5TKWA

1.35 angstrom resolution crystal structure of a pullulanase-specific type ii secretion system integral cytoplasmic membrane protein gspl (n-terminal fragment; residues 1-237) from klebsiella pneumoniae.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
236
structure length
236
Chain Sequence
b'NKINASPQAMLIVRLAAAQAPLHWQLFAPGEPHHEASGRWPTDDASPFPALAEQYPAWVLIPASDCAFHSLTLPAGLRKPPLQVAPFLLEEQLADDVEATHFALLHRQQAQCEIVAVQRQKMRDWLARCESLSLQPLALTPDVLALPWQPPAWSAVQVDEQWLIRHQPWGGMAAENVWLTELLQSEAEEHVIDSYSPPPAAPGVWREQPAQTLLTLAARHPAAQKLSLLQGEFAVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type II secretion system protein L
publication title 1.35 Angstrom Resolution Crystal Structure of a Pullulanase-specific Type II Secretion System Integral Cytoplasmic Membrane Protein GspL (N-terminal fragment; residues 1-237) from Klebsiella pneumoniae.
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
molecule tags Hydrolase
total genus 56
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2016-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05134 T2SSL Type II secretion system (T2SS), protein L
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.370 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5tkwA02
3.30.420.380 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5tkwA01
2BH1A 1YF5L 1W97L 5TKWA 4PHTX
chains in the Genus database with same CATH superfamily
1U4BA 1C0TA 2YJEA 4ZTJA 2A5XA 3AVHA 3OYDA 3H3NO 1QQMA 4JK8A 4OVLA 3QBWA 3PSFA 3O9TA 1OH5A 2Q0UA 4B3SK 3EE9A 2YKNA 4BDZA 1U2VA 1T05A 2OTJN 1NK0A 1NJIO 3VEXA 1K8KB 4FLVA 4DR1K 2YNHA 3AVAA 5CY4A 3VEWA 4PL7A 3SQ0A 1C1AA 4CJ3A 3DXKA 2HNZA 1NWKA 1RT1A 3O5BA 4ISEA 4OPAA 5CHIA 3Q7BA 4YOUA 2O8EA 4CECA 2ITGA 4FXDA 3THXB 3QIPA 4BACA 4RW8A 1TYQB 5AQNA 3GDQA 4CF8A 1FXXA 3DRSA 4ISGA 3E66A 4IFEA 4AHCA 3CPWM 3R9PA 4DSKA 3OTOK 2NRZA 1KAXA 1NJXA 3LM2A 4QS7A 1BO5O 4FZZA 1F21A 4WE1A 3L3UA 3AO4A 5AQQA 2ASPA 3AVJA 3ZSWA 4CJSA 3NGYA 2XY6A 2PFUA 1QQNA 5T7BA 4LFCK 3LALA 3WNGA 2A42A 2FSKA 2KZZA 4E89A 3CQ8A 1A5WA 5BPNA 1HYZA 1VQNN 3ZT2A 4HUGA 5AQXA 5C25A 3EE8A 5FROA 1BG3A 3ZT4A 2QWRA 3MEEA 5BRDA 1Z25A 1BQNA 1H1VA 3OYAA 2EHGA 4NO7A 1VQ7N 3CCVN 4CEQA 3HBTA 4NCAA 2OANA 3P38A 1Q7YO 3CQYA 1NGGA 1C0GA 1NG9A 3A2FA 3E9PA 3TAEA 4JKDA 1NGCA 3NE6A 4IEIA 3ULEA 2HBLA 3LP2A 2AJQA 3UKUB 3MEDA 2R7YA 3LP0A 4CHQA 3ENHA 1BA0A 3VEOA 5BPMA 3S3NA 1BOTO 3GG4A 3FGUA 3G4SN 3KKRA 3MCPA 4IFVA 4C1NK 4DF8A 4IO8A 3SUNA 2Q31A 5LMNK 3P31A 3JAMO 5FPMA 1VQ9N 4FOIA 1TGOA 1X3MA 3L2VA 1B9DA 5K14A 4DV3K 2GWJA 3KLIA 3HPOA 3SV4A 3ULDA 3N4PA 3RR7A 1NK4A 4F9OA 4CJRA 2A41A 3CM5A 4MQ3A 2GUIA 4PHTX 4OPJA 2DFHA 1EXQA 1BWFO 4NLCA 4FJXA 3J7AP 1VSEA 4XH1A 3LPUA 5CYQA 3SAGA 5HBMA 4H0XB 4GV6A 2OPPA 2FXUA 3V1RA 4E7LA 4B9TA 5C42A 4DTPA 1YXQA 4RG8A 5LJVA 1ESVA 4KB1A 3CCSN 1IV0A 1QHAA 4FWQA 5AZIA 3MN6A 3MDQA 4CF2A 4MO5A 1U2VB 3WEEA 1YAGA 2VWJA 2D0BA 4CF9A 3SJHA 3DLGA 4HUFA 3AA2A 4CJWA 3LDOA 2FBYA 3O80A 4PWDA 3DYAA 1VQ5N 1S9GA 2RN2A 5AFUA 3PO4A 2O8DA 4KB0A 3KWIA 1XNQK 3DXKB 2VG6A 3ZSVA 1ZC6A 2O8EB 2Q3SA 2I7PA 3M1FA 4CGGA 3T19A 4BVOA 4E7HA 4QAGA 4G9ZA 3VGKA 2D0AA 2Q97A 2KW4A 1D5AA 3LZJA 2YNGA 3OYKA 1C0MA 3P4IA 1BHLA 3KTQA 3OYGA 3IDHA 3AO2A 4F8RA 1DTTA 3CC2N 3A0IX 3HVTA 3NF9A 3D2EA 3ITHA 3SBGA 4CE9A 3V4IA 1G99A 4U67L 3D6RA 3WXIA 1CZAN 4CJQA 4DLGA 1RDDA 2ZJRL 3S3MA 2YNFA 3ISNC 2VWBA 4ILJA 3OJUA 4Q0BA 5AQZA 3U9DA 3HPHA 5EY4A 3ZEUA 2IS3A 2E8AA 2HHQA 1L3TA 2D1KA 4HCBA 3IAYA 3JXUA 4CZLA 4KRFA 3O4QA 5BN8A 3VQDA 2UXBK 3TU5A 2HOEA 3C65A 3DXMA 3KIOA 3DI6A 4B9LA 4LSNA 3OS0A 3SV3A 2O8CB 1JLAA 3NGZA 4K42A 3A5NC 1OH7A 3PX0A 2NRHA 2WTUA 1JXBA 3K58A 2QWPA 5AQHA 5ADXH 4BY9C 3BUZB 4X66K 4Y0WA 1TL1A 3AVMA 4JKFA 4DFKA 4FWMA 2E1YA 4IG3A 3AO3A 1B9FA 1TUUA 3MN5A 1QSSA 3VEZA 2G8HA 3O08A 3LZIA 4I7FA 1ITGA 2VQEK 2P5GA 4CIFA 4DV5K 4B1UB 5AQRA 3AGKA 2DFFA 2G8KA 3BZCA 2KQ2A 4FJKA 2G8VA 2VG5A 4JI7K 4DQPA 1VSFA 4MDAA 1NJWA 4H5RA 4C23A 4YOTA 1KVAA 3FFIA 1N32K 2IC3A 2FF3B 2W40A 3MK6A 3MN9A 3HOSA 4WQ4C 4RTFD 2P9IA 2WOMA 1JLGA 2B5JA 4EZ6A 3SPYA 1E4GT 3O3GA 3J80O 1CXUA 1NKBA 4LFBK 1Q9YA 3DLKA 3HM9A 3V9ZA 3QICA 2I7NA 1M1KO 1NGBA 2F4VK 4WQ5A 4M45A 5BN9A 2OA8A 4CF0A 1RILA 2P9KA 2OPRA 2QW9A 4FWRA 5DK5A 1XMQK 2O8FA 3CFPA 1XUPO 4JI4K 1YJ9N 2A3ZA 3LDQA 4ILGB 3B6OA 2IVOA 4C8LA 1RDCA 1LW2A 1C1CA 2OZMA 5JLFA 1MA9B 3W0LA 1HKCA 3THYA 4PKHA 1KCFA 3TI0A 3IFRA 2JLEA 1XMOK 4BQLA 2D4WA 3K2PA 4B3OA 5HL7L 1TKXA 3WEEB 2HHXA 3E01A 3K59A 4MFBA 3P5JA 2WONA 3LPTA 4CHYA 4EHTA 2QWMA 4FM0A 1RDBA 4B1YB 3R8EA 1S1UA 2VQFK 1FW6A 5ELZA 3L2QA 3E9OA 1S1WA 2O8DB 1DGKN 1OVQA 3O1WA 2ZJQL 4WFAL 3FZLA 4XEIA 4L8RB 5I9EB 2XHBA 2G8UA 4M41A 1JJ2M 4JI8K 2F96A 1VSJA 1BIUA 3L6QA 5KQDA 1IG9A 1SKSA 1YVUA 4DU3A 3K5MA 3DWLA 1X1PA 3OY9A 3ZSQA 4KREA 4DR5K 4CZIA 1W7AA 4BR0A 4DTRA 1VQMN 3F2KA 3I8DA 1ATSA 4X65K 3OYLA 1U45A 1CZBA 3VEYA 4CBWA 1TYQA 1VSMA 4FO0A 4CEFA 4C8OA 4CBXA 4ID5A 3VQQA 4Z4CA 2E2OA 3D0PA 4MLHA 3H45C 1C0UA 4N5SA 3KK3A 4BRLA 5BR9A 1IBLK 3DM2A 1NGJA 4JHDB 3T69A 3SCXA 3RMCA 4K43A 3AVIA 2YI1A 5TKWA 1J54A 2E2QA 1BDGA 3U4LA 1ASWA 2DY4A 1RBUA 2ASOA 4KAZA 3AVNA 2XY8A 3NVMA 3VPZA 2Q36A 4DMNA 3SUOA 4A61A 3RRGA 4DTSA 3FFKB 4UQGA 2HVHA 4DSEA 3SI6A 3FR0A 4JK9A 3K5OA 3CFRA 3ENBA 1LWCA 5HOOA 3CMAN 2VCPA 1VSDA 3CI5A 4ICLA 3C0BA 4CESA 3KLGA 3CQXA 4W5NA 3I33A 1KXPA 1TV6A 3AAQA 1UOCA 4Z4GA 4Z4HA 5KQ8A 1KTQA 3RRHA 4FYDA 3THWB 3UKUA 1TK0A 4GVMA 4EP5A 1S1TA 4B9UA 2Z1JA 2QXLA 2KZMA 1WN7A 1WB9A 1SKWA 1Z05A 2W41A 4DQRA 1C1BA 3K5NA 4EZ9A 4FLZA 2OPSA 1R59O 1UA1A 2F8TA 2V51B 1KQSM 4B3MK 4LY7A 4CIGA 3M6GA 3O6WA 4CJ4A 2HHUA 2D5RA 3CCUN 4CGFA 4GKKK 5M1NA 4W5QA 4CJUA 3VQAA 3SK3A 3KLHA 3I0SA 5BRFA 1S72N 3TSUA 3AAPA 4BWMA 4CD1A 4DTJA 4E7JA 3F9KA 2P9KB 1TK5A 2A40A 3AVKA 4LF9K 3LM9A 4I9QA 4GV3A 4Z4IA 5AQLA 4KHQA 2O8FB 3AVGA 3NH1A 4GKJK 4KKOA 1HUXA 2DFEA 1RFQA 2OYQA 4CK1A 4K0KK 4CJPA 4DTNA 4MLEA 1UA0A 3WUHA 4B8CA 3VF6A 3W3DA 1XNRK 3PLAA 3THYB 4CHOA 5F0XA 4NYFA 5HRSA 2KTQA 3TTFA 4M3YA 3DAWA 2E6MA 1HNVA 3HXMA 2ITMA 3E9LA 4CERA 1U48A 2FC0A 5A2QO 1WLJA 4KFBA 2RHKA 1ASUA 5HRPA 4A5AA 1UAXA 1Q82O 3OYCA 4FJGA 4YNQA 3OBYA 4FWOA 4BC5A 1QE1A 4M3WA 4WF9L 4Q5VA 4FW2A 3CCMN 4BRCA 4KPYA 4K8ZA 4NXNK 3KKSA 5EVZA 1WBDA 4KHUA 1ATRA 2YHYA 1VRTA 3QMLA 4HHTA 3PUFA 1NGHA 1VQPN 3HSCA 4KHNA 1B92A 3ZETA 4E0DA 4KH6A 4JKGA 4FLUA 1KFSA 3CD6N 1J6ZA 4CEEA 4O0JA 5J2QA 3G10A 4O4GA 1TVRA 2HNDA 1N8RO 2V52B 4CZKA 3DMJA 1MWMA 4LH4A 3H1VX 2PZSA 2KFZA 4FLTA 4FJLA 3EZ5A 4DFPA 3RMBA 3NVKA 1RTJA 5AQJA 3ZSZA 2XO7A 4FWNA 2NZTA 4JNEA 5E41A 2QWOA 3A8YA 2QWQA 1XHZA 1RTHA 5AR0A 4KH4A 4N76A 4FJ8A 3MWPA 4M3XA 1D9FA 3QNOA 4CZGA 1QZ5A 4DSIA 3ENOA 4EFHA 1TL3A 3F73A 4OLBA 5AQMA 1G15A 1NGFA 5JVGL 4IDHA 5CR4A 3QETA 4BE0A 4BROA 4CIEA 4JKAA 3S3OA 3QIOA 3BP8A 4NYNA 3FLCO 2RKIA 4BVPA 2DPNA 1DKGD 4ZTFA 2P9UA 2OPQA 4IZ9A 4B1WB 4CJLA 1J5OA 1RBSA 2D0OA 3VTHA 4CD3A 2O8CA 1JLFA 4BGBA 2UXCK 2AA4A 5CZ2A 2WBNA 2P9LA 4I2PA 4NXMK 5GINA 2VWKA 4NCBA 1NU0A 1GLJO 1BA1A 4H03B 5FPEA 1HNZK 2QKKA 3IRXA 3O9SA 1MDUB 1BUPA 4OJRA 2UYTA 4FJNA 4B1XB 3PY8A 3NF7A 1YIJN 4CZMA 2FBVA 3VQ4A 3KZBA 4KHPK 1T3VA 5J2MA 4KHSA 5J2NA 3G0ZA 3TR8A 4CEOA 2QKBA 5C12A 4PUOA 3QFUA 1HPMA 3CYMA 2O4GA 2JWLA 4YDUA 4BRIA 3T1HK 2V7ZA 2NRVA 1VSLA 1NNEA 2GEMA 1XWLA 2GX9A 1M90O 1HRHA 2Z1HA 1ZBIA 2YHXA 4H5WA 3CCJN 3K57A 4E3SA 2GWKA 3SMSA 1Q86O 4H5NA 3NMUA 3NBPA 3KK2A 2VGNA 4JD2B 3DOKA 3QFPA 3VTIA 4CFAA 1CZ9A 1TK8A 1S1VA 2FBXA 3AVFA 3A5MC 4YOVA 3TARA 3RWUA 2YJFA 3EN9A 2P9SB 2RF2A 2HHTA 3H1QA 3SMPA 4YOWA 4IOCL 4M3RA 3HOTA 4C8KA 2FF6A 4CJ5A 2E6LA 4M42A 4FW1A 3HSTB 3OYHA 1SQKA 3NH2A 3DLLL 4BGAA 1HR0K 2ZJPL 3DRRA 3RVCA 1Q8IA 4CJ7A 3LWMA 1U49A 3MXIA 2Q2RA 4IDKA 2YX6A 4C8NA 3K5LA 3BF1A 4DKWA 5FRMA 5KRTA 4BC4A 1QVGM 1VK0A 4KI6A 4CZFA 5M1QA 2HNYA 4FJ5A 2QTDA 2O8BB 2W6KA 3TTDA 3ATVA 3QERA 1QQCA 4BR4A 2RPIA 2QWNA 1K73O 1LCUA 2YNIA 1ZBLA 1K9MO 5C0YA 5AQFA 3ZETB 4RW6A 1HKBA 5GIOA 3NCIA 4JKGB 2JWKA 2AP1A 3BY5A 4Z4FA 3WQUA 1ZBHA 1NK5A 3TAPA 2GTDA 3MECA 4FM1A 5C10A 3VEVA 2PY5A 4EAHD 3DLBA 3WNEA 1JL1A 2CGLA 1E4FT 2BUPA 4CHZA 3KLFA 4CJKA 5J1EA 3GOIA 1FKOA 1NGEA 1MWKA 4AM7A 5BRHA 3WXKA 2HF3A 1L3SA 1KVCA 4DB3A 3TAQA 4N56A 1RT6A 3VQPA 3BDPA 3KHYA 4H5TA 1IO2A 3C6TA 3KD5E 3QEPA 1S22A 1WSGA 4JHDA 3EKUA 3K0SA 4FVUA 2X6SA 2XRIA 3O4WA 4GVEA 3V6DA 1VSHA 1NJYA 3H3OB 2HHSA 3P39A 1HJRA 3NFAA 1KSPA 3L3VA 4YOYA 2P9UB 4JEPA 4LD0A 3FZKA 3L4IA 1BQMA 4FPBA 4FJJA 1S5JA 3CC4N 4IO9L 2P9LB 3O8MA 2OZSA 1QQOA 4ELVA 3HL8A 4O5FA 5AQKA 1K8AO 4BRKA 3R6MA 5GAEP 4DV0K 2D0CA 4O0IA 3OS1A 2CGKA 4B1ZA 3O9QA 4OPHA 1Q18A 5AZJB 4ELTA 4PQUA 4FSVA 4JRPA 4X62K 2W6LA 1GLEG 4CBUA 2G8FA 4DFMA 3V81A 1REVA 2QXFA 3SUQA 1RT3A 5J2PA 1W9HA 4HTUA 1EO1A 1Z26A 4DF4A 4KHWA 5F1XA 3WXMB 5C2FA 5JICA 4M3ZA 3THWA 1IKWA 3L0QA 1HLUA 4C8MA 3LAMA 4A59A 3M8SA 1NK8A 5M1OA 4WQ5C 4FLWA 5DM6L 1J5EK 1RGIA 3AV9A 3TSPA 4K41A 4DSJA 4JS4A 3KK1A 3VQ9A 1WOQA 1XQSC 1DTQA 1ATNA 4A57A 4EP4A 1VQ8N 5DMRA 1Z6RA 4GW6A 1YHQN 4E19A 2HW3A 4JKBA 1JLBA 2X6NA 3VQEA 4DR4K 3OJSA 1IKYA 4H5VA 4DU4A 3ZYYX 1WSFA 3HM8A 5JMVA 4GMJB 3QEWA 1RNHA 3SNNA 5HLFA 1NOYA 1GLFO 1VSIA 1WSIA 2E2NA 5BR8K 3H08A 3GL1A 2CH5A 3KWGA 1T7PA 3CETA 3OA9A 3JS6A 3ZCMA 2HHVA 3IS9A 4DV4K 4A2AA 4B9SA 1KD1O 1NK7A 1T03A 3MXMA 3OBWA 1NGIA 1WSHA 2RE2A 1X3NA 2FBTA 3CJ9A 1VQON 3UIQA 3UB5A 5HRRA 2Z1IA 3O3FA 4J8FA 3LANA 2YHBA 3FZFA 1WSEA 5AQOA 1X9MA 2E2PA 4FWSA 5SWMA 1T6DA 4IJAA 3TANA 4L3QA 3DLHA 1SV5A 3V9WA 1N6QA 4CZJA 5AJ3K 1XC3A 1SUQA 4BC3A 2X74A 4OGEA 3QLHA 1SZ2A 3AVCA 4LF6K 3R1XA 4JI1K 2ZD1A 4KO0A 4R5PA 4V19S 4O8UA 3TAGA 1EWQA 3NAEA 1U04A 4RW9A 4Y1CA 5I42A 4J2DA 5FLXO 5AQTA 3ZSRA 5LL6Z 4DV2K 1W2BM 1OH8A 3O9RA 4E1MA 4B9NA 3SAHA 4FWLA 3LP3A 4DFJA 2NUBA 1RT5A 4ID1A 3I56N 1Q81O 1S1XA 5HROA 4PL8A 1QS4A 1BISA 4K8XA 1RDWX 3AA3A 3AARA 3L8BA 4B9VA 4O5BA 3CCRN 2P5OA 3C6AA 3TABA 5D3GA 4LC9B 1R0AA 1X9WA 3EZWA 4O44A 1Y97A 4FCYA 1YJWN 3SPZA 3LDNA 4CW7B 3CCLN 3NF8A 1T44A 2LSNA 4M7YA 4XIUA 1P90A 2PBDA 3CXCM 1HNWK 3V9UA 1FK9A 3CJAA 5GAGP 2UUBK 2ZQBA 4OKEA 2X78A 3L2WA 1VAZA 1GOAA 4GNIA 4CHPA 3HZ6A 2BE2A 3EEQA 2KHOA 4DR3K 2P9PA 1NGAA 3T1YK 2ASMA 2DTUA 3BEXA 2PYJA 4CGDA 1RTIA 4F2RA 2QM1A 4PKGA 4KHYA 1I3AA 3ZT1A 1ZBUA 3BZKA 1LWFA 1VQKN 4DQQA 3H6EA 4G1QA 3HYFA 3EYZA 4OO1J 2P51A 4B3RK 4JI3K 3QEXA 5CE3A 5AQGA 3KVGA 4E1JA 1NK9A 3VQCA 3ASMA 4DSLA 4JAXA 5KPTA 5M1FA 2Q0RA 4J2AA 3CC7N 3PSIA 4IWVA 1YF5L 1KAYA 4LF5K 4FK2A 3MXJA 2O4IA 3V9SA 3R3LA 1KRPA 4AHTA 1N5YA 2WFBA 3VESA 5AQVA 4FJMA 3AY9A 4JD2A 1LOTB 2E1ZA 1GLAG 5H1SQ 1OH6A 2IAJA 4CJEA 4DLEA 1N33K 4WCEL 3FZHA 4I6MB 2HMIA 3QO9A 1YVNA 5AFUH 5ADXA 2P9SA 2D0PA 2CGJA 3JSMA 1RCHA 1KFDA 3O9UA 4I2QA 4LSLA 3QB0A 1TKZA 1YTUA 1D9DA 4MO4A 3M5RA 3PIPL 3WNHA 2QA4N 1C0FA 3PX6A 3QEIA 2ZGYA 3C94A 4F2SA 3QINA 4CFBA 4CJFA 3HI0A 3SQ2A 4IXCA 3VQBA 3RMAA 4JKHA 4BR7A 4DV6K 2IVNA 4DHYA 3Q7CA 1IBKK 4NB4A 2Y1JA 1JCGA 5GADP 4CFDA 4FZYA 4YOXA 1QVFM 3OYFA 3CFOA 3KK7A 1NKCA 1VQ4N 4JRQA 3L4QA 4H0YB 4IEEA 2O8BA 1IJJA 1S6QA 1Y64A 1YTAA 5EOYA 3G25A 1XHXA 1LV5A 5MLCQ 3J81O 4YHHK 1XC9A 3ZX2A 3D7EO 1N36K 2PAVA 4OLAA 1HQEA 4FL9A 4BE1A 3S9HA 1EP4A 1GLBG 1HX1A 4CZHA 2BANA 2NRWA 5C15A 1KLNA 4AH9A 3THVA 1YI2N 4JKCA 2UUCK 4EIAA 4CEZA 4DTMA 3CPEA 2HHWA 1JXEA 1TKDA 3WXJA 3HK2A 4LF4K 3T1AA 3OHRA 1RDUA 2HBMA 2B4JA 1C6VA 4FVMA 5KGWA 1DLOA 1ASVA 3TAFA 1EQYA 4TSXA 1GLDG 4CF1A 4QS8A 4DS5A 2IOCA 2E4LA 3ZSOA 3QESA 3RR8A 1RT2A 3I55N 3K9JA 3NGIA 4K25A 2GBZA 3VQ6A 5LY3A 3EKSA 3TPQA 1FKPA 1BL3A 4CGHA 2GELA 4FWKA 3VENA 4KI4A 3HT3A 5HP1A 4YFUA 3VGLA 1A5VA 3VMFB 4BC2A 1DT9A 4CHNA 4AM6A 5JS1A 4RWTA 2P9PB 3AO5A 1TAQA 4PA1A 5FPDA 4HTLA 2ATQA 4Z0UA 3HP9A 1NOZA 2YCHA 2NRXA 3KJVA 1MU2A 4YDUC 3M8PA 1WUAA 3VF2A 4JI0K 1L3VA 3V1OA 3PO5A 3OYEA 4DTXA 2ZGZA 4FOEA 4H0VB 5JLHA 3HRGA 1LWEA 2XY7A 5AZJA 1BGXT 2ZF5O 3LAKA 1IKXA 1LAWA 1NM1A 4FPAA 3CERA 1K6YA 3MWTA 3QEVA 4N41A 2ZM6K 3U9ZA 3HP6A 4B3TK 1HJOA 2Y1IA 3VOVA 3VETA 1HNIA 1JLEA 5IT9O 1ZBFA 1QZ6A 4IFYA 4A2BA 3K9KA 3NDKA 3QNNA 3EO3A 4J2BA 3D2FB 4CEAA 4BDYA 4CEBA 4JI5K 3CJ1A 3HPGA 5I3UA 4BRGA 3N4QA 4BR2A 3LDSA 3BGRA 2JGUA 2YHAA 3AO1A 4CJTA 5E84A 4O55A 3MX2A 1V4SA 2ETJA 4ILHA 2HMPA 1I39A 3SAFA 1WAFA 5B8HA 1U47A 3LDPA 4BWJA 2UU9K 1V4TA 2YHWA 2IDOA 1X9SA 4QCLA 1OKJA 1RT4A 2IIRA 1DEJA 2OCEA 3IG1A 3RSEA 4H8KA 4DV1K 2VYPA 3MX5A 3DRPA 1KVBA 3OYMA 4M63C 2WUSA 3M8QA 4OX9K 1P8ZA 4ZHRA 3CMEN 3CJ7A 3ZT0A 5EU7A 3T7ZA 4F4KA 5F2RA 3ZX3A 3BF3A 3O1BA 4DWIA 4IBNA 4DUYK 1SL1A 3FZMA 2UUAK 4BDPA 1KLMA 5M1PA 4CGIA 3TAMA 3VF4A 5C24A 2HBJA 1WSJA 3IUCA 4OKKA 3UKRA 3U3YA 3B6PA 3SJJA 4DQIA 4BR5A 3OVNA 4CK2A 4XH4A 4N47A 3RMDA 1ZXOA 4CEDA 4M7XA 4JLHA 5GIPA 4OGCA 4AF1A 1NMNA 3V9XA 1GOBA 1W0HA 4M3UA 2VGMA 4BRAA 4BRDA 1QSLA 3D45A 3NF6A 3A5LC 4GY2B 5JVHL 1LAVA 4BG8A 4FJ9A 2HVIA 4LFAK 2P1JA 4IKFA 2QEXN 4JKEA 4AILC 1NLVA 4DTUA 2E5LK 4J2EA 4JI2K 1IBMK 4DR2K 4FWPA 4DTOA 5AQUA 2BGGA 4DQSA 3PV8A 5FRNA 3M8RA 5AQIA 1VQ6N 4B8AB 4ELUA 4U7BA 2H3GX 5GAHP 1FJGK 4KTQA 1NBWA 1YITN 1W97L 4NLBA 4KH5A 4EHUA 1Q9XA 4H0OA 3P1GA 4DSFA 3C7NA 1RTDA 3FE1A 2EX3A 3TTCA 1J9AA 4B08A 3CJCA 3G6EN 2G8IA 3E1YA 3ZSXA 4BRPA 4PKIA 3VN5A 3VA3A 3SZ2A 2KFNA 3DLEA 1N34K 4BR9A 4JN4A 3OYNA 4IOAL 4OPKA 2KLAA 4R79A 3MN7A 3J8AA 2W42A 4WFNL 3ZLJA 1CLQA 3O4NA 1EKEA 1T6CA 1RDAA 4KTZA 4X64K 4A62A 4FLXA 2CH6A 1TKTA 1IKVA 1JCFA 4DR7K 2A6AA 5FDLA 3DLRA 5BREA 3SLCA 1SS6A 3G71N 1NJZA 2HSTA 4XH5A 3PX4A 1J53A 4O8KA 1TAUA 3ULEB 1IG8A 5M1KA 4AHSA 3VQ5A 5KPRA 3B8AX 1WBBA 1S6PA 4B9MA 2I5JA 2V7YA 2BH1A 4DU1A 3WXLA 4QOZB 4M3TA 1HMVA 3GE1A 3LDLA 5BPLA 1IH7A 1L5UA 5CYMA 5HRNA 3IMXA 3MEGA 4HUEA 1O1WA 1JLQA 3SYZA 4BRMA 1GLCG 5KRSA 4CI6A 3L2RA 3M3ZA 3AVBA 5AQPA 4MDBA 4B9QA 2P9NA 4CJVA 1NKEA 1WNSA 2J4RA 4BRFA 4BG9A 1VQLN 4H4OA 4RW7A 1KAZA 3RSEB 4I6MA 4OKJA 2XY5A 2QI2A 1JL2A 3ALYA 3OS2A 4F3TA 2VG7A 3AVLA 3DJCA 3I0RA 4Y1DA 1BIZA 1HNXK 4AHRA 2FSJA 3WNFA 4CGJA 4DR6K 4AHVA 5EX5A 1VHXA 4HWIA 3U8XA 1T8EA 3ATUA 2ZWHA 4BRNA 4YORA 3U3GA 5SZTA 4WQ4A 1VRUA 1UWBA 4GV9A 4LH5A 4W5TA 2B6AA 3VQ7A 3U6FA 2F8SA 4FK4A 2HHHK 5E26A 4H4MA 3ID6A 3UKRB 4H0TB 4AQYK 4FJHA 1OVYA 2BDPA 4IG0A 1VSKA 2ZE2A 3NH0A 3T3FA 5AZIB 3MCAB 1D4XA 2G8WA 1BI4A 3SQ1A 2IGIA 4JI6K 3P83D 5KGXA 5FPNA 3I8BA 1ZYQA 2HBKA 4F3OA 3CHWA 4IOXA 1ZBSA 3ZT3A 3CCEN 4HVJA 3F9MA 3JYTA 4CCHA 1JLCA 3NHGA 1RBTA 4ISFA 1EETA 4RCHA 3AA5X 3PIOL 4WYBA 2HF4A 3CIPA 3GBTA 1SKRA 1U6ZA 2A1RA 2KKZA 1E3MA 3CCQN 3J7ZO 4IJNA 1JCEA 2F9WA 1HKGA 4JS5A 1SL0A 3S41A 4DG1A 4FZXC 3OW2M 3OYJA 1K8KA 4BRHA 3WQTA 3MMVA 1JKHA 5KPZA 3HO1A 2OTLN 1A5XA 2F9TA 5TKYA 4KBOA 2YV0X 1QSYA 1TUYA 3D2EB 3THXA 1RBRA 3C7NB 3TSQA 1L3UA 3MAQA 5LMUK 4UY8O 3SQ4A 4CVNE 3VGMA 2GUPA 3WT0A 4FK0A 2E88A 3LL3A 3EL2A 3ZEUB 4DS4A 1S3XA 4AHUA 1LW0A 4W5OA 1HYSA 2FLOA 5DM7L 5C2DA 4BRQA 3RTVA 3SBTA 4LF8K 2PYLA 2F7TA 1HYVA 3DXMB 4Z4EA 1QTMA 4JV5K 4BE2A 3KD1E 3VERA 4E7IA 4QS9A 3HVRA 1BCMA 2EWSA 1HQUA 4CZEA 1NGDA 1D8YA 1O13A 3ZSYA 4BREA 2FSNA 3OYBA 3V1QA 3UE5A 4KV8A 3SUPA 4I9LA 1GLLO 3F5TA 3O3HA 4JK7A 4RW4A 3CJBA 3CG7A 3C95A 4C1NI 3CF5L 3HTVA 4FLYA 3QBXA 3TWHA 3C6UA 3QDKA 4DUZK 1EX4A 4E7KA 4DCHA 1BU6O 2QK9A 3OYIA 1YUWA 5KI6A 5JS2A 4DV7K 1YJNN 4FM2A 2NRRA 4A5BA 1HPZA 3ZX0A 3D2FA 4DQ8A 4E1NA 3LWLA 1NK6A 3J7YP 2WC9A 4LF7K 4Z94A 5AQSA 1EWRA 1RT7A 3L2UA 2P9NB 4H0PA 3VQ8A 4FJIA 3HJFA 3H46O 5KTQA 2P9IB 2Q1NA 3EY1A 1ILYA 1S9EA 1SL2A 1XI1A 2NLXA 4WFBL 1X9JA 3CM6A 4CFCA 2UXDK 4PY5A 2IVPA 1NMDA 4B1VA 1I94K 5EXWA 1SAZA 3ID8A 4NCGA 3LP1A 4CK3A 1WAJA 5AQYA 4BQZA 2NNWA 4HCCA 3A5OC 4FJ7A 1BCOA 1CXQA 2Z1GA 2BTFA 5AQWA 4YY3K 3AA4A 1KC8O 1YT3A 2QWLA 2NRTA 2HB5A 4JYAK 3AGRA 2E20A 3VA0A 3C6HA 1QHTA 2GV9A 5LJWA 4KTWA 5IWAK 3IKMA 1BI4B 2A1SA 4W5RA 1GOCA 5CZ1A 2YKMA 1RBVA 3KLEA 3DOLA
chains in the Genus database with same CATH topology
2CGKA 4FO0A 4CBXA 3SAFA 5B8HA 2YJEA 4B1ZA 3O9QA 2E2OA 4OPHA 3LDPA 1Q18A 3H45C 4MLHA 5AZJB 4BRLA 2A5XA 1V4TA 2YHWA 4FSVA 5BR9A 1NGJA 1GLEG 4JHDB 3T69A 4CBUA 3H3NO 1QQMA 4JK8A 1OKJA 3QBWA 4K43A 3O9TA 2IIRA 2Q0UA 1DEJA 3EE9A 2YI1A 1U2VA 5TKWA 3RSEA 1EO1A 2VYPA 5F1XA 3MX5A 2E2QA 3WXMB 1BDGA 4M63C 5C2FA 5JICA 2OTJN 3U4LA 2WUSA 1P8ZA 3CMEN 3L0QA 2ASOA 1NJIO 1HLUA 3CJ7A 3VEXA 1K8KB 3T7ZA 3NVMA 4A59A 3VPZA 2Q36A 5F2RA 4A61A 3ZX3A 3VEWA 4PL7A 3BF3A 3O1BA 4WQ5C 5M1OA 3DXKA 3FFKB 4BRHA 1NWKA 5DM6L 3O5BA 1RGIA 4ISEA 4OPAA 5CHIA 3Q7BA 4YOUA 3TSPA 4K41A 3FZMA 3FR0A 4JK9A 5M1PA 1TYQB 3ENBA 5AQNA 5HOOA 3CMAN 3GDQA 2VCPA 3VF4A 3CI5A 4ISGA 1WOQA 1XQSC 3E66A 1ATNA 2HBJA 3C0BA 3IUCA 3UKRA 4A57A 4IFEA 3CPWM 4BR5A 1VQ8N 3R9PA 4XH4A 2NRZA 3CQXA 1Z6RA 3I33A 1KAXA 1KXPA 3AAQA 3LM2A 4QS7A 1YHQN 1BO5O 4JKBA 5KQ8A 1ZXOA 4M7XA 4H5VA 5GIPA 4AF1A 3ZYYX 5AQQA 3HM8A 5JMVA 2ASPA 1GLFO 2VGMA 2PFUA 3UKUA 1QQNA 2E2NA 4BRAA 3GL1A 2CH5A 3KWGA 2A42A 4BRDA 2FSKA 3CETA 3OA9A 2QXLA 3A5LC 3JS6A 4GY2B 5JVHL 4BG8A 5BPNA 1Z05A 4A2AA 2W41A 1VQNN 2QEXN 4JKEA 1NLVA 1KD1O 5AQXA 1R59O 2V51B 3EE8A 3OBWA 1NGIA 4FWPA 1KQSM 3M6GA 3O6WA 2RE2A 1BG3A 1X3NA 5AQUA 2QWRA 5BRDA 3CCUN 3CJ9A 1VQON 5M1NA 3UB5A 1H1VA 5AQIA 1VQ6N 3SK3A 4J8FA 4NO7A 5BRFA 3FZFA 2H3GX 4U7BA 1S72N 1VQ7N 3TSUA 5AQOA 5GAHP 3HBTA 3CCVN 3AAPA 2E2PA 2OANA 3P38A 4FWSA 3CQYA 4CD1A 1Q7YO 1NBWA 1YITN 1T6DA 1W97L 2P9KB 1NGGA 4IJAA 1C0GA 4KH5A 4NLBA 4EHUA 2A40A 3E9PA 3LM9A 4H0OA 4JKDA 4L3QA 1NGCA 4GV3A 3C7NA 3FE1A 4IEIA 1XC3A 5AQLA 3TTCA 3ULEA 4CZJA 2HBLA 4BC3A 3CJCA 1HUXA 3UKUB 3G6EN 1SZ2A 1RFQA 3E1YA 4BRPA 4PKIA 3R1XA 3ENHA 4O8UA 1BA0A 3VEOA 5BPMA 4MLEA 1BOTO 3GG4A 3VF6A 3W3DA 3WUHA 4JN4A 4BR9A 3PLAA 3FGUA 3G4SN 4IOAL 5F0XA 3MCPA 2KLAA 4C1NK 5AQTA 3TTFA 3DAWA 4R79A 3MN7A 3J8AA 4IO8A 4WFNL 2ITMA 3E9LA 1W2BM 1T6CA 2Q31A 3O9RA 3P31A 5FPMA 4FWLA 4FOIA 3SAHA 1VQ9N 4A62A 2RHKA 2CH6A 1JCFA 4A5AA 2A6AA 1X3MA 1Q82O 3I56N 3OBYA 1Q81O 5BREA 4FWOA 4BC5A 3SLCA 1SS6A 4WF9L 3G71N 2GWJA 2HSTA 4PL8A 4XH5A 3CCMN 4BRCA 4O8KA 1RDWX 3AARA 3N4PA 4F9OA 2A41A 3ULEB 3CCRN 5EVZA 3C6AA 1IG8A 4LC9B 4PHTX 5M1KA 1ATRA 5KPRA 2YHYA 3QMLA 3B8AX 3EZWA 1BWFO 4NLCA 1YJWN 1NGHA 1VQPN 3HSCA 3LDNA 3CCLN 2V7YA 2BH1A 4XH1A 3ZETA 1T44A 4M7YA 3WXLA 1P90A 3GE1A 4JKGA 4KH6A 3SAGA 3LDLA 2PBDA 5BPLA 3CD6N 1J6ZA 3CXCM 3CJAA 5GAGP 3IMXA 4H0XB 4GV6A 2FXUA 1N8RO 1VAZA 4GNIA 3HZ6A 2V52B 4CZKA 4BRMA 1GLCG 2KHOA 1YXQA 1MWMA 4CI6A 3H1VX 5LJVA 1ESVA 3M3ZA 2P9PA 3CCSN 1NGAA 5AQPA 2ASMA 3NVKA 3BEXA 4MDBA 2P9NA 5AQJA 4B9QA 1QHAA 4FWNA 2NZTA 4JNEA 2QM1A 2J4RA 4FWQA 4PKGA 5AZIA 4BRFA 2QWOA 3MN6A 4BG9A 3A8YA 3MDQA 1VQLN 4MO5A 1KAZA 1U2VB 2QWQA 1YAGA 4I6MA 3RSEB 3WEEA 3SJHA 5AR0A 4KH4A 1VQKN 3MWPA 2QI2A 3H6EA 3LDOA 4OO1J 3DJCA 4CZGA 1QZ5A 3O80A 5CE3A 3ENOA 4EFHA 5AQGA 1VQ5N 3KVGA 2FSJA 4E1JA 5AFUA 5AQMA 4JAXA 1NGFA 5JVGL 4IDHA 5KPTA 5EX5A 5M1FA 4HWIA 3U8XA 2Q0RA 2ZWHA 3ATUA 3KWIA 3DXKB 3CC7N 4BRNA 4IWVA 1YF5L 1KAYA 1ZC6A 5CR4A 4YORA 4WQ4A 2I7PA 4BROA 3M1FA 4JKAA 4GV9A 3BP8A 3FLCO 4BVPA 4BVOA 2DPNA 1DKGD 4G9ZA 3R3LA 2P9UA 3VGKA 4B1WB 4IZ9A 5E26A 2Q97A 2WFBA 2D0OA 3ID6A 3UKRB 4H0TB 3VTHA 3VESA 4CD3A 1OVYA 4BGBA 5AQVA 2AA4A 2WBNA 2P9LA 3AY9A 5GINA 4JD2A 1LOTB 2E1ZA 1GLAG 5H1SQ 1GLJO 3P4IA 5AZIB 3MCAB 1D4XA 1BA1A 3IDHA 4H03B 5FPEA 4WCEL 3O9SA 1MDUB 3CC2N 3A0IX 3FZHA 4I6MB 5FPNA 1BUPA 1YVNA 3I8BA 3D2EA 2HBKA 2UYTA 3SBGA 3CHWA 4B1XB 1G99A 1YIJN 5AFUH 3D6RA 4IOXA 2P9SA 1CZAN 1ZBSA 3WXIA 4CZMA 4U67L 5ADXA 2D0PA 3KZBA 2CGJA 3CCEN 2ZJRL 1T3VA 3O9UA 3F9MA 2VWBA 4ILJA 3QB0A 5AQZA 3U9DA 5C12A 4ISFA 4MO4A 4RCHA 3PIOL 5EY4A 3M5RA 4WYBA 3ZEUA 2HF4A 2E8AA 1HPMA 3QFUA 3PIPL 3CIPA 1C0FA 2QA4N 3GBTA 2ZGYA 2D1KA 1U6ZA 2JWLA 4YDUA 4BRIA 2KKZA 2V7ZA 2NRVA 3CCQN 2GEMA 3JXUA 4IJNA 3J7ZO 1JCEA 2F9WA 1HKGA 4CZLA 3S41A 5BN8A 2GX9A 3OW2M 3TU5A 2HOEA 1M90O 3C65A 2YHXA 3DXMA 3HI0A 4IXCA 4H5WA 3CCJN 1K8KA 2GWKA 4JKHA 3MMVA 3SMSA 2IVNA 4H5NA 3WQTA 3Q7CA 4BR7A 4NB4A 4DHYA 5KPZA 4K42A 1Q86O 1JCGA 5GADP 2OTLN 3NMUA 4YOXA 1QVFM 2VGNA 4JD2B 3A5NC 3KK7A 1VQ4N 2F9TA 2NRHA 5TKYA 4KBOA 3L4QA 3QFPA 2QWPA 5AQHA 3VTIA 5ADXH 4BY9C 1TUYA 3BUZB 4Y0WA 3D2EB 4H0YB 3C7NB 4IEEA 4JKFA 4YOVA 3A5MC 3TSQA 2YJFA 3EN9A 1IJJA 4UY8O 2P9SB 1Y64A 5EOYA 4FWMA 3H1QA 3G25A 2E1YA 3SMPA 5MLCQ 4YOWA 4IOCL 1TUUA 3VGMA 2GUPA 3MN5A 3HOTA 3ZX2A 3D7EO 3WT0A 2E88A 2PAVA 3LL3A 3VEZA 3EL2A 3ZEUB 4FL9A 3O08A 1S3XA 2FF6A 1GLBG 1HX1A 2FLOA 4B1UB 4CZHA 5DM7L 2NRWA 5C2DA 4BRQA 5C15A 5AQRA 3AGKA 5C0YA 1SQKA 3SBTA 2F7TA 3DLLL 1YI2N 4JKCA 4BGAA 3DXMB 4EIAA 2ZJPL 3RVCA 4MDAA 3CPEA 4H5RA 4C23A 4YOTA 4CJ7A 3VERA 4QS9A 2Q2RA 2FF3B 3WXJA 2YX6A 2W40A 3BF1A 3MK6A 4DKWA 3OHRA 1RDUA 2EWSA 4BC4A 3MN9A 2HBMA 1NGDA 4CZEA 1QVGM 4CZFA 1O13A 5M1QA 3HOSA 4WQ4C 4RTFD 4BREA 2FSNA 2P9IA 2QTDA 3UE5A 1EQYA 1E4GT 1GLDG 4QS8A 3TTDA 3ATVA 1GLLO 3F5TA 4JK7A 4BR4A 3CJBA 2QWNA 1K73O 1LCUA 4C1NI 3I55N 3CF5L 3HTVA 3QICA 1K9MO 5AQFA 3ZETB 2I7NA 1HKBA 3QBXA 5GIOA 3K9JA 1NGBA 3QDKA 1M1KO 4K25A 4JKGB 2JWKA 4WQ5A 5LY3A 2AP1A 3EKSA 5BN9A 4DCHA 1BU6O 3TPQA 1YUWA 3WQUA 2P9KA 2GELA 1YJNN 4FWKA 3VENA 2QW9A 2NRRA 4FWRA 4A5BA 3VGLA 3VMFB 2GTDA 4BC2A 3ZX0A 3D2FA 1DT9A 1XUPO 4DQ8A 4AM6A 1YJ9N 2A3ZA 2WC9A 3LDQA 4ILGB 5C10A 3VEVA 4RWTA 2P9PB 2IVOA 4EAHD 4HTLA 5FPDA 4Z94A 5AQSA 2P9NB 5JLFA 1MA9B 3W0LA 1HKCA 4PKHA 2CGLA 2YCHA 1E4FT 2NRXA 3IFRA 2BUPA 4BQLA 4H0PA 4YDUC 2D4WA 3H46O 1WUAA 2P9IB 1NGEA 3GOIA 1MWKA 3VF2A 3WEEB 5HL7L 4AM7A 2Q1NA 5BRHA 1ILYA 3WXKA 2HF3A 4EHTA 4DB3A 2QWMA 2NLXA 2ZGZA 4FOEA 1X9JA 4B1YB 4WFBL 4H0VB 3R8EA 5JLHA 3HRGA 5ELZA 3KHYA 4H5TA 3E9OA 5AZJA 2ZF5O 1NM1A 1DGKN 3O1WA 4FPAA 1S22A 2IVPA 2ZJQL 1NMDA 3CERA 3FZLA 3MWTA 4JHDA 4XEIA 4WFAL 3EKUA 3U9ZA 4B1VA 5I9EB 4FVUA 1JJ2M 5EXWA 1HJOA 1SAZA 3ID8A 3O4WA 4GVEA 3VETA 3VOVA 5AQYA 4BQZA 2NNWA 3L6QA 3A5OC 3H3OB 1QZ6A 3P39A 5KQDA 4A2BA 3K9KA 3EO3A 4YOYA 3D2FB 2P9UB 4JEPA 3DWLA 3CJ1A 3FZKA 3L4IA 2BTFA 4FPBA 4BRGA 3N4QA 5AQWA 3CC4N 1KC8O 4BR2A 2QWLA 4IO9L 2NRTA 2P9LB 3O8MA 1QQOA 4CZIA 3AGRA 2E20A 3C6HA 4BR0A 4O5FA 5LJWA 1VQMN 3IKMA 5E84A 3F2KA 5AQKA 3MX2A 1K8AO 1V4SA 4BRKA 3R6MA 1ATSA 5GAEP 4ILHA 3VEYA 4CBWA 2HMPA 1TYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH1 A;  1YF5 L;  1W97 L;  5TKW A;  4PHT X; 
#chains in the Genus database with same CATH topology
 1U4B A;  1C0T A;  2YJE A;  4ZTJ A;  2A5X A;  3AVH A;  3OYD A;  3H3N O;  1QQM A;  4JK8 A;  4OVL A;  3QBW A;  3PSF A;  3O9T A;  1OH5 A;  2Q0U A;  4B3S K;  3EE9 A;  2YKN A;  4BDZ A;  1U2V A;  1T05 A;  2OTJ N;  1NK0 A;  1NJI O;  3VEX A;  1K8K B;  4FLV A;  4DR1 K;  2YNH A;  3AVA A;  5CY4 A;  3VEW A;  4PL7 A;  3SQ0 A;  1C1A A;  4CJ3 A;  3DXK A;  2HNZ A;  1NWK A;  1RT1 A;  3O5B A;  4ISE A;  4OPA A;  5CHI A;  3Q7B A;  4YOU A;  2O8E A;  4CEC A;  2ITG A;  4FXD A;  3THX B;  3QIP A;  4BAC A;  4RW8 A;  1TYQ B;  5AQN A;  3GDQ A;  4CF8 A;  1FXX A;  3DRS A;  4ISG A;  3E66 A;  4IFE A;  4AHC A;  3CPW M;  3R9P A;  4DSK A;  3OTO K;  2NRZ A;  1KAX A;  1NJX A;  3LM2 A;  4QS7 A;  1BO5 O;  4FZZ A;  1F21 A;  4WE1 A;  3L3U A;  3AO4 A;  5AQQ A;  2ASP A;  3AVJ A;  3ZSW A;  4CJS A;  3NGY A;  2XY6 A;  2PFU A;  1QQN A;  5T7B A;  4LFC K;  3LAL A;  3WNG A;  2A42 A;  2FSK A;  2KZZ A;  4E89 A;  3CQ8 A;  1A5W A;  5BPN A;  1HYZ A;  1VQN N;  3ZT2 A;  4HUG A;  5AQX A;  5C25 A;  3EE8 A;  5FRO A;  1BG3 A;  3ZT4 A;  2QWR A;  3MEE A;  5BRD A;  1Z25 A;  1BQN A;  1H1V A;  3OYA A;  2EHG A;  4NO7 A;  1VQ7 N;  3CCV N;  4CEQ A;  3HBT A;  4NCA A;  2OAN A;  3P38 A;  1Q7Y O;  3CQY A;  1NGG A;  1C0G A;  1NG9 A;  3A2F A;  3E9P A;  3TAE A;  4JKD A;  1NGC A;  3NE6 A;  4IEI A;  3ULE A;  2HBL A;  3LP2 A;  2AJQ A;  3UKU B;  3MED A;  2R7Y A;  3LP0 A;  4CHQ A;  3ENH A;  1BA0 A;  3VEO A;  5BPM A;  3S3N A;  1BOT O;  3GG4 A;  3FGU A;  3G4S N;  3KKR A;  3MCP A;  4IFV A;  4C1N K;  4DF8 A;  4IO8 A;  3SUN A;  2Q31 A;  5LMN K;  3P31 A;  3JAM O;  5FPM A;  1VQ9 N;  4FOI A;  1TGO A;  1X3M A;  3L2V A;  1B9D A;  5K14 A;  4DV3 K;  2GWJ A;  3KLI A;  3HPO A;  3SV4 A;  3ULD A;  3N4P A;  3RR7 A;  1NK4 A;  4F9O A;  4CJR A;  2A41 A;  3CM5 A;  4MQ3 A;  2GUI A;  4PHT X;  4OPJ A;  2DFH A;  1EXQ A;  1BWF O;  4NLC A;  4FJX A;  3J7A P;  1VSE A;  4XH1 A;  3LPU A;  5CYQ A;  3SAG A;  5HBM A;  4H0X B;  4GV6 A;  2OPP A;  2FXU A;  3V1R A;  4E7L A;  4B9T A;  5C42 A;  4DTP A;  1YXQ A;  4RG8 A;  5LJV A;  1ESV A;  4KB1 A;  3CCS N;  1IV0 A;  1QHA A;  4FWQ A;  5AZI A;  3MN6 A;  3MDQ A;  4CF2 A;  4MO5 A;  1U2V B;  3WEE A;  1YAG A;  2VWJ A;  2D0B A;  4CF9 A;  3SJH A;  3DLG A;  4HUF A;  3AA2 A;  4CJW A;  3LDO A;  2FBY A;  3O80 A;  4PWD A;  3DYA A;  1VQ5 N;  1S9G A;  2RN2 A;  5AFU A;  3PO4 A;  2O8D A;  4KB0 A;  3KWI A;  1XNQ K;  3DXK B;  2VG6 A;  3ZSV A;  1ZC6 A;  2O8E B;  2Q3S A;  2I7P A;  3M1F A;  4CGG A;  3T19 A;  4BVO A;  4E7H A;  4QAG A;  4G9Z A;  3VGK A;  2D0A A;  2Q97 A;  2KW4 A;  1D5A A;  3LZJ A;  2YNG A;  3OYK A;  1C0M A;  3P4I A;  1BHL A;  3KTQ A;  3OYG A;  3IDH A;  3AO2 A;  4F8R A;  1DTT A;  3CC2 N;  3A0I X;  3HVT A;  3NF9 A;  3D2E A;  3ITH A;  3SBG A;  4CE9 A;  3V4I A;  1G99 A;  4U67 L;  3D6R A;  3WXI A;  1CZA N;  4CJQ A;  4DLG A;  1RDD A;  2ZJR L;  3S3M A;  2YNF A;  3ISN C;  2VWB A;  4ILJ A;  3OJU A;  4Q0B A;  5AQZ A;  3U9D A;  3HPH A;  5EY4 A;  3ZEU A;  2IS3 A;  2E8A A;  2HHQ A;  1L3T A;  2D1K A;  4HCB A;  3IAY A;  3JXU A;  4CZL A;  4KRF A;  3O4Q A;  5BN8 A;  3VQD A;  2UXB K;  3TU5 A;  2HOE A;  3C65 A;  3DXM A;  3KIO A;  3DI6 A;  4B9L A;  4LSN A;  3OS0 A;  3SV3 A;  2O8C B;  1JLA A;  3NGZ A;  4K42 A;  3A5N C;  1OH7 A;  3PX0 A;  2NRH A;  2WTU A;  1JXB A;  3K58 A;  2QWP A;  5AQH A;  5ADX H;  4BY9 C;  3BUZ B;  4X66 K;  4Y0W A;  1TL1 A;  3AVM A;  4JKF A;  4DFK A;  4FWM A;  2E1Y A;  4IG3 A;  3AO3 A;  1B9F A;  1TUU A;  3MN5 A;  1QSS A;  3VEZ A;  2G8H A;  3O08 A;  3LZI A;  4I7F A;  1ITG A;  2VQE K;  2P5G A;  4CIF A;  4DV5 K;  4B1U B;  5AQR A;  3AGK A;  2DFF A;  2G8K A;  3BZC A;  2KQ2 A;  4FJK A;  2G8V A;  2VG5 A;  4JI7 K;  4DQP A;  1VSF A;  4MDA A;  1NJW A;  4H5R A;  4C23 A;  4YOT A;  1KVA A;  3FFI A;  1N32 K;  2IC3 A;  2FF3 B;  2W40 A;  3MK6 A;  3MN9 A;  3HOS A;  4WQ4 C;  4RTF D;  2P9I A;  2WOM A;  1JLG A;  2B5J A;  4EZ6 A;  3SPY A;  1E4G T;  3O3G A;  3J80 O;  1CXU A;  1NKB A;  4LFB K;  1Q9Y A;  3DLK A;  3HM9 A;  3V9Z A;  3QIC A;  2I7N A;  1M1K O;  1NGB A;  2F4V K;  4WQ5 A;  4M45 A;  5BN9 A;  2OA8 A;  4CF0 A;  1RIL A;  2P9K A;  2OPR A;  2QW9 A;  4FWR A;  5DK5 A;  1XMQ K;  2O8F A;  3CFP A;  1XUP O;  4JI4 K;  1YJ9 N;  2A3Z A;  3LDQ A;  4ILG B;  3B6O A;  2IVO A;  4C8L A;  1RDC A;  1LW2 A;  1C1C A;  2OZM A;  5JLF A;  1MA9 B;  3W0L A;  1HKC A;  3THY A;  4PKH A;  1KCF A;  3TI0 A;  3IFR A;  2JLE A;  1XMO K;  4BQL A;  2D4W A;  3K2P A;  4B3O A;  5HL7 L;  1TKX A;  3WEE B;  2HHX A;  3E01 A;  3K59 A;  4MFB A;  3P5J A;  2WON A;  3LPT A;  4CHY A;  4EHT A;  2QWM A;  4FM0 A;  1RDB A;  4B1Y B;  3R8E A;  1S1U A;  2VQF K;  1FW6 A;  5ELZ A;  3L2Q A;  3E9O A;  1S1W A;  2O8D B;  1DGK N;  1OVQ A;  3O1W A;  2ZJQ L;  4WFA L;  3FZL A;  4XEI A;  4L8R B;  5I9E B;  2XHB A;  2G8U A;  4M41 A;  1JJ2 M;  4JI8 K;  2F96 A;  1VSJ A;  1BIU A;  3L6Q A;  5KQD A;  1IG9 A;  1SKS A;  1YVU A;  4DU3 A;  3K5M A;  3DWL A;  1X1P A;  3OY9 A;  3ZSQ A;  4KRE A;  4DR5 K;  4CZI A;  1W7A A;  4BR0 A;  4DTR A;  1VQM N;  3F2K A;  3I8D A;  1ATS A;  4X65 K;  3OYL A;  1U45 A;  1CZB A;  3VEY A;  4CBW A;  1TYQ A;  1VSM A;  4FO0 A;  4CEF A;  4C8O A;  4CBX A;  4ID5 A;  3VQQ A;  4Z4C A;  2E2O A;  3D0P A;  4MLH A;  3H45 C;  1C0U A;  4N5S A;  3KK3 A;  4BRL A;  5BR9 A;  1IBL K;  3DM2 A;  1NGJ A;  4JHD B;  3T69 A;  3SCX A;  3RMC A;  4K43 A;  3AVI A;  2YI1 A;  5TKW A;  1J54 A;  2E2Q A;  1BDG A;  3U4L A;  1ASW A;  2DY4 A;  1RBU A;  2ASO A;  4KAZ A;  3AVN A;  2XY8 A;  3NVM A;  3VPZ A;  2Q36 A;  4DMN A;  3SUO A;  4A61 A;  3RRG A;  4DTS A;  3FFK B;  4UQG A;  2HVH A;  4DSE A;  3SI6 A;  3FR0 A;  4JK9 A;  3K5O A;  3CFR A;  3ENB A;  1LWC A;  5HOO A;  3CMA N;  2VCP A;  1VSD A;  3CI5 A;  4ICL A;  3C0B A;  4CES A;  3KLG A;  3CQX A;  4W5N A;  3I33 A;  1KXP A;  1TV6 A;  3AAQ A;  1UOC A;  4Z4G A;  4Z4H A;  5KQ8 A;  1KTQ A;  3RRH A;  4FYD A;  3THW B;  3UKU A;  1TK0 A;  4GVM A;  4EP5 A;  1S1T A;  4B9U A;  2Z1J A;  2QXL A;  2KZM A;  1WN7 A;  1WB9 A;  1SKW A;  1Z05 A;  2W41 A;  4DQR A;  1C1B A;  3K5N A;  4EZ9 A;  4FLZ A;  2OPS A;  1R59 O;  1UA1 A;  2F8T A;  2V51 B;  1KQS M;  4B3M K;  4LY7 A;  4CIG A;  3M6G A;  3O6W A;  4CJ4 A;  2HHU A;  2D5R A;  3CCU N;  4CGF A;  4GKK K;  5M1N A;  4W5Q A;  4CJU A;  3VQA A;  3SK3 A;  3KLH A;  3I0S A;  5BRF A;  1S72 N;  3TSU A;  3AAP A;  4BWM A;  4CD1 A;  4DTJ A;  4E7J A;  3F9K A;  2P9K B;  1TK5 A;  2A40 A;  3AVK A;  4LF9 K;  3LM9 A;  4I9Q A;  4GV3 A;  4Z4I A;  5AQL A;  4KHQ A;  2O8F B;  3AVG A;  3NH1 A;  4GKJ K;  4KKO A;  1HUX A;  2DFE A;  1RFQ A;  2OYQ A;  4CK1 A;  4K0K K;  4CJP A;  4DTN A;  4MLE A;  1UA0 A;  3WUH A;  4B8C A;  3VF6 A;  3W3D A;  1XNR K;  3PLA A;  3THY B;  4CHO A;  5F0X A;  4NYF A;  5HRS A;  2KTQ A;  3TTF A;  4M3Y A;  3DAW A;  2E6M A;  1HNV A;  3HXM A;  2ITM A;  3E9L A;  4CER A;  1U48 A;  2FC0 A;  5A2Q O;  1WLJ A;  4KFB A;  2RHK A;  1ASU A;  5HRP A;  4A5A A;  1UAX A;  1Q82 O;  3OYC A;  4FJG A;  4YNQ A;  3OBY A;  4FWO A;  4BC5 A;  1QE1 A;  4M3W A;  4WF9 L;  4Q5V A;  4FW2 A;  3CCM N;  4BRC A;  4KPY A;  4K8Z A;  4NXN K;  3KKS A;  5EVZ A;  1WBD A;  4KHU A;  1ATR A;  2YHY A;  1VRT A;  3QML A;  4HHT A;  3PUF A;  1NGH A;  1VQP N;  3HSC A;  4KHN A;  1B92 A;  3ZET A;  4E0D A;  4KH6 A;  4JKG A;  4FLU A;  1KFS A;  3CD6 N;  1J6Z A;  4CEE A;  4O0J A;  5J2Q A;  3G10 A;  4O4G A;  1TVR A;  2HND A;  1N8R O;  2V52 B;  4CZK A;  3DMJ A;  1MWM A;  4LH4 A;  3H1V X;  2PZS A;  2KFZ A;  4FLT A;  4FJL A;  3EZ5 A;  4DFP A;  3RMB A;  3NVK A;  1RTJ A;  5AQJ A;  3ZSZ A;  2XO7 A;  4FWN A;  2NZT A;  4JNE A;  5E41 A;  2QWO A;  3A8Y A;  2QWQ A;  1XHZ A;  1RTH A;  5AR0 A;  4KH4 A;  4N76 A;  4FJ8 A;  3MWP A;  4M3X A;  1D9F A;  3QNO A;  4CZG A;  1QZ5 A;  4DSI A;  3ENO A;  4EFH A;  1TL3 A;  3F73 A;  4OLB A;  5AQM A;  1G15 A;  1NGF A;  5JVG L;  4IDH A;  5CR4 A;  3QET A;  4BE0 A;  4BRO A;  4CIE A;  4JKA A;  3S3O A;  3QIO A;  3BP8 A;  4NYN A;  3FLC O;  2RKI A;  4BVP A;  2DPN A;  1DKG D;  4ZTF A;  2P9U A;  2OPQ A;  4IZ9 A;  4B1W B;  4CJL A;  1J5O A;  1RBS A;  2D0O A;  3VTH A;  4CD3 A;  2O8C A;  1JLF A;  4BGB A;  2UXC K;  2AA4 A;  5CZ2 A;  2WBN A;  2P9L A;  4I2P A;  4NXM K;  5GIN A;  2VWK A;  4NCB A;  1NU0 A;  1GLJ O;  1BA1 A;  4H03 B;  5FPE A;  1HNZ K;  2QKK A;  3IRX A;  3O9S A;  1MDU B;  1BUP A;  4OJR A;  2UYT A;  4FJN A;  4B1X B;  3PY8 A;  3NF7 A;  1YIJ N;  4CZM A;  2FBV A;  3VQ4 A;  3KZB A;  4KHP K;  1T3V A;  5J2M A;  4KHS A;  5J2N A;  3G0Z A;  3TR8 A;  4CEO A;  2QKB A;  5C12 A;  4PUO A;  3QFU A;  1HPM A;  3CYM A;  2O4G A;  2JWL A;  4YDU A;  4BRI A;  3T1H K;  2V7Z A;  2NRV A;  1VSL A;  1NNE A;  2GEM A;  1XWL A;  2GX9 A;  1M90 O;  1HRH A;  2Z1H A;  1ZBI A;  2YHX A;  4H5W A;  3CCJ N;  3K57 A;  4E3S A;  2GWK A;  3SMS A;  1Q86 O;  4H5N A;  3NMU A;  3NBP A;  3KK2 A;  2VGN A;  4JD2 B;  3DOK A;  3QFP A;  3VTI A;  4CFA A;  1CZ9 A;  1TK8 A;  1S1V A;  2FBX A;  3AVF A;  3A5M C;  4YOV A;  3TAR A;  3RWU A;  2YJF A;  3EN9 A;  2P9S B;  2RF2 A;  2HHT A;  3H1Q A;  3SMP A;  4YOW A;  4IOC L;  4M3R A;  3HOT A;  4C8K A;  2FF6 A;  4CJ5 A;  2E6L A;  4M42 A;  4FW1 A;  3HST B;  3OYH A;  1SQK A;  3NH2 A;  3DLL L;  4BGA A;  1HR0 K;  2ZJP L;  3DRR A;  3RVC A;  1Q8I A;  4CJ7 A;  3LWM A;  1U49 A;  3MXI A;  2Q2R A;  4IDK A;  2YX6 A;  4C8N A;  3K5L A;  3BF1 A;  4DKW A;  5FRM A;  5KRT A;  4BC4 A;  1QVG M;  1VK0 A;  4KI6 A;  4CZF A;  5M1Q A;  2HNY A;  4FJ5 A;  2QTD A;  2O8B B;  2W6K A;  3TTD A;  3ATV A;  3QER A;  1QQC A;  4BR4 A;  2RPI A;  2QWN A;  1K73 O;  1LCU A;  2YNI A;  1ZBL A;  1K9M O;  5C0Y A;  5AQF A;  3ZET B;  4RW6 A;  1HKB A;  5GIO A;  3NCI A;  4JKG B;  2JWK A;  2AP1 A;  3BY5 A;  4Z4F A;  3WQU A;  1ZBH A;  1NK5 A;  3TAP A;  2GTD A;  3MEC A;  4FM1 A;  5C10 A;  3VEV A;  2PY5 A;  4EAH D;  3DLB A;  3WNE A;  1JL1 A;  2CGL A;  1E4F T;  2BUP A;  4CHZ A;  3KLF A;  4CJK A;  5J1E A;  3GOI A;  1FKO A;  1NGE A;  1MWK A;  4AM7 A;  5BRH A;  3WXK A;  2HF3 A;  1L3S A;  1KVC A;  4DB3 A;  3TAQ A;  4N56 A;  1RT6 A;  3VQP A;  3BDP A;  3KHY A;  4H5T A;  1IO2 A;  3C6T A;  3KD5 E;  3QEP A;  1S22 A;  1WSG A;  4JHD A;  3EKU A;  3K0S A;  4FVU A;  2X6S A;  2XRI A;  3O4W A;  4GVE A;  3V6D A;  1VSH A;  1NJY A;  3H3O B;  2HHS A;  3P39 A;  1HJR A;  3NFA A;  1KSP A;  3L3V A;  4YOY A;  2P9U B;  4JEP A;  4LD0 A;  3FZK A;  3L4I A;  1BQM A;  4FPB A;  4FJJ A;  1S5J A;  3CC4 N;  4IO9 L;  2P9L B;  3O8M A;  2OZS A;  1QQO A;  4ELV A;  3HL8 A;  4O5F A;  5AQK A;  1K8A O;  4BRK A;  3R6M A;  5GAE P;  4DV0 K;  2D0C A;  4O0I A;  3OS1 A;  2CGK A;  4B1Z A;  3O9Q A;  4OPH A;  1Q18 A;  5AZJ B;  4ELT A;  4PQU A;  4FSV A;  4JRP A;  4X62 K;  2W6L A;  1GLE G;  4CBU A;  2G8F A;  4DFM A;  3V81 A;  1REV A;  2QXF A;  3SUQ A;  1RT3 A;  5J2P A;  1W9H A;  4HTU A;  1EO1 A;  1Z26 A;  4DF4 A;  4KHW A;  5F1X A;  3WXM B;  5C2F A;  5JIC A;  4M3Z A;  3THW A;  1IKW A;  3L0Q A;  1HLU A;  4C8M A;  3LAM A;  4A59 A;  3M8S A;  1NK8 A;  5M1O A;  4WQ5 C;  4FLW A;  5DM6 L;  1J5E K;  1RGI A;  3AV9 A;  3TSP A;  4K41 A;  4DSJ A;  4JS4 A;  3KK1 A;  3VQ9 A;  1WOQ A;  1XQS C;  1DTQ A;  1ATN A;  4A57 A;  4EP4 A;  1VQ8 N;  5DMR A;  1Z6R A;  4GW6 A;  1YHQ N;  4E19 A;  2HW3 A;  4JKB A;  1JLB A;  2X6N A;  3VQE A;  4DR4 K;  3OJS A;  1IKY A;  4H5V A;  4DU4 A;  3ZYY X;  1WSF A;  3HM8 A;  5JMV A;  4GMJ B;  3QEW A;  1RNH A;  3SNN A;  5HLF A;  1NOY A;  1GLF O;  1VSI A;  1WSI A;  2E2N A;  5BR8 K;  3H08 A;  3GL1 A;  2CH5 A;  3KWG A;  1T7P A;  3CET A;  3OA9 A;  3JS6 A;  3ZCM A;  2HHV A;  3IS9 A;  4DV4 K;  4A2A A;  4B9S A;  1KD1 O;  1NK7 A;  1T03 A;  3MXM A;  3OBW A;  1NGI A;  1WSH A;  2RE2 A;  1X3N A;  2FBT A;  3CJ9 A;  1VQO N;  3UIQ A;  3UB5 A;  5HRR A;  2Z1I A;  3O3F A;  4J8F A;  3LAN A;  2YHB A;  3FZF A;  1WSE A;  5AQO A;  1X9M A;  2E2P A;  4FWS A;  5SWM A;  1T6D A;  4IJA A;  3TAN A;  4L3Q A;  3DLH A;  1SV5 A;  3V9W A;  1N6Q A;  4CZJ A;  5AJ3 K;  1XC3 A;  1SUQ A;  4BC3 A;  2X74 A;  4OGE A;  3QLH A;  1SZ2 A;  3AVC A;  4LF6 K;  3R1X A;  4JI1 K;  2ZD1 A;  4KO0 A;  4R5P A;  4V19 S;  4O8U A;  3TAG A;  1EWQ A;  3NAE A;  1U04 A;  4RW9 A;  4Y1C A;  5I42 A;  4J2D A;  5FLX O;  5AQT A;  3ZSR A;  5LL6 Z;  4DV2 K;  1W2B M;  1OH8 A;  3O9R A;  4E1M A;  4B9N A;  3SAH A;  4FWL A;  3LP3 A;  4DFJ A;  2NUB A;  1RT5 A;  4ID1 A;  3I56 N;  1Q81 O;  1S1X A;  5HRO A;  4PL8 A;  1QS4 A;  1BIS A;  4K8X A;  1RDW X;  3AA3 A;  3AAR A;  3L8B A;  4B9V A;  4O5B A;  3CCR N;  2P5O A;  3C6A A;  3TAB A;  5D3G A;  4LC9 B;  1R0A A;  1X9W A;  3EZW A;  4O44 A;  1Y97 A;  4FCY A;  1YJW N;  3SPZ A;  3LDN A;  4CW7 B;  3CCL N;  3NF8 A;  1T44 A;  2LSN A;  4M7Y A;  4XIU A;  1P90 A;  2PBD A;  3CXC M;  1HNW K;  3V9U A;  1FK9 A;  3CJA A;  5GAG P;  2UUB K;  2ZQB A;  4OKE A;  2X78 A;  3L2W A;  1VAZ A;  1GOA A;  4GNI A;  4CHP A;  3HZ6 A;  2BE2 A;  3EEQ A;  2KHO A;  4DR3 K;  2P9P A;  1NGA A;  3T1Y K;  2ASM A;  2DTU A;  3BEX A;  2PYJ A;  4CGD A;  1RTI A;  4F2R A;  2QM1 A;  4PKG A;  4KHY A;  1I3A A;  3ZT1 A;  1ZBU A;  3BZK A;  1LWF A;  1VQK N;  4DQQ A;  3H6E A;  4G1Q A;  3HYF A;  3EYZ A;  4OO1 J;  2P51 A;  4B3R K;  4JI3 K;  3QEX A;  5CE3 A;  5AQG A;  3KVG A;  4E1J A;  1NK9 A;  3VQC A;  3ASM A;  4DSL A;  4JAX A;  5KPT A;  5M1F A;  2Q0R A;  4J2A A;  3CC7 N;  3PSI A;  4IWV A;  1YF5 L;  1KAY A;  4LF5 K;  4FK2 A;  3MXJ A;  2O4I A;  3V9S A;  3R3L A;  1KRP A;  4AHT A;  1N5Y A;  2WFB A;  3VES A;  5AQV A;  4FJM A;  3AY9 A;  4JD2 A;  1LOT B;  2E1Z A;  1GLA G;  5H1S Q;  1OH6 A;  2IAJ A;  4CJE A;  4DLE A;  1N33 K;  4WCE L;  3FZH A;  4I6M B;  2HMI A;  3QO9 A;  1YVN A;  5AFU H;  5ADX A;  2P9S A;  2D0P A;  2CGJ A;  3JSM A;  1RCH A;  1KFD A;  3O9U A;  4I2Q A;  4LSL A;  3QB0 A;  1TKZ A;  1YTU A;  1D9D A;  4MO4 A;  3M5R A;  3PIP L;  3WNH A;  2QA4 N;  1C0F A;  3PX6 A;  3QEI A;  2ZGY A;  3C94 A;  4F2S A;  3QIN A;  4CFB A;  4CJF A;  3HI0 A;  3SQ2 A;  4IXC A;  3VQB A;  3RMA A;  4JKH A;  4BR7 A;  4DV6 K;  2IVN A;  4DHY A;  3Q7C A;  1IBK K;  4NB4 A;  2Y1J A;  1JCG A;  5GAD P;  4CFD A;  4FZY A;  4YOX A;  1QVF M;  3OYF A;  3CFO A;  3KK7 A;  1NKC A;  1VQ4 N;  4JRQ A;  3L4Q A;  4H0Y B;  4IEE A;  2O8B A;  1IJJ A;  1S6Q A;  1Y64 A;  1YTA A;  5EOY A;  3G25 A;  1XHX A;  1LV5 A;  5MLC Q;  3J81 O;  4YHH K;  1XC9 A;  3ZX2 A;  3D7E O;  1N36 K;  2PAV A;  4OLA A;  1HQE A;  4FL9 A;  4BE1 A;  3S9H A;  1EP4 A;  1GLB G;  1HX1 A;  4CZH A;  2BAN A;  2NRW A;  5C15 A;  1KLN A;  4AH9 A;  3THV A;  1YI2 N;  4JKC A;  2UUC K;  4EIA A;  4CEZ A;  4DTM A;  3CPE A;  2HHW A;  1JXE A;  1TKD A;  3WXJ A;  3HK2 A;  4LF4 K;  3T1A A;  3OHR A;  1RDU A;  2HBM A;  2B4J A;  1C6V A;  4FVM A;  5KGW A;  1DLO A;  1ASV A;  3TAF A;  1EQY A;  4TSX A;  1GLD G;  4CF1 A;  4QS8 A;  4DS5 A;  2IOC A;  2E4L A;  3ZSO A;  3QES A;  3RR8 A;  1RT2 A;  3I55 N;  3K9J A;  3NGI A;  4K25 A;  2GBZ A;  3VQ6 A;  5LY3 A;  3EKS A;  3TPQ A;  1FKP A;  1BL3 A;  4CGH A;  2GEL A;  4FWK A;  3VEN A;  4KI4 A;  3HT3 A;  5HP1 A;  4YFU A;  3VGL A;  1A5V A;  3VMF B;  4BC2 A;  1DT9 A;  4CHN A;  4AM6 A;  5JS1 A;  4RWT A;  2P9P B;  3AO5 A;  1TAQ A;  4PA1 A;  5FPD A;  4HTL A;  2ATQ A;  4Z0U A;  3HP9 A;  1NOZ A;  2YCH A;  2NRX A;  3KJV A;  1MU2 A;  4YDU C;  3M8P A;  1WUA A;  3VF2 A;  4JI0 K;  1L3V A;  3V1O A;  3PO5 A;  3OYE A;  4DTX A;  2ZGZ A;  4FOE A;  4H0V B;  5JLH A;  3HRG A;  1LWE A;  2XY7 A;  5AZJ A;  1BGX T;  2ZF5 O;  3LAK A;  1IKX A;  1LAW A;  1NM1 A;  4FPA A;  3CER A;  1K6Y A;  3MWT A;  3QEV A;  4N41 A;  2ZM6 K;  3U9Z A;  3HP6 A;  4B3T K;  1HJO A;  2Y1I A;  3VOV A;  3VET A;  1HNI A;  1JLE A;  5IT9 O;  1ZBF A;  1QZ6 A;  4IFY A;  4A2B A;  3K9K A;  3NDK A;  3QNN A;  3EO3 A;  4J2B A;  3D2F B;  4CEA A;  4BDY A;  4CEB A;  4JI5 K;  3CJ1 A;  3HPG A;  5I3U A;  4BRG A;  3N4Q A;  4BR2 A;  3LDS A;  3BGR A;  2JGU A;  2YHA A;  3AO1 A;  4CJT A;  5E84 A;  4O55 A;  3MX2 A;  1V4S A;  2ETJ A;  4ILH A;  2HMP A;  1I39 A;  3SAF A;  1WAF A;  5B8H A;  1U47 A;  3LDP A;  4BWJ A;  2UU9 K;  1V4T A;  2YHW A;  2IDO A;  1X9S A;  4QCL A;  1OKJ A;  1RT4 A;  2IIR A;  1DEJ A;  2OCE A;  3IG1 A;  3RSE A;  4H8K A;  4DV1 K;  2VYP A;  3MX5 A;  3DRP A;  1KVB A;  3OYM A;  4M63 C;  2WUS A;  3M8Q A;  4OX9 K;  1P8Z A;  4ZHR A;  3CME N;  3CJ7 A;  3ZT0 A;  5EU7 A;  3T7Z A;  4F4K A;  5F2R A;  3ZX3 A;  3BF3 A;  3O1B A;  4DWI A;  4IBN A;  4DUY K;  1SL1 A;  3FZM A;  2UUA K;  4BDP A;  1KLM A;  5M1P A;  4CGI A;  3TAM A;  3VF4 A;  5C24 A;  2HBJ A;  1WSJ A;  3IUC A;  4OKK A;  3UKR A;  3U3Y A;  3B6P A;  3SJJ A;  4DQI A;  4BR5 A;  3OVN A;  4CK2 A;  4XH4 A;  4N47 A;  3RMD A;  1ZXO A;  4CED A;  4M7X A;  4JLH A;  5GIP A;  4OGC A;  4AF1 A;  1NMN A;  3V9X A;  1GOB A;  1W0H A;  4M3U A;  2VGM A;  4BRA A;  4BRD A;  1QSL A;  3D45 A;  3NF6 A;  3A5L C;  4GY2 B;  5JVH L;  1LAV A;  4BG8 A;  4FJ9 A;  2HVI A;  4LFA K;  2P1J A;  4IKF A;  2QEX N;  4JKE A;  4AIL C;  1NLV A;  4DTU A;  2E5L K;  4J2E A;  4JI2 K;  1IBM K;  4DR2 K;  4FWP A;  4DTO A;  5AQU A;  2BGG A;  4DQS A;  3PV8 A;  5FRN A;  3M8R A;  5AQI A;  1VQ6 N;  4B8A B;  4ELU A;  4U7B A;  2H3G X;  5GAH P;  1FJG K;  4KTQ A;  1NBW A;  1YIT N;  1W97 L;  4NLB A;  4KH5 A;  4EHU A;  1Q9X A;  4H0O A;  3P1G A;  4DSF A;  3C7N A;  1RTD A;  3FE1 A;  2EX3 A;  3TTC A;  1J9A A;  4B08 A;  3CJC A;  3G6E N;  2G8I A;  3E1Y A;  3ZSX A;  4BRP A;  4PKI A;  3VN5 A;  3VA3 A;  3SZ2 A;  2KFN A;  3DLE A;  1N34 K;  4BR9 A;  4JN4 A;  3OYN A;  4IOA L;  4OPK A;  2KLA A;  4R79 A;  3MN7 A;  3J8A A;  2W42 A;  4WFN L;  3ZLJ A;  1CLQ A;  3O4N A;  1EKE A;  1T6C A;  1RDA A;  4KTZ A;  4X64 K;  4A62 A;  4FLX A;  2CH6 A;  1TKT A;  1IKV A;  1JCF A;  4DR7 K;  2A6A A;  5FDL A;  3DLR A;  5BRE A;  3SLC A;  1SS6 A;  3G71 N;  1NJZ A;  2HST A;  4XH5 A;  3PX4 A;  1J53 A;  4O8K A;  1TAU A;  3ULE B;  1IG8 A;  5M1K A;  4AHS A;  3VQ5 A;  5KPR A;  3B8A X;  1WBB A;  1S6P A;  4B9M A;  2I5J A;  2V7Y A;  2BH1 A;  4DU1 A;  3WXL A;  4QOZ B;  4M3T A;  1HMV A;  3GE1 A;  3LDL A;  5BPL A;  1IH7 A;  1L5U A;  5CYM A;  5HRN A;  3IMX A;  3MEG A;  4HUE A;  1O1W A;  1JLQ A;  3SYZ A;  4BRM A;  1GLC G;  5KRS A;  4CI6 A;  3L2R A;  3M3Z A;  3AVB A;  5AQP A;  4MDB A;  4B9Q A;  2P9N A;  4CJV A;  1NKE A;  1WNS A;  2J4R A;  4BRF A;  4BG9 A;  1VQL N;  4H4O A;  4RW7 A;  1KAZ A;  3RSE B;  4I6M A;  4OKJ A;  2XY5 A;  2QI2 A;  1JL2 A;  3ALY A;  3OS2 A;  4F3T A;  2VG7 A;  3AVL A;  3DJC A;  3I0R A;  4Y1D A;  1BIZ A;  1HNX K;  4AHR A;  2FSJ A;  3WNF A;  4CGJ A;  4DR6 K;  4AHV A;  5EX5 A;  1VHX A;  4HWI A;  3U8X A;  1T8E A;  3ATU A;  2ZWH A;  4BRN A;  4YOR A;  3U3G A;  5SZT A;  4WQ4 A;  1VRU A;  1UWB A;  4GV9 A;  4LH5 A;  4W5T A;  2B6A A;  3VQ7 A;  3U6F A;  2F8S A;  4FK4 A;  2HHH K;  5E26 A;  4H4M A;  3ID6 A;  3UKR B;  4H0T B;  4AQY K;  4FJH A;  1OVY A;  2BDP A;  4IG0 A;  1VSK A;  2ZE2 A;  3NH0 A;  3T3F A;  5AZI B;  3MCA B;  1D4X A;  2G8W A;  1BI4 A;  3SQ1 A;  2IGI A;  4JI6 K;  3P83 D;  5KGX A;  5FPN A;  3I8B A;  1ZYQ A;  2HBK A;  4F3O A;  3CHW A;  4IOX A;  1ZBS A;  3ZT3 A;  3CCE N;  4HVJ A;  3F9M A;  3JYT A;  4CCH A;  1JLC A;  3NHG A;  1RBT A;  4ISF A;  1EET A;  4RCH A;  3AA5 X;  3PIO L;  4WYB A;  2HF4 A;  3CIP A;  3GBT A;  1SKR A;  1U6Z A;  2A1R A;  2KKZ A;  1E3M A;  3CCQ N;  3J7Z O;  4IJN A;  1JCE A;  2F9W A;  1HKG A;  4JS5 A;  1SL0 A;  3S41 A;  4DG1 A;  4FZX C;  3OW2 M;  3OYJ A;  1K8K A;  4BRH A;  3WQT A;  3MMV A;  1JKH A;  5KPZ A;  3HO1 A;  2OTL N;  1A5X A;  2F9T A;  5TKY A;  4KBO A;  2YV0 X;  1QSY A;  1TUY A;  3D2E B;  3THX A;  1RBR A;  3C7N B;  3TSQ A;  1L3U A;  3MAQ A;  5LMU K;  4UY8 O;  3SQ4 A;  4CVN E;  3VGM A;  2GUP A;  3WT0 A;  4FK0 A;  2E88 A;  3LL3 A;  3EL2 A;  3ZEU B;  4DS4 A;  1S3X A;  4AHU A;  1LW0 A;  4W5O A;  1HYS A;  2FLO A;  5DM7 L;  5C2D A;  4BRQ A;  3RTV A;  3SBT A;  4LF8 K;  2PYL A;  2F7T A;  1HYV A;  3DXM B;  4Z4E A;  1QTM A;  4JV5 K;  4BE2 A;  3KD1 E;  3VER A;  4E7I A;  4QS9 A;  3HVR A;  1BCM A;  2EWS A;  1HQU A;  4CZE A;  1NGD A;  1D8Y A;  1O13 A;  3ZSY A;  4BRE A;  2FSN A;  3OYB A;  3V1Q A;  3UE5 A;  4KV8 A;  3SUP A;  4I9L A;  1GLL O;  3F5T A;  3O3H A;  4JK7 A;  4RW4 A;  3CJB A;  3CG7 A;  3C95 A;  4C1N I;  3CF5 L;  3HTV A;  4FLY A;  3QBX A;  3TWH A;  3C6U A;  3QDK A;  4DUZ K;  1EX4 A;  4E7K A;  4DCH A;  1BU6 O;  2QK9 A;  3OYI A;  1YUW A;  5KI6 A;  5JS2 A;  4DV7 K;  1YJN N;  4FM2 A;  2NRR A;  4A5B A;  1HPZ A;  3ZX0 A;  3D2F A;  4DQ8 A;  4E1N A;  3LWL A;  1NK6 A;  3J7Y P;  2WC9 A;  4LF7 K;  4Z94 A;  5AQS A;  1EWR A;  1RT7 A;  3L2U A;  2P9N B;  4H0P A;  3VQ8 A;  4FJI A;  3HJF A;  3H46 O;  5KTQ A;  2P9I B;  2Q1N A;  3EY1 A;  1ILY A;  1S9E A;  1SL2 A;  1XI1 A;  2NLX A;  4WFB L;  1X9J A;  3CM6 A;  4CFC A;  2UXD K;  4PY5 A;  2IVP A;  1NMD A;  4B1V A;  1I94 K;  5EXW A;  1SAZ A;  3ID8 A;  4NCG A;  3LP1 A;  4CK3 A;  1WAJ A;  5AQY A;  4BQZ A;  2NNW A;  4HCC A;  3A5O C;  4FJ7 A;  1BCO A;  1CXQ A;  2Z1G A;  2BTF A;  5AQW A;  4YY3 K;  3AA4 A;  1KC8 O;  1YT3 A;  2QWL A;  2NRT A;  2HB5 A;  4JYA K;  3AGR A;  2E20 A;  3VA0 A;  3C6H A;  1QHT A;  2GV9 A;  5LJW A;  4KTW A;  5IWA K;  3IKM A;  1BI4 B;  2A1S A;  4W5R A;  1GOC A;  5CZ1 A;  2YKM A;  1RBV A;  3KLE A;  3DOL A; 
#chains in the Genus database with same CATH homology
 2CGK A;  4FO0 A;  4CBX A;  3SAF A;  5B8H A;  2YJE A;  4B1Z A;  3O9Q A;  2E2O A;  4OPH A;  3LDP A;  1Q18 A;  3H45 C;  4MLH A;  5AZJ B;  4BRL A;  2A5X A;  1V4T A;  2YHW A;  4FSV A;  5BR9 A;  1NGJ A;  1GLE G;  4JHD B;  3T69 A;  4CBU A;  3H3N O;  1QQM A;  4JK8 A;  1OKJ A;  3QBW A;  4K43 A;  3O9T A;  2IIR A;  2Q0U A;  1DEJ A;  3EE9 A;  2YI1 A;  1U2V A;  5TKW A;  3RSE A;  1EO1 A;  2VYP A;  5F1X A;  3MX5 A;  2E2Q A;  3WXM B;  1BDG A;  4M63 C;  5C2F A;  5JIC A;  2OTJ N;  3U4L A;  2WUS A;  1P8Z A;  3CME N;  3L0Q A;  2ASO A;  1NJI O;  1HLU A;  3CJ7 A;  3VEX A;  1K8K B;  3T7Z A;  3NVM A;  4A59 A;  3VPZ A;  2Q36 A;  5F2R A;  4A61 A;  3ZX3 A;  3VEW A;  4PL7 A;  3BF3 A;  3O1B A;  4WQ5 C;  5M1O A;  3DXK A;  3FFK B;  4BRH A;  1NWK A;  5DM6 L;  3O5B A;  1RGI A;  4ISE A;  4OPA A;  5CHI A;  3Q7B A;  4YOU A;  3TSP A;  4K41 A;  3FZM A;  3FR0 A;  4JK9 A;  5M1P A;  1TYQ B;  3ENB A;  5AQN A;  5HOO A;  3CMA N;  3GDQ A;  2VCP A;  3VF4 A;  3CI5 A;  4ISG A;  1WOQ A;  1XQS C;  3E66 A;  1ATN A;  2HBJ A;  3C0B A;  3IUC A;  3UKR A;  4A57 A;  4IFE A;  3CPW M;  4BR5 A;  1VQ8 N;  3R9P A;  4XH4 A;  2NRZ A;  3CQX A;  1Z6R A;  3I33 A;  1KAX A;  1KXP A;  3AAQ A;  3LM2 A;  4QS7 A;  1YHQ N;  1BO5 O;  4JKB A;  5KQ8 A;  1ZXO A;  4M7X A;  4H5V A;  5GIP A;  4AF1 A;  3ZYY X;  5AQQ A;  3HM8 A;  5JMV A;  2ASP A;  1GLF O;  2VGM A;  2PFU A;  3UKU A;  1QQN A;  2E2N A;  4BRA A;  3GL1 A;  2CH5 A;  3KWG A;  2A42 A;  4BRD A;  2FSK A;  3CET A;  3OA9 A;  2QXL A;  3A5L C;  3JS6 A;  4GY2 B;  5JVH L;  4BG8 A;  5BPN A;  1Z05 A;  4A2A A;  2W41 A;  1VQN N;  2QEX N;  4JKE A;  1NLV A;  1KD1 O;  5AQX A;  1R59 O;  2V51 B;  3EE8 A;  3OBW A;  1NGI A;  4FWP A;  1KQS M;  3M6G A;  3O6W A;  2RE2 A;  1BG3 A;  1X3N A;  5AQU A;  2QWR A;  5BRD A;  3CCU N;  3CJ9 A;  1VQO N;  5M1N A;  3UB5 A;  1H1V A;  5AQI A;  1VQ6 N;  3SK3 A;  4J8F A;  4NO7 A;  5BRF A;  3FZF A;  2H3G X;  4U7B A;  1S72 N;  1VQ7 N;  3TSU A;  5AQO A;  5GAH P;  3HBT A;  3CCV N;  3AAP A;  2E2P A;  2OAN A;  3P38 A;  4FWS A;  3CQY A;  4CD1 A;  1Q7Y O;  1NBW A;  1YIT N;  1T6D A;  1W97 L;  2P9K B;  1NGG A;  4IJA A;  1C0G A;  4KH5 A;  4NLB A;  4EHU A;  2A40 A;  3E9P A;  3LM9 A;  4H0O A;  4JKD A;  4L3Q A;  1NGC A;  4GV3 A;  3C7N A;  3FE1 A;  4IEI A;  1XC3 A;  5AQL A;  3TTC A;  3ULE A;  4CZJ A;  2HBL A;  4BC3 A;  3CJC A;  1HUX A;  3UKU B;  3G6E N;  1SZ2 A;  1RFQ A;  3E1Y A;  4BRP A;  4PKI A;  3R1X A;  3ENH A;  4O8U A;  1BA0 A;  3VEO A;  5BPM A;  4MLE A;  1BOT O;  3GG4 A;  3VF6 A;  3W3D A;  3WUH A;  4JN4 A;  4BR9 A;  3PLA A;  3FGU A;  3G4S N;  4IOA L;  5F0X A;  3MCP A;  2KLA A;  4C1N K;  5AQT A;  3TTF A;  3DAW A;  4R79 A;  3MN7 A;  3J8A A;  4IO8 A;  4WFN L;  2ITM A;  3E9L A;  1W2B M;  1T6C A;  2Q31 A;  3O9R A;  3P31 A;  5FPM A;  4FWL A;  4FOI A;  3SAH A;  1VQ9 N;  4A62 A;  2RHK A;  2CH6 A;  1JCF A;  4A5A A;  2A6A A;  1X3M A;  1Q82 O;  3I56 N;  3OBY A;  1Q81 O;  5BRE A;  4FWO A;  4BC5 A;  3SLC A;  1SS6 A;  4WF9 L;  3G71 N;  2GWJ A;  2HST A;  4PL8 A;  4XH5 A;  3CCM N;  4BRC A;  4O8K A;  1RDW X;  3AAR A;  3N4P A;  4F9O A;  2A41 A;  3ULE B;  3CCR N;  5EVZ A;  3C6A A;  1IG8 A;  4LC9 B;  4PHT X;  5M1K A;  1ATR A;  5KPR A;  2YHY A;  3QML A;  3B8A X;  3EZW A;  1BWF O;  4NLC A;  1YJW N;  1NGH A;  1VQP N;  3HSC A;  3LDN A;  3CCL N;  2V7Y A;  2BH1 A;  4XH1 A;  3ZET A;  1T44 A;  4M7Y A;  3WXL A;  1P90 A;  3GE1 A;  4JKG A;  4KH6 A;  3SAG A;  3LDL A;  2PBD A;  5BPL A;  3CD6 N;  1J6Z A;  3CXC M;  3CJA A;  5GAG P;  3IMX A;  4H0X B;  4GV6 A;  2FXU A;  1N8R O;  1VAZ A;  4GNI A;  3HZ6 A;  2V52 B;  4CZK A;  4BRM A;  1GLC G;  2KHO A;  1YXQ A;  1MWM A;  4CI6 A;  3H1V X;  5LJV A;  1ESV A;  3M3Z A;  2P9P A;  3CCS N;  1NGA A;  5AQP A;  2ASM A;  3NVK A;  3BEX A;  4MDB A;  2P9N A;  5AQJ A;  4B9Q A;  1QHA A;  4FWN A;  2NZT A;  4JNE A;  2QM1 A;  2J4R A;  4FWQ A;  4PKG A;  5AZI A;  4BRF A;  2QWO A;  3MN6 A;  4BG9 A;  3A8Y A;  3MDQ A;  1VQL N;  4MO5 A;  1KAZ A;  1U2V B;  2QWQ A;  1YAG A;  4I6M A;  3RSE B;  3WEE A;  3SJH A;  5AR0 A;  4KH4 A;  1VQK N;  3MWP A;  2QI2 A;  3H6E A;  3LDO A;  4OO1 J;  3DJC A;  4CZG A;  1QZ5 A;  3O80 A;  5CE3 A;  3ENO A;  4EFH A;  5AQG A;  1VQ5 N;  3KVG A;  2FSJ A;  4E1J A;  5AFU A;  5AQM A;  4JAX A;  1NGF A;  5JVG L;  4IDH A;  5KPT A;  5EX5 A;  5M1F A;  4HWI A;  3U8X A;  2Q0R A;  2ZWH A;  3ATU A;  3KWI A;  3DXK B;  3CC7 N;  4BRN A;  4IWV A;  1YF5 L;  1KAY A;  1ZC6 A;  5CR4 A;  4YOR A;  4WQ4 A;  2I7P A;  4BRO A;  3M1F A;  4JKA A;  4GV9 A;  3BP8 A;  3FLC O;  4BVP A;  4BVO A;  2DPN A;  1DKG D;  4G9Z A;  3R3L A;  2P9U A;  3VGK A;  4B1W B;  4IZ9 A;  5E26 A;  2Q97 A;  2WFB A;  2D0O A;  3ID6 A;  3UKR B;  4H0T B;  3VTH A;  3VES A;  4CD3 A;  1OVY A;  4BGB A;  5AQV A;  2AA4 A;  2WBN A;  2P9L A;  3AY9 A;  5GIN A;  4JD2 A;  1LOT B;  2E1Z A;  1GLA G;  5H1S Q;  1GLJ O;  3P4I A;  5AZI B;  3MCA B;  1D4X A;  1BA1 A;  3IDH A;  4H03 B;  5FPE A;  4WCE L;  3O9S A;  1MDU B;  3CC2 N;  3A0I X;  3FZH A;  4I6M B;  5FPN A;  1BUP A;  1YVN A;  3I8B A;  3D2E A;  2HBK A;  2UYT A;  3SBG A;  3CHW A;  4B1X B;  1G99 A;  1YIJ N;  5AFU H;  3D6R A;  4IOX A;  2P9S A;  1CZA N;  1ZBS A;  3WXI A;  4CZM A;  4U67 L;  5ADX A;  2D0P A;  3KZB A;  2CGJ A;  3CCE N;  2ZJR L;  1T3V A;  3O9U A;  3F9M A;  2VWB A;  4ILJ A;  3QB0 A;  5AQZ A;  3U9D A;  5C12 A;  4ISF A;  4MO4 A;  4RCH A;  3PIO L;  5EY4 A;  3M5R A;  4WYB A;  3ZEU A;  2HF4 A;  2E8A A;  1HPM A;  3QFU A;  3PIP L;  3CIP A;  1C0F A;  2QA4 N;  3GBT A;  2ZGY A;  2D1K A;  1U6Z A;  2JWL A;  4YDU A;  4BRI A;  2KKZ A;  2V7Z A;  2NRV A;  3CCQ N;  2GEM A;  3JXU A;  4IJN A;  3J7Z O;  1JCE A;  2F9W A;  1HKG A;  4CZL A;  3S41 A;  5BN8 A;  2GX9 A;  3OW2 M;  3TU5 A;  2HOE A;  1M90 O;  3C65 A;  2YHX A;  3DXM A;  3HI0 A;  4IXC A;  4H5W A;  3CCJ N;  1K8K A;  2GWK A;  4JKH A;  3MMV A;  3SMS A;  2IVN A;  4H5N A;  3WQT A;  3Q7C A;  4BR7 A;  4NB4 A;  4DHY A;  5KPZ A;  4K42 A;  1Q86 O;  1JCG A;  5GAD P;  2OTL N;  3NMU A;  4YOX A;  1QVF M;  2VGN A;  4JD2 B;  3A5N C;  3KK7 A;  1VQ4 N;  2F9T A;  2NRH A;  5TKY A;  4KBO A;  3L4Q A;  3QFP A;  2QWP A;  5AQH A;  3VTI A;  5ADX H;  4BY9 C;  1TUY A;  3BUZ B;  4Y0W A;  3D2E B;  4H0Y B;  3C7N B;  4IEE A;  4JKF A;  4YOV A;  3A5M C;  3TSQ A;  2YJF A;  3EN9 A;  1IJJ A;  4UY8 O;  2P9S B;  1Y64 A;  5EOY A;  4FWM A;  3H1Q A;  3G25 A;  2E1Y A;  3SMP A;  5MLC Q;  4YOW A;  4IOC L;  1TUU A;  3VGM A;  2GUP A;  3MN5 A;  3HOT A;  3ZX2 A;  3D7E O;  3WT0 A;  2E88 A;  2PAV A;  3LL3 A;  3VEZ A;  3EL2 A;  3ZEU B;  4FL9 A;  3O08 A;  1S3X A;  2FF6 A;  1GLB G;  1HX1 A;  2FLO A;  4B1U B;  4CZH A;  5DM7 L;  2NRW A;  5C2D A;  4BRQ A;  5C15 A;  5AQR A;  3AGK A;  5C0Y A;  1SQK A;  3SBT A;  2F7T A;  3DLL L;  1YI2 N;  4JKC A;  4BGA A;  3DXM B;  4EIA A;  2ZJP L;  3RVC A;  4MDA A;  3CPE A;  4H5R A;  4C23 A;  4YOT A;  4CJ7 A;  3VER A;  4QS9 A;  2Q2R A;  2FF3 B;  3WXJ A;  2YX6 A;  2W40 A;  3BF1 A;  3MK6 A;  4DKW A;  3OHR A;  1RDU A;  2EWS A;  4BC4 A;  3MN9 A;  2HBM A;  1NGD A;  4CZE A;  1QVG M;  4CZF A;  1O13 A;  5M1Q A;  3HOS A;  4WQ4 C;  4RTF D;  4BRE A;  2FSN A;  2P9I A;  2QTD A;  3UE5 A;  1EQY A;  1E4G T;  1GLD G;  4QS8 A;  3TTD A;  3ATV A;  1GLL O;  3F5T A;  4JK7 A;  4BR4 A;  3CJB A;  2QWN A;  1K73 O;  1LCU A;  4C1N I;  3I55 N;  3CF5 L;  3HTV A;  3QIC A;  1K9M O;  5AQF A;  3ZET B;  2I7N A;  1HKB A;  3QBX A;  5GIO A;  3K9J A;  1NGB A;  3QDK A;  1M1K O;  4K25 A;  4JKG B;  2JWK A;  4WQ5 A;  5LY3 A;  2AP1 A;  3EKS A;  5BN9 A;  4DCH A;  1BU6 O;  3TPQ A;  1YUW A;  3WQU A;  2P9K A;  2GEL A;  1YJN N;  4FWK A;  3VEN A;  2QW9 A;  2NRR A;  4FWR A;  4A5B A;  3VGL A;  3VMF B;  2GTD A;  4BC2 A;  3ZX0 A;  3D2F A;  1DT9 A;  1XUP O;  4DQ8 A;  4AM6 A;  1YJ9 N;  2A3Z A;  2WC9 A;  3LDQ A;  4ILG B;  5C10 A;  3VEV A;  4RWT A;  2P9P B;  2IVO A;  4EAH D;  4HTL A;  5FPD A;  4Z94 A;  5AQS A;  2P9N B;  5JLF A;  1MA9 B;  3W0L A;  1HKC A;  4PKH A;  2CGL A;  2YCH A;  1E4F T;  2NRX A;  3IFR A;  2BUP A;  4BQL A;  4H0P A;  4YDU C;  2D4W A;  3H46 O;  1WUA A;  2P9I B;  1NGE A;  3GOI A;  1MWK A;  3VF2 A;  3WEE B;  5HL7 L;  4AM7 A;  2Q1N A;  5BRH A;  1ILY A;  3WXK A;  2HF3 A;  4EHT A;  4DB3 A;  2QWM A;  2NLX A;  2ZGZ A;  4FOE A;  1X9J A;  4B1Y B;  4WFB L;  4H0V B;  3R8E A;  5JLH A;  3HRG A;  5ELZ A;  3KHY A;  4H5T A;  3E9O A;  5AZJ A;  2ZF5 O;  1NM1 A;  1DGK N;  3O1W A;  4FPA A;  1S22 A;  2IVP A;  2ZJQ L;  1NMD A;  3CER A;  3FZL A;  3MWT A;  4JHD A;  4XEI A;  4WFA L;  3EKU A;  3U9Z A;  4B1V A;  5I9E B;  4FVU A;  1JJ2 M;  5EXW A;  1HJO A;  1SAZ A;  3ID8 A;  3O4W A;  4GVE A;  3VET A;  3VOV A;  5AQY A;  4BQZ A;  2NNW A;  3L6Q A;  3A5O C;  3H3O B;  1QZ6 A;  3P39 A;  5KQD A;  4A2B A;  3K9K A;  3EO3 A;  4YOY A;  3D2F B;  2P9U B;  4JEP A;  3DWL A;  3CJ1 A;  3FZK A;  3L4I A;  2BTF A;  4FPB A;  4BRG A;  3N4Q A;  5AQW A;  3CC4 N;  1KC8 O;  4BR2 A;  2QWL A;  4IO9 L;  2NRT A;  2P9L B;  3O8M A;  1QQO A;  4CZI A;  3AGR A;  2E20 A;  3C6H A;  4BR0 A;  4O5F A;  5LJW A;  1VQM N;  3IKM A;  5E84 A;  3F2K A;  5AQK A;  3MX2 A;  1K8A O;  1V4S A;  4BRK A;  3R6M A;  1ATS A;  5GAE P;  4ILH A;  3VEY A;  4CBW A;  2HMP A;  1TYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...