 3G4SN 3KIOA 3S9HA 4AHSA 5KPZA 1S9EA 2GUPA 3T7ZA 1X9JA 2CGJA 5E26A 4A2BA 4DR3K 5E84A 3OYDA 3IMXA 1O1WA 3O9SA 4AQYK 4H5NA 3I8BA 4FJ9A 2YNGA 5F1XA 4NXMK 4DFKA 2OTLN 3OYAA 1Y97A 4B9TA 5JS1A 2FSJA 1ATRA 4E1NA 4ILHA 5ADXH 1RTJA 4CZFA 4M3XA 4BRAA 1I39A 2CH6A 3U9DA 3SAHA 1KD1O 3CMAN 4Z4IA 2BE2A 4LD0A 2B6AA 3OTOK 3SUPA 1OH5A 1JJ2M 2E4LA 2Q97A 2P1JA 5TKYA 4I6MB 4KTWA 2JWLA 3IFRA 4CECA 2O4IA 1BA1A 1Q82O 3T1HK 3VENA 1ASUA 4RW9A 1K8KB 3V81A 2BH1A 1BG3A 1NK9A 1ITGA 5HBMA 5BN9A 4DSJA 3MMVA 2X6SA 3WQUA 1XWLA 2O8DB 1NJYA 2O8BA 1S1TA 2QW9A 2FF6A 2RHKA 3QEPA 2Z1JA 2ETJA 3C7NB 1XNQK 4GKKK 2ASMA 3AVIA 1ZBUA 1R0AA 4JS4A 4MO4A 3TR8A 4KAZA 1X1PA 1ZBSA 4N47A 4DSLA 2HF4A 1L3TA 2YV0X 5CY4A 3ZT0A 4EAHD 3UKUA 3FZHA 1A5WA 4IZ9A 4ID5A 3TSPA 3WNFA 1RT2A 2YX6A 3KLEA 3AGRA 5FPEA 4DQQA 4IJNA 3VPZA 4DV7K 3KD1E 4MLEA 1S6PA 4OPHA 1JLFA 4DQIA 4H0PA 5KRTA 1UAXA 1RDUA 2VQFK 4DQRA 4BDZA 3CD6N 2QWOA 2GBZA 3P4IA 4TSXA 3K5OA 5C12A 3CF5L 3AO2A 2VGNA 4A5AA 3QEVA 5M1KA 1SAZA 3LM2A 5M1FA 4WYBA 1KAXA 3J7YP 3THYA 2D0AA 1B9DA 4DF8A 1NM1A 4A57A 2GX9A 3HP9A 2KLAA 2HW3A 1BA0A 2HHQA 2IVNA 3GL1A 3W0LA 4O55A 3IG1A 4DQSA 4CEEA 2P9LB 3OJSA 2Z1GA 4JKFA 3R6MA 1IKXA 3AVJA 3LWLA 1GLDG 1NBWA 4DV1K 3F9MA 4JK9A 1NJIO 1JCGA 4KFBA 4B9QA 1S9GA 3SAFA 2UXCK 1UA0A 3O3GA 1N32K 3WNGA 3AVGA 3V9WA 1GOCA 2RPIA 4EFHA 2UXBK 5HL7L 1NKBA 3QIPA 1N6QA 3CJ7A 4H4MA 2HHWA 4CJLA 3MX2A 5DMRA 1FKPA 4W5OA 1TKDA 3VQEA 4I9QA 2P9UB 3NF7A 3GBTA 4O0JA 3ATUA 3OW2M 1JKHA 4WFBL 3EZWA 4Q5VA 3C0BA 4BWJA 3KK1A 3VQPA 4LFCK 2GUIA 1L3SA 1IG9A 4FJ7A 3MCAB 1HPZA 4CHNA 3I55N 1KLNA 1KRPA 5HRPA 5LMUK 2RF2A 1J53A 5D3GA 2GV9A 1DKGD 3TAGA 1SV5A 3RMAA 4K41A 4B3RK 3WXJA 2P9NA 2E2NA 3OYHA 3KWIA 5AQTA 5ADXA 3VQDA 4K25A 3M8PA 1TKTA 4JI6K 3CCEN 5JLHA 3RR7A 3SV4A 4B3OA 4JI5K 1HYVA 1FKOA 4CIFA 3L2RA 4YOWA 1S22A 3UKRB 3C6AA 5JVHL 5AQJA 3K5MA 3CCJN 4X62K 1HJOA 1YIJN 3K9JA 3LP1A 3CC4N 3CFRA 4JAXA 1X9WA 2FSKA 4FVUA 2V51B 3NVMA 3S41A 3VEVA 4IDKA 4CEAA 4YNQA 4B1ZA 4DFPA 3MWPA 4CBUA 3AAPA 4G9ZA 1FJGK 3PO4A 5I9EB 4J2EA 4H03B 1XMOK 2UUAK 2YNHA 1P90A 2NRHA 1NJWA 5KRSA 2KW4A 4HUGA 1RT6A 4YOXA 5AQNA 2JLEA 2WC9A 4LFAK 3OA9A 2FBYA 3TAEA 1GLEG 4C1NI 3OYIA 3FZLA 3NCIA 3VF6A 4W5RA 3D45A 3Q7CA 3CCMN 1TK8A 2D0BA 4KHQA 3VGKA 3CCQN 5M1PA 3A5NC 4OPJA 1T05A 4F2SA 3PX0A 3SI6A 4BR5A 5KTQA 3QINA 2NLXA 3ID8A 1WOQA 3SQ0A 3CPEA 3BF3A 3S3MA 4CD3A 4A61A 3EKUA 3VOVA 4DMNA 4E7IA 4RWTA 4JD2B 1T03A 1JL1A 5C2DA 2O8EA 4CE9A 3CMEN 3P31A 4ELUA 4MQ3A 3O3FA 1TKXA 3H08A 3CG7A 3EY1A 1TVRA 1K6YA 3MCPA 3PX4A 2HHVA 3SBGA 4G1QA 3VQBA 4H0OA 4QOZB 4FJJA 3T19A 2DPNA 1SKRA 1KVBA 1EO1A 1CZBA 1MU2A 4DU4A 3ALYA 1IH7A 4JEPA 3VGMA 2JGUA 1VQON 2FLOA 2O8CA 1BISA 3WXMB 4JKHA 3RRHA 3S3OA 3H3NO 3OYLA 3LP2A 3QESA 1FW6A 4EHUA 4CEOA 1QQNA 4C8MA 4C8NA 3TTDA 1BHLA 1WB9A 4W5NA 3WXLA
chains in the Genus database with same CATH topology
4BR9A 4H0YB 1NGDA 2VWBA 3MN9A 2ITMA 2GTDA 5EY4A 2YI1A 3MN5A 1YHQN 2P9IB 4GVEA 4BRIA 3DXKA 3F2KA 4U7BA 1Q86O 5BRHA 1O13A 2QEXN 5M1NA 1Z6RA 3A8YA 3E9PA 4NLBA 4JKBA 3SLCA 3ULEA 2VCPA 3IKMA 2QTDA 3D2EA 3SJHA 3PLAA 3ZX0A 1RDWX 3DXMB 5M1OA 4BC2A 4IWVA 5AFUA 5TKWA 2ZF5O 1BUPA 4FWLA 2E2QA 3Q7BA 3VERA 1YUWA 2YHWA 3CETA 2AP1A 4IOXA 5AQRA 1NMDA 3TPQA 5AQHA 4BR0A 4CD1A 2Q36A 3HZ6A 3BUZB 1TYQB 1OKJA 3CCLN 4BC4A 2E88A 3L0QA 4BC5A 1TYQA 2HOEA 1EQYA 1QVGM 3ZEUB 4M7XA 4H0VB 2I7NA 4PL8A 1C0FA 4IXCA 4BR7A 1K8AO 2JWKA 3ZETA 1G99A 4J8FA 5AZIA 4LC9B 4QS9A 5KPTA 4CBXA 1LOTB 4YDUC 5CE3A 3C6HA 4XH1A 3D2EB 4H5VA 2W40A 4RCHA 2GWJA 4FWRA 4JKAA 1VQ8N 4M7YA 4KH6A 5EVZA 4FL9A 2ZJQL 3H46O 2NRTA 2IVOA 2YJFA 2NRRA 3SK3A 3CJCA 2OTJN 1QHAA 1VQ9N 1HX1A 3MK6A 1BWFO 4HWIA 1NGFA 2P9LA 4NO7A 2D4WA 3F5TA 1QZ5A 2HBMA 3MN7A 3QFPA 3I56N 3CC7N 5BN8A 1NGIA 4H5TA 4BG9A 1VQKN 4H5RA 4CZJA 4FWSA 3MX5A 4QS7A 3M3ZA 3J7ZO 1HKGA 3CI5A 3VEYA 4BRLA 5C0YA 2F7TA 1NGBA 4CZGA 4WFNL 2P9PA 4B1UB 2PFUA 4IFEA 4MDBA 2QWMA 5C15A 4BRNA 4FOIA 5AQQA 1QVFM 1J6ZA 1KAYA 2QWPA 2A6AA 3WEEA 3R1XA 4MDAA 4BY9C 3CQXA 4YOTA 4NLCA 4JNEA 3AAQA 3SMPA 1VAZA 1VQLN 5AQYA 2KHOA 5KQDA 1NGAA 1KC8O 1JCFA 3QB0A 5AQKA 4FPAA 2E2PA 1E4GT 4K42A 2YHYA 3RSEB 1W97L 2FSNA 1Q7YO 2HBKA 2Q0UA 1YJ9N 1YITN 4AM6A 4WCEL 3LL3A 5AQUA 3O6WA 3G4SN 3EN9A 5BR9A 3O5BA 1M90O 3H3OB 5KPZA 3U8XA 2P9NB 2GUPA 3T7ZA 1X9JA 2CGJA 5E26A 2QA4N 4A2BA 2P9UA 3U4LA 2BTFA 5E84A 2HF3A 3BF1A 1HUXA 3IMXA 4A2AA 4FWKA 3E1YA 1ATNA 3O9SA 4WF9L 3ZX3A 4BGAA 4YDUA 5C10A 4H5NA 3I8BA 4AM7A 3MDQA 3QICA 1VQPN 1MDUB 5F1XA 5CR4A 2OTLN 2PBDA 2A41A 5GINA 3L4QA 1U2VB 3ID6A 2FSJA 1ATRA 4BGBA 5ADXH 3H1QA 4ILHA 4CZFA 3CJ9A 2E20A 2GEMA 4BRAA 3NMUA 2CH6A 3U9DA 4ISGA 5GADP 3SAHA 1KD1O 3WXKA 3CMAN 3TTFA 3B8AX 4Z94A 4BRGA 3KVGA 3FZFA 2P9PB 1Z05A 3VETA 4OPAA 2ZJPL 2YCHA 5AR0A 3P38A 4BRMA 3EKSA 2IIRA 2V7ZA 4FWNA 3UE5A 3ULEB 3ATVA 2WUSA 4CZKA 3HOTA 1VQ7N 1HKBA 1JJ2M 3HOSA 4CBWA 2Q97A 1R59O 2QM1A 3JXUA 3A5OC 5TKYA 2ZJRL 3G25A 4I6MB 3VMFB 3E66A 2JWLA 3QFUA 5AQXA 5BPNA 3A5MC 3IFRA 1MWKA 1K73O 1BA1A 1BO5O 1Q82O 4GV9A 3I33A 3VENA 4XH4A 3UKUB 1K8KB 3N4QA 4E1JA 1YVNA 2BH1A 1RGIA 1BG3A 3AY9A 3SAGA 3TU5A 4KH5A 5BN9A 2P9KA 3O1WA 4PKGA 3P39A 3CC2N 3MMVA 3VEXA 4CZMA 4IEIA 4A5BA 4JN4A 1SZ2A 1KQSM 3WQUA 3KHYA 4H0XB 4ISEA 4YOYA 3A0IX 4FPBA 5GIPA 2IVPA 4JKGA 4BRKA 3FGUA 5AQIA 2QW9A 2FF6A 2QWQA 2RHKA 3K9KA 3LDLA 3VEWA 5BRFA 3D6RA 4YOVA 5JVGL 3H45C 5FPDA 1ZXOA 1N8RO 3C7NB 1K9MO 1VQ5N 1NLVA 4KBOA 3O4WA 1YXQA 2ASMA 3GDQA 1X3MA 3TSUA 3CPWM 4MO4A 1U6ZA 4PKIA 2E1YA 5ELZA 5BPMA 1YAGA 1NGEA 1ZBSA 1OVYA 2A3ZA 2P9KB 3C65A 2HF4A 3O8MA 3R9PA 3RSEA 3ZX2A 2HBJA 1VQ6N 4EAHD 3UKUA 3FZHA 2NNWA 3QMLA 4IZ9A 3DLLL 3CCUN 3TSPA 1YJWN 4BQZA 3CXCM 3OBWA 2YX6A 4PHTX 4IO9L 3AGRA 5FPEA 3ZETB 4IJNA 3VPZA 4XH5A 4Y0WA 4MLEA 1S3XA 3DXKB 2NZTA 3IUCA 4OPHA 4EIAA 1VQMN 3BEXA 4IDHA 2F9TA 4H0PA 4QS8A 3QDKA 2E8AA 1XQSC 1RDUA 4ILGB 3L6QA 4CZHA 1C0GA 3VF4A 3O08A 1P8ZA 2NRZA 2KKZA 4B1XB 4GV6A 4RTFD 3CD6N 2A40A 2QWOA 1ATSA 3AGKA 3O9UA 3P4IA 4O8KA 3CCRN 2BUPA 2UYTA 2D1KA 3EL2A 5C12A 3LDNA 4O8UA 2Q2RA 3CF5L 4ILJA 3MN6A 2VGNA 3CHWA 2NRXA 3D2FA 3FR0A 4A5AA 4DCHA 5DM7L 2P9SA 3O9RA 4BROA 4JKCA 1BOTO 5M1KA 2W41A 5AQSA 1SAZA 3QBXA 3LM2A 3H6EA 2D0OA 3VF2A 3VTHA 5M1FA 4WYBA 1KAXA 5BRDA 3AARA 4MLHA 2CGKA 1T3VA 1Q81O 5AQFA 1M1KO 5F0XA 1NM1A 4A57A 2GX9A 2NRVA 1NGGA 4JK7A 4BRCA 2KLAA 2F9WA 1BA0A 2PAVA 1ZC6A 2IVNA 3GL1A 3M5RA 4JKGB 3W0LA 3CCSN 3ENOA 3OBYA 5M1QA 1T6CA 2P9LB 3HRGA 3C7NA 4JKFA 2YJEA 3R6MA 3O1BA 4GNIA 3HTVA 1GLDG 2CGLA 3VESA 1NBWA 1YI2N 3F9MA 1NGCA 4JK9A 1JCGA 4BRFA 1KAZA 1NJIO 4B9QA 5JLFA 3SAFA 2D0PA 3HM8A 4HTLA 3EO3A 3PIOL 4XEIA 4DHYA 4JHDB 2E2OA 2ZWHA 3M1FA 2CH5A 2QWRA 4DKWA 3G6EN 1VQNN 5H1SQ 1SQKA 3CQYA 4EFHA 3TSQA 3N4PA 4FWQA 5HL7L 1XC3A 3SBTA 5GAGP 3CJ7A 4YOUA 5HOOA 4CJ7A 5GAHP 3MX2A 4IJAA 4PL7A 4B1WB 2P9UB 3CJAA 5DM6L 3GBTA 3M6GA 2EWSA 2GELA 3ATUA 3OW2M 4WFBL 5EOYA 3EZWA 4AF1A 4M63C 2QI2A 2ZGZA 3C0BA 1HLUA 4PKHA 5FPMA 4KH4A 4R79A 5CHIA 4GV3A 3A5LC 1U2VA 4BC3A 4CZIA 2YHXA 3ENHA 3KK7A 4FWOA 3FFKB 4IEEA 3WEEB 4U67L 3O9QA 3MCAB 2VYPA 1D4XA 1CZAN 2QWNA 3R8EA 5EX5A 3I55N 2FXUA 5AQLA 5LJWA 4K43A 4BG8A 1MWMA 3E9LA 1TUYA 2QXLA 4BRHA 5JMVA 1DKGD 3IDHA 1W2BM 4K41A 4H5WA 3WXJA 4CZLA 1DT9A 2P9NA 2E2NA 3WQTA 3GE1A 5AZIB 3KWIA 5AQTA 5ADXA 3VTIA 5AQWA 1GLFO 4K25A 4EHTA 3W3DA 3CCEN 2ASOA 5AZJA 5JLHA 1WUAA 4BVPA 5MLCQ 3KWGA 5AZJB 4YOWA 1NWKA 1S22A 5LJVA 3UKRB 5F2RA 3C6AA 4B1VA 5JVHL 4JKEA 2V52B 5AQJA 3CCJN 2VGMA 3UKRA 1HJOA 1QQMA 1YIJN 4JKDA 5C2FA 2Q31A 3CERA 3K9JA 2V7YA 3FLCO 2A42A 1HPMA 2RE2A 1VQ4N 3CJ1A 2A5XA 3CC4N 2I7PA 1GLAG 4JAXA 2FSKA 4FVUA 1JCEA 4C1NK 2V51B 3NVMA 3S41A 3VEVA 4B1ZA 1GLCG 3FZMA 3MWPA 3VGLA 3ZEUA 4CBUA 5LY3A 3LM9A 1ESVA 3AAPA 4BQLA 4G9ZA 5KQ8A 3NVKA 2P9IA 5I9EB 4WFAL 1NGHA 4FWPA 4H03B 1IG8A 4FWMA 4L3QA 3E9OA 3T69A 4BVOA 3LDOA 4I6MA 3CIPA 1P90A 4ISFA 1TUUA 2NRHA 5AQGA 3HSCA 3VEZA 1XUPO 1YF5L 2HMPA 3O80A 4YOXA 5AQNA 1X3NA 2WC9A 1GLBG 3OA9A 4BR4A 1GLEG 4C1NI 3DJCA 3ENBA 3FZLA 1LCUA 3RVCA 1ILYA 3VF6A 5KPRA 2P9SB 3EE9A 4DB3A 3D7EO 2QWLA 3QBWA 3D2FB 2AA4A 3Q7CA 3CCMN 5AQOA 4JHDA 3FZKA 3VGKA 3CCQN 3R3LA 3A5NC 4NB4A 5M1PA 5B8HA 3U9ZA 4BR2A 4BR5A 3HI0A 2Q1NA 4YORA 4IO8A 4OO1J 2NLXA 1KXPA 1T44A 3ID8A 1WOQA 4DQ8A 3DAWA 2FF3B 3CPEA 3BF3A 1BU6O 4FSVA 1Y64A 1E4FT 3UB5A 3G71N 4JK8A 4CD3A 4A61A 3EKUA 3EE8A 3GOIA 4FO0A 4WQ4C 3VOVA 3SMSA 3PIPL 4WQ5A 4RWTA 4BRDA 4JD2B 2GWKA 4O5FA 3OHRA 5C2DA 1SS6A 5FPNA 4WQ5C 2OANA 1S72N 1GLLO 1RFQA 2HBLA 4WQ4A 5JICA 4MO5A 4A62A 3VEOA 4F9OA 3P31A 5BPLA 3CMEN 2Q0RA 4UY8O 1BDGA 2WFBA 3HBTA 4CI6A 4C23A 2NRWA 3TTCA 1V4SA 3CCVN 1MA9B 4FOEA 3MCPA 3GG4A 2H3GX 3SBGA 4A59A 1H1VA 1T6DA 4H0OA 5AQMA 1YJNN 4H0TB 3LDPA 2DPNA 3O9TA 1EO1A 5AQZA 4IOAL 3WUHA 3DWLA 5AQVA 1DGKN 3DXMA 4B1YB 3CJBA 1QZ6A 4GY2B 3MWTA 4JEPA 3VGMA 3LDQA 3ZYYX 2FLOA 5EXWA 1DEJA 4BRQA 3KZBA 1VQON 5AQPA 5GIOA 4JD2A 3L4IA 4JKHA 2J4RA 3WXMB 4BREA 3H1VX 3J8AA 4CZEA 2E1ZA 3WXIA 5BREA 1HKCA 3FE1A 3H3NO 3JS6A 2HSTA 2ZGYA 5AFUH 5GAEP 3BP8A 2WBNA 4BRPA 3WT0A 1QQNA 1IJJA 4EHUA 4IOCL 1Q18A 2ASPA 1QQOA 3TTDA 1V4TA 1GLJO 1K8KA 1NGJA 3WXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH1 A;  1W97 L;  4PHT X;  1YF5 L;  5TKW A; 
#chains in the Genus database with same CATH topology
 1NGD A;  2O8B B;  2ITM A;  3V9S A;  2YI1 A;  2P9I B;  4GVE A;  3ZSY A;  5C24 A;  5BRH A;  1O13 A;  4FXD A;  3SQ2 A;  3E9P A;  4NLB A;  1Z26 A;  2VCP A;  4F8R A;  3D2E A;  1RDW X;  3DXM B;  5J2Q A;  4IWV A;  1C0U A;  3NAE A;  3Q7B A;  3VER A;  4CD1 A;  2AP1 A;  2WOM A;  5C25 A;  3BUZ B;  3RRG A;  1OKJ A;  3CCL N;  4M41 A;  1QVG M;  3ZEU B;  1RT5 A;  4LF7 K;  2HHT A;  2Z1I A;  2HNY A;  5CZ2 A;  4CJE A;  1G99 A;  4J8F A;  4QS9 A;  1LOT B;  4YDU C;  3AA3 A;  4B08 A;  4XH1 A;  4WE1 A;  3L3U A;  2W40 A;  4YFU A;  4RG8 A;  4E89 A;  4KI4 A;  2WTU A;  1N5Y A;  3CJC A;  2OTJ N;  1QHA A;  3KK2 A;  1U49 A;  2P9L A;  3DOL A;  2D4W A;  1FK9 A;  3QFP A;  1VQK N;  4QAG A;  4CZJ A;  3MX5 A;  1GOA A;  3VEY A;  5C0Y A;  4LF4 K;  4C8O A;  4CZG A;  4IFE A;  4FJM A;  4BRN A;  4FK0 A;  1WLJ A;  1J6Z A;  2QWP A;  3WEE A;  1SL1 A;  5IT9 O;  4BY9 C;  2QKK A;  3J80 O;  1VAZ A;  2OPP A;  2PYJ A;  4M3Z A;  3P5J A;  5KQD A;  3KTQ A;  4FJI A;  1JCF A;  5AQK A;  1W97 L;  2HBK A;  1A5X A;  1KFD A;  4CFA A;  4FJL A;  3LL3 A;  1G15 A;  3EN9 A;  3DYA A;  3L3V A;  3LP3 A;  4CHZ A;  3AVL A;  2P9U A;  3U4L A;  4RW7 A;  4E7H A;  1IV0 A;  1HUX A;  1UWB A;  3VQ4 A;  3AVH A;  3OYF A;  4FWK A;  4WF9 L;  1XHZ A;  4YDU A;  5C10 A;  4CIE A;  4AM7 A;  1TL3 A;  3QIC A;  2B5J A;  1VQP N;  1MDU B;  1RDA A;  4KPY A;  4NYF A;  2PBD A;  1C1C A;  3MAQ A;  4FLU A;  2FC0 A;  2A1S A;  3CQ8 A;  4I2Q A;  1TAU A;  2E20 A;  1S1U A;  1WSI A;  2OA8 A;  3B8A X;  4Z94 A;  3KVG A;  4ELV A;  3VET A;  2YCH A;  5AR0 A;  3P38 A;  2UU9 K;  5HRS A;  2IIR A;  2VQE K;  3UE5 A;  4CZK A;  4KTQ A;  3DRS A;  1HKB A;  3HOS A;  2I5J A;  5JS2 A;  4CW7 B;  5BPN A;  4CED A;  1K73 O;  4DSK A;  4E1J A;  1RGI A;  3SAG A;  1WBB A;  4CGI A;  2P9K A;  4FW1 A;  4PUO A;  4IEI A;  4CK3 A;  4DR1 K;  1SZ2 A;  5HRO A;  3I0R A;  4H0X B;  1QSY A;  5GIP A;  2X6N A;  4JKG A;  4BRK A;  1EX4 A;  5BRF A;  3D6R A;  4KTZ A;  5FPD A;  1ZXO A;  3SNN A;  1QTM A;  1N8R O;  3TSU A;  1KVC A;  3GDQ A;  1QSL A;  1QSS A;  3MEC A;  1J5E K;  1NGE A;  3RSE A;  2A3Z A;  1OVY A;  2P9K B;  3V9X A;  3AA2 A;  2PYL A;  1KVA A;  1VQ6 N;  3L8B A;  3DLL L;  3HL8 A;  4KHP K;  2XHB A;  3OBW A;  4M45 A;  4JI0 K;  3ZET B;  2HVH A;  3OY9 A;  1S3X A;  3DXK B;  3HVT A;  2F9T A;  4JI8 K;  2DFF A;  4CK2 A;  1RCH A;  3FFI A;  4CZH A;  1C0G A;  1P8Z A;  5J2N A;  3QEX A;  3NFA A;  2BUP A;  1ZBH A;  2E6M A;  2ZQB A;  1BGX T;  1KLM A;  3EL2 A;  4ILJ A;  4FZZ A;  3K5N A;  3D2F A;  3FR0 A;  1JXE A;  2P9S A;  4BRO A;  3K57 A;  4JKC A;  3QEI A;  1E3M A;  2D0O A;  3VTH A;  5BRD A;  1HYS A;  4MLH A;  2X78 A;  1Q81 O;  5AQF A;  4FLZ A;  1ZBL A;  4XIU A;  1C1B A;  1EP4 A;  5I3U A;  2F9W A;  3HM9 A;  3M5R A;  2RN2 A;  1VRU A;  5J1E A;  3ENO A;  1D9D A;  3DLB A;  1WN7 A;  4NYN A;  2YJE A;  4GNI A;  2XRI A;  4N41 A;  4CJQ A;  1NGC A;  3ZT4 A;  5JLF A;  3HM8 A;  2W42 A;  3EO3 A;  4XEI A;  4JHD B;  3M1F A;  2CH5 A;  3PSI A;  4DKW A;  3G6E N;  1VQN N;  5H1S Q;  3CQY A;  4CJR A;  4JI7 K;  3TSQ A;  3N4P A;  3SUQ A;  1KFS A;  1J54 A;  3E01 A;  4YOU A;  5HOO A;  3MXM A;  5GAH P;  5DM6 L;  1ZYQ A;  3M6G A;  2GEL A;  4LY7 A;  5EOY A;  4FVM A;  1HYZ A;  4PKH A;  2UUC K;  4BC3 A;  4CZI A;  2YHX A;  3ENH A;  5A2Q O;  4H8K A;  1Q9Y A;  3WEE B;  2EHG A;  3FFK B;  4C8L A;  3T3F A;  1BI4 A;  4B9M A;  2VYP A;  3QNO A;  3R8E A;  1WSJ A;  3DMJ A;  3MEE A;  5LJW A;  3DRR A;  4DTN A;  4BG8 A;  1X9M A;  4DF4 A;  1IBM K;  1W2B M;  3WQT A;  3VTI A;  3NH2 A;  3EYZ A;  4FZY A;  5AZJ A;  2OPQ A;  1JLQ A;  1WUA A;  5MLC Q;  3AV9 A;  3QER A;  1NJZ A;  3QLH A;  1W0H A;  3EZ5 A;  5F2R A;  3DLH A;  2V52 B;  3ZT3 A;  3DLE A;  3NGZ A;  2HHX A;  1QQM A;  4JKD A;  3CER A;  2A42 A;  2RE2 A;  3JSM A;  3LAN A;  1JCE A;  4C1N K;  3VQQ A;  4FJG A;  4L8R B;  5FRM A;  3ZEU A;  3LM9 A;  4BQL A;  2A1R A;  3V9Z A;  5KQ8 A;  2O8F B;  4FWP A;  1IG8 A;  4FWM A;  4AHR A;  3E9O A;  4BVO A;  4I6M A;  5LL6 Z;  3CIP A;  2PZS A;  4M3W A;  3KKS A;  3A2F A;  4M42 A;  3HSC A;  3JYT A;  3VEZ A;  1L3V A;  4KHS A;  2DFE A;  1BIZ A;  4ICL A;  1NNE A;  1GLB G;  4FK2 A;  1D9F A;  1LCU A;  3K2P A;  3RVC A;  1ILY A;  1OH6 A;  3D7E O;  2QWL A;  1BQM A;  4ID1 A;  3ZSX A;  1ZBI A;  3WNH A;  4H4O A;  4CJU A;  1RBS A;  2HHH K;  4LH4 A;  4JHD A;  4NB4 A;  2D5R A;  2Q1N A;  4OO1 J;  1KXP A;  2R7Y A;  1B9F A;  5BR8 K;  4DQ8 A;  3UB5 A;  3DAW A;  3LAK A;  1BU6 O;  1E4F T;  4Q0B A;  2HHU A;  2NUB A;  4B9L A;  3PIP L;  3SMS A;  4JRQ A;  4WQ5 A;  4BE2 A;  2PY5 A;  4BRD A;  3HP6 A;  1RTI A;  3DLK A;  3OHR A;  4CJT A;  1S72 N;  1GLL O;  4O5B A;  4F9O A;  3VEO A;  1SKW A;  3AVN A;  1CZ9 A;  2WFB A;  3K58 A;  4C8K A;  3MXI A;  3G10 A;  4C23 A;  3I8D A;  4CFC A;  2H3G X;  1VK0 A;  1T6D A;  1TAQ A;  3OYG A;  1YJN N;  4F3T A;  3O9T A;  3SPY A;  4IOA L;  3HST B;  3DWL A;  4B1Y B;  2RKI A;  2IAJ A;  1QZ6 A;  2XO7 A;  3CM5 A;  4BRQ A;  1LWE A;  3LDQ A;  5CYQ A;  5EXW A;  3VQ7 A;  1ZBF A;  3KZB A;  4FJH A;  4FJK A;  4JD2 A;  1NOY A;  4BRE A;  3H1V X;  1YTA A;  2HST A;  2ZGY A;  4DLE A;  3BP8 A;  2WBN A;  5FRO A;  3WT0 A;  4X65 K;  1Q18 A;  2G8U A;  1GLJ O;  1VSD A;  1K8K A;  3SUN A;  5AJ3 K;  4F2R A;  2XY6 A;  4CF0 A;  3L2W A;  4OLA A;  1HNZ K;  1TGO A;  1Q86 O;  1NK8 A;  2QEX N;  3RR8 A;  5M1N A;  3RWU A;  4JKB A;  1WNS A;  4BE0 A;  3IKM A;  2QTD A;  3OVN A;  4IG0 A;  4CHQ A;  4DSI A;  4B8C A;  1BUP A;  4CJP A;  1YUW A;  3CET A;  4BR0 A;  3TPQ A;  3BY5 A;  5AQH A;  2G8K A;  4PWD A;  3BDP A;  4DQP A;  1TYQ B;  2P5G A;  4KB0 A;  1C1A A;  4BC5 A;  4OGC A;  4FK4 A;  1TYQ A;  4DWI A;  2G8W A;  1C0F A;  2JWK A;  2VWK A;  3VQA A;  5KPT A;  1RTH A;  3ZLJ A;  4CBX A;  5SWM A;  1OVQ A;  3KD5 E;  4M7Y A;  1NKC A;  3NF8 A;  5E41 A;  1X9S A;  4JRP A;  3OS2 A;  3H46 O;  3PUF A;  2IVO A;  2YJF A;  2NRR A;  1RT3 A;  2G8V A;  1KCF A;  3MK6 A;  1BWF O;  3ITH A;  5FRN A;  4GW6 A;  1RT1 A;  1L5U A;  3TAM A;  3CC7 N;  5HP1 A;  4H5T A;  4BG9 A;  4DUY K;  4LSN A;  4CJ4 A;  1VSL A;  1DTT A;  4UQG A;  2P9P A;  4B1U B;  2PFU A;  3V4I A;  3LWM A;  5C15 A;  4FOI A;  5AQQ A;  4RW4 A;  4F3O A;  4AHT A;  1KAY A;  3LDS A;  4BAC A;  2KTQ A;  3CQX A;  4FM2 A;  2ATQ A;  4NLC A;  3TI0 A;  4JNE A;  4CFB A;  1VQL N;  5AQY A;  2KHO A;  1NGA A;  3EEQ A;  1S1V A;  4CGG A;  4FPA A;  3OJU A;  1Q7Y O;  2Q0U A;  3ZT1 A;  1YJ9 N;  5EU7 A;  1JLC A;  3THW B;  1A5V A;  5DK5 A;  3KLI A;  3OYJ A;  4FJN A;  4AM6 A;  5T7B A;  4RW8 A;  3O6W A;  3ZCM A;  3OYC A;  5BR9 A;  4DU1 A;  5CZ1 A;  1M90 O;  4JS5 A;  5CYM A;  2LSN A;  3U8X A;  2G8F A;  2BTF A;  1JLG A;  4CCH A;  1RT4 A;  1TKZ A;  3E1Y A;  1ATN A;  4J2B A;  4CJV A;  1F21 A;  3ZX3 A;  3ZSZ A;  4CF9 A;  3MDQ A;  5CR4 A;  3L2Q A;  5GIN A;  3L4Q A;  1U2V B;  3ID6 A;  5HRR A;  1EXQ A;  1HNV A;  3CJ9 A;  5GAD P;  4B3M K;  3WXK A;  3TAF A;  3NF6 A;  5KGW A;  2P9P B;  1Z05 A;  1C0T A;  2ZJP L;  4DTR A;  4PA1 A;  4BRM A;  4CGH A;  2V7Z A;  4FWN A;  3ULE B;  4KB1 A;  3ATV A;  3VQ8 A;  4DR6 K;  1R59 O;  3JXU A;  3VMF B;  3E66 A;  3QFU A;  5AQX A;  4Z0U A;  4O4G A;  1MWK A;  3CFO A;  3I33 A;  4XH4 A;  3UKU B;  4FM1 A;  1VSI A;  1SUQ A;  1XMQ K;  3AY9 A;  4JLH A;  3TU5 A;  2P51 A;  2EX3 A;  4PKG A;  3P39 A;  4CZM A;  4A5B A;  2YKM A;  3NH1 A;  4ISE A;  4YOY A;  3A0I X;  2IVP A;  5AQI A;  1XI1 A;  2QWQ A;  2DY4 A;  3NBP A;  4YOV A;  3H45 C;  3THX A;  1HR0 K;  1LAV A;  1VQ5 N;  3O4W A;  1YXQ A;  3T1Y K;  4I7F A;  2QK9 A;  4FLX A;  1U6Z A;  2E1Y A;  5ELZ A;  3OYE A;  4CVN E;  1NOZ A;  3DRP A;  3PY8 A;  4E0D A;  4ZTF A;  1VSM A;  3C65 A;  1TK5 A;  3T1A A;  3SQ1 A;  1NK0 A;  4BQZ A;  3CXC M;  4CEQ A;  4DSF A;  4PHT X;  4IO9 L;  3MXJ A;  4V19 S;  1WSH A;  4XH5 A;  4MFB A;  4N56 A;  5I42 A;  3KLH A;  1VQM N;  4FCY A;  4IDH A;  1J5O A;  4QS8 A;  4K8X A;  2E8A A;  4GKJ K;  3U3G A;  3UIQ A;  3L6Q A;  3VF4 A;  3O08 A;  2HB5 A;  1XNR K;  4GV6 A;  3QIO A;  4DR5 K;  1LW2 A;  4EZ6 A;  3O9U A;  1BCM A;  1JLB A;  2UYT A;  3K59 A;  3AVA A;  3AVF A;  3SUO A;  4O8U A;  2Q2R A;  3CHW A;  4DCH A;  3AVC A;  5DM7 L;  3O9R A;  1BOT O;  3QBX A;  4OVL A;  3TAB A;  2CGK A;  1M1K O;  4HCB A;  1RBV A;  2NRV A;  2PAV A;  3TAR A;  3AO3 A;  4FJ5 A;  4JKG B;  1RBR A;  5M1Q A;  3C7N A;  1Q8I A;  1D8Y A;  3HTV A;  2G8H A;  4BRF A;  1KAZ A;  1FXX A;  3ZSO A;  4HUE A;  4HTL A;  1I3A A;  3PIO L;  4BDP A;  3ZT2 A;  2E2O A;  4J2D A;  1SQK A;  3NH0 A;  3SBT A;  4CJ7 A;  4IJA A;  4DG1 A;  1NK7 A;  2O4G A;  3THX B;  2EWS A;  4ELT A;  4AF1 A;  2FBX A;  3M8R A;  3VQ9 A;  4KH4 A;  3VQC A;  3A5L C;  1I94 K;  4QCL A;  4AHC A;  3KK7 A;  4R5P A;  3L2V A;  4IEE A;  4U67 L;  3HXM A;  3RTV A;  2OYQ A;  1N33 K;  1D4X A;  4CJF A;  3BGR A;  2YNI A;  2FXU A;  3QO9 A;  5AQL A;  4DR2 K;  1N34 K;  1MWM A;  3E9L A;  4B9S A;  4HUF A;  3F9K A;  3IDH A;  3DLG A;  4CZL A;  2Y1J A;  1NU0 A;  1GLF O;  1QQC A;  2ZD1 A;  3AO1 A;  3W3D A;  3OYN A;  2ASO A;  5FDL A;  3AO5 A;  3ASM A;  4LF6 K;  4HHT A;  1ASW A;  5K14 A;  5HLF A;  3HJF A;  1CXQ A;  1NWK A;  5FLX O;  2WON A;  4IFV A;  2KFN A;  3VQ5 A;  2ZE2 A;  2VGM A;  2B4J A;  1BIU A;  4AIL C;  1HPM A;  2OPS A;  4KHW A;  4K0K K;  1VQ4 N;  3CJ1 A;  2A5X A;  4DSE A;  2OZS A;  4CIG A;  4DTX A;  1DTQ A;  3HPH A;  3VGL A;  4IKF A;  4DTJ A;  2FBV A;  1OH8 A;  1DLO A;  4WFA L;  1S1W A;  1NGH A;  4L3Q A;  3DM2 A;  1JL2 A;  1HQE A;  3T69 A;  1C6V A;  3LDO A;  4FZX C;  3SJJ A;  1YF5 L;  4OKE A;  3OYM A;  3DJC A;  3ENB A;  2O8D A;  3THW A;  1NG9 A;  4E1M A;  4PQU A;  2VWJ A;  5KPR A;  2P9S B;  3EE9 A;  3D2F B;  1RT7 A;  4DTU A;  3MEG A;  3L2U A;  3J81 O;  3THY B;  3R3L A;  5B8H A;  4YOR A;  2HMI A;  4DV2 K;  3SZ2 A;  1T44 A;  4CEF A;  1HNW K;  1Y64 A;  4JK8 A;  4NCA A;  4KV8 A;  3EE8 A;  4WQ4 C;  3DI6 A;  3SV3 A;  3S3N A;  3IS9 A;  5FPN A;  1HNI A;  2HBL A;  4WQ4 A;  2OPR A;  2Y1I A;  4A62 A;  5BPL A;  2Q0R A;  3HBT A;  1WSF A;  2BGG A;  4BDY A;  4CI6 A;  2ITG A;  3CCV N;  1V4S A;  4CJ3 A;  3SPZ A;  3THV A;  3U3Y A;  1Q9X A;  1T7P A;  3WUH A;  3TAN A;  5AQV A;  4DS5 A;  3CJB A;  1WAF A;  1RDB A;  1JLE A;  4DTO A;  3G0Z A;  4X64 K;  3ZYY X;  1DEJ A;  2DTU A;  3KJV A;  5GIO A;  3L4I A;  2J4R A;  4CZE A;  3WXI A;  5BRE A;  1HKC A;  3FE1 A;  3JS6 A;  4FM0 A;  3O4N A;  2W6L A;  4BRP A;  1IJJ A;  1QQO A;  1V4T A;  3VA0 A;  4CFD A;  2IC3 A;  3DLR A;  4BR9 A;  4LFB K;  1LWF A;  3MN5 A;  1YHQ N;  4BRI A;  3DXK A;  3F2K A;  4U7B A;  4FLV A;  1LW0 A;  5HRN A;  3SLC A;  3PO5 A;  3KLF A;  3SJH A;  3MED A;  1EWQ A;  3ZX0 A;  5M1O A;  4BC2 A;  5AFU A;  4DFM A;  5TKW A;  1ASV A;  4FWL A;  2E2Q A;  1NKE A;  2O8E B;  2BDP A;  2YHW A;  4IBN A;  1LWC A;  4IOX A;  4NCG A;  1NMD A;  2G8I A;  1REV A;  2HHS A;  2Q36 A;  3HZ6 A;  1U47 A;  1HRH A;  4BC4 A;  3L0Q A;  4PY5 A;  1U48 A;  3LAL A;  2HOE A;  1EQY A;  4F4K A;  4PL8 A;  1U4B A;  3ZET A;  5AZI A;  3C6U A;  5CE3 A;  1D5A A;  3C6H A;  4CHY A;  3D2E B;  4RW6 A;  4H5V A;  3JAM O;  4EP4 A;  4JKA A;  1J9A A;  1IKW A;  4GVM A;  3KKR A;  4KH6 A;  5EVZ A;  3AVB A;  4FL9 A;  2ZJQ L;  4JI4 K;  3SK3 A;  4B9N A;  2Q3S A;  1VQ9 N;  3CYM A;  4HWI A;  1NGF A;  4NO7 A;  1Z25 A;  1VSK A;  3F5T A;  5J2P A;  1QZ5 A;  2HBM A;  4KRE A;  3MN7 A;  3ZSQ A;  5BN8 A;  2P5O A;  2KFZ A;  4M3R A;  4H5R A;  4QS7 A;  4LH5 A;  3J7Z O;  1HKG A;  3CI5 A;  4J2A A;  4KHY A;  1NGB A;  4WFN L;  4N76 A;  2O8C B;  1W9H A;  2QWM A;  2F8T A;  2A6A A;  4W5T A;  4BWM A;  1L3U A;  5SZT A;  2E6L A;  3V6D A;  3RMC A;  1W7A A;  4CEZ A;  1LV5 A;  3C6T A;  4K42 A;  1E4G T;  2YHY A;  1YTU A;  1NMN A;  3P83 D;  1NJX A;  3P1G A;  3V9U A;  3CM6 A;  3SYZ A;  4DTS A;  3ZSW A;  4Z4E A;  2HND A;  5AQU A;  3LP0 A;  4Y1D A;  1U04 A;  3KLG A;  3O5B A;  3DOK A;  1N36 K;  4OX9 K;  3H3O B;  4CHP A;  3HYF A;  2P9N B;  4DV4 K;  2QA4 N;  2IDO A;  3M8S A;  2HF3 A;  3BF1 A;  2QXF A;  4A2A A;  4B8A B;  4BGA A;  3SQ4 A;  4AHV A;  2KZM A;  4LF5 K;  4E19 A;  4EZ9 A;  2A41 A;  4JV5 K;  4BGB A;  3H1Q A;  2GEM A;  3NMU A;  4ISG A;  4CEB A;  3BZK A;  3TTF A;  4BRG A;  3FZF A;  4OPA A;  3EKS A;  1CXU A;  3HOT A;  2WUS A;  1VQ7 N;  4FYD A;  4CBW A;  4M3U A;  3TAP A;  2QM1 A;  1RDD A;  3A5O C;  4I2P A;  2ZJR L;  3G25 A;  4DTP A;  4CER A;  2QKB A;  1IKY A;  3A5M C;  4DR4 K;  1BO5 O;  4GV9 A;  3N4Q A;  2UUB K;  1YVN A;  3HO1 A;  4KH5 A;  2X74 A;  4OPK A;  1JLA A;  3O1W A;  3CC2 N;  3VEX A;  4X66 K;  4DV3 K;  4KHN A;  4JN4 A;  1KQS M;  2Z1H A;  3KHY A;  2XY7 A;  4FPB A;  4FLW A;  3PV8 A;  4O44 A;  3OS1 A;  3FGU A;  3U6F A;  1IBL K;  1VHX A;  3LDL A;  3VEW A;  3ZSR A;  3K9K A;  1HJR A;  3NHG A;  5JVG L;  2OCE A;  4EP5 A;  1K9M O;  1NLV A;  2YHB A;  4KBO A;  1HNX K;  1X3M A;  3CPW M;  1CLQ A;  4Z4F A;  3LAM A;  4PKI A;  4KKO A;  4CES A;  5BPM A;  3V1O A;  3K5L A;  1YAG A;  4HCC A;  3O8M A;  3ZX2 A;  1QS4 A;  3R9P A;  2HBJ A;  5KGX A;  4JI1 K;  2NNW A;  3QML A;  3CCU N;  4K8Z A;  1YJW N;  3NGI A;  3VN5 A;  4CF8 A;  3C95 A;  3AA4 A;  4CJK A;  3IAY A;  4Y0W A;  3IUC A;  1QE1 A;  2NZT A;  4EIA A;  3BEX A;  1T8E A;  3LZJ A;  3QDK A;  1XQS C;  5KI6 A;  4JI3 K;  4ILG B;  4E7K A;  4LF8 K;  1C0M A;  2NRZ A;  2KKZ A;  4CJW A;  1VSF A;  1SKS A;  4B1X B;  4RTF D;  2A40 A;  1LAW A;  1EKE A;  1ATS A;  2VG5 A;  3AGK A;  4O8K A;  3CCR N;  4DV0 K;  1GOB A;  1VSH A;  3LPU A;  1B92 A;  2D1K A;  4GMJ B;  4JYA K;  3LDN A;  3MN6 A;  3NE6 A;  2NRX A;  2W41 A;  5AQS A;  4CF1 A;  2KQ2 A;  1S5J A;  3H6E A;  3VF2 A;  3AAR A;  3V1R A;  1KSP A;  1T3V A;  3LZI A;  5F0X A;  4B9U A;  3QEW A;  1IO2 A;  1WSG A;  1NGG A;  4JK7 A;  4BRC A;  1ZC6 A;  3CCS N;  3OBY A;  4W5Q A;  1T6C A;  3HRG A;  4M3Y A;  1RIL A;  4OKK A;  3O1B A;  4FLT A;  2CGL A;  3VES A;  1YI2 N;  4KI6 A;  2D0P A;  2ZM6 K;  4CJS A;  4DV5 K;  4DHY A;  2ZWH A;  2QWR A;  4HTU A;  4CHO A;  4FWQ A;  1XC3 A;  5GAG P;  3ISN C;  4DU3 A;  4FJX A;  4PL7 A;  4B1W B;  3CJA A;  2W6K A;  4M63 C;  1WSE A;  2QI2 A;  1YVU A;  1S1X A;  2ZGZ A;  4HVJ A;  1HLU A;  5FPM A;  4R79 A;  2XY8 A;  1S6Q A;  5CHI A;  4GV3 A;  3M8Q A;  1U2V A;  4FWO A;  2HVI A;  3O9Q A;  1CZA N;  2QWN A;  4DLG A;  5EX5 A;  4DTM A;  4K43 A;  4JI2 K;  1TUY A;  2QXL A;  4BRH A;  4KO0 A;  5JMV A;  1UOC A;  4H5W A;  1DT9 A;  3GE1 A;  5AZI B;  2F8S A;  1KTQ A;  4NCB A;  5AQW A;  4CF2 A;  4EHT A;  3B6P A;  3K0S A;  4BVP A;  3NGY A;  3KWG A;  5AZJ B;  3HVR A;  5LJV A;  4B1V A;  4JKE A;  3VQ6 A;  4OLB A;  4Z4C A;  4B3S K;  3UKR A;  4CGF A;  5C2F A;  2Q31 A;  2V7Y A;  3FLC O;  2I7P A;  1GLA G;  1IKV A;  1GLC G;  3FZM A;  5LMN K;  4DS4 A;  5LY3 A;  1ESV A;  2IGI A;  4YHH K;  3NVK A;  2P9I A;  3RMB A;  3C94 A;  4Y1C A;  4YY3 K;  3AA5 X;  4E7L A;  4O0I A;  1VRT A;  4ISF A;  1TUU A;  4FW2 A;  5AQG A;  3RMD A;  1XUP O;  2OZM A;  2HMP A;  3O80 A;  3B6O A;  1X3N A;  4E3S A;  3V1Q A;  2F4V K;  4BR4 A;  4DB3 A;  2VG6 A;  3QBW A;  2AA4 A;  5AQO A;  4OJR A;  3FZK A;  5C42 A;  4M3T A;  4DUZ K;  2O8F A;  3U9Z A;  4BR2 A;  3HT3 A;  2D0C A;  3HI0 A;  4IO8 A;  3TAQ A;  1HQU A;  2FF3 B;  2DFH A;  4FSV A;  3G71 N;  4B3T K;  5J2M A;  3NF9 A;  1NK4 A;  4FO0 A;  3GOI A;  3HPO A;  3QET A;  3J7A P;  3PX6 A;  1NK5 A;  2GWK A;  4O5F A;  3IRX A;  1SS6 A;  4WQ5 C;  2OAN A;  1RFQ A;  3HPG A;  5JIC A;  3AVK A;  4MO5 A;  1OH7 A;  4DV6 K;  1RTD A;  4LF9 K;  1BQN A;  4UY8 O;  1BDG A;  1EET A;  1EWR A;  4Z4H A;  4IG3 A;  2NRW A;  3TTC A;  1MA9 B;  4FOE A;  3ULD A;  3GG4 A;  4A59 A;  1H1V A;  5AQM A;  3AO4 A;  4OGE A;  4H0T B;  3LDP A;  3D0P A;  3OYB A;  5IWA K;  5AQZ A;  1VSE A;  1RDC A;  1HMV A;  1DGK N;  3DXM A;  4CK1 A;  4GY2 B;  3MWT A;  3PSF A;  4ZHR A;  5AQP A;  2E5L K;  4DFJ A;  3J8A A;  2E1Z A;  3NDK A;  3VA3 A;  5AFU H;  4KHU A;  3I0S A;  5GAE P;  4OKJ A;  4IOC L;  1WAJ A;  4IFY A;  1XC9 A;  2ASP A;  1YT3 A;  3OYK A;  4E7J A;  1UA1 A;  1NGJ A;  4H0Y B;  1VSJ A;  2VWB A;  3MN9 A;  2GTD A;  5EY4 A;  3OS0 A;  3BZC A;  2F96 A;  4I9L A;  3ZSV A;  1Z6R A;  3A8Y A;  1TL1 A;  3ULE A;  2UXD K;  1U45 A;  3PLA A;  4AH9 A;  2XY5 A;  1TK0 A;  2ZF5 O;  3KK3 A;  1RBT A;  2HNZ A;  5AQR A;  4FLY A;  1WBD A;  2FBT A;  2AJQ A;  1TV6 A;  3WNE A;  3F73 A;  2E88 A;  4N5S A;  4KRF A;  3LPT A;  3HK2 A;  4M7X A;  4H0V B;  2I7N A;  4IXC A;  4BR7 A;  1K8A O;  1XHX A;  4LC9 B;  2YHA A;  3CFP A;  1IBK K;  3QNN A;  1SL2 A;  4RCH A;  2GWJ A;  4FWR A;  1VQ8 N;  2VG7 A;  2NRT A;  1BL3 A;  1BCO A;  1HX1 A;  4CJ5 A;  4B9V A;  1SL0 A;  1QHT A;  4FJ8 A;  1RBU A;  3I56 N;  1NGI A;  1RNH A;  2IOC A;  4FWS A;  3O4Q A;  3M3Z A;  2YNF A;  1NK6 A;  3SCX A;  4BRL A;  4DR7 K;  2F7T A;  2BAN A;  3O3H A;  2KZZ A;  4MDB A;  4Z4G A;  2YKN A;  1JXB A;  4LSL A;  1QVF M;  3R1X A;  4MDA A;  4YOT A;  3SMP A;  3AAQ A;  1KC8 O;  3TWH A;  4NXN K;  3QB0 A;  2E2P A;  2IS3 A;  3AVM A;  3RSE B;  2FSN A;  1BI4 B;  4BE1 A;  1YIT N;  4AHU A;  4CGD A;  4CGJ A;  4WCE L;  4ZTJ A;  3G4S N;  3KIO A;  3S9H A;  4AHS A;  5KPZ A;  1S9E A;  2GUP A;  3T7Z A;  1X9J A;  2CGJ A;  5E26 A;  4A2B A;  4DR3 K;  5E84 A;  3OYD A;  3IMX A;  1O1W A;  3O9S A;  4AQY K;  4H5N A;  3I8B A;  4FJ9 A;  2YNG A;  5F1X A;  4NXM K;  4DFK A;  2OTL N;  3OYA A;  1Y97 A;  4B9T A;  5JS1 A;  2FSJ A;  1ATR A;  4E1N A;  4ILH A;  5ADX H;  1RTJ A;  4CZF A;  4M3X A;  4BRA A;  1I39 A;  2CH6 A;  3U9D A;  3SAH A;  1KD1 O;  3CMA N;  4Z4I A;  2BE2 A;  4LD0 A;  2B6A A;  3OTO K;  3SUP A;  1OH5 A;  1JJ2 M;  2E4L A;  2Q97 A;  2P1J A;  5TKY A;  4I6M B;  4KTW A;  2JWL A;  3IFR A;  4CEC A;  2O4I A;  1BA1 A;  1Q82 O;  3T1H K;  3VEN A;  1ASU A;  4RW9 A;  1K8K B;  3V81 A;  2BH1 A;  1BG3 A;  1NK9 A;  1ITG A;  5HBM A;  5BN9 A;  4DSJ A;  3MMV A;  2X6S A;  3WQU A;  1XWL A;  2O8D B;  1NJY A;  2O8B A;  1S1T A;  2QW9 A;  2FF6 A;  2RHK A;  3QEP A;  2Z1J A;  2ETJ A;  3C7N B;  1XNQ K;  4GKK K;  2ASM A;  3AVI A;  1ZBU A;  1R0A A;  4JS4 A;  4MO4 A;  3TR8 A;  4KAZ A;  1X1P A;  1ZBS A;  4N47 A;  4DSL A;  2HF4 A;  1L3T A;  2YV0 X;  5CY4 A;  3ZT0 A;  4EAH D;  3UKU A;  3FZH A;  1A5W A;  4IZ9 A;  4ID5 A;  3TSP A;  3WNF A;  1RT2 A;  2YX6 A;  3KLE A;  3AGR A;  5FPE A;  4DQQ A;  4IJN A;  3VPZ A;  4DV7 K;  3KD1 E;  4MLE A;  1S6P A;  4OPH A;  1JLF A;  4DQI A;  4H0P A;  5KRT A;  1UAX A;  1RDU A;  2VQF K;  4DQR A;  4BDZ A;  3CD6 N;  2QWO A;  2GBZ A;  3P4I A;  4TSX A;  3K5O A;  5C12 A;  3CF5 L;  3AO2 A;  2VGN A;  4A5A A;  3QEV A;  5M1K A;  1SAZ A;  3LM2 A;  5M1F A;  4WYB A;  1KAX A;  3J7Y P;  3THY A;  2D0A A;  1B9D A;  4DF8 A;  1NM1 A;  4A57 A;  2GX9 A;  3HP9 A;  2KLA A;  2HW3 A;  1BA0 A;  2HHQ A;  2IVN A;  3GL1 A;  3W0L A;  4O55 A;  3IG1 A;  4DQS A;  4CEE A;  2P9L B;  3OJS A;  2Z1G A;  4JKF A;  3R6M A;  1IKX A;  3AVJ A;  3LWL A;  1GLD G;  1NBW A;  4DV1 K;  3F9M A;  4JK9 A;  1NJI O;  1JCG A;  4KFB A;  4B9Q A;  1S9G A;  3SAF A;  2UXC K;  1UA0 A;  3O3G A;  1N32 K;  3WNG A;  3AVG A;  3V9W A;  1GOC A;  2RPI A;  4EFH A;  2UXB K;  5HL7 L;  1NKB A;  3QIP A;  1N6Q A;  3CJ7 A;  4H4M A;  2HHW A;  4CJL A;  3MX2 A;  5DMR A;  1FKP A;  4W5O A;  1TKD A;  3VQE A;  4I9Q A;  2P9U B;  3NF7 A;  3GBT A;  4O0J A;  3ATU A;  3OW2 M;  1JKH A;  4WFB L;  3EZW A;  4Q5V A;  3C0B A;  4BWJ A;  3KK1 A;  3VQP A;  4LFC K;  2GUI A;  1L3S A;  1IG9 A;  4FJ7 A;  3MCA B;  1HPZ A;  4CHN A;  3I55 N;  1KLN A;  1KRP A;  5HRP A;  5LMU K;  2RF2 A;  1J53 A;  5D3G A;  2GV9 A;  1DKG D;  3TAG A;  1SV5 A;  3RMA A;  4K41 A;  4B3R K;  3WXJ A;  2P9N A;  2E2N A;  3OYH A;  3KWI A;  5AQT A;  5ADX A;  3VQD A;  4K25 A;  3M8P A;  1TKT A;  4JI6 K;  3CCE N;  5JLH A;  3RR7 A;  3SV4 A;  4B3O A;  4JI5 K;  1HYV A;  1FKO A;  4CIF A;  3L2R A;  4YOW A;  1S22 A;  3UKR B;  3C6A A;  5JVH L;  5AQJ A;  3K5M A;  3CCJ N;  4X62 K;  1HJO A;  1YIJ N;  3K9J A;  3LP1 A;  3CC4 N;  3CFR A;  4JAX A;  1X9W A;  2FSK A;  4FVU A;  2V51 B;  3NVM A;  3S41 A;  3VEV A;  4IDK A;  4CEA A;  4YNQ A;  4B1Z A;  4DFP A;  3MWP A;  4CBU A;  3AAP A;  4G9Z A;  1FJG K;  3PO4 A;  5I9E B;  4J2E A;  4H03 B;  1XMO K;  2UUA K;  2YNH A;  1P90 A;  2NRH A;  1NJW A;  5KRS A;  2KW4 A;  4HUG A;  1RT6 A;  4YOX A;  5AQN A;  2JLE A;  2WC9 A;  4LFA K;  3OA9 A;  2FBY A;  3TAE A;  1GLE G;  4C1N I;  3OYI A;  3FZL A;  3NCI A;  3VF6 A;  4W5R A;  3D45 A;  3Q7C A;  3CCM N;  1TK8 A;  2D0B A;  4KHQ A;  3VGK A;  3CCQ N;  5M1P A;  3A5N C;  4OPJ A;  1T05 A;  4F2S A;  3PX0 A;  3SI6 A;  4BR5 A;  5KTQ A;  3QIN A;  2NLX A;  3ID8 A;  1WOQ A;  3SQ0 A;  3CPE A;  3BF3 A;  3S3M A;  4CD3 A;  4A61 A;  3EKU A;  3VOV A;  4DMN A;  4E7I A;  4RWT A;  4JD2 B;  1T03 A;  1JL1 A;  5C2D A;  2O8E A;  4CE9 A;  3CME N;  3P31 A;  4ELU A;  4MQ3 A;  3O3F A;  1TKX A;  3H08 A;  3CG7 A;  3EY1 A;  1TVR A;  1K6Y A;  3MCP A;  3PX4 A;  2HHV A;  3SBG A;  4G1Q A;  3VQB A;  4H0O A;  4QOZ B;  4FJJ A;  3T19 A;  2DPN A;  1SKR A;  1KVB A;  1EO1 A;  1CZB A;  1MU2 A;  4DU4 A;  3ALY A;  1IH7 A;  4JEP A;  3VGM A;  2JGU A;  1VQO N;  2FLO A;  2O8C A;  1BIS A;  3WXM B;  4JKH A;  3RRH A;  3S3O A;  3H3N O;  3OYL A;  3LP2 A;  3QES A;  1FW6 A;  4EHU A;  4CEO A;  1QQN A;  4C8M A;  4C8N A;  3TTD A;  1BHL A;  1WB9 A;  4W5N A;  3WXL A; 
#chains in the Genus database with same CATH homology
 4BR9 A;  4H0Y B;  1NGD A;  2VWB A;  3MN9 A;  2ITM A;  2GTD A;  5EY4 A;  2YI1 A;  3MN5 A;  1YHQ N;  2P9I B;  4GVE A;  4BRI A;  3DXK A;  3F2K A;  4U7B A;  1Q86 O;  5BRH A;  1O13 A;  2QEX N;  5M1N A;  1Z6R A;  3A8Y A;  3E9P A;  4NLB A;  4JKB A;  3SLC A;  3ULE A;  2VCP A;  3IKM A;  2QTD A;  3D2E A;  3SJH A;  3PLA A;  3ZX0 A;  1RDW X;  3DXM B;  5M1O A;  4BC2 A;  4IWV A;  5AFU A;  5TKW A;  2ZF5 O;  1BUP A;  4FWL A;  2E2Q A;  3Q7B A;  3VER A;  1YUW A;  2YHW A;  3CET A;  2AP1 A;  4IOX A;  5AQR A;  1NMD A;  3TPQ A;  5AQH A;  4BR0 A;  4CD1 A;  2Q36 A;  3HZ6 A;  3BUZ B;  1TYQ B;  1OKJ A;  3CCL N;  4BC4 A;  2E88 A;  3L0Q A;  4BC5 A;  1TYQ A;  2HOE A;  1EQY A;  1QVG M;  3ZEU B;  4M7X A;  4H0V B;  2I7N A;  4PL8 A;  1C0F A;  4IXC A;  4BR7 A;  1K8A O;  2JWK A;  3ZET A;  1G99 A;  4J8F A;  5AZI A;  4LC9 B;  4QS9 A;  5KPT A;  4CBX A;  1LOT B;  4YDU C;  5CE3 A;  3C6H A;  4XH1 A;  3D2E B;  4H5V A;  2W40 A;  4RCH A;  2GWJ A;  4FWR A;  4JKA A;  1VQ8 N;  4M7Y A;  4KH6 A;  5EVZ A;  4FL9 A;  2ZJQ L;  3H46 O;  2NRT A;  2IVO A;  2YJF A;  2NRR A;  3SK3 A;  3CJC A;  2OTJ N;  1QHA A;  1VQ9 N;  1HX1 A;  3MK6 A;  1BWF O;  4HWI A;  1NGF A;  2P9L A;  4NO7 A;  2D4W A;  3F5T A;  1QZ5 A;  2HBM A;  3MN7 A;  3QFP A;  3I56 N;  3CC7 N;  5BN8 A;  1NGI A;  4H5T A;  4BG9 A;  1VQK N;  4H5R A;  4CZJ A;  4FWS A;  3MX5 A;  4QS7 A;  3M3Z A;  3J7Z O;  1HKG A;  3CI5 A;  3VEY A;  4BRL A;  5C0Y A;  2F7T A;  1NGB A;  4CZG A;  4WFN L;  2P9P A;  4B1U B;  2PFU A;  4IFE A;  4MDB A;  2QWM A;  5C15 A;  4BRN A;  4FOI A;  5AQQ A;  1QVF M;  1J6Z A;  1KAY A;  2QWP A;  2A6A A;  3WEE A;  3R1X A;  4MDA A;  4BY9 C;  3CQX A;  4YOT A;  4NLC A;  4JNE A;  3AAQ A;  3SMP A;  1VAZ A;  1VQL N;  5AQY A;  2KHO A;  5KQD A;  1NGA A;  1KC8 O;  1JCF A;  3QB0 A;  5AQK A;  4FPA A;  2E2P A;  1E4G T;  4K42 A;  2YHY A;  3RSE B;  1W97 L;  2FSN A;  1Q7Y O;  2HBK A;  2Q0U A;  1YJ9 N;  1YIT N;  4AM6 A;  4WCE L;  3LL3 A;  5AQU A;  3O6W A;  3G4S N;  3EN9 A;  5BR9 A;  3O5B A;  1M90 O;  3H3O B;  5KPZ A;  3U8X A;  2P9N B;  2GUP A;  3T7Z A;  1X9J A;  2CGJ A;  5E26 A;  2QA4 N;  4A2B A;  2P9U A;  3U4L A;  2BTF A;  5E84 A;  2HF3 A;  3BF1 A;  1HUX A;  3IMX A;  4A2A A;  4FWK A;  3E1Y A;  1ATN A;  3O9S A;  4WF9 L;  3ZX3 A;  4BGA A;  4YDU A;  5C10 A;  4H5N A;  3I8B A;  4AM7 A;  3MDQ A;  3QIC A;  1VQP N;  1MDU B;  5F1X A;  5CR4 A;  2OTL N;  2PBD A;  2A41 A;  5GIN A;  3L4Q A;  1U2V B;  3ID6 A;  2FSJ A;  1ATR A;  4BGB A;  5ADX H;  3H1Q A;  4ILH A;  4CZF A;  3CJ9 A;  2E20 A;  2GEM A;  4BRA A;  3NMU A;  2CH6 A;  3U9D A;  4ISG A;  5GAD P;  3SAH A;  1KD1 O;  3WXK A;  3CMA N;  3TTF A;  3B8A X;  4Z94 A;  4BRG A;  3KVG A;  3FZF A;  2P9P B;  1Z05 A;  3VET A;  4OPA A;  2ZJP L;  2YCH A;  5AR0 A;  3P38 A;  4BRM A;  3EKS A;  2IIR A;  2V7Z A;  4FWN A;  3UE5 A;  3ULE B;  3ATV A;  2WUS A;  4CZK A;  3HOT A;  1VQ7 N;  1HKB A;  1JJ2 M;  3HOS A;  4CBW A;  2Q97 A;  1R59 O;  2QM1 A;  3JXU A;  3A5O C;  5TKY A;  2ZJR L;  3G25 A;  4I6M B;  3VMF B;  3E66 A;  2JWL A;  3QFU A;  5AQX A;  5BPN A;  3A5M C;  3IFR A;  1MWK A;  1K73 O;  1BA1 A;  1BO5 O;  1Q82 O;  4GV9 A;  3I33 A;  3VEN A;  4XH4 A;  3UKU B;  1K8K B;  3N4Q A;  4E1J A;  1YVN A;  2BH1 A;  1RGI A;  1BG3 A;  3AY9 A;  3SAG A;  3TU5 A;  4KH5 A;  5BN9 A;  2P9K A;  3O1W A;  4PKG A;  3P39 A;  3CC2 N;  3MMV A;  3VEX A;  4CZM A;  4IEI A;  4A5B A;  4JN4 A;  1SZ2 A;  1KQS M;  3WQU A;  3KHY A;  4H0X B;  4ISE A;  4YOY A;  3A0I X;  4FPB A;  5GIP A;  2IVP A;  4JKG A;  4BRK A;  3FGU A;  5AQI A;  2QW9 A;  2FF6 A;  2QWQ A;  2RHK A;  3K9K A;  3LDL A;  3VEW A;  5BRF A;  3D6R A;  4YOV A;  5JVG L;  3H45 C;  5FPD A;  1ZXO A;  1N8R O;  3C7N B;  1K9M O;  1VQ5 N;  1NLV A;  4KBO A;  3O4W A;  1YXQ A;  2ASM A;  3GDQ A;  1X3M A;  3TSU A;  3CPW M;  4MO4 A;  1U6Z A;  4PKI A;  2E1Y A;  5ELZ A;  5BPM A;  1YAG A;  1NGE A;  1ZBS A;  1OVY A;  2A3Z A;  2P9K B;  3C65 A;  2HF4 A;  3O8M A;  3R9P A;  3RSE A;  3ZX2 A;  2HBJ A;  1VQ6 N;  4EAH D;  3UKU A;  3FZH A;  2NNW A;  3QML A;  4IZ9 A;  3DLL L;  3CCU N;  3TSP A;  1YJW N;  4BQZ A;  3CXC M;  3OBW A;  2YX6 A;  4PHT X;  4IO9 L;  3AGR A;  5FPE A;  3ZET B;  4IJN A;  3VPZ A;  4XH5 A;  4Y0W A;  4MLE A;  1S3X A;  3DXK B;  2NZT A;  3IUC A;  4OPH A;  4EIA A;  1VQM N;  3BEX A;  4IDH A;  2F9T A;  4H0P A;  4QS8 A;  3QDK A;  2E8A A;  1XQS C;  1RDU A;  4ILG B;  3L6Q A;  4CZH A;  1C0G A;  3VF4 A;  3O08 A;  1P8Z A;  2NRZ A;  2KKZ A;  4B1X B;  4GV6 A;  4RTF D;  3CD6 N;  2A40 A;  2QWO A;  1ATS A;  3AGK A;  3O9U A;  3P4I A;  4O8K A;  3CCR N;  2BUP A;  2UYT A;  2D1K A;  3EL2 A;  5C12 A;  3LDN A;  4O8U A;  2Q2R A;  3CF5 L;  4ILJ A;  3MN6 A;  2VGN A;  3CHW A;  2NRX A;  3D2F A;  3FR0 A;  4A5A A;  4DCH A;  5DM7 L;  2P9S A;  3O9R A;  4BRO A;  4JKC A;  1BOT O;  5M1K A;  2W41 A;  5AQS A;  1SAZ A;  3QBX A;  3LM2 A;  3H6E A;  2D0O A;  3VF2 A;  3VTH A;  5M1F A;  4WYB A;  1KAX A;  5BRD A;  3AAR A;  4MLH A;  2CGK A;  1T3V A;  1Q81 O;  5AQF A;  1M1K O;  5F0X A;  1NM1 A;  4A57 A;  2GX9 A;  2NRV A;  1NGG A;  4JK7 A;  4BRC A;  2KLA A;  2F9W A;  1BA0 A;  2PAV A;  1ZC6 A;  2IVN A;  3GL1 A;  3M5R A;  4JKG B;  3W0L A;  3CCS N;  3ENO A;  3OBY A;  5M1Q A;  1T6C A;  2P9L B;  3HRG A;  3C7N A;  4JKF A;  2YJE A;  3R6M A;  3O1B A;  4GNI A;  3HTV A;  1GLD G;  2CGL A;  3VES A;  1NBW A;  1YI2 N;  3F9M A;  1NGC A;  4JK9 A;  1JCG A;  4BRF A;  1KAZ A;  1NJI O;  4B9Q A;  5JLF A;  3SAF A;  2D0P A;  3HM8 A;  4HTL A;  3EO3 A;  3PIO L;  4XEI A;  4DHY A;  4JHD B;  2E2O A;  2ZWH A;  3M1F A;  2CH5 A;  2QWR A;  4DKW A;  3G6E N;  1VQN N;  5H1S Q;  1SQK A;  3CQY A;  4EFH A;  3TSQ A;  3N4P A;  4FWQ A;  5HL7 L;  1XC3 A;  3SBT A;  5GAG P;  3CJ7 A;  4YOU A;  5HOO A;  4CJ7 A;  5GAH P;  3MX2 A;  4IJA A;  4PL7 A;  4B1W B;  2P9U B;  3CJA A;  5DM6 L;  3GBT A;  3M6G A;  2EWS A;  2GEL A;  3ATU A;  3OW2 M;  4WFB L;  5EOY A;  3EZW A;  4AF1 A;  4M63 C;  2QI2 A;  2ZGZ A;  3C0B A;  1HLU A;  4PKH A;  5FPM A;  4KH4 A;  4R79 A;  5CHI A;  4GV3 A;  3A5L C;  1U2V A;  4BC3 A;  4CZI A;  2YHX A;  3ENH A;  3KK7 A;  4FWO A;  3FFK B;  4IEE A;  3WEE B;  4U67 L;  3O9Q A;  3MCA B;  2VYP A;  1D4X A;  1CZA N;  2QWN A;  3R8E A;  5EX5 A;  3I55 N;  2FXU A;  5AQL A;  5LJW A;  4K43 A;  4BG8 A;  1MWM A;  3E9L A;  1TUY A;  2QXL A;  4BRH A;  5JMV A;  1DKG D;  3IDH A;  1W2B M;  4K41 A;  4H5W A;  3WXJ A;  4CZL A;  1DT9 A;  2P9N A;  2E2N A;  3WQT A;  3GE1 A;  5AZI B;  3KWI A;  5AQT A;  5ADX A;  3VTI A;  5AQW A;  1GLF O;  4K25 A;  4EHT A;  3W3D A;  3CCE N;  2ASO A;  5AZJ A;  5JLH A;  1WUA A;  4BVP A;  5MLC Q;  3KWG A;  5AZJ B;  4YOW A;  1NWK A;  1S22 A;  5LJV A;  3UKR B;  5F2R A;  3C6A A;  4B1V A;  5JVH L;  4JKE A;  2V52 B;  5AQJ A;  3CCJ N;  2VGM A;  3UKR A;  1HJO A;  1QQM A;  1YIJ N;  4JKD A;  5C2F A;  2Q31 A;  3CER A;  3K9J A;  2V7Y A;  3FLC O;  2A42 A;  1HPM A;  2RE2 A;  1VQ4 N;  3CJ1 A;  2A5X A;  3CC4 N;  2I7P A;  1GLA G;  4JAX A;  2FSK A;  4FVU A;  1JCE A;  4C1N K;  2V51 B;  3NVM A;  3S41 A;  3VEV A;  4B1Z A;  1GLC G;  3FZM A;  3MWP A;  3VGL A;  3ZEU A;  4CBU A;  5LY3 A;  3LM9 A;  1ESV A;  3AAP A;  4BQL A;  4G9Z A;  5KQ8 A;  3NVK A;  2P9I A;  5I9E B;  4WFA L;  1NGH A;  4FWP A;  4H03 B;  1IG8 A;  4FWM A;  4L3Q A;  3E9O A;  3T69 A;  4BVO A;  3LDO A;  4I6M A;  3CIP A;  1P90 A;  4ISF A;  1TUU A;  2NRH A;  5AQG A;  3HSC A;  3VEZ A;  1XUP O;  1YF5 L;  2HMP A;  3O80 A;  4YOX A;  5AQN A;  1X3N A;  2WC9 A;  1GLB G;  3OA9 A;  4BR4 A;  1GLE G;  4C1N I;  3DJC A;  3ENB A;  3FZL A;  1LCU A;  3RVC A;  1ILY A;  3VF6 A;  5KPR A;  2P9S B;  3EE9 A;  4DB3 A;  3D7E O;  2QWL A;  3QBW A;  3D2F B;  2AA4 A;  3Q7C A;  3CCM N;  5AQO A;  4JHD A;  3FZK A;  3VGK A;  3CCQ N;  3R3L A;  3A5N C;  4NB4 A;  5M1P A;  5B8H A;  3U9Z A;  4BR2 A;  4BR5 A;  3HI0 A;  2Q1N A;  4YOR A;  4IO8 A;  4OO1 J;  2NLX A;  1KXP A;  1T44 A;  3ID8 A;  1WOQ A;  4DQ8 A;  3DAW A;  2FF3 B;  3CPE A;  3BF3 A;  1BU6 O;  4FSV A;  1Y64 A;  1E4F T;  3UB5 A;  3G71 N;  4JK8 A;  4CD3 A;  4A61 A;  3EKU A;  3EE8 A;  3GOI A;  4FO0 A;  4WQ4 C;  3VOV A;  3SMS A;  3PIP L;  4WQ5 A;  4RWT A;  4BRD A;  4JD2 B;  2GWK A;  4O5F A;  3OHR A;  5C2D A;  1SS6 A;  5FPN A;  4WQ5 C;  2OAN A;  1S72 N;  1GLL O;  1RFQ A;  2HBL A;  4WQ4 A;  5JIC A;  4MO5 A;  4A62 A;  3VEO A;  4F9O A;  3P31 A;  5BPL A;  3CME N;  2Q0R A;  4UY8 O;  1BDG A;  2WFB A;  3HBT A;  4CI6 A;  4C23 A;  2NRW A;  3TTC A;  1V4S A;  3CCV N;  1MA9 B;  4FOE A;  3MCP A;  3GG4 A;  2H3G X;  3SBG A;  4A59 A;  1H1V A;  1T6D A;  4H0O A;  5AQM A;  1YJN N;  4H0T B;  3LDP A;  2DPN A;  3O9T A;  1EO1 A;  5AQZ A;  4IOA L;  3WUH A;  3DWL A;  5AQV A;  1DGK N;  3DXM A;  4B1Y B;  3CJB A;  1QZ6 A;  4GY2 B;  3MWT A;  4JEP A;  3VGM A;  3LDQ A;  3ZYY X;  2FLO A;  5EXW A;  1DEJ A;  4BRQ A;  3KZB A;  1VQO N;  5AQP A;  5GIO A;  4JD2 A;  3L4I A;  4JKH A;  2J4R A;  3WXM B;  4BRE A;  3H1V X;  3J8A A;  4CZE A;  2E1Z A;  3WXI A;  5BRE A;  1HKC A;  3FE1 A;  3H3N O;  3JS6 A;  2HST A;  2ZGY A;  5AFU H;  5GAE P;  3BP8 A;  2WBN A;  4BRP A;  3WT0 A;  1QQN A;  1IJJ A;  4EHU A;  4IOC L;  1Q18 A;  2ASP A;  1QQO A;  3TTD A;  1V4T A;  1GLJ O;  1K8K A;  1NGJ A;  3WXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...