5TKWA

1.35 angstrom resolution crystal structure of a pullulanase-specific type ii secretion system integral cytoplasmic membrane protein gspl (n-terminal fragment; residues 1-237) from klebsiella pneumoniae.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
236
structure length
236
Chain Sequence
NKINASPQAMLIVRLAAAQAPLHWQLFAPGEPHHEASGRWPTDDASPFPALAEQYPAWVLIPASDCAFHSLTLPAGLRKPPLQVAPFLLEEQLADDVEATHFALLHRQQAQCEIVAVQRQKMRDWLARCESLSLQPLALTPDVLALPWQPPAWSAVQVDEQWLIRHQPWGGMAAENVWLTELLQSEAEEHVIDSYSPPPAAPGVWREQPAQTLLTLAARHPAAQKLSLLQGEFAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type II secretion system protein L
publication title 1.35 Angstrom Resolution Crystal Structure of a Pullulanase-specific Type II Secretion System Integral Cytoplasmic Membrane Protein GspL (N-terminal fragment; residues 1-237) from Klebsiella pneumoniae.
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
molecule tags Hydrolase
total genus 56
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2016-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05134 T2SSL Type II secretion system (T2SS), protein L
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.370 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5tkwA02
3.30.420.380 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5tkwA01
5TKWA 1W97L 4PHTX 1YF5L 2BH1A
chains in the Genus database with same CATH superfamily
3IFRA 4GVMA 3TAEA 1Z6RA 1E4FT 3CJAA 4CD3A 3VERA 1MWKA 3AO2A 4FJKA 3ZETB 1WBDA 4E19A 3S3MA 1VQLN 3WXMB 1KLNA 2HHUA 4DUZK 3FFKB 1TAUA 4IBNA 2NRRA 3CJ7A 2X6NA 2P9PA 3O9TA 3QDKA 1Z05A 2ZGZA 1FW6A 4CD1A 1BOTO 4O44A 1T6CA 5EY4A 2A5XA 4KREA 4IKFA 2B5JA 3L2VA 1H1VA 3C7NA 1XMQK 1NGFA 5M1OA 4FJXA 4IEEA 3OW2M 5AQTA 2HB5A 1J9AA 1WUAA 5ADXH 5CZ2A 5C15A 3C6UA 1SKSA 3SAHA 3E9OA 1UA0A 4H5RA 1VRUA 1LAWA 4ZTFA 1U6ZA 5FRNA 4GNIA 2KHOA 3MECA 5ELZA 1U48A 4NXMK 3FLCO 3A5NC 4KHYA 1ASVA 4B1UB 3LANA 2D0CA 3FGUA 3TI0A 1XNQK 4CF9A 4RW9A 1MWMA 5HRPA 4JV5K 1VQ7N 4B1YB 5AQYA 4BQZA 4U67L 2PZSA 4YFUA 3OYMA 1WSFA 1WSIA 4CESA 3KKRA 1VSLA 5C0YA 1HLUA 1WNSA 4HHTA 4DQPA 1Q81O 3EY1A 1SL1A 1SKRA 4BE1A 4H0VB 4O5BA 3D2FB 3CIPA 1D5AA 2KW4A 3QEVA 2HF4A 3SQ0A 1NWKA 3VQPA 2GUIA 4FJLA 3WXIA 3A0IX 4DFMA 3CCMN 1BG3A 2A3ZA 4MDAA 3R6MA 3P1GA 1TK5A 3D7EO 4F9OA 1JLQA 1IBKK 1QSYA 1ESVA 2UUCK 3TU5A 3O1BA 4LF7K 2CH5A 4YDUC 4JAXA 4FVMA 3TARA 4FZXC 1UA1A 1RTDA 3QFUA 4Z4CA 1RT5A 4LD0A 4YHHK 3KK7A 5AQMA 2D0BA 4C8KA 3KK2A 3ATVA 4M3XA 4DS4A 2O8BB 3N4QA 3MWPA 3NVMA 3SUOA 3KD1E 4QCLA 4HTUA 4MLHA 1BIZA 4KHQA 3QIOA 1XQSC 3S41A 4DTJA 3MEDA 2NRVA 3HBTA 2G8HA 1NK9A 3TAQA 3SNNA 3RSEA 3V9SA 3VA3A 3L8BA 4KI6A 1ZYQA 5JMVA 1B92A 4KKOA 2E2NA 2FLOA 3OA9A 2OA8A 1N36K 3HXMA 4KTWA 4JI8K 1J54A 1KAYA 5C24A 5MLCQ 3K58A 2HNYA 2CGLA 4BACA 1QSLA 4ISFA 2D0PA 1KQSM 4PY5A 4EHTA 4JI6K 1VQ6N 4YORA 2BH1A 3C95A 3A2FA 4YNQA 1IG9A 5C42A 3SCXA 3O80A 4OKEA 1ATRA 3SPZA 2IVNA 4IDHA 4B9QA 1BU6O 1HX1A 4F3OA 4LFAK 4M3TA 4DV0K 1NGJA 2RF2A 5ADXA 3QERA 3HP6A 4DTRA 4KV8A 4Y0WA 2IVPA 4R79A 4BE2A 4CF1A 4O55A 4A2BA 5AQVA 2P9IA 1GLDG 2OPQA 1VSHA 4CZHA 1RGIA 1WBBA 5CHIA 1KLMA 2ZGYA 4DR7K 2ZJQL 3F9MA 4KAZA 4DQIA 1LW0A 3RWUA 3KWIA 3DRPA 3H3NO 3UKRB 5FPDA 4BQLA 2HHTA 3DM2A 5JLHA 1CZ9A 2Z1IA 4CIFA 3K9JA 3TSQA 1HKGA 2UXBK 1WSGA 4N47A 4BR9A 2OANA 5DK5A 4NO7A 3BGRA 4Z4EA 1JKHA 1JLCA 2HNZA 3TR8A 3AVBA 2FSJA 1ASWA 4JI0K 3FZHA 1U49A 1X1PA 2XO7A 1HNVA 3CFOA 5KRTA 5CE3A 4B9SA 3JSMA 2D0OA 4CFAA 4FK2A 1VQKN 2QKBA 1Z25A 1LWEA 2BE2A 3FFIA 3K5OA 3OTOK 3AVNA 2Q1NA 4FPAA 1JJ2M 3DXKA 4BWMA 4DQRA 3HTVA 3KIOA 2F96A 3T19A 2IOCA 1NOYA 2O8CA 4DLGA 3BZKA 3KLIA 5J2PA 3P39A 3CFPA 1HKCA 2V7YA 4BE0A 2FBVA 4OJRA 5FDLA 4BREA 4CW7B 1TL3A 3RMAA 5SWMA 4CHNA 4DTPA 4DSEA 1HNWK 4E7HA 4ILGB 1TK0A 3EZ5A 3GG4A 3VQ7A 3HO1A 2BANA 3OBYA 4CCHA 1KTQA 2ITGA 1L5UA 3QLHA 1P8ZA 3HK2A 1KAXA 1U2VA 4JKAA 3CQXA 4K8ZA 1WOQA 4RW4A 4ILJA 3MAQA 4DQSA 2ZM6K 4IFYA 5FROA 5KPTA 5F2RA 1NBWA 3I55N 3M3ZA 1RT3A 3VEZA 3J7AP 3CC2N 2WBNA 3IMXA 1IKWA 3Q7BA 3WXLA 1QQCA 4FOIA 4JKGB 3M5RA 1X3NA 1C1CA 5M1PA 4AHRA 3QINA 1YAGA 4BR5A 2WUSA 1Q8IA 5JICA 1ZBHA 1BHLA 2I5JA 4I6MB 4GY2B 5AQIA 3SAGA 2Y1JA 2YNIA 3AVIA 4NXNK 2HOEA 1CZAN 3VEXA 4UQGA 4M3YA 1BI4A 2G8FA 4DUYK 2W40A 1FKOA 3MX2A 2XY8A 2DFEA 2G8KA 2E6LA 2F9TA 5KI6A 1F21A 3QEIA 3KLGA 4JK9A 1RTIA 4FM0A 2P51A 4JKEA 4Z4IA 3EZWA 3BZCA 1VQNN 3ENBA 2DFHA 3THWA 4QAGA 4QS8A 3KTQA 3AO5A 2HHXA 5TKYA 3LALA 3I0RA 4FWKA 4Q5VA 4DS5A 3ZCMA 4FJHA 3LWMA 3HOSA 2FC0A 2AP1A 2XY5A 3K57A 1S9EA 3HZ6A 3LM9A 3D2EA 3C7NB 1MDUB 4HCBA 1LCUA 1W7AA 1HNIA 5DM6L 5AQFA 4AM7A 1OKJA 3SQ1A 5CZ1A 3NH1A 5AZIA 1IH7A 1VSIA 3PY8A 2BGGA 3E01A 1O13A 3HSCA 4DMNA 4W5OA 1C0UA 2YHBA 4L3QA 5K14A 1HUXA 1GLEG 4FOEA 4CJVA 4JD2A 3V81A 4XH5A 3VQ5A 4DTNA 2CGJA 2CGKA 3VF6A 3J8AA 4MDBA 2HHHK 1ILYA 4OPKA 1IO2A 5FRMA 3OHRA 4WQ4C 3GE1A 4LF9K 5TKWA 3S3OA 4GV6A 1RFQA 1TYQA 1NMDA 3C94A 4CGIA 3UE5A 1RT2A 2P9SA 3OYAA 1X9WA 1HMVA 3L6QA 3ZSWA 1TUYA 1A5WA 4RW6A 1YVNA 3DJCA 1QHTA 1FKPA 1J53A 3CQ8A 3LAMA 3CCVN 3ZSYA 2NRHA 1XC9A 4DV6K 3SMPA 4ELTA 1E4GT 3CJCA 2YX6A 4H5TA 4IG0A 4A61A 1YI2N 3S3NA 3QMLA 1CXQA 3AY9A 4JN4A 5JS2A 4LFCK 3DLHA 2ZD1A 3VEWA 1WN7A 4DR4K 4G1QA 5KGXA 4C8OA 3H45C 3H1VX 1XMOK 1NJYA 2KQ2A 2RN2A 3BF1A 3CM5A 4DSLA 4E7IA 3LDOA 3KJVA 4N5SA 4CK2A 3OJUA 4WF9L 1NK0A 3T1YK 3O5BA 2Q2RA 3VGLA 3V4IA 3R8EA 3K9KA 4CK1A 3OYGA 2UU9K 1KVCA 1TUUA 1BCMA 2BTFA 4KPYA 1NK5A 5AQOA 3IAYA 3ZX3A 3AO4A 1RTJA 4CZMA 1ZBLA 3I8BA 1CXUA 2EHGA 2YHXA 1TV6A 2E20A 3V1OA 4CERA 2ZE2A 3V6DA 3RSEB 4PL8A 2EWSA 3EO3A 4Z4GA 4X66K 4BDZA 3SPYA 5JVGL 3MN9A 3MX5A 2YCHA 4FWMA 5AQGA 3OYEA 1SS6A 3ZT0A 3U9ZA 5HROA 3L2QA 2IS3A 3OJSA 4JYAK 5C2FA 3J7YP 4KB1A 1O1WA 4BC3A 1BWFO 3NF7A 3HRGA 3L0QA 4RCHA 2V7ZA 3OYHA 4BGBA 1QQOA 3CYMA 3O08A 3B6OA 3CQYA 1HPMA 1VSDA 1N6QA 3B8AX 3M8RA 1CZBA 2YHYA 3C6AA 1WAJA 2P9LA 3O9RA 2DFFA 3M8PA 3MK6A 1M1KO 3MN5A 5EVZA 2P9IB 4M3RA 3NH2A 3SUPA 1V4TA 2WONA 1BIUA 2ATQA 1LWCA 5D3GA 3FZMA 1C0MA 1KVBA 1W97L 1CLQA 2E8AA 3SJJA 4B08A 3QNOA 1NGCA 2X6SA 4IG3A 2D5RA 3LZIA 1T8EA 4CK3A 3AA2A 1VSFA 4J2EA 4PL7A 4KFBA 1VRTA 3VA0A 4W5TA 3PO5A 3SV4A 5E41A 2ZJPL 4OPAA 4LSLA 4AHUA 3AVHA 3AVKA 1D4XA 4WQ5A 4A5BA 1HQUA 3O1WA 3T69A 1N34K 1Y64A 5M1FA 2BUPA 2B6AA 2W42A 1HYZA 1XHXA 1S1TA 1C1AA 1YTUA 1NGAA 5KGWA 3H3OB 3CMEN 1K8KA 3P5JA 5AZJA 1D8YA 2R7YA 4BROA 3F2KA 4B8CA 1TVRA 2P9UA 4Y1DA 3NF6A 4CJFA 4CHYA 4CHZA 4Z0UA 4Z4FA 2QWQA 1I94K 1S6PA 4FWSA 3NF8A 3EYZA 4JS4A 4OO1J 3TAPA 4IFVA 1KSPA 3DXKB 4LF6K 5BREA 2O8CB 4KH5A 1BCOA 2VYPA 4BR7A 1JXEA 3RMDA 1SKWA 4KH4A 1X9SA 1KXPA 4BDYA 1U45A 4B1ZA 1JLFA 1R59O 4AHSA 3BEXA 3CJBA 3PSIA 1N8RO 1BDGA 3DOLA 1NJIO 3NHGA 3G25A 4CFBA 4JHDB 3DYAA 1SUQA 2P9KA 4YDUA 1J6ZA 4Z94A 2WOMA 5GAEP 1Z26A 4DV1K 5LJWA 2A6AA 2HNDA 2VGMA 1L3SA 1U2VB 5T7BA 5BPNA 2Z1JA 3G6EN 2Q36A 1VSJA 4DB3A 2J4RA 2KZZA 1GLFO 4H4MA 1NGIA 4E1NA 5AQSA 3J81O 4F2SA 3J80O 1OVQA 3MN7A 4B3RK 2A42A 4JEPA 4JKFA 3ITHA 4AHTA 2ZWHA 3L2UA 3V9WA 1XI1A 3D45A 3TTCA 4W5NA 2QM1A 4BRIA 2RE2A 4EIAA 1ASUA 4CJQA 3KLHA 3C6HA 4E1MA 4EP5A 3R9PA 5AQNA 2E6MA 3AAPA 4BRAA 3ENHA 3TTFA 1K8AO 2O8FA 2KTQA 3NDKA 5HLFA 2VG7A 4HVJA 4IZ9A 5IWAK 3F5TA 3WQTA 4H4OA 4PQUA 2UXCK 1R0AA 2HW3A 4BRMA 3C6TA 3ZSVA 1QQNA 3VETA 3VN5A 4H03B 4I9QA 2Z1GA 4B9LA 4FCYA 1VQON 2DPNA 3AVGA 2FBYA 3CC4N 2F8TA 4DKWA 1DKGD 4DF8A 4CBUA 2HBMA 2HMIA 4PHTX 3CC7N 4HCCA 3T1AA 1QE1A 3THWB 4LH4A 2YJFA 1YJ9N 3LDPA 3V9XA 1NNEA 4M63C 4CEDA 1KFSA 3P38A 1IV0A 4FLVA 3BUZB 3RMCA 1LOTB 3VGMA 4BRKA 4ICLA 3CCUN 1GOCA 4XH4A 3VOVA 4OGEA 4DF4A 4GKKK 2KKZA 4JKBA 3D2EB 2E88A 4W5QA 1OH6A 1WB9A 4DHYA 1NOZA 3SMSA 2JLEA 4E1JA 1LWFA 1TAQA 4CJ4A 3JAMO 4CEAA 4RTFD 2HBKA 3HPGA 1VAZA 4OPJA 4XEIA 5AZIB 3ID8A 3DAWA 3KK3A 4CJPA 3AVAA 3HOTA 1E3MA 4BRPA 4NCAA 5I3UA 2QEXN 1I3AA 4DTOA 2WC9A 3K5MA 4BRHA 4JD2B 4RW8A 1UOCA 4O8KA 4OKKA 3PO4A 1SZ2A 5AQRA 3VQQA 4CJEA 4FYDA 2NLXA 2UUAK 1TYQB 5HRSA 5FPEA 4HUFA 3WEEA 1YHQN 2P9SB 3JXUA 4OPHA 3LZJA 3I8DA 2P1JA 3BP8A 1RBUA 2ZQBA 2OTJN 1KAZA 1RT6A 1ITGA 2GELA 1YIJN 1BISA 3NF9A 1QVGM 4JK7A 4DFKA 4DV3K 2HBJA 4MFBA 1QQMA 1D9DA 3NVKA 2WFBA 3O4NA 4FW1A 2QW9A 3P83D 3HI0A 3GBTA 1HJOA 2GV9A 4NYFA 2VQFK 4DR3K 2QWOA 4N76A 4B8AB 3DI6A 3NH0A 2HHSA 4GW6A 5HL7L 3O3FA 4FO0A 3RVCA 1UWBA 4PKIA 3VEYA 3SLCA 4PWDA 1YTAA 3CERA 5DMRA 4KHSA 2B4JA 2ASOA 4FJJA 2XY7A 3NMUA 1SV5A 1HR0K 4EZ9A 1ZBIA 1S1UA 2YKMA 3DRSA 1WSEA 4CJ5A 3TAGA 4RW7A 2AA4A 2D0AA 5CY4A 1K6YA 4FZZA 4I7FA 3E66A 4F8RA 5AQWA 3VF2A 4W5RA 4B9MA 4DU3A 3KWGA 1GLAG 1NLVA 3ULEA 2G8WA 4FK4A 5B8HA 3CD6N 4M3UA 1B9FA 1RILA 2QXFA 3CG7A 3PX4A 5E26A 4K42A 4B1XB 1Q18A 1RT7A 4CGFA 1YF5L 3MEGA 3B6PA 3TPQA 5FLXO 3NGIA 4F2RA 1DTQA 1HYVA 3QB0A 4IWVA 1IBLK 4BRFA 4KHWA 2O8EB 1DT9A 3W3DA 4DV2K 4AHCA 4CBWA 5BR9A 4ISGA 3AVMA 4AQYK 3QBXA 3K5NA 3GDQA 5I42A 4CZGA 4ZTJA 1EKEA 1U04A 1N5YA 3L4IA 3SQ2A 4JS5A 1TKDA 3G10A 3KK1A 1XNRK 2HVHA 1RBVA 5J2MA 4CBXA 3V1QA 1HQEA 4RWTA 2P9LB 1K9MO 2PYLA 5CYQA 4CGGA 2IVOA 1MA9B 3AO3A 4FLWA 1XHZA 2JWLA 1T05A 5LY3A 4KTZA 5BN8A 1OVYA 4ID1A 1RBTA 4KI4A 4AHVA 1JL2A 3OYFA 1IBMK 1I39A 1BO5O 4EP4A 3ZEUB 3WT0A 3G4SN 4H5VA 3D2FA 4OX9K 2O4IA 2Z1HA 4GVEA 3VQ6A 2F8SA 3OVNA 4I9LA 1RDBA 1ZBFA 3SZ2A 4CF8A 1X9JA 5AQPA 2YNHA 2W41A 2PFUA 4QS7A 1K8KB 3T3FA 3O9QA 4V19S 2FBXA 1QHAA 3TANA 5AQZA 1ATNA 4K0KK 2P9UB 2VG5A 4CEQA 5M1NA 4CJKA 4WE1A 1RT4A 2P9PB 4DSFA 3ZT4A 3Q7CA 1S6QA 4BRNA 4C1NI 3WNGA 5SZTA 4NCBA 4CGJA 2KLAA 3DLGA 2NRTA 3DRRA 4BR4A 2YJEA 5E84A 3VQBA 1TKZA 1QVFM 2X78A 1OH8A 2HSTA 3ZSRA 4C1NK 5J1EA 1GLCG 4CEZA 3NBPA 5EOYA 3AA3A 3CETA 5AQUA 3O9SA 1WSHA 4BR2A 4WFNL 5HBMA 4C8NA 3HVRA 1SL0A 4LF5K 3I0SA 3LDLA 1P90A 1VQMN 4JI3K 4IFEA 4K43A 1FJGK 4R5PA 1YT3A 3HM8A 4CZLA 4GKJK 1RDDA 1VQPN 3RR8A 4PUOA 4ELVA 3M8SA 2GUPA 4DU1A 3QFPA 4CHOA 3QIPA 5BRFA 4FM1A 4K25A 1J5OA 5EU7A 1EP4A 3GL1A 3VQ9A 2XHBA 3DLEA 3ZX2A 3CPEA 1S22A 4CECA 1IJJA 4ZHRA 1NG9A 1EWRA 1IG8A 3GOIA 3ZSOA 1NKBA 4E3SA 4E0DA 3FE1A 2E2PA 5AQHA 3IRXA 3DLRA 3FZFA 4A62A 4J2AA 4BRLA 3RMBA 3K5LA 4XIUA 3CHWA 4FLYA 4U7BA 2QWLA 5GINA 2ETJA 4OLAA 1X3MA 1JXBA 4L8RB 3L3UA 3ZSZA 3A5MC 1QZ5A 1C0TA 4BC4A 3FZKA 3KLEA 4H0YB 5FPNA 3EKUA 3OYCA 4IJAA 3ZSQA 1JLEA 2FF6A 4YOYA 4CF0A 3A5OC 4NLBA 1FXXA 1NK7A 3LL3A 2HF3A 4CZEA 2A40A 2QTDA 2GBZA 3V1RA 4FWRA 2IAJA 3O6WA 3IDHA 1Y97A 4B9UA 2YI1A 4KHNA 4M7YA 3CCRN 3DLKA 5KTQA 1RDAA 3G71N 2NRZA 5AQKA 4C23A 3NE6A 2GX9A 3IS9A 2NZTA 3NCIA 4BRGA 3THYA 1A5VA 4JNEA 1BQMA 5BR8K 3OYNA 4A57A 1VQ8N 3RR7A 3UKUA 1RNHA 5KQ8A 1BL3A 2F4VK 4BRQA 2FSKA 3CJ1A 4N41A 3L3VA 3ZYYX 3ZSXA 1BGXT 4HUEA 2FF3B 3E1YA 5AQJA 1NKEA 1C1BA 1T3VA 1TGOA 5KRSA 5LL6Z 3MCPA 4J2DA 3MN6A 2P5GA 1VQ9N 2E2QA 1EO1A 3RTVA 1RBRA 3AA4A 3LP2A 3TAFA 1WSJA 4UY8O 1IKYA 4B9TA 4BG9A 1L3TA 1IKVA 1JLGA 1RDCA 2A41A 1OH7A 1UAXA 4O5FA 4CVNE 3F9KA 3O4QA 3SAFA 3LDSA 3CJ9A 5LMUK 3WEEB 3VESA 1RDUA 4DR1K 4Y1CA 4BWJA 4JI1K 3A5LC 3P4IA 2ITMA 1D9FA 3LPTA 4DLEA 3SYZA 4HUGA 2OPRA 2PBDA 4IOAL 3OYBA 1KCFA 2A1SA 4NYNA 4PKGA 4DFJA 3QNNA 1J5EK 3OYIA 3T1HK 4FJ5A 4O8UA 1U4BA 3TSPA 4WFBL 4IEIA 4AH9A 2UXDK 2FXUA 3EKSA 4CE9A 2F9WA 4H0PA 2ASMA 5GIOA 3CCJN 2E4LA 4CIEA 3THXA 4Z4HA 4JKHA 1RCHA 4H5NA 5AFUH 4FWLA 4MLEA 4OGCA 4ELUA 4B3OA 3SUQA 1DTTA 2JGUA 5J2QA 2OPPA 3IUCA 4FVUA 4F4KA 1YITN 3C65A 5M1QA 5BRHA 3M6GA 3HPOA 5HOOA 3M1FA 3SV3A 1BA0A 4CEOA 4M3ZA 3S9HA 5F0XA 2OTLN 3QICA 4WCEL 2HHWA 3WNHA 2QI2A 2RKIA 1TK8A 4FZYA 3O3GA 3VENA 3ULEB 3HL8A 1ZXOA 3ATUA 4DR5K 1A5XA 1HRHA 1HPZA 3E9PA 5M1KA 4X65K 2P9NA 3QEXA 4E7LA 1NKCA 4DSKA 4CJWA 3HJFA 3PUFA 3L2RA 3UB5A 2IC3A 4B3TK 4BGAA 5BPMA 3J7ZO 2AJQA 1NK8A 4CJLA 4MQ3A 4JK8A 4DTUA 4JRQA 1OH5A 3BDPA 3SK3A 3LWLA 4CJSA 4DG1A 3ID6A 4E7JA 4DV7K 3TABA 1L3VA 2D4WA 1MU2A 3L4QA 3CF5L 3F73A 3AVJA 4WQ5C 4FJGA 3CCLN 2IGIA 4IOXA 4ISEA 1EQYA 4CJTA 2I7NA 2E2OA 3ZT3A 1GOBA 3DWLA 3KZBA 3EE8A 5GIPA 3D0PA 1VQ4N 2VWKA 3WNEA 5GAHP 3NFAA 1QTMA 2GTDA 2ZF5O 2QWNA 4H0TB 2QA4N 1LAVA 1KVAA 4A5AA 4QS9A 3HVTA 1XC3A 3HP9A 4N56A 1BI4B 2OCEA 5C2DA 1JL1A 4LC9B 3WUHA 4K8XA 4JRPA 3QO9A 2JWKA 3OYDA 4FJ8A 1WAFA 3ZLJA 1TKTA 4EFHA 2F7TA 4CJRA 4HTLA 2O4GA 4B3SK 4G9ZA 3HYFA 2FSNA 4CIGA 3PV8A 4DU4A 3U9DA 3VEVA 4IDKA 3K59A 1KFDA 2QKKA 3PX6A 2VWJA 2D1KA 3L2WA 5CYMA 1GLJO 4RG8A 3SQ4A 5AFUA 2NUBA 3VQ8A 4BC5A 1GLLO 4DTXA 3ENOA 3CFRA 1ZBSA 2Q0UA 4H0XB 5AR0A 3THVA 2OPSA 4DWIA 4H5WA 2KFNA 4NCGA 5JVHL 4KO0A 3BF3A 1K73O 2HMPA 4B3MK 1ZC6A 2UUBK 1HNXK 2V51B 5KQDA 3VF4A 4KTQA 4A2AA 1REVA 3PX0A 5C25A 3OS0A 3DLLL 3OBWA 3QBWA 2O8DA 1YUWA 2EX3A 3RRGA 3WXKA 5DM7L 3FR0A 4LF8K 4O0JA 5AQXA 4F3TA 4FJMA 2G8IA 4JLHA 1VSKA 3DLBA 3EEQA 2UYTA 4ILHA 4YOUA 3OYLA 5A2QO 4FWQA 1T7PA 5I9EB 2RHKA 5H1SQ 4CZJA 3AA5X 3DXMA 3OYKA 3O9UA 3T7ZA 4LF4K 4OLBA 4BRDA 4FK0A 3R1XA 4KRFA 2ASPA 3U3GA 4FJ9A 3AV9A 3LAKA 2DTUA 1FK9A 3CCEN 4X64K 3ALYA 4BG8A 1NGHA 5HRNA 4CJ7A 2W6LA 1YJNN 3IKMA 1TL1A 2YHWA 4FM2A 3EL2A 5KPZA 3KHYA 1ZBUA 2PAVA 4WYBA 5GAGP 4LSNA 5LJVA 3RRHA 2I7PA 3SBTA 1GLBG 3VQ4A 4DR6K 1Q86O 3NGZA 3TTDA 1V4SA 4LFBK 3ZETA 2E1ZA 3VEOA 3LDQA 1VK0A 1Q7YO 3THYB 3MEEA 4DQ8A 2DY4A 3U8XA 3U6FA 3HT3A 4DFPA 3AARA 3UKUB 4YOWA 3VQAA 3LP0A 1S1VA 3R3LA 4CEFA 2XY6A 2Y1IA 4IOCL 2QXLA 4E7KA 1BA1A 1GOAA 3PIPL 3WXJA 4DCHA 1KRPA 4M41A 3E9LA 2GWJA 3HPHA 4EAHD 3TAMA 5HP1A 5LMNK 4JHDA 4B9NA 3LM2A 3N4PA 2X74A 4CGDA 1S1WA 1T44A 2GWKA 3K2PA 1NJZA 3CPWM 3OYJA 1G15A 3LPUA 3CCQN 2XRIA 3U4LA 5JS1A 4FLTA 2GEMA 3QESA 4EZ6A 5F1XA 4JI4K 2A1RA 4C8MA 4O4GA 5IT9O 4TSXA 1JCFA 4FPBA 4XH1A 1NGBA 3CXCM 4FJ7A 5BPLA 3VQEA 5BRDA 3AVCA 5BN9A 4IJNA 4IO8A 1SAZA 4KBOA 2IIRA 4Q0BA 3CCSN 4PA1A 3I56N 2YV0X 4I2QA 1NK6A 2PY5A 2IDOA 3JS6A 2QWRA 4DSJA 5CR4A 2VQEK 1S1XA 4BRCA 2VGNA 3EE9A 3CM6A 2Q0RA 1LV5A 4GV3A 3G0ZA 3W0LA 1EX4A 4PKHA 4CFDA 4FWNA 4GV9A 3VTHA 1B9DA 1XWLA 1VSEA 1TKXA 3KVGA 4IXCA 4WQ4A 3WNFA 3H08A 4FW2A 3FZLA 3THXB 1S9GA 2Q31A 5AZJB 4QOZB 5AQQA 4AM6A 4BVOA 2PYJA 2Q3SA 2YNGA 4KHUA 1VHXA 2WTUA 4C8LA 3CI5A 1RDWX 3O3HA 3MWTA 3QETA 4M7XA 4CI6A 1KC8O 4BDPA 1YVUA 3OY9A 1NMNA 2YKNA 5GADP 5KPRA 4LH5A 2O8BA 1N33K 5C12A 1DEJA 4GMJB 4YOXA 4MO5A 3AVFA 3TSUA 1QSSA 5FPMA 4B1VA 1S5JA 3I33A 5AJ3K 3LP3A 2OZMA 1N32K 1M90O 3O4WA 2BDPA 2W6KA 3MXJA 2QWMA 3AO1A 4IO9L 1Q82O 4CHPA 2P9NB 2HHVA 4FWPA 3MDQA 4OKJA 4K41A 1HKBA 3SBGA 2OZSA 4CHQA 4BVPA 2NRXA 1HJRA 2P9KB 2VG6A 4J8FA 5EX5A 3KLFA 4CJ3A 4CEBA 3KD5E 4FJNA 3PLAA 1EETA 1NGDA 2OYQA 3LP1A 1RBSA 4LY7A 4HWIA 3OS1A 3VTIA 4E89A 3P31A 1NJWA 2VCPA 4NLCA 1BUPA 1U47A 4YOVA 3V9ZA 3QEPA 4MO4A 1EXQA 5HRRA 4DR2K 1X9MA 1XUPO 3O8MA 1RT1A 3QEWA 2YHAA 1JCEA 1JLBA 2QK9A 2G8VA 4KHPK 4CJUA 2NRWA 2FBTA 4DV4K 4M3WA 1NGEA 3ISNC 2O8FB 4DV5K 3JYTA 3KKSA 1VQ5N 1SQKA 3H46O 3VPZA 4JI2K 1EWQA 4FSVA 3UKRA 1HNZK 4ID5A 3MCAB 4I2PA 4FLZA 3MMVA 2HBLA 4J2BA 1NJXA 1DGKN 4KH6A 3ZT2A 4FL9A 1C0FA 3PSFA 1Q9XA 4KB0A 1JLAA 2Q97A 3ULDA 3WQUA 2VWBA 3EN9A 3MXIA 3SJHA 1VSMA 1NGGA 3DOKA 3SUNA 3HM9A 4NB4A 4OVLA 4WFAL 3U3YA 3HSTB 4CEEA 1T03A 3IG1A 4BR0A 3K0SA 4CFCA 3VQDA 1NU0A 4CGHA 2E1YA 4JI7K 4FJIA 1C0GA 4CZKA 3OS2A 1Q9YA 2QWPA 3PIOL 4M45A 3VQCA 2KFZA 5C10A 4FWOA 1T6DA 1YJWN 3ZT1A 3AGKA 4JKCA 3AVLA 2P5OA 3D6RA 4DSIA 3C0BA 4FXDA 2HVIA 1YXQA 1RTHA 1NK4A 2E5LK 3DMJA 4FLUA 4EHUA 3V9UA 3NAEA 2HHQA 2CH6A 5AQLA 1S72N 1W9HA 2ZJRL 4YOTA 3TWHA 4JI5K 1QS4A 3VMFB 4X62K 1WLJA 4A59A 4AF1A 1ATSA 1S3XA 4DQQA 4AILC 2G8UA 3UIQA 4B9VA 2O8EA 3NGYA 1W2BM 1C6VA 1LW2A 2RPIA 1HYSA 2LSNA 2YNFA 1QZ6A 4BY9C 3SI6A 4DTSA 4BC2A 2H3GX 1SL2A 4CZFA 3LDNA 2O8DB 1BQNA 4FLXA 1JCGA 3H1QA 1KD1O 4M42A 4JKDA 3MXMA 4JKGA 1G99A 3M8QA 4B1WB 1IKXA 4YY3K 1L3UA 3ASMA 3CMAN 4H8KA 4I6MA 3AGRA 3DXMB 3BY5A 3A8YA 1NM1A 3ZX0A 1W0HA 4H0OA 2KZMA 5JLFA 3VGKA 1DLOA 4CF2A 5EXWA 2NNWA 3AAQA 4O0IA 4DTMA 4CZIA 3H6EA 3ZEUA 2V52B 5J2NA
chains in the Genus database with same CATH topology
1GLJO 3DJCA 3IFRA 5AFUA 3QBXA 3CCVN 2NRHA 3GDQA 4BC5A 4CZGA 1GLLO 3SMPA 1Z6RA 1E4GT 3CJCA 2YX6A 3L4IA 4H5TA 3ENOA 1ZBSA 1E4FT 2Q0UA 4A61A 1YI2N 3CJAA 3QMLA 4CD3A 4H0XB 3VERA 1MWKA 3AY9A 5AR0A 4JN4A 3ZETB 4CBXA 1VQLN 3VEWA 3WXMB 4RWTA 2P9LB 3FFKB 2NRRA 1K9MO 3CJ7A 4H5WA 3H45C 3H1VX 2IVOA 2P9PA 3O9TA 5JVHL 3QDKA 1MA9B 3BF1A 1Z05A 2ZGZA 3BF3A 1K73O 2JWLA 2HMPA 4CD1A 1BOTO 5LY3A 5BN8A 1OVYA 1T6CA 1ZC6A 5EY4A 2A5XA 3LDOA 2V51B 1H1VA 5KQDA 3VF4A 3C7NA 4WF9L 4A2AA 1NGFA 5M1OA 4IEEA 3OW2M 5AQTA 3O5BA 2Q2RA 3VGLA 1BO5O 1WUAA 3R8EA 3K9KA 5ADXH 3OBWA 3QBWA 3WT0A 3ZEUB 5C15A 3DLLL 1YUWA 3G4SN 3WXKA 4H5VA 5DM7L 1TUUA 2BTFA 3D2FA 3FR0A 5AQXA 3SAHA 3E9OA 5AQOA 4GVEA 4H5RA 3ZX3A 4CZMA 1U6ZA 2UYTA 1X9JA 3I8BA 2KHOA 4GNIA 2YHXA 5ELZA 4ILHA 5AQPA 2E20A 2W41A 3FLCO 4YOUA 3A5NC 2PFUA 4QS7A 1K8KB 3O9QA 4FWQA 3RSEB 4B1UB 1QHAA 4PL8A 2EWSA 3EO3A 3FGUA 5AQZA 2RHKA 5I9EB 5H1SQ 4CZJA 3DXMA 1ATNA 3O9UA 3T7ZA 1MWMA 2P9UB 5M1NA 5JVGL 1VQ7N 3MN9A 4B1YB 3MX5A 2P9PB 5AQYA 4BRDA 2YCHA 3R1XA 4BQZA 4U67L 4FWMA 2ASPA 5AQGA 1SS6A 3Q7CA 3U9ZA 4BRNA 3CCEN 4C1NI 5C2FA 5C0YA 4BG8A 2KLAA 1NGHA 1HLUA 4CJ7A 2NRTA 4BR4A 2YJEA 5E84A 1BWFO 3IKMA 2YHWA 4BC3A 3EL2A 3HRGA 3L0QA 3KHYA 4RCHA 2PAVA 2V7ZA 4WYBA 5GAGP 5KPZA 5LJVA 1Q81O 1QVFM 4BGBA 2I7PA 2HSTA 3SBTA 4C1NK 1GLBG 1GLCG 1QQOA 3O08A 1Q86O 5EOYA 3TTDA 4H0VB 1V4SA 3D2FB 3CQYA 3CIPA 3CETA 1HPMA 5AQUA 3O9SA 3ZETA 2E1ZA 2HF4A 3VEOA 3B8AX 4BR2A 4WFNL 2YHYA 1NWKA 3LDQA 3C6AA 2P9LA 3LDLA 3WXIA 1P90A 3A0IX 1Q7YO 3O9RA 3MK6A 1M1KO 1VQMN 3MN5A 1BG3A 2A3ZA 4MDAA 4IFEA 2P9IB 3R6MA 4K43A 5EVZA 4DQ8A 3D7EO 4F9OA 3U8XA 1V4TA 3HM8A 4CZLA 1ESVA 3FZMA 1VQPN 3TU5A 1W97L 2GUPA 2E8AA 3AARA 3QFPA 3UKUB 3O1BA 4YOWA 2CH5A 4YDUC 4JAXA 5BRFA 1NGCA 3R3LA 4K25A 4IOCL 3GL1A 3QFUA 4PL7A 2QXLA 3KK7A 5AQMA 3ZX2A 1BA1A 3CPEA 3ATVA 3PIPL 1S22A 3N4QA 3MWPA 1IJJA 3NVMA 4OPAA 3WXJA 2ZJPL 1IG8A 3GOIA 4DCHA 1D4XA 3E9LA 4WQ5A 4A5BA 3FE1A 2E2PA 3O1WA 4MLHA 5AQHA 3T69A 2GWJA 3FZFA 1Y64A 4A62A 5M1FA 4BRLA 2BUPA 1XQSC 3S41A 4EAHD 4JHDA 3LM2A 2NRVA 3N4PA 1T44A 2GWKA 3CHWA 3HBTA 3CPWM 4U7BA 1NGAA 2QWLA 3H3OB 5GINA 3CMEN 1K8KA 3CCQN 5AZJA 3RSEA 1X3MA 3U4LA 4BROA 5JMVA 3A5MC 1QZ5A 2E2NA 4BC4A 2GEMA 3FZKA 3F2KA 5F1XA 2P9UA 2FLOA 3OA9A 4H0YB 5FPNA 3EKUA 2QWQA 1KAYA 1JCFA 1TUYA 4FPBA 4IJAA 4XH1A 5MLCQ 1NGBA 3CXCM 4FWSA 5BPLA 2FF6A 4YOYA 5BRDA 2CGLA 5BN9A 3A5OC 2D0PA 4IJNA 4ISFA 4IO8A 1SAZA 4NLBA 4EHTA 1KQSM 4KBOA 2IIRA 1VQ6N 4YORA 2BH1A 3CCSN 3DXKB 3LL3A 3I56N 2HF3A 4CZEA 5BREA 3O80A 1ATRA 2A40A 2IVNA 2QTDA 4KH5A 3JS6A 4BR7A 2VYPA 4FWRA 2QWRA 5CR4A 3O6WA 3IDHA 4IDHA 4B9QA 2YI1A 4KH4A 4BRCA 1BU6O 1HX1A 1KXPA 4M7YA 3CCRN 2VGNA 4B1ZA 1R59O 3EE9A 1NGJA 2Q0RA 3G71N 5ADXA 4GV3A 3BEXA 3CJBA 1N8RO 1BDGA 3W0LA 2NRZA 4PKHA 1NJIO 5AQKA 4C23A 2GX9A 3G25A 2NZTA 4FWNA 4JHDB 4Y0WA 2IVPA 3VTHA 4R79A 4GV9A 4BRGA 3KVGA 4IXCA 4WQ4A 2P9KA 2P9IA 5AQVA 4YDUA 1GLDG 3FZLA 4A2BA 1J6ZA 4Z94A 2Q31A 5AZJB 4JNEA 4CZHA 5AQQA 1RGIA 4AM6A 5GAEP 4BVOA 4A57A 5LJWA 2A6AA 5CHIA 1VQ8N 2VGMA 1U2VB 2ZGYA 3UKUA 5KQ8A 2ZJQL 3F9MA 3CI5A 1RDWX 5BPNA 3MWTA 4BRQA 4M7XA 3G6EN 4CI6A 2Q36A 2FSKA 1KC8O 3CJ1A 4DB3A 2J4RA 3KWIA 3ZYYX 1GLFO 3H3NO 5KPRA 5GADP 1NGIA 2FF3B 3E1YA 5AQJA 5AQSA 5C12A 1DEJA 3UKRB 5FPDA 4BQLA 4YOXA 3MN7A 4MO5A 2A42A 5JLHA 1T3VA 4JEPA 4JKFA 3TSUA 5FPMA 3K9JA 3MCPA 3TSQA 1HKGA 4B1VA 2ZWHA 3I33A 3MN6A 1VQ9N 2E2QA 3TTCA 1EO1A 2QM1A 4BRIA 2RE2A 4EIAA 4BR9A 3O4WA 1M90O 2OANA 4UY8O 2QWMA 4IO9L 4NO7A 1Q82O 2P9NB 3C6HA 4FWPA 3MDQA 3R9PA 5AQNA 4K41A 1HKBA 3SBGA 3AAPA 4BG9A 2A41A 4BRAA 2FSJA 3ENHA 3TTFA 4BVPA 4O5FA 1K8AO 2NRXA 2P9KB 3FZHA 4IZ9A 3SAFA 3CJ9A 3F5TA 4J8FA 5EX5A 3WQTA 3WEEB 3VESA 5CE3A 1RDUA 4BRMA 3PLAA 2D0OA 1NGDA 1VQKN 3A5LC 1QQNA 3P4IA 2ITMA 3VETA 2Q1NA 4H03B 4HWIA 4FPAA 2PBDA 3VTIA 1VQON 4IOAL 1JJ2M 2DPNA 3DXKA 3HTVA 3P31A 3CC4N 2VCPA 4DKWA 4NLCA 4PKGA 1DKGD 1BUPA 4CBUA 2HBMA 4YOVA 3P39A 1HKCA 2V7YA 4PHTX 4O8UA 3CC7N 4MO4A 4BREA 3TSPA 4WFBL 2YJFA 1YJ9N 3LDPA 4IEIA 4M63C 3P38A 1XUPO 3O8MA 2FXUA 3EKSA 3BUZB 1LOTB 3VGMA 4BRKA 3CCUN 2F9WA 4H0PA 4XH4A 2ASMA 3VOVA 4ILGB 5GIOA 3CCJN 4OO1J 1JCEA 3GG4A 4JKHA 4H5NA 3CCMN 5AFUH 2KKZA 3OBYA 4JKBA 2NRWA 4FWLA 4MLEA 3D2EB 2E88A 1P8ZA 1NGEA 1KAXA 1U2VA 4DHYA 4JKAA 3CQXA 3SMSA 4E1JA 3IUCA 4FVUA 1WOQA 1YITN 4ILJA 3C65A 5M1QA 1VQ5N 5KPTA 5F2RA 4RTFD 2HBKA 5BRHA 3M6GA 1NBWA 3I55N 1SQKA 3M3ZA 5HOOA 3H46O 1VAZA 3M1FA 4XEIA 3VEZA 5AZIB 3ID8A 3VPZA 1BA0A 3CC2N 3DAWA 2WBNA 3IMXA 4FSVA 3UKRA 3MCAB 5F0XA 3Q7BA 3WXLA 3HOTA 2OTLN 3MMVA 2HBLA 3QICA 4FOIA 4JKGB 4WCEL 1DGKN 4KH6A 4BRPA 3M5RA 2QI2A 4FL9A 1X3NA 5M1PA 2QEXN 1C0FA 2WC9A 3VENA 2Q97A 4BRHA 3ULEB 3WQUA 4JD2B 2VWBA 3EN9A 1ZXOA 1YAGA 3ATUA 3SJHA 2WUSA 4BR5A 5JICA 1NGGA 4O8KA 3E9PA 5M1KA 4I6MB 4NB4A 4WFAL 2P9NA 4GY2B 5AQIA 1SZ2A 5AQRA 4BR0A 3SAGA 2HOEA 2E1YA 3UB5A 1CZAN 1C0GA 2NLXA 3VEXA 4CZKA 1TYQB 1YHQN 5FPEA 3WEEA 2P9SB 3JXUA 4OPHA 4BGAA 5BPMA 3J7ZO 3BP8A 2QWPA 3PIOL 2OTJN 5C10A 4FWOA 1T6DA 1YJWN 3AGKA 1KAZA 4JKCA 2W40A 4JK8A 3D6RA 3C0BA 3MX2A 2GELA 1YXQA 3SK3A 1YIJN 3ID6A 4EHUA 1QVGM 2F9TA 4JK7A 2D4WA 3L4QA 2CH6A 3CF5L 2HBJA 5AQLA 1S72N 4JK9A 2ZJRL 4YOTA 1QQMA 3NVKA 4JKEA 2WFBA 4WQ5C 3CCLN 3EZWA 2QW9A 4IOXA 4ISEA 1EQYA 1VQNN 3ENBA 3VMFB 3HI0A 2I7NA 2E2OA 4A59A 3DWLA 3GBTA 3KZBA 3EE8A 4QS8A 5GIPA 1HJOA 5TKYA 4AF1A 1ATSA 1S3XA 2QWOA 4FWKA 1VQ4N 3HOSA 5GAHP 2AP1A 5HL7L 1W2BM 4FO0A 3RVCA 3HZ6A 4PKIA 3LM9A 3D2EA 3VEYA 2GTDA 3SLCA 1QZ6A 2ZF5O 3CERA 2QWNA 4BY9C 3C7NB 1MDUB 1LCUA 4H0TB 5DM6L 2QA4N 4BC2A 2ASOA 2H3GX 5AQFA 4A5AA 4QS9A 4AM7A 1XC3A 1OKJA 4CZFA 3LDNA 3NMUA 5C2DA 1JCGA 5AZIA 4LC9B 2AA4A 3H1QA 3WUHA 1KD1O 2JWKA 4JKDA 1O13A 3HSCA 4JKGA 1G99A 3E66A 5AQWA 3VF2A 4L3QA 3KWGA 1HUXA 1GLAG 1NLVA 1GLEG 4B1WB 4FOEA 3ULEA 4JD2A 5B8HA 3CD6N 4XH5A 2CGJA 3CMAN 4EFHA 2F7TA 5E26A 2CGKA 4HTLA 4K42A 4I6MA 3VF6A 1Q18A 3AGRA 3DXMB 3J8AA 4B1XB 4MDBA 4G9ZA 1ILYA 3A8YA 2FSNA 1NM1A 1YF5L 3OHRA 3ZX0A 4H0OA 4WQ4C 3TPQA 3GE1A 5JLFA 3QB0A 4IWVA 5TKWA 3VGKA 4GV6A 3U9DA 3VEVA 4BRFA 1RFQA 1TYQA 1NMDA 1DT9A 5EXWA 3W3DA 2NNWA 3UE5A 4CBWA 2P9SA 3AAQA 5BR9A 4CZIA 3H6EA 3L6QA 4ISGA 2V52B 3ZEUA 2D1KA 1YJNN 1YVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TKW A;  1W97 L;  4PHT X;  1YF5 L;  2BH1 A; 
#chains in the Genus database with same CATH topology
 3IFR A;  4GVM A;  3TAE A;  1Z6R A;  1E4F T;  3CJA A;  4CD3 A;  3VER A;  1MWK A;  3AO2 A;  4FJK A;  3ZET B;  1WBD A;  4E19 A;  3S3M A;  1VQL N;  3WXM B;  1KLN A;  2HHU A;  4DUZ K;  3FFK B;  1TAU A;  4IBN A;  2NRR A;  3CJ7 A;  2X6N A;  2P9P A;  3O9T A;  3QDK A;  1Z05 A;  2ZGZ A;  1FW6 A;  4CD1 A;  1BOT O;  4O44 A;  1T6C A;  5EY4 A;  2A5X A;  4KRE A;  4IKF A;  2B5J A;  3L2V A;  1H1V A;  3C7N A;  1XMQ K;  1NGF A;  5M1O A;  4FJX A;  4IEE A;  3OW2 M;  5AQT A;  2HB5 A;  1J9A A;  1WUA A;  5ADX H;  5CZ2 A;  5C15 A;  3C6U A;  1SKS A;  3SAH A;  3E9O A;  1UA0 A;  4H5R A;  1VRU A;  1LAW A;  4ZTF A;  1U6Z A;  5FRN A;  4GNI A;  2KHO A;  3MEC A;  5ELZ A;  1U48 A;  4NXM K;  3FLC O;  3A5N C;  4KHY A;  1ASV A;  4B1U B;  3LAN A;  2D0C A;  3FGU A;  3TI0 A;  1XNQ K;  4CF9 A;  4RW9 A;  1MWM A;  5HRP A;  4JV5 K;  1VQ7 N;  4B1Y B;  5AQY A;  4BQZ A;  4U67 L;  2PZS A;  4YFU A;  3OYM A;  1WSF A;  1WSI A;  4CES A;  3KKR A;  1VSL A;  5C0Y A;  1HLU A;  1WNS A;  4HHT A;  4DQP A;  1Q81 O;  3EY1 A;  1SL1 A;  1SKR A;  4BE1 A;  4H0V B;  4O5B A;  3D2F B;  3CIP A;  1D5A A;  2KW4 A;  3QEV A;  2HF4 A;  3SQ0 A;  1NWK A;  3VQP A;  2GUI A;  4FJL A;  3WXI A;  3A0I X;  4DFM A;  3CCM N;  1BG3 A;  2A3Z A;  4MDA A;  3R6M A;  3P1G A;  1TK5 A;  3D7E O;  4F9O A;  1JLQ A;  1IBK K;  1QSY A;  1ESV A;  2UUC K;  3TU5 A;  3O1B A;  4LF7 K;  2CH5 A;  4YDU C;  4JAX A;  4FVM A;  3TAR A;  4FZX C;  1UA1 A;  1RTD A;  3QFU A;  4Z4C A;  1RT5 A;  4LD0 A;  4YHH K;  3KK7 A;  5AQM A;  2D0B A;  4C8K A;  3KK2 A;  3ATV A;  4M3X A;  4DS4 A;  2O8B B;  3N4Q A;  3MWP A;  3NVM A;  3SUO A;  3KD1 E;  4QCL A;  4HTU A;  4MLH A;  1BIZ A;  4KHQ A;  3QIO A;  1XQS C;  3S41 A;  4DTJ A;  3MED A;  2NRV A;  3HBT A;  2G8H A;  1NK9 A;  3TAQ A;  3SNN A;  3RSE A;  3V9S A;  3VA3 A;  3L8B A;  4KI6 A;  1ZYQ A;  5JMV A;  1B92 A;  4KKO A;  2E2N A;  2FLO A;  3OA9 A;  2OA8 A;  1N36 K;  3HXM A;  4KTW A;  4JI8 K;  1J54 A;  1KAY A;  5C24 A;  5MLC Q;  3K58 A;  2HNY A;  2CGL A;  4BAC A;  1QSL A;  4ISF A;  2D0P A;  1KQS M;  4PY5 A;  4EHT A;  4JI6 K;  1VQ6 N;  4YOR A;  2BH1 A;  3C95 A;  3A2F A;  4YNQ A;  1IG9 A;  5C42 A;  3SCX A;  3O80 A;  4OKE A;  1ATR A;  3SPZ A;  2IVN A;  4IDH A;  4B9Q A;  1BU6 O;  1HX1 A;  4F3O A;  4LFA K;  4M3T A;  4DV0 K;  1NGJ A;  2RF2 A;  5ADX A;  3QER A;  3HP6 A;  4DTR A;  4KV8 A;  4Y0W A;  2IVP A;  4R79 A;  4BE2 A;  4CF1 A;  4O55 A;  4A2B A;  5AQV A;  2P9I A;  1GLD G;  2OPQ A;  1VSH A;  4CZH A;  1RGI A;  1WBB A;  5CHI A;  1KLM A;  2ZGY A;  4DR7 K;  2ZJQ L;  3F9M A;  4KAZ A;  4DQI A;  1LW0 A;  3RWU A;  3KWI A;  3DRP A;  3H3N O;  3UKR B;  5FPD A;  4BQL A;  2HHT A;  3DM2 A;  5JLH A;  1CZ9 A;  2Z1I A;  4CIF A;  3K9J A;  3TSQ A;  1HKG A;  2UXB K;  1WSG A;  4N47 A;  4BR9 A;  2OAN A;  5DK5 A;  4NO7 A;  3BGR A;  4Z4E A;  1JKH A;  1JLC A;  2HNZ A;  3TR8 A;  3AVB A;  2FSJ A;  1ASW A;  4JI0 K;  3FZH A;  1U49 A;  1X1P A;  2XO7 A;  1HNV A;  3CFO A;  5KRT A;  5CE3 A;  4B9S A;  3JSM A;  2D0O A;  4CFA A;  4FK2 A;  1VQK N;  2QKB A;  1Z25 A;  1LWE A;  2BE2 A;  3FFI A;  3K5O A;  3OTO K;  3AVN A;  2Q1N A;  4FPA A;  1JJ2 M;  3DXK A;  4BWM A;  4DQR A;  3HTV A;  3KIO A;  2F96 A;  3T19 A;  2IOC A;  1NOY A;  2O8C A;  4DLG A;  3BZK A;  3KLI A;  5J2P A;  3P39 A;  3CFP A;  1HKC A;  2V7Y A;  4BE0 A;  2FBV A;  4OJR A;  5FDL A;  4BRE A;  4CW7 B;  1TL3 A;  3RMA A;  5SWM A;  4CHN A;  4DTP A;  4DSE A;  1HNW K;  4E7H A;  4ILG B;  1TK0 A;  3EZ5 A;  3GG4 A;  3VQ7 A;  3HO1 A;  2BAN A;  3OBY A;  4CCH A;  1KTQ A;  2ITG A;  1L5U A;  3QLH A;  1P8Z A;  3HK2 A;  1KAX A;  1U2V A;  4JKA A;  3CQX A;  4K8Z A;  1WOQ A;  4RW4 A;  4ILJ A;  3MAQ A;  4DQS A;  2ZM6 K;  4IFY A;  5FRO A;  5KPT A;  5F2R A;  1NBW A;  3I55 N;  3M3Z A;  1RT3 A;  3VEZ A;  3J7A P;  3CC2 N;  2WBN A;  3IMX A;  1IKW A;  3Q7B A;  3WXL A;  1QQC A;  4FOI A;  4JKG B;  3M5R A;  1X3N A;  1C1C A;  5M1P A;  4AHR A;  3QIN A;  1YAG A;  4BR5 A;  2WUS A;  1Q8I A;  5JIC A;  1ZBH A;  1BHL A;  2I5J A;  4I6M B;  4GY2 B;  5AQI A;  3SAG A;  2Y1J A;  2YNI A;  3AVI A;  4NXN K;  2HOE A;  1CZA N;  3VEX A;  4UQG A;  4M3Y A;  1BI4 A;  2G8F A;  4DUY K;  2W40 A;  1FKO A;  3MX2 A;  2XY8 A;  2DFE A;  2G8K A;  2E6L A;  2F9T A;  5KI6 A;  1F21 A;  3QEI A;  3KLG A;  4JK9 A;  1RTI A;  4FM0 A;  2P51 A;  4JKE A;  4Z4I A;  3EZW A;  3BZC A;  1VQN N;  3ENB A;  2DFH A;  3THW A;  4QAG A;  4QS8 A;  3KTQ A;  3AO5 A;  2HHX A;  5TKY A;  3LAL A;  3I0R A;  4FWK A;  4Q5V A;  4DS5 A;  3ZCM A;  4FJH A;  3LWM A;  3HOS A;  2FC0 A;  2AP1 A;  2XY5 A;  3K57 A;  1S9E A;  3HZ6 A;  3LM9 A;  3D2E A;  3C7N B;  1MDU B;  4HCB A;  1LCU A;  1W7A A;  1HNI A;  5DM6 L;  5AQF A;  4AM7 A;  1OKJ A;  3SQ1 A;  5CZ1 A;  3NH1 A;  5AZI A;  1IH7 A;  1VSI A;  3PY8 A;  2BGG A;  3E01 A;  1O13 A;  3HSC A;  4DMN A;  4W5O A;  1C0U A;  2YHB A;  4L3Q A;  5K14 A;  1HUX A;  1GLE G;  4FOE A;  4CJV A;  4JD2 A;  3V81 A;  4XH5 A;  3VQ5 A;  4DTN A;  2CGJ A;  2CGK A;  3VF6 A;  3J8A A;  4MDB A;  2HHH K;  1ILY A;  4OPK A;  1IO2 A;  5FRM A;  3OHR A;  4WQ4 C;  3GE1 A;  4LF9 K;  5TKW A;  3S3O A;  4GV6 A;  1RFQ A;  1TYQ A;  1NMD A;  3C94 A;  4CGI A;  3UE5 A;  1RT2 A;  2P9S A;  3OYA A;  1X9W A;  1HMV A;  3L6Q A;  3ZSW A;  1TUY A;  1A5W A;  4RW6 A;  1YVN A;  3DJC A;  1QHT A;  1FKP A;  1J53 A;  3CQ8 A;  3LAM A;  3CCV N;  3ZSY A;  2NRH A;  1XC9 A;  4DV6 K;  3SMP A;  4ELT A;  1E4G T;  3CJC A;  2YX6 A;  4H5T A;  4IG0 A;  4A61 A;  1YI2 N;  3S3N A;  3QML A;  1CXQ A;  3AY9 A;  4JN4 A;  5JS2 A;  4LFC K;  3DLH A;  2ZD1 A;  3VEW A;  1WN7 A;  4DR4 K;  4G1Q A;  5KGX A;  4C8O A;  3H45 C;  3H1V X;  1XMO K;  1NJY A;  2KQ2 A;  2RN2 A;  3BF1 A;  3CM5 A;  4DSL A;  4E7I A;  3LDO A;  3KJV A;  4N5S A;  4CK2 A;  3OJU A;  4WF9 L;  1NK0 A;  3T1Y K;  3O5B A;  2Q2R A;  3VGL A;  3V4I A;  3R8E A;  3K9K A;  4CK1 A;  3OYG A;  2UU9 K;  1KVC A;  1TUU A;  1BCM A;  2BTF A;  4KPY A;  1NK5 A;  5AQO A;  3IAY A;  3ZX3 A;  3AO4 A;  1RTJ A;  4CZM A;  1ZBL A;  3I8B A;  1CXU A;  2EHG A;  2YHX A;  1TV6 A;  2E20 A;  3V1O A;  4CER A;  2ZE2 A;  3V6D A;  3RSE B;  4PL8 A;  2EWS A;  3EO3 A;  4Z4G A;  4X66 K;  4BDZ A;  3SPY A;  5JVG L;  3MN9 A;  3MX5 A;  2YCH A;  4FWM A;  5AQG A;  3OYE A;  1SS6 A;  3ZT0 A;  3U9Z A;  5HRO A;  3L2Q A;  2IS3 A;  3OJS A;  4JYA K;  5C2F A;  3J7Y P;  4KB1 A;  1O1W A;  4BC3 A;  1BWF O;  3NF7 A;  3HRG A;  3L0Q A;  4RCH A;  2V7Z A;  3OYH A;  4BGB A;  1QQO A;  3CYM A;  3O08 A;  3B6O A;  3CQY A;  1HPM A;  1VSD A;  1N6Q A;  3B8A X;  3M8R A;  1CZB A;  2YHY A;  3C6A A;  1WAJ A;  2P9L A;  3O9R A;  2DFF A;  3M8P A;  3MK6 A;  1M1K O;  3MN5 A;  5EVZ A;  2P9I B;  4M3R A;  3NH2 A;  3SUP A;  1V4T A;  2WON A;  1BIU A;  2ATQ A;  1LWC A;  5D3G A;  3FZM A;  1C0M A;  1KVB A;  1W97 L;  1CLQ A;  2E8A A;  3SJJ A;  4B08 A;  3QNO A;  1NGC A;  2X6S A;  4IG3 A;  2D5R A;  3LZI A;  1T8E A;  4CK3 A;  3AA2 A;  1VSF A;  4J2E A;  4PL7 A;  4KFB A;  1VRT A;  3VA0 A;  4W5T A;  3PO5 A;  3SV4 A;  5E41 A;  2ZJP L;  4OPA A;  4LSL A;  4AHU A;  3AVH A;  3AVK A;  1D4X A;  4WQ5 A;  4A5B A;  1HQU A;  3O1W A;  3T69 A;  1N34 K;  1Y64 A;  5M1F A;  2BUP A;  2B6A A;  2W42 A;  1HYZ A;  1XHX A;  1S1T A;  1C1A A;  1YTU A;  1NGA A;  5KGW A;  3H3O B;  3CME N;  1K8K A;  3P5J A;  5AZJ A;  1D8Y A;  2R7Y A;  4BRO A;  3F2K A;  4B8C A;  1TVR A;  2P9U A;  4Y1D A;  3NF6 A;  4CJF A;  4CHY A;  4CHZ A;  4Z0U A;  4Z4F A;  2QWQ A;  1I94 K;  1S6P A;  4FWS A;  3NF8 A;  3EYZ A;  4JS4 A;  4OO1 J;  3TAP A;  4IFV A;  1KSP A;  3DXK B;  4LF6 K;  5BRE A;  2O8C B;  4KH5 A;  1BCO A;  2VYP A;  4BR7 A;  1JXE A;  3RMD A;  1SKW A;  4KH4 A;  1X9S A;  1KXP A;  4BDY A;  1U45 A;  4B1Z A;  1JLF A;  1R59 O;  4AHS A;  3BEX A;  3CJB A;  3PSI A;  1N8R O;  1BDG A;  3DOL A;  1NJI O;  3NHG A;  3G25 A;  4CFB A;  4JHD B;  3DYA A;  1SUQ A;  2P9K A;  4YDU A;  1J6Z A;  4Z94 A;  2WOM A;  5GAE P;  1Z26 A;  4DV1 K;  5LJW A;  2A6A A;  2HND A;  2VGM A;  1L3S A;  1U2V B;  5T7B A;  5BPN A;  2Z1J A;  3G6E N;  2Q36 A;  1VSJ A;  4DB3 A;  2J4R A;  2KZZ A;  1GLF O;  4H4M A;  1NGI A;  4E1N A;  5AQS A;  3J81 O;  4F2S A;  3J80 O;  1OVQ A;  3MN7 A;  4B3R K;  2A42 A;  4JEP A;  4JKF A;  3ITH A;  4AHT A;  2ZWH A;  3L2U A;  3V9W A;  1XI1 A;  3D45 A;  3TTC A;  4W5N A;  2QM1 A;  4BRI A;  2RE2 A;  4EIA A;  1ASU A;  4CJQ A;  3KLH A;  3C6H A;  4E1M A;  4EP5 A;  3R9P A;  5AQN A;  2E6M A;  3AAP A;  4BRA A;  3ENH A;  3TTF A;  1K8A O;  2O8F A;  2KTQ A;  3NDK A;  5HLF A;  2VG7 A;  4HVJ A;  4IZ9 A;  5IWA K;  3F5T A;  3WQT A;  4H4O A;  4PQU A;  2UXC K;  1R0A A;  2HW3 A;  4BRM A;  3C6T A;  3ZSV A;  1QQN A;  3VET A;  3VN5 A;  4H03 B;  4I9Q A;  2Z1G A;  4B9L A;  4FCY A;  1VQO N;  2DPN A;  3AVG A;  2FBY A;  3CC4 N;  2F8T A;  4DKW A;  1DKG D;  4DF8 A;  4CBU A;  2HBM A;  2HMI A;  4PHT X;  3CC7 N;  4HCC A;  3T1A A;  1QE1 A;  3THW B;  4LH4 A;  2YJF A;  1YJ9 N;  3LDP A;  3V9X A;  1NNE A;  4M63 C;  4CED A;  1KFS A;  3P38 A;  1IV0 A;  4FLV A;  3BUZ B;  3RMC A;  1LOT B;  3VGM A;  4BRK A;  4ICL A;  3CCU N;  1GOC A;  4XH4 A;  3VOV A;  4OGE A;  4DF4 A;  4GKK K;  2KKZ A;  4JKB A;  3D2E B;  2E88 A;  4W5Q A;  1OH6 A;  1WB9 A;  4DHY A;  1NOZ A;  3SMS A;  2JLE A;  4E1J A;  1LWF A;  1TAQ A;  4CJ4 A;  3JAM O;  4CEA A;  4RTF D;  2HBK A;  3HPG A;  1VAZ A;  4OPJ A;  4XEI A;  5AZI B;  3ID8 A;  3DAW A;  3KK3 A;  4CJP A;  3AVA A;  3HOT A;  1E3M A;  4BRP A;  4NCA A;  5I3U A;  2QEX N;  1I3A A;  4DTO A;  2WC9 A;  3K5M A;  4BRH A;  4JD2 B;  4RW8 A;  1UOC A;  4O8K A;  4OKK A;  3PO4 A;  1SZ2 A;  5AQR A;  3VQQ A;  4CJE A;  4FYD A;  2NLX A;  2UUA K;  1TYQ B;  5HRS A;  5FPE A;  4HUF A;  3WEE A;  1YHQ N;  2P9S B;  3JXU A;  4OPH A;  3LZJ A;  3I8D A;  2P1J A;  3BP8 A;  1RBU A;  2ZQB A;  2OTJ N;  1KAZ A;  1RT6 A;  1ITG A;  2GEL A;  1YIJ N;  1BIS A;  3NF9 A;  1QVG M;  4JK7 A;  4DFK A;  4DV3 K;  2HBJ A;  4MFB A;  1QQM A;  1D9D A;  3NVK A;  2WFB A;  3O4N A;  4FW1 A;  2QW9 A;  3P83 D;  3HI0 A;  3GBT A;  1HJO A;  2GV9 A;  4NYF A;  2VQF K;  4DR3 K;  2QWO A;  4N76 A;  4B8A B;  3DI6 A;  3NH0 A;  2HHS A;  4GW6 A;  5HL7 L;  3O3F A;  4FO0 A;  3RVC A;  1UWB A;  4PKI A;  3VEY A;  3SLC A;  4PWD A;  1YTA A;  3CER A;  5DMR A;  4KHS A;  2B4J A;  2ASO A;  4FJJ A;  2XY7 A;  3NMU A;  1SV5 A;  1HR0 K;  4EZ9 A;  1ZBI A;  1S1U A;  2YKM A;  3DRS A;  1WSE A;  4CJ5 A;  3TAG A;  4RW7 A;  2AA4 A;  2D0A A;  5CY4 A;  1K6Y A;  4FZZ A;  4I7F A;  3E66 A;  4F8R A;  5AQW A;  3VF2 A;  4W5R A;  4B9M A;  4DU3 A;  3KWG A;  1GLA G;  1NLV A;  3ULE A;  2G8W A;  4FK4 A;  5B8H A;  3CD6 N;  4M3U A;  1B9F A;  1RIL A;  2QXF A;  3CG7 A;  3PX4 A;  5E26 A;  4K42 A;  4B1X B;  1Q18 A;  1RT7 A;  4CGF A;  1YF5 L;  3MEG A;  3B6P A;  3TPQ A;  5FLX O;  3NGI A;  4F2R A;  1DTQ A;  1HYV A;  3QB0 A;  4IWV A;  1IBL K;  4BRF A;  4KHW A;  2O8E B;  1DT9 A;  3W3D A;  4DV2 K;  4AHC A;  4CBW A;  5BR9 A;  4ISG A;  3AVM A;  4AQY K;  3QBX A;  3K5N A;  3GDQ A;  5I42 A;  4CZG A;  4ZTJ A;  1EKE A;  1U04 A;  1N5Y A;  3L4I A;  3SQ2 A;  4JS5 A;  1TKD A;  3G10 A;  3KK1 A;  1XNR K;  2HVH A;  1RBV A;  5J2M A;  4CBX A;  3V1Q A;  1HQE A;  4RWT A;  2P9L B;  1K9M O;  2PYL A;  5CYQ A;  4CGG A;  2IVO A;  1MA9 B;  3AO3 A;  4FLW A;  1XHZ A;  2JWL A;  1T05 A;  5LY3 A;  4KTZ A;  5BN8 A;  1OVY A;  4ID1 A;  1RBT A;  4KI4 A;  4AHV A;  1JL2 A;  3OYF A;  1IBM K;  1I39 A;  1BO5 O;  4EP4 A;  3ZEU B;  3WT0 A;  3G4S N;  4H5V A;  3D2F A;  4OX9 K;  2O4I A;  2Z1H A;  4GVE A;  3VQ6 A;  2F8S A;  3OVN A;  4I9L A;  1RDB A;  1ZBF A;  3SZ2 A;  4CF8 A;  1X9J A;  5AQP A;  2YNH A;  2W41 A;  2PFU A;  4QS7 A;  1K8K B;  3T3F A;  3O9Q A;  4V19 S;  2FBX A;  1QHA A;  3TAN A;  5AQZ A;  1ATN A;  4K0K K;  2P9U B;  2VG5 A;  4CEQ A;  5M1N A;  4CJK A;  4WE1 A;  1RT4 A;  2P9P B;  4DSF A;  3ZT4 A;  3Q7C A;  1S6Q A;  4BRN A;  4C1N I;  3WNG A;  5SZT A;  4NCB A;  4CGJ A;  2KLA A;  3DLG A;  2NRT A;  3DRR A;  4BR4 A;  2YJE A;  5E84 A;  3VQB A;  1TKZ A;  1QVF M;  2X78 A;  1OH8 A;  2HST A;  3ZSR A;  4C1N K;  5J1E A;  1GLC G;  4CEZ A;  3NBP A;  5EOY A;  3AA3 A;  3CET A;  5AQU A;  3O9S A;  1WSH A;  4BR2 A;  4WFN L;  5HBM A;  4C8N A;  3HVR A;  1SL0 A;  4LF5 K;  3I0S A;  3LDL A;  1P90 A;  1VQM N;  4JI3 K;  4IFE A;  4K43 A;  1FJG K;  4R5P A;  1YT3 A;  3HM8 A;  4CZL A;  4GKJ K;  1RDD A;  1VQP N;  3RR8 A;  4PUO A;  4ELV A;  3M8S A;  2GUP A;  4DU1 A;  3QFP A;  4CHO A;  3QIP A;  5BRF A;  4FM1 A;  4K25 A;  1J5O A;  5EU7 A;  1EP4 A;  3GL1 A;  3VQ9 A;  2XHB A;  3DLE A;  3ZX2 A;  3CPE A;  1S22 A;  4CEC A;  1IJJ A;  4ZHR A;  1NG9 A;  1EWR A;  1IG8 A;  3GOI A;  3ZSO A;  1NKB A;  4E3S A;  4E0D A;  3FE1 A;  2E2P A;  5AQH A;  3IRX A;  3DLR A;  3FZF A;  4A62 A;  4J2A A;  4BRL A;  3RMB A;  3K5L A;  4XIU A;  3CHW A;  4FLY A;  4U7B A;  2QWL A;  5GIN A;  2ETJ A;  4OLA A;  1X3M A;  1JXB A;  4L8R B;  3L3U A;  3ZSZ A;  3A5M C;  1QZ5 A;  1C0T A;  4BC4 A;  3FZK A;  3KLE A;  4H0Y B;  5FPN A;  3EKU A;  3OYC A;  4IJA A;  3ZSQ A;  1JLE A;  2FF6 A;  4YOY A;  4CF0 A;  3A5O C;  4NLB A;  1FXX A;  1NK7 A;  3LL3 A;  2HF3 A;  4CZE A;  2A40 A;  2QTD A;  2GBZ A;  3V1R A;  4FWR A;  2IAJ A;  3O6W A;  3IDH A;  1Y97 A;  4B9U A;  2YI1 A;  4KHN A;  4M7Y A;  3CCR N;  3DLK A;  5KTQ A;  1RDA A;  3G71 N;  2NRZ A;  5AQK A;  4C23 A;  3NE6 A;  2GX9 A;  3IS9 A;  2NZT A;  3NCI A;  4BRG A;  3THY A;  1A5V A;  4JNE A;  1BQM A;  5BR8 K;  3OYN A;  4A57 A;  1VQ8 N;  3RR7 A;  3UKU A;  1RNH A;  5KQ8 A;  1BL3 A;  2F4V K;  4BRQ A;  2FSK A;  3CJ1 A;  4N41 A;  3L3V A;  3ZYY X;  3ZSX A;  1BGX T;  4HUE A;  2FF3 B;  3E1Y A;  5AQJ A;  1NKE A;  1C1B A;  1T3V A;  1TGO A;  5KRS A;  5LL6 Z;  3MCP A;  4J2D A;  3MN6 A;  2P5G A;  1VQ9 N;  2E2Q A;  1EO1 A;  3RTV A;  1RBR A;  3AA4 A;  3LP2 A;  3TAF A;  1WSJ A;  4UY8 O;  1IKY A;  4B9T A;  4BG9 A;  1L3T A;  1IKV A;  1JLG A;  1RDC A;  2A41 A;  1OH7 A;  1UAX A;  4O5F A;  4CVN E;  3F9K A;  3O4Q A;  3SAF A;  3LDS A;  3CJ9 A;  5LMU K;  3WEE B;  3VES A;  1RDU A;  4DR1 K;  4Y1C A;  4BWJ A;  4JI1 K;  3A5L C;  3P4I A;  2ITM A;  1D9F A;  3LPT A;  4DLE A;  3SYZ A;  4HUG A;  2OPR A;  2PBD A;  4IOA L;  3OYB A;  1KCF A;  2A1S A;  4NYN A;  4PKG A;  4DFJ A;  3QNN A;  1J5E K;  3OYI A;  3T1H K;  4FJ5 A;  4O8U A;  1U4B A;  3TSP A;  4WFB L;  4IEI A;  4AH9 A;  2UXD K;  2FXU A;  3EKS A;  4CE9 A;  2F9W A;  4H0P A;  2ASM A;  5GIO A;  3CCJ N;  2E4L A;  4CIE A;  3THX A;  4Z4H A;  4JKH A;  1RCH A;  4H5N A;  5AFU H;  4FWL A;  4MLE A;  4OGC A;  4ELU A;  4B3O A;  3SUQ A;  1DTT A;  2JGU A;  5J2Q A;  2OPP A;  3IUC A;  4FVU A;  4F4K A;  1YIT N;  3C65 A;  5M1Q A;  5BRH A;  3M6G A;  3HPO A;  5HOO A;  3M1F A;  3SV3 A;  1BA0 A;  4CEO A;  4M3Z A;  3S9H A;  5F0X A;  2OTL N;  3QIC A;  4WCE L;  2HHW A;  3WNH A;  2QI2 A;  2RKI A;  1TK8 A;  4FZY A;  3O3G A;  3VEN A;  3ULE B;  3HL8 A;  1ZXO A;  3ATU A;  4DR5 K;  1A5X A;  1HRH A;  1HPZ A;  3E9P A;  5M1K A;  4X65 K;  2P9N A;  3QEX A;  4E7L A;  1NKC A;  4DSK A;  4CJW A;  3HJF A;  3PUF A;  3L2R A;  3UB5 A;  2IC3 A;  4B3T K;  4BGA A;  5BPM A;  3J7Z O;  2AJQ A;  1NK8 A;  4CJL A;  4MQ3 A;  4JK8 A;  4DTU A;  4JRQ A;  1OH5 A;  3BDP A;  3SK3 A;  3LWL A;  4CJS A;  4DG1 A;  3ID6 A;  4E7J A;  4DV7 K;  3TAB A;  1L3V A;  2D4W A;  1MU2 A;  3L4Q A;  3CF5 L;  3F73 A;  3AVJ A;  4WQ5 C;  4FJG A;  3CCL N;  2IGI A;  4IOX A;  4ISE A;  1EQY A;  4CJT A;  2I7N A;  2E2O A;  3ZT3 A;  1GOB A;  3DWL A;  3KZB A;  3EE8 A;  5GIP A;  3D0P A;  1VQ4 N;  2VWK A;  3WNE A;  5GAH P;  3NFA A;  1QTM A;  2GTD A;  2ZF5 O;  2QWN A;  4H0T B;  2QA4 N;  1LAV A;  1KVA A;  4A5A A;  4QS9 A;  3HVT A;  1XC3 A;  3HP9 A;  4N56 A;  1BI4 B;  2OCE A;  5C2D A;  1JL1 A;  4LC9 B;  3WUH A;  4K8X A;  4JRP A;  3QO9 A;  2JWK A;  3OYD A;  4FJ8 A;  1WAF A;  3ZLJ A;  1TKT A;  4EFH A;  2F7T A;  4CJR A;  4HTL A;  2O4G A;  4B3S K;  4G9Z A;  3HYF A;  2FSN A;  4CIG A;  3PV8 A;  4DU4 A;  3U9D A;  3VEV A;  4IDK A;  3K59 A;  1KFD A;  2QKK A;  3PX6 A;  2VWJ A;  2D1K A;  3L2W A;  5CYM A;  1GLJ O;  4RG8 A;  3SQ4 A;  5AFU A;  2NUB A;  3VQ8 A;  4BC5 A;  1GLL O;  4DTX A;  3ENO A;  3CFR A;  1ZBS A;  2Q0U A;  4H0X B;  5AR0 A;  3THV A;  2OPS A;  4DWI A;  4H5W A;  2KFN A;  4NCG A;  5JVH L;  4KO0 A;  3BF3 A;  1K73 O;  2HMP A;  4B3M K;  1ZC6 A;  2UUB K;  1HNX K;  2V51 B;  5KQD A;  3VF4 A;  4KTQ A;  4A2A A;  1REV A;  3PX0 A;  5C25 A;  3OS0 A;  3DLL L;  3OBW A;  3QBW A;  2O8D A;  1YUW A;  2EX3 A;  3RRG A;  3WXK A;  5DM7 L;  3FR0 A;  4LF8 K;  4O0J A;  5AQX A;  4F3T A;  4FJM A;  2G8I A;  4JLH A;  1VSK A;  3DLB A;  3EEQ A;  2UYT A;  4ILH A;  4YOU A;  3OYL A;  5A2Q O;  4FWQ A;  1T7P A;  5I9E B;  2RHK A;  5H1S Q;  4CZJ A;  3AA5 X;  3DXM A;  3OYK A;  3O9U A;  3T7Z A;  4LF4 K;  4OLB A;  4BRD A;  4FK0 A;  3R1X A;  4KRF A;  2ASP A;  3U3G A;  4FJ9 A;  3AV9 A;  3LAK A;  2DTU A;  1FK9 A;  3CCE N;  4X64 K;  3ALY A;  4BG8 A;  1NGH A;  5HRN A;  4CJ7 A;  2W6L A;  1YJN N;  3IKM A;  1TL1 A;  2YHW A;  4FM2 A;  3EL2 A;  5KPZ A;  3KHY A;  1ZBU A;  2PAV A;  4WYB A;  5GAG P;  4LSN A;  5LJV A;  3RRH A;  2I7P A;  3SBT A;  1GLB G;  3VQ4 A;  4DR6 K;  1Q86 O;  3NGZ A;  3TTD A;  1V4S A;  4LFB K;  3ZET A;  2E1Z A;  3VEO A;  3LDQ A;  1VK0 A;  1Q7Y O;  3THY B;  3MEE A;  4DQ8 A;  2DY4 A;  3U8X A;  3U6F A;  3HT3 A;  4DFP A;  3AAR A;  3UKU B;  4YOW A;  3VQA A;  3LP0 A;  1S1V A;  3R3L A;  4CEF A;  2XY6 A;  2Y1I A;  4IOC L;  2QXL A;  4E7K A;  1BA1 A;  1GOA A;  3PIP L;  3WXJ A;  4DCH A;  1KRP A;  4M41 A;  3E9L A;  2GWJ A;  3HPH A;  4EAH D;  3TAM A;  5HP1 A;  5LMN K;  4JHD A;  4B9N A;  3LM2 A;  3N4P A;  2X74 A;  4CGD A;  1S1W A;  1T44 A;  2GWK A;  3K2P A;  1NJZ A;  3CPW M;  3OYJ A;  1G15 A;  3LPU A;  3CCQ N;  2XRI A;  3U4L A;  5JS1 A;  4FLT A;  2GEM A;  3QES A;  4EZ6 A;  5F1X A;  4JI4 K;  2A1R A;  4C8M A;  4O4G A;  5IT9 O;  4TSX A;  1JCF A;  4FPB A;  4XH1 A;  1NGB A;  3CXC M;  4FJ7 A;  5BPL A;  3VQE A;  5BRD A;  3AVC A;  5BN9 A;  4IJN A;  4IO8 A;  1SAZ A;  4KBO A;  2IIR A;  4Q0B A;  3CCS N;  4PA1 A;  3I56 N;  2YV0 X;  4I2Q A;  1NK6 A;  2PY5 A;  2IDO A;  3JS6 A;  2QWR A;  4DSJ A;  5CR4 A;  2VQE K;  1S1X A;  4BRC A;  2VGN A;  3EE9 A;  3CM6 A;  2Q0R A;  1LV5 A;  4GV3 A;  3G0Z A;  3W0L A;  1EX4 A;  4PKH A;  4CFD A;  4FWN A;  4GV9 A;  3VTH A;  1B9D A;  1XWL A;  1VSE A;  1TKX A;  3KVG A;  4IXC A;  4WQ4 A;  3WNF A;  3H08 A;  4FW2 A;  3FZL A;  3THX B;  1S9G A;  2Q31 A;  5AZJ B;  4QOZ B;  5AQQ A;  4AM6 A;  4BVO A;  2PYJ A;  2Q3S A;  2YNG A;  4KHU A;  1VHX A;  2WTU A;  4C8L A;  3CI5 A;  1RDW X;  3O3H A;  3MWT A;  3QET A;  4M7X A;  4CI6 A;  1KC8 O;  4BDP A;  1YVU A;  3OY9 A;  1NMN A;  2YKN A;  5GAD P;  5KPR A;  4LH5 A;  2O8B A;  1N33 K;  5C12 A;  1DEJ A;  4GMJ B;  4YOX A;  4MO5 A;  3AVF A;  3TSU A;  1QSS A;  5FPM A;  4B1V A;  1S5J A;  3I33 A;  5AJ3 K;  3LP3 A;  2OZM A;  1N32 K;  1M90 O;  3O4W A;  2BDP A;  2W6K A;  3MXJ A;  2QWM A;  3AO1 A;  4IO9 L;  1Q82 O;  4CHP A;  2P9N B;  2HHV A;  4FWP A;  3MDQ A;  4OKJ A;  4K41 A;  1HKB A;  3SBG A;  2OZS A;  4CHQ A;  4BVP A;  2NRX A;  1HJR A;  2P9K B;  2VG6 A;  4J8F A;  5EX5 A;  3KLF A;  4CJ3 A;  4CEB A;  3KD5 E;  4FJN A;  3PLA A;  1EET A;  1NGD A;  2OYQ A;  3LP1 A;  1RBS A;  4LY7 A;  4HWI A;  3OS1 A;  3VTI A;  4E89 A;  3P31 A;  1NJW A;  2VCP A;  4NLC A;  1BUP A;  1U47 A;  4YOV A;  3V9Z A;  3QEP A;  4MO4 A;  1EXQ A;  5HRR A;  4DR2 K;  1X9M A;  1XUP O;  3O8M A;  1RT1 A;  3QEW A;  2YHA A;  1JCE A;  1JLB A;  2QK9 A;  2G8V A;  4KHP K;  4CJU A;  2NRW A;  2FBT A;  4DV4 K;  4M3W A;  1NGE A;  3ISN C;  2O8F B;  4DV5 K;  3JYT A;  3KKS A;  1VQ5 N;  1SQK A;  3H46 O;  3VPZ A;  4JI2 K;  1EWQ A;  4FSV A;  3UKR A;  1HNZ K;  4ID5 A;  3MCA B;  4I2P A;  4FLZ A;  3MMV A;  2HBL A;  4J2B A;  1NJX A;  1DGK N;  4KH6 A;  3ZT2 A;  4FL9 A;  1C0F A;  3PSF A;  1Q9X A;  4KB0 A;  1JLA A;  2Q97 A;  3ULD A;  3WQU A;  2VWB A;  3EN9 A;  3MXI A;  3SJH A;  1VSM A;  1NGG A;  3DOK A;  3SUN A;  3HM9 A;  4NB4 A;  4OVL A;  4WFA L;  3U3Y A;  3HST B;  4CEE A;  1T03 A;  3IG1 A;  4BR0 A;  3K0S A;  4CFC A;  3VQD A;  1NU0 A;  4CGH A;  2E1Y A;  4JI7 K;  4FJI A;  1C0G A;  4CZK A;  3OS2 A;  1Q9Y A;  2QWP A;  3PIO L;  4M45 A;  3VQC A;  2KFZ A;  5C10 A;  4FWO A;  1T6D A;  1YJW N;  3ZT1 A;  3AGK A;  4JKC A;  3AVL A;  2P5O A;  3D6R A;  4DSI A;  3C0B A;  4FXD A;  2HVI A;  1YXQ A;  1RTH A;  1NK4 A;  2E5L K;  3DMJ A;  4FLU A;  4EHU A;  3V9U A;  3NAE A;  2HHQ A;  2CH6 A;  5AQL A;  1S72 N;  1W9H A;  2ZJR L;  4YOT A;  3TWH A;  4JI5 K;  1QS4 A;  3VMF B;  4X62 K;  1WLJ A;  4A59 A;  4AF1 A;  1ATS A;  1S3X A;  4DQQ A;  4AIL C;  2G8U A;  3UIQ A;  4B9V A;  2O8E A;  3NGY A;  1W2B M;  1C6V A;  1LW2 A;  2RPI A;  1HYS A;  2LSN A;  2YNF A;  1QZ6 A;  4BY9 C;  3SI6 A;  4DTS A;  4BC2 A;  2H3G X;  1SL2 A;  4CZF A;  3LDN A;  2O8D B;  1BQN A;  4FLX A;  1JCG A;  3H1Q A;  1KD1 O;  4M42 A;  4JKD A;  3MXM A;  4JKG A;  1G99 A;  3M8Q A;  4B1W B;  1IKX A;  4YY3 K;  1L3U A;  3ASM A;  3CMA N;  4H8K A;  4I6M A;  3AGR A;  3DXM B;  3BY5 A;  3A8Y A;  1NM1 A;  3ZX0 A;  1W0H A;  4H0O A;  2KZM A;  5JLF A;  3VGK A;  1DLO A;  4CF2 A;  5EXW A;  2NNW A;  3AAQ A;  4O0I A;  4DTM A;  4CZI A;  3H6E A;  3ZEU A;  2V52 B;  5J2N A; 
#chains in the Genus database with same CATH homology
 1GLJ O;  3DJC A;  3IFR A;  5AFU A;  3QBX A;  3CCV N;  2NRH A;  3GDQ A;  4BC5 A;  4CZG A;  1GLL O;  3SMP A;  1Z6R A;  1E4G T;  3CJC A;  2YX6 A;  3L4I A;  4H5T A;  3ENO A;  1ZBS A;  1E4F T;  2Q0U A;  4A61 A;  1YI2 N;  3CJA A;  3QML A;  4CD3 A;  4H0X B;  3VER A;  1MWK A;  3AY9 A;  5AR0 A;  4JN4 A;  3ZET B;  4CBX A;  1VQL N;  3VEW A;  3WXM B;  4RWT A;  2P9L B;  3FFK B;  2NRR A;  1K9M O;  3CJ7 A;  4H5W A;  3H45 C;  3H1V X;  2IVO A;  2P9P A;  3O9T A;  5JVH L;  3QDK A;  1MA9 B;  3BF1 A;  1Z05 A;  2ZGZ A;  3BF3 A;  1K73 O;  2JWL A;  2HMP A;  4CD1 A;  1BOT O;  5LY3 A;  5BN8 A;  1OVY A;  1T6C A;  1ZC6 A;  5EY4 A;  2A5X A;  3LDO A;  2V51 B;  1H1V A;  5KQD A;  3VF4 A;  3C7N A;  4WF9 L;  4A2A A;  1NGF A;  5M1O A;  4IEE A;  3OW2 M;  5AQT A;  3O5B A;  2Q2R A;  3VGL A;  1BO5 O;  1WUA A;  3R8E A;  3K9K A;  5ADX H;  3OBW A;  3QBW A;  3WT0 A;  3ZEU B;  5C15 A;  3DLL L;  1YUW A;  3G4S N;  3WXK A;  4H5V A;  5DM7 L;  1TUU A;  2BTF A;  3D2F A;  3FR0 A;  5AQX A;  3SAH A;  3E9O A;  5AQO A;  4GVE A;  4H5R A;  3ZX3 A;  4CZM A;  1U6Z A;  2UYT A;  1X9J A;  3I8B A;  2KHO A;  4GNI A;  2YHX A;  5ELZ A;  4ILH A;  5AQP A;  2E20 A;  2W41 A;  3FLC O;  4YOU A;  3A5N C;  2PFU A;  4QS7 A;  1K8K B;  3O9Q A;  4FWQ A;  3RSE B;  4B1U B;  1QHA A;  4PL8 A;  2EWS A;  3EO3 A;  3FGU A;  5AQZ A;  2RHK A;  5I9E B;  5H1S Q;  4CZJ A;  3DXM A;  1ATN A;  3O9U A;  3T7Z A;  1MWM A;  2P9U B;  5M1N A;  5JVG L;  1VQ7 N;  3MN9 A;  4B1Y B;  3MX5 A;  2P9P B;  5AQY A;  4BRD A;  2YCH A;  3R1X A;  4BQZ A;  4U67 L;  4FWM A;  2ASP A;  5AQG A;  1SS6 A;  3Q7C A;  3U9Z A;  4BRN A;  3CCE N;  4C1N I;  5C2F A;  5C0Y A;  4BG8 A;  2KLA A;  1NGH A;  1HLU A;  4CJ7 A;  2NRT A;  4BR4 A;  2YJE A;  5E84 A;  1BWF O;  3IKM A;  2YHW A;  4BC3 A;  3EL2 A;  3HRG A;  3L0Q A;  3KHY A;  4RCH A;  2PAV A;  2V7Z A;  4WYB A;  5GAG P;  5KPZ A;  5LJV A;  1Q81 O;  1QVF M;  4BGB A;  2I7P A;  2HST A;  3SBT A;  4C1N K;  1GLB G;  1GLC G;  1QQO A;  3O08 A;  1Q86 O;  5EOY A;  3TTD A;  4H0V B;  1V4S A;  3D2F B;  3CQY A;  3CIP A;  3CET A;  1HPM A;  5AQU A;  3O9S A;  3ZET A;  2E1Z A;  2HF4 A;  3VEO A;  3B8A X;  4BR2 A;  4WFN L;  2YHY A;  1NWK A;  3LDQ A;  3C6A A;  2P9L A;  3LDL A;  3WXI A;  1P90 A;  3A0I X;  1Q7Y O;  3O9R A;  3MK6 A;  1M1K O;  1VQM N;  3MN5 A;  1BG3 A;  2A3Z A;  4MDA A;  4IFE A;  2P9I B;  3R6M A;  4K43 A;  5EVZ A;  4DQ8 A;  3D7E O;  4F9O A;  3U8X A;  1V4T A;  3HM8 A;  4CZL A;  1ESV A;  3FZM A;  1VQP N;  3TU5 A;  1W97 L;  2GUP A;  2E8A A;  3AAR A;  3QFP A;  3UKU B;  3O1B A;  4YOW A;  2CH5 A;  4YDU C;  4JAX A;  5BRF A;  1NGC A;  3R3L A;  4K25 A;  4IOC L;  3GL1 A;  3QFU A;  4PL7 A;  2QXL A;  3KK7 A;  5AQM A;  3ZX2 A;  1BA1 A;  3CPE A;  3ATV A;  3PIP L;  1S22 A;  3N4Q A;  3MWP A;  1IJJ A;  3NVM A;  4OPA A;  3WXJ A;  2ZJP L;  1IG8 A;  3GOI A;  4DCH A;  1D4X A;  3E9L A;  4WQ5 A;  4A5B A;  3FE1 A;  2E2P A;  3O1W A;  4MLH A;  5AQH A;  3T69 A;  2GWJ A;  3FZF A;  1Y64 A;  4A62 A;  5M1F A;  4BRL A;  2BUP A;  1XQS C;  3S41 A;  4EAH D;  4JHD A;  3LM2 A;  2NRV A;  3N4P A;  1T44 A;  2GWK A;  3CHW A;  3HBT A;  3CPW M;  4U7B A;  1NGA A;  2QWL A;  3H3O B;  5GIN A;  3CME N;  1K8K A;  3CCQ N;  5AZJ A;  3RSE A;  1X3M A;  3U4L A;  4BRO A;  5JMV A;  3A5M C;  1QZ5 A;  2E2N A;  4BC4 A;  2GEM A;  3FZK A;  3F2K A;  5F1X A;  2P9U A;  2FLO A;  3OA9 A;  4H0Y B;  5FPN A;  3EKU A;  2QWQ A;  1KAY A;  1JCF A;  1TUY A;  4FPB A;  4IJA A;  4XH1 A;  5MLC Q;  1NGB A;  3CXC M;  4FWS A;  5BPL A;  2FF6 A;  4YOY A;  5BRD A;  2CGL A;  5BN9 A;  3A5O C;  2D0P A;  4IJN A;  4ISF A;  4IO8 A;  1SAZ A;  4NLB A;  4EHT A;  1KQS M;  4KBO A;  2IIR A;  1VQ6 N;  4YOR A;  2BH1 A;  3CCS N;  3DXK B;  3LL3 A;  3I56 N;  2HF3 A;  4CZE A;  5BRE A;  3O80 A;  1ATR A;  2A40 A;  2IVN A;  2QTD A;  4KH5 A;  3JS6 A;  4BR7 A;  2VYP A;  4FWR A;  2QWR A;  5CR4 A;  3O6W A;  3IDH A;  4IDH A;  4B9Q A;  2YI1 A;  4KH4 A;  4BRC A;  1BU6 O;  1HX1 A;  1KXP A;  4M7Y A;  3CCR N;  2VGN A;  4B1Z A;  1R59 O;  3EE9 A;  1NGJ A;  2Q0R A;  3G71 N;  5ADX A;  4GV3 A;  3BEX A;  3CJB A;  1N8R O;  1BDG A;  3W0L A;  2NRZ A;  4PKH A;  1NJI O;  5AQK A;  4C23 A;  2GX9 A;  3G25 A;  2NZT A;  4FWN A;  4JHD B;  4Y0W A;  2IVP A;  3VTH A;  4R79 A;  4GV9 A;  4BRG A;  3KVG A;  4IXC A;  4WQ4 A;  2P9K A;  2P9I A;  5AQV A;  4YDU A;  1GLD G;  3FZL A;  4A2B A;  1J6Z A;  4Z94 A;  2Q31 A;  5AZJ B;  4JNE A;  4CZH A;  5AQQ A;  1RGI A;  4AM6 A;  5GAE P;  4BVO A;  4A57 A;  5LJW A;  2A6A A;  5CHI A;  1VQ8 N;  2VGM A;  1U2V B;  2ZGY A;  3UKU A;  5KQ8 A;  2ZJQ L;  3F9M A;  3CI5 A;  1RDW X;  5BPN A;  3MWT A;  4BRQ A;  4M7X A;  3G6E N;  4CI6 A;  2Q36 A;  2FSK A;  1KC8 O;  3CJ1 A;  4DB3 A;  2J4R A;  3KWI A;  3ZYY X;  1GLF O;  3H3N O;  5KPR A;  5GAD P;  1NGI A;  2FF3 B;  3E1Y A;  5AQJ A;  5AQS A;  5C12 A;  1DEJ A;  3UKR B;  5FPD A;  4BQL A;  4YOX A;  3MN7 A;  4MO5 A;  2A42 A;  5JLH A;  1T3V A;  4JEP A;  4JKF A;  3TSU A;  5FPM A;  3K9J A;  3MCP A;  3TSQ A;  1HKG A;  4B1V A;  2ZWH A;  3I33 A;  3MN6 A;  1VQ9 N;  2E2Q A;  3TTC A;  1EO1 A;  2QM1 A;  4BRI A;  2RE2 A;  4EIA A;  4BR9 A;  3O4W A;  1M90 O;  2OAN A;  4UY8 O;  2QWM A;  4IO9 L;  4NO7 A;  1Q82 O;  2P9N B;  3C6H A;  4FWP A;  3MDQ A;  3R9P A;  5AQN A;  4K41 A;  1HKB A;  3SBG A;  3AAP A;  4BG9 A;  2A41 A;  4BRA A;  2FSJ A;  3ENH A;  3TTF A;  4BVP A;  4O5F A;  1K8A O;  2NRX A;  2P9K B;  3FZH A;  4IZ9 A;  3SAF A;  3CJ9 A;  3F5T A;  4J8F A;  5EX5 A;  3WQT A;  3WEE B;  3VES A;  5CE3 A;  1RDU A;  4BRM A;  3PLA A;  2D0O A;  1NGD A;  1VQK N;  3A5L C;  1QQN A;  3P4I A;  2ITM A;  3VET A;  2Q1N A;  4H03 B;  4HWI A;  4FPA A;  2PBD A;  3VTI A;  1VQO N;  4IOA L;  1JJ2 M;  2DPN A;  3DXK A;  3HTV A;  3P31 A;  3CC4 N;  2VCP A;  4DKW A;  4NLC A;  4PKG A;  1DKG D;  1BUP A;  4CBU A;  2HBM A;  4YOV A;  3P39 A;  1HKC A;  2V7Y A;  4PHT X;  4O8U A;  3CC7 N;  4MO4 A;  4BRE A;  3TSP A;  4WFB L;  2YJF A;  1YJ9 N;  3LDP A;  4IEI A;  4M63 C;  3P38 A;  1XUP O;  3O8M A;  2FXU A;  3EKS A;  3BUZ B;  1LOT B;  3VGM A;  4BRK A;  3CCU N;  2F9W A;  4H0P A;  4XH4 A;  2ASM A;  3VOV A;  4ILG B;  5GIO A;  3CCJ N;  4OO1 J;  1JCE A;  3GG4 A;  4JKH A;  4H5N A;  3CCM N;  5AFU H;  2KKZ A;  3OBY A;  4JKB A;  2NRW A;  4FWL A;  4MLE A;  3D2E B;  2E88 A;  1P8Z A;  1NGE A;  1KAX A;  1U2V A;  4DHY A;  4JKA A;  3CQX A;  3SMS A;  4E1J A;  3IUC A;  4FVU A;  1WOQ A;  1YIT N;  4ILJ A;  3C65 A;  5M1Q A;  1VQ5 N;  5KPT A;  5F2R A;  4RTF D;  2HBK A;  5BRH A;  3M6G A;  1NBW A;  3I55 N;  1SQK A;  3M3Z A;  5HOO A;  3H46 O;  1VAZ A;  3M1F A;  4XEI A;  3VEZ A;  5AZI B;  3ID8 A;  3VPZ A;  1BA0 A;  3CC2 N;  3DAW A;  2WBN A;  3IMX A;  4FSV A;  3UKR A;  3MCA B;  5F0X A;  3Q7B A;  3WXL A;  3HOT A;  2OTL N;  3MMV A;  2HBL A;  3QIC A;  4FOI A;  4JKG B;  4WCE L;  1DGK N;  4KH6 A;  4BRP A;  3M5R A;  2QI2 A;  4FL9 A;  1X3N A;  5M1P A;  2QEX N;  1C0F A;  2WC9 A;  3VEN A;  2Q97 A;  4BRH A;  3ULE B;  3WQU A;  4JD2 B;  2VWB A;  3EN9 A;  1ZXO A;  1YAG A;  3ATU A;  3SJH A;  2WUS A;  4BR5 A;  5JIC A;  1NGG A;  4O8K A;  3E9P A;  5M1K A;  4I6M B;  4NB4 A;  4WFA L;  2P9N A;  4GY2 B;  5AQI A;  1SZ2 A;  5AQR A;  4BR0 A;  3SAG A;  2HOE A;  2E1Y A;  3UB5 A;  1CZA N;  1C0G A;  2NLX A;  3VEX A;  4CZK A;  1TYQ B;  1YHQ N;  5FPE A;  3WEE A;  2P9S B;  3JXU A;  4OPH A;  4BGA A;  5BPM A;  3J7Z O;  3BP8 A;  2QWP A;  3PIO L;  2OTJ N;  5C10 A;  4FWO A;  1T6D A;  1YJW N;  3AGK A;  1KAZ A;  4JKC A;  2W40 A;  4JK8 A;  3D6R A;  3C0B A;  3MX2 A;  2GEL A;  1YXQ A;  3SK3 A;  1YIJ N;  3ID6 A;  4EHU A;  1QVG M;  2F9T A;  4JK7 A;  2D4W A;  3L4Q A;  2CH6 A;  3CF5 L;  2HBJ A;  5AQL A;  1S72 N;  4JK9 A;  2ZJR L;  4YOT A;  1QQM A;  3NVK A;  4JKE A;  2WFB A;  4WQ5 C;  3CCL N;  3EZW A;  2QW9 A;  4IOX A;  4ISE A;  1EQY A;  1VQN N;  3ENB A;  3VMF B;  3HI0 A;  2I7N A;  2E2O A;  4A59 A;  3DWL A;  3GBT A;  3KZB A;  3EE8 A;  4QS8 A;  5GIP A;  1HJO A;  5TKY A;  4AF1 A;  1ATS A;  1S3X A;  2QWO A;  4FWK A;  1VQ4 N;  3HOS A;  5GAH P;  2AP1 A;  5HL7 L;  1W2B M;  4FO0 A;  3RVC A;  3HZ6 A;  4PKI A;  3LM9 A;  3D2E A;  3VEY A;  2GTD A;  3SLC A;  1QZ6 A;  2ZF5 O;  3CER A;  2QWN A;  4BY9 C;  3C7N B;  1MDU B;  1LCU A;  4H0T B;  5DM6 L;  2QA4 N;  4BC2 A;  2ASO A;  2H3G X;  5AQF A;  4A5A A;  4QS9 A;  4AM7 A;  1XC3 A;  1OKJ A;  4CZF A;  3LDN A;  3NMU A;  5C2D A;  1JCG A;  5AZI A;  4LC9 B;  2AA4 A;  3H1Q A;  3WUH A;  1KD1 O;  2JWK A;  4JKD A;  1O13 A;  3HSC A;  4JKG A;  1G99 A;  3E66 A;  5AQW A;  3VF2 A;  4L3Q A;  3KWG A;  1HUX A;  1GLA G;  1NLV A;  1GLE G;  4B1W B;  4FOE A;  3ULE A;  4JD2 A;  5B8H A;  3CD6 N;  4XH5 A;  2CGJ A;  3CMA N;  4EFH A;  2F7T A;  5E26 A;  2CGK A;  4HTL A;  4K42 A;  4I6M A;  3VF6 A;  1Q18 A;  3AGR A;  3DXM B;  3J8A A;  4B1X B;  4MDB A;  4G9Z A;  1ILY A;  3A8Y A;  2FSN A;  1NM1 A;  1YF5 L;  3OHR A;  3ZX0 A;  4H0O A;  4WQ4 C;  3TPQ A;  3GE1 A;  5JLF A;  3QB0 A;  4IWV A;  5TKW A;  3VGK A;  4GV6 A;  3U9D A;  3VEV A;  4BRF A;  1RFQ A;  1TYQ A;  1NMD A;  1DT9 A;  5EXW A;  3W3D A;  2NNW A;  3UE5 A;  4CBW A;  2P9S A;  3AAQ A;  5BR9 A;  4CZI A;  3H6E A;  3L6Q A;  4ISG A;  2V52 B;  3ZEU A;  2D1K A;  1YJN N;  1YVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...