5TPWH

Crystal structure of amino terminal domains of the nmda receptor subunit glun1 and glun2a in complex with zinc at the glun2a
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
218
structure length
211
Chain Sequence
EVKLVESGPELKKPGETVKISCKASGFTFTNYGMNWVKQAPGKGLKWMGWINIYTGEPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARGYDYEGYFDYWGQGTTLTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords NMDA glutamate receptor subunit
publication title Molecular Basis for Subtype Specificity and High-Affinity Zinc Inhibition in the GluN1-GluN2A NMDA Receptor Amino-Terminal Domain.
pubmed doi rcsb
source organism Xenopus laevis
total genus 34
structure length 211
sequence length 218
ec nomenclature
pdb deposition date 2016-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tpwH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tpwH02
4E0RA 4J4PC 4N68A 5J9PB 1XR9B 3GM8A 2K3TA 4BJLA 4JRYE 2O5XH 3EJYC 4JM2C 4RAHA 1HQRB 2BDNL 3G6JF 4M7KH 2FO4A 3WS3A 1JGVL 3M45A 1WBYA 2FSEA 4K9EC 3MLRL 2VXQH 4QXTB 5ANME 5IFJA 2KL6A 4MS8C 1SBSL 1FRGH 4ODSL 3MGOA 2E7LA 1WAAF 4H25B 4MXQC 3QR2A 2OTWA 3QUXB 4LLUB 4F37F 1AD9B 4MAYB 3VXMA 2DKSA 5D5MB 3LQAH 3CX2A 4DOHB 3KPPA 2W65A 4LAJH 3PWPA 5CMAB 1GZPA 3QEUB 3NCYP 4DFIA 3QO1A 5KSBB 4AEIH 5D71L 1IEAB 3MA9H 5HXMA 3ARGA 2W92A 5FM4A 3IXAB 3MLYL 4NSKB 3BE1H 3RAJH 4QHLB 4Z7OF 1I3VA 4BZYA 5ETUA 3E6FB 3UROR 2GT9B 1MI5E 4KRPB 3UJJL 3FFCD 1H3GA 3MUGB 2IBZX 3BOVA 2JB6B 3CZFB 3VFWA 2JIXA 3EO0B 3MYJA 5E2WH 4LSQL 2RGSA 1T1WB 4GG6E 1WZ1L 5ANMA 5IM7B 3CFIC 1EHLH 4J4PA 1JHLL 3LY6A 4AIZB 5HDQL 3CLEH 2DBJA 1A21A 2GY7B 1HHGA 4JM2A 4DZBB 4HGWA 1GXEA 1Q9KA 1Q94B 2XY2A 1KJ3L 5F93C 3FQWB 3QEGH 3E2HB 3MCG1 4HPYL 3EBAA 3RKPA 4JVWA 4UINH 4WCYL 1KNOB 3BEVB 5C71A 4Q74A 1OF2B 2BVPA 4PJDE 4LHUA 1UZ6F 1NMCB 1TTUA 1MVUA 1NCAH 5IMMA 3EJZC 3G6DH 5IGXH 2B1HL 4U1GB 4MDIB 1MI5A 4K94C 3S97C 4IOIA 3MGTB 3WO4B 3WHXA 4GXUM 5D4QA 1IAKA 3QCUH 4Y16D 4PRHE 5BCAA 5K9OA 4IOSD 1KB9J 5F7KC 5I30L 4XP1L 2EIDA 2NY0B 4M5YH 3QJHA 1NGQL 4J2XA 3NFNA 4LIQL 1D6EB 3RVVD 1MHCB 5EO1B 5SX5K 2XWBA 1KCSL 4FTVE 4BZ2L 4ZNEA 4UDTB 5DK2B 1FFPA 4NHCH 2VOTA 5EBWA 4Z0XA 3SKJH 5EU3B 1BIHA 2FX7L 4QRPA 3BPNB 2G60L 1FN4B 3DXAB 5C0CE 1JTOA 1XGQA 1I1YA 2ARJA 5JMRA 1QFUH 4DUWA 5KVGH 3VI4F 4NZRH 1I7UB 4XCYA 1QSED 1Z0MA 4WWKC 3X3GH 4I0CC 5I16B 3CUPB 3C8DA 4KC3B 3K0WA 4PGEB 4Y2DD 1UCTA 5HGHA 4OFIA 1V7NH 4KRPD 5C0JA 1QFPA 2GTZA 1BQLH 4H5SB 3O45A 4MSWA 4NYLB 1FYTB 2WM0A 3UCRA 5DJCB 4PRHA 4AEHH 4JFDD 3SDCD 1FGVH 3FQNB 1HSBB 3QAZB 4WU7B 2I5YH 2GJJA 3MR9B 1NKOA 2ZCKL 3GM0A 3LVEA 3PV7A 2FEDC 5I6XB 3SN6N 4J1UA 5HDOA 5IQ9B 3AMLA 1LILA 1FIEA 3FT3A 3GI9L 4NNPH 5GGTL 2W0KA 2FJHB 1I3RA 2D9QB 5A2FA 4HIEB 4P5MA 2BNRE 2AK1H 2BVEA 2A2QT 1S8DB 5ACMA 4QHMB 1KIQA 1NKRA 2J8OA 3HI1A 3UJTL 2R0ZH 3NMEA 3G5XB 4YC2C 2R1XB 4CDHA 3DURA 2QKIB 1EHNA 4P2RE 1U8LA 1OAUH 1C7TA 4MNGE 5ICYB 1E6JH 5FKAB 3RUGB 5FO8B 2VISB 2YOCA 3GKZA 2DQGH 3PV6A 2ZCLH 2Y5TA 2M8XA 1A1OB 3ARWA 3GB7B 1IKFH 4DAGH 3V95A 1YN7B 3EFFB 4JHAH 1MFDL 4WWKA 3RVWC 5EG6C 4GXVL 1Z0NA 3RX7A 4KRNA 4LCYA 1YNLH 1H3XA 1X5HA 4ETQA 2BSRB 3QQ3A 1MREH 4PP1C 4P23B 1RIUL 3B9VA 5DA0B 2W9EL 3S3PA 1MFCL 2DL2A 2C1PA 2BNRA 3MRJB 4U6XA 3HZKA 3QDHA 4JPWH 1FP5A 1S3KH 4APQD 1NMBL 3DMMC 3QXUA 2XTJB 5IVZA 3DXAD 4NBXB 5TGBB 5C0RL 2VLLA 4XNUL 3ZTNL 5I1DA 1G7JB 1NCUA 1L7TH 3L3OB 4LVHB 3UTTE 1TVHB 3K4AA 1N59A 4V2BA 5CJXC 4P48A 2BK8A 2BOCB 1EFXD 3EKCA 5JOFB 2QHRH 3GRWH 4OUUB 2H6PB 2VNCA 1QBLH 2VXUL 1BGXH 2DI7A 3GSVA 5KAQG 4ZPTA 3JUYA 3QA3A 3PNWA 2FECI 3QI9B 3D2UB 2NTFB 2XWJB 3SGEI 1IC4L 2VXTL 4R26L 5CIPA 4YE4H 5CD3A 5JPNB 4HIJA 4I0KA 1ZWIA 1C7SA 3MOBH 5DD1H 1W72H 3WFDL 4JQVC 3JV4B 1W72B 2HFEB 4HUXA 2IMMA 4LSSL 4W6XB 4U7MA 4L1HA 4LDOB 4JFFE 3C08L 4N0YL 4Z7QE 2J7LA 4HH9B 3G6JE 1E28A 3P9WB 3FTGB 4HMDA 3OTTA 2EXWD 4GW1B 5CS7A 1FZOA 4H88H 4K2UH 4EVNB 3OZ9L 3T2QA 4HFUH 2ATPB 5E8DL 5DHVH 1HKLL 1PQZA 5DHVB 5DZNA 3SDXA 2DIAA 4R3SB 3HLAB 2YK1L 3LDBC 4BQ8A 2BNUB 1PZ5B 1UYWL 4UQ3B 4BQ6A 2CXKA 3TNNA 5EIIA 4LIQE 4M93B 3DO7A 1AKJD 3T3PE 1EZVY 4JFOA 4G43B 3IDXL 3RL1A 2Z93B 2NY2B 1IAIL 3NIDF 3ARSA 3D5OF 1JBJA 2P5WE 3EYUL 3STLA 4XGZA 2Z35B 5CJXA 5F44A 4Z7OE 5IT2L 4R7DA 5E2TL 2VLRA 2D0HA 3OKNA 1K8DA 4ONGH 5T1DL 4GBXD 1R5VA 1ZTXL 1WUNT 4G8EA 4J6RH 1Z5LA 2FYYA 4N8CL 1ZLVK 2ID5A 3MZTA 4X9HA 5E4EC 3TP4A 3JXAA 3HC0A 3IDYB 4FQ1H 4JQVA 1FQ9C 4GW5B 2I07B 5HHMD 4MVBD 4EIZC 1BQHG 4M7ZC 1JRHL 4C58B 2QQKL 3N06B 3E8UL 5D7IE 4JO3H 1YYMH 2HG5B 4HCRH 3OKDA 4UI2A 3TBSA 4OCSH 5D2LE 2Y7QB 4Y0GA 1CE1H 1AGBB 1PG7L 3KWWA 3P3YA 5DJYA 3OJVC 2P5WA 4WI9A 6FABH 3HRZA 4ZDHB 5F7FA 4YEEA 4XWGH 2EDYA 4PJAF 3RVXD 5CBEA 3OMZA 5MEPA 4TTGA 3G6AA 2MWCA 3CSPA 4CW1A 2YD8A 5D6CA 4JY6A 1NUNB 4LFHG 1BZQK 2WLZA 3BYYA 4G6KL 5HYFA 3JWNC 4ZFGH 2A9MH 2BERA 1I3GH 3RA7L 2V2WB 3Q6FB 4PB0H 5D7JB 5I17A 3UO1H 2VRAA 5IVXA 4JPKL 1FE8H 1HHJA 5GXBB 5LXGH 4TULH 5J57B 4LSDA 4X7SH 5KW9H 1CL7I 4I3SL 4HF5L 4P3DA 5D5MF 5D7IA 4LCUB 5FYLD 1CT8B 4WV1B 4X9FA 4PJ8D 5D2LA 5TJWK 1NSNH 3VGGA 4U3XA 1M71A 4POYA 5IV2A 4F80A 3KLSA 1L0QA 2AI0L 2NY2D 4OZIF 1T7XA 3VI4E 1AO7A 5CKAA 4YHKL 4ZXBC 4KK8D 4UDUB 3S9DB 3C5ZC 2YMXL 4NO0A 2NY6C 1JZ2A 1V3JA 3RGVC 2EYSB 1LNUB 2IG2L 2EDQA 1YDPB 2BRQA 3VRLF 2WBWB 1XGPB 3CGTA 3GIZL 1NPUA 4XX1E 3B2VL 4AYFA 1JGDA 1LO2H 2OBGA 1FAKT 4CBPA 5D1ZC 5C6TH 2GSIB 2Z8RA 4LLDA 4M7JL 4LSRH 4ZSOB 4P2QB 1PAMA 4PRAB 3IU3A 3O8XC 3ULSB 3UEZA 1CGYA 2AEQL 2AXHA 4OJFH 1EJOH 1G6RL 1RHHA 1A6UH 5DT1L 5E2VL 3F12A 1UWGH 2D9CA 5E1AA 5INDB 1WV7T 4HKZA 2O5XL 1V8HA 5E6IB 1VFBB 4NKOB 4D0BB 1IGYB 4XVUC 4NKIH 2XNAA 2X4QA 4M7KL 2PO6A 5IW3A 4YHYB 5FB8B 2HAZA 3CH1A 4KROC 4LLQA 5GGUB 2PYFB 3DVGA 4E42B 2B20A 5IR1A 1Z2KA 1HSAB 2ZG3A 4TSBH 3LQAL 4GKNB 4RMVA 3M1BA 5T1KA 3C5ZA 3O2DH 5I8CB 3OJ2C 1D5XA 4IM8A 3RBSA 3GJFA 4AH2B 5C1MB 4TUOA 5C08E 4AEIL 4UT9H 4PTTB 1FVCB 1CN4A 3MA9L 3QDAA 3RGVA 3T8XB 5J6HA 2HN7A 3AREB 1CBVH 4LEOB 1WCBB 2NY5C 1DEEA 3HR5B 2DWDA 3BE1L 4QXGH 3RAJL 2GSGA 5D1ZA 4U49A 4Z95H 5CP7B 4JPVH 2EC8A 2W0FB 3A0OA 1JTTA 4KKNA 2APWA 2CR3A 5JQ6H 4YIQA 2CLZB 4ELKB 3IDGB 3O8XA 1RJYA 2Q87A 3MV7A 4NO5B 5D2NB 4EI6A 4L3CB 5DC0A 5E2WL 1UKTA 5JHLH 3V4PH 4JHZA 1FJ1A 3WN5A 1TVBB 1EHLL 1HI6A 4RDQF 2UY7A 5IW6B 4R7NA 3CLEL 4YHLH 3WKNA 4MD5B 4LHQB 3K4ZA 3O3UN 2EDOA 4R4ND 1PLGH 3NGBB 2ED7A 25C8H 2QEJA 3QEGL 2DQFA 2HT3C 4UINL 1P1ZB 3D1MC 4WO4C 1XGRA 1NCAL 5F8QC 1WBZB 5HY9B 4WI7A 3G6DL 4YDLB 5IGXL 4E9LA 5D1QC 4PG2C 3EIFA 5BW7C 3GSRB 3LQZB 4YHNA 3MFFA 4QHUA 4NQED 3QCUL 3QISA 1F4XL 1D5MA 1YZZA 4S1SL 1KC5H 5IOPB 5F9WC 3PL6B 4XCNA 1L0YA 3FO1B 1EEZA 3CFJA 4K3GA 2W9DH 3OAYK 2NNAA 4M5YL 2IPTH 3MNWA 2EICA 4PJIB 3SPVB 3F6IA 3MMEA 4IMKC 5GRWA 3IVKA 1A4KA 4YHMH 5HTSA 4ZUWB 3FFCE 1FG2B 3SKJL 1ZA6A 1KGCD 2DYPB 1G7MB 2NZ9C 3CLFL 4N8PA 3SQBA 4YH6A 5EU7C 4F33A 5ESVB 1AP2B 3GSUA 4KRMB 3VFRB 1J8HE 1LMKA 2CSPA 5AD0B 4BM7A 1SM3L 3EW3B 3FB6A 1HCVA 1QFUL 1OWWA 3K74B 3KLHC 4BYHA 4Z7WE 5KVGL 3BSZH 4NZRL 4KHTH 1VGEH 1DBBH 2Q3ZA 5FF6B 3X3GL 2GQHA 5SWZA 2ZCHH 3HR6A 3LKQB 1KPRB 4PJ5B 1V7NL 3HE6B 1H8OA 1K2DA 1X5FA 2F9BT 1G7IB 2D7OA 5E56A 1R3JA 3QXDB 4Y89A 1BQLL 1JF1A 4LPCA 4ONHB 4CNIA 3W5MA 1UM5H 4MA1C 5GQBA 1MWAH 3QJFA 5JOPD 3RVUD 8CGTA 1MWAB 4JKLA 4NFDA 4AEHL 5DYOB 2DTMH 1FGVL 2MQ0A 4HUNB 4NFBA 4FXKB 1P4BL 2I5YL 1D5BB 2NZIA 4ERSH 4WNQA 5D1QA 2F54B 5I75C 1PKOA 1ZVSA 5BW7A 2IF7A 5C0DA 3AVEA 2OR7A 2W9LA 1K5NA 1UH3A 2YRPA 4UU9B 4GH7B 3LB6D 1QLFA 4GRLA 3A67H 4YO0A 4QRRB 3KGRA 4ZUSA 4MAYC 2R0ZL 1J8HA 3BD5A 4IMKA 2ITDB 4M6OL 3VJ6A 3MJ6A 3OX8A 4R2GD 5CEYB 1XFPA 1OTUD 2C3XA 4Z7WA 4JHBA 4XAKD 5F3HA 4U0RB 5GRYA 1OAUL 2VL5A 5EZIH 5ACLA 2VL4A 3NZ8B 3IS0X 4AIXA 1S9VB 3ZKMC 1J12A 1BJ1H 4R4FH 5DJAA 1JHTB 1U58A 4PR5A 2KBGA 3DX7A 2DQGL 4A6YA 5D5ME 1KT2B 4MJ4A 4GRMB 5KSBE 4AQOA 4JHAL 3BW9A 1VESA 4DGYH 1T22B 1N3NA 1FYHB 1HXMA 4KPHH 2ICEA 1J7VR 3O41A 1YNLL 3FHAA 1IC7H 4BQ9A 2E9WA 3BN9C 4NQDB 1MREL 1SEBB 1FNEB 1A9BA 4PP1D 2Z4QB 3LCYA 2W1NA 3U4BL 5J9PA 1XR9A 4B41A 1S3KL 2DYPD 3VD7A 5DQDH 1HQRA 3CSBA 4JFDE 3S5LA 3WL9B 4OZFH 3PIQB 1L7TL 4PJFB 4QXTA 3H7LA 5DRNB 3BDYH 4FFYH 4NOFA 3CXDH 4H25A 3QUXA 3OHXB 2QHRL 3GRWL 4LLUA 3VFTB 1QBLL 1AD9A 1BGXL 3ARZA 4MAYA 1TITA 3LN4B 3O3AB 4PJEB 4WFFD 3KHQA 5CMAA 3G5YB 2VDKH 4N9OB 3ZT7A 5KSBA 1IEAA 4OTXH 3WO4C 4KFZC 4YE4L 5KS9B 5GJTH 4CMHB 2M1KA 5DD1L 3VXTB 2BSSB 1W72L 2F54D 1CTOA 2Q86B 3IXAA 4Z76A 4NSKA 3ES6B 3LMJH 4C59B 4QHLA 4KUZH 1CDIA 4OZ4B 4XPGL 2NY0C 2NMSA 3E6FA 2GT9A 5LQBH 1XR8B 4KVNH 5IFHH 3MUGA 4RFOH 5EBGA 5B39B 2JB6A 3CZFA 4GSDH 4H88L 4K2UL 2QADC 4F9LC 4RMTA 2MHAA 3EO0A 5FYLL 1T1WA 1NC4B 2VJXA 1RJZB 2NY3C 5IM7A 4HJGB 1P84K 3BPNC 4GKZB 4JDZB 5GS0H 3L3JB 2ORBH 2UWEB 4BFEA 5DSCB 3I02B 4I1NB 1N0LA 4JEGB 4NNYB 3X17A 5F7EH 1MCDA 5GGQH 3TPKA 1A6ZB 4L8CB 1Q94A 1WFTA 3FQWA 4MCYB 4OM1H 4V1DA 1KNOA 3BEVA 1OF2A 3DXAE 3C5JB 3TVMD 4ZS7H 3VXPA 1S9YB 2GFBB 1MRCH 2JJUA 3GSNH 3PWLB 4OI9A 4ONGL 3GSNB 4OLYH 1EA9C 4QO1A 3QAZC 3MNVB 4Q9BA 3TPUB 4J6RL 4MDIA 2CKNA 3AC0A 1WLHA 2DJUA 2AJUH 2A73B 3CCHB 3RWIB 4OZGF 3FRPG 2E6QA 5DMJB 1BLNB 1KTDB 4FQLH 5MEND 2XOTA 4PRID 3VXUD 2VLJB 1KLFA 2R9HD 3EOBA 2LFGA 4X6DF 4JO3L 4AMKL 1YYML 3VWJD 4HCRL 2IADB 1D6EA 5D96B 1MHCA 5EO1A 5CD5C 4OCSL 4F9LA 3WO3B 4UDTA 5DK2A 5J1TC 1CE1L 5C07D 1J05B 3KR3H 3QIBB 4R90H 1CLOH 5EU3A 4XWGL 5DVKA 1RK1B 4FABH 1FN4A 3ZO0A 3DXAA 3ZE1F 4QTIH 3RWHB 1NCTA 5BRZB 1I7UA 1FZJB 1K8IB 4J8RB 4OF0A 5I16A 3CUPA 4NC1C 3DX8B 1TMCB 1U8IB 2KUTA 1CGSH 2OZ4H 3NIGE 4PPTA 3RUGE 4PGEA 5CGTA 4AT6B 4PJBF 1I3GL 1WJ3A 3HMXA 1IT9H 4K8RC 4H5SA 1FE8L 3FQTB 4NYLA 5EO9B 1FYTA 2A38A 5LXGL 2N4IA 2Q76A 4OZHF 4TULL 4X7SL 5DJCA 3F7PC 2EDTA 4P9HH 1MCOH 1HSBA 4WU7A 2P7TB 3MR9A 2OYPA 5A3IC 3QULB 3ZZ1A 4X5XB 5IIEA 1V3MA 2XTJC 2HLFD 2OM5A 43CAB 4B53A 3GBMH 4KZEH 1NSNL 3ILPB 3RTQB 1OLZA 5IQ7H 5IQ9A 4OQTH 5JUEH 2EH8H 4D0DB 5C09D 2FJHA 1TQBB 5CP3H 4GJTB 3BJ91 3E0GA 1X4ZA 4HIEA 4PD4K 1S8DA 4CN4A 3TJHC 4CU7A 1CFNA 4YZFF 3S98A 2Z31B 2XTJE 5HHME 1FNSH 2I25N 3QI9C 2R1XA 3W9DB 1T7ZA 3GFUA 2QKIA 2AK4B 2J8UB 5ICYA 3MV11 1B0GB 5FKAA 3RUGA 4EUPG 3MRPB 4L4TB 5FO8A 2VISA 5C70A 1QZ1A 4PJCF 2H26B 3OAZK 4XPFH 5C6TL 4RQQB 1TZHB 2NW3B 2NLJB 4S0SD 1A1OA 3TWCH 3GB7A 4LSRL 3X13B 5GRUH 5AZEH 1YN7A 3EFFA 2VLJD 4X9GA 1OP3K 4OJFL 5CSGA 1T3FB 4LBEB 5IEHB 1EJOL 3BWAB 4OGYH 1A6UL 2BSRA 4JREC 2XZCH 4P23A 5K9KB 5L0QB 1NBQA 2F58H 3BYTA 3SGDI 4A2MA 4M6AA 1KTLB 1IGMH 1FLRH 1NFIB 1T1XB 3MRJA 1AIFB 3LSOA 1ZLUK 1QEWB 4XPAL 3L3IB 4RGNB 4HSQA 5HYSG 5TGBA 1G7JA 5T5NG 1RVFH 1INEH 3L3OA 1TVHA 4G8FB 3I3BA 5JOFA 1U8QB 4J23A 4RGOH 4OUUA 5JW4M 2H6PA 4TSBL 5GS1C 3O2DL 3QI9A 3IRZA 3D2UA 2NTFA 1DVFB 2XWJA 3E6HB 4UT9L 1LP9B 2CK0H 3HUJF 5KSAC 2HJLB 1CBVL 4QXWA 2K7QA 4KZDH 5JPNA 1FCGA 2ZUSA 3IDYC 5IB2B 3JV4A 1W72A 2HFEA 4Z95L 4JPVL 1XIWD 3AB0B 3BKCH 1VENA 3AS3A 5E7BA 2CKBH 2CKBB 5B38G 3FTGA 4GW1A 4IIQB 4U6YA 5HVHB 5JHLL 3TT3H 3V4PL 3WFBH 2ATPA 4BSWB 5DHVA 2QHLA 5ID0B 4R3SA 3HLAA 3MRCB 2BNUA 1PZ5A 2CGRH 4YHLL 4UQ3A 1PEZA 4YFEA 3B9EA 4JZJB 1PLGL 4G43A 3T2OA 1P84J 4MNQD 5FK9B 2QSCH 3SJVA 2Z93A 4WGWB 4UBDD 4MJ5B 2HKFH 3DTXB 5E95B 5CINH 2Z35A 4B0MM 5D7JC 3GMPB 4OT1H 3D39D 4WO4D 4TUKL 2A6IB 4G8GD 2GJ6D 1FL3B 1KELH 3GBNH 5HVFB 4M9PA 4YXHH 1FZKA 4WV1C 3VFSB 1KC5L 2DQUH 3EOAB 4RGND 4GW5A 2BP3A 1ZE3C 4UTBH 2I07A 2W9DL 3VWKC 4DEPB 5KVEL 2L0DA 2CUMA 3AROA 1DQML 3UTSD 1R3IH 2MCG1 1DBAH 1DQQA 2HG5A 1BBDH 3MGAA 4HCRA 4YHML 2Y7QA 1F90H 4PV8B 5E8EB 1YMMB 1FH5H 1UKQA 3BESR 1VPOH 1AGBA 1ZKAA 3EGSB 1RPQA 4KJPD 4ZDHA 3U9PH 3T4AB 1ETZB 4JVUA 5F97E 2NX5B 2PKDA 3BSZL 1VGEL 4ZFGL 1DBBL 3U36B 4PB9H 1FL5B 3B9AA 4UT7H 3TYGH 3BUYB 2ZCHL 4OZGE 2ZSVB 3GZKA 2NTSP 4NCC2 5H35B 3EAKA 3D3VB 3UBXG 5JW5B 1RZJC 2V2WA 3Q6FA 4MD4B 5D7JA 3FO2B 1EEYB 1UM5L 4X6DE 1T89C 3OPZH 5HHPB 5BOPA 2JJVA 1F97A 2DTML 2ADFH 4ZSOE 3S36H 4KK9C 2F53B 5E6IC 4LCUA 1RURH 4ONFL 1IGFH 3OB0K 1CT8A 2FR4B 5J89A 4YHYC 1UXWB 5HDBF 4WV1A 1HYSD 2F5BH 2A6DB 1JGUH 3DARA 3QQ9C 4HK0B 5E8PB 4CMMB 3QPXH 2BVQB 4RAUB 4IRJD 3A67L 4NQEE 3TBWB 1UG9A 4UDUA 4PD4J 1GRWA 5M94B 2VZUA 5EZIL 2EIZB 4PY8J 1SMAA 2EYSA 4TTDC 1LNUA 5ELIA 2DMBA 3AREC 3LEVH 1JGLH 4UUJB 1YDPA 3RDTB 4OZHE 1XGPA 4I2XB 2YN3A 5IKCB 2KQMA 2XG5A 5I1LB 1MJ8H 3EDJA 2KZWA 5FUOH 1KGCE 2GSIA 5DI8B 4ZSOA 1JP5A 1ZA3A 3NCEB 4P2QA 2EE2A 1WZLA 3OG4B 4PRAA 4DGYL 3LPWA 2VLMD 3G08B 3ULSA 4TSCH 1CE6B 1BF8A 2A6JB 5DRZB 3R8QA 4ZO6A 2AJXH 1T89A 4YZFE 3H9YA 4M48H 1RD6A 1KB5H 2Z8VC 5INDA 1BD2D 1KB5B 3UJIH 5DFWH 5C86A 2P8MB 2PW2B 2V17H 5L8LB 1CICD 5E6IA 1VFBA 5DQDL 2DF3A 4NKOA 1IGYA 5JOPE 5EUOF 1FFOB 2BJMH 5D2NE 5I71C 3SGJC 5FB8A 1VACB 1AR1D 1X5XA 3S7GA 3QBTB 4WUKH 4GAGH 2XZQH 5GGUA 2PYFA 3BDYL 3PDDA 4FFYL 4E42A 5J0BA 3HCVB 4JQIL 5TDPB 3NOIA 4GMSH 5DR5H 4MA8H 1HSAA 4XP6L 1E27A 2IMNA 1CDCA 1JL8A 1HWHB 4I0PC 4PRPD 2NYYD 4YDLC 5I8CA 2VDKL 5CGYC 4AH2A 1A9EB 1X44A 2Z92A 5EOTB 3ORJA 5TE6H 1FVCA 3T8XA 5TF1H 1QSVA 3H7BB 3AREA 5J7CC 5GJTL 4LEOA 1WCBA 2F53D 4J3TA 3HR5A 3SDDB 4F58H 3V6OC 5DJ0B 4MXWH 3PL6C 2FIKB 1DE4B 1OAZL 4XZUB 4Z18A 4MHHG 5CP7A 3O2VH 4KUZL 4U2ZA 2W0FA 5GZND 1LEIB 3T0EB 4UAOB 4KK6D 3QUML 5LQBL 5IFHL 2CLZA 2P42B 2W38A 4RFOL 3IDGA 4ELKA 1CXHA 1WZKA 3ZHKA 4GSDL 4NO5A 5D2NA 4L3CA 2YWYA 3QDMB 4L8DA 3I75B 3T4YB 2QSQA 4IDJH 1F5WA 1TVBA 4WFHD 1G6VK 2NY3D 3HE7C 4ZODA 5IW6A 4C57C 4M8QB 5GS0L 2ORBL 3VGFA 1L9NA 4YNYB 4LKCB 3HUJE 5GGQL 3EFDL 5F7NC 1P6AB 2CIKA 5F7HA 4K3HA 4OM1L 4L4VD 3HE6C 1OARH 1OTTD 2FWOB 5KANG 2O61A 4ZS7L 3MCKB 2EE6A 1MRCL 3GSNL 1WBZA 4XH2B 5HY9A 2LQRA 4LLWB 2X4NB 2DLIA 4WIQA 3GSRA 4YHZH 3LQZA 4WFFE 5JZ7C 1S7RB 2AJUL 2H9GA 1YUHB 4FQLL 5IOPA 3V6OA 3PL6A 3FO1A 5T33H 3GIVA 4WDIA 3SKOB 4I9WE 2F54E 4PJIA 1I9RH 3SPVA 2VSDA 4HXBH 4HX1B 5LGHH 4ODXA 1FLTX 3V6BR 4U0RC 1EO8H 1WC7B 1B4JH 3KR3L 5I9QC 4ZUWA 3DETC 1FG2A 3IFPB 1CLOL 4OFPA 4UIKH 3S37H 4QRRE 3PWNB 5GJSH 5CEZH 3Q48A 4FABL 1KTRL 5ESVA 1AP2A 5HGAB 3S34H 3VFRA 5AD0A 3J7HA 4XCEA 2FEEL 3GGWB 3SDDD 4Q9RL 4QLRA 3VGAB 2GIYA 5FF6A 2OZ4L 1R5WB 2ED8A 2VDOH 4QT5B 2EDDA 3LKQA 1KPRA 4PJ5A 5DRXA 3HE6A 1IT9L 4OD1H 3MXWH 4ONHA 5JTWA 2BHUA 1T80A 4C83B 1MWAA 4P9HL 1MCOL 3QDMD 5DYOA 4OV5B 4OCRH 5K59F 4FXKA 2AJZB 1D5BA 1NEZB 2IH3B 3SCMB 2HJFA 2ADJB 3IT8D 3B43A 3GBML 5A3ID 4KZEL 4D2NA 1T20B 5IQ7L 4NQDE 4OQTL 4HW6A 2EH8L 3STZB 4UU9A 3GSQA 1WICA 1Q38A 3H9SB 4IOFC 4Y4KB 3QIWB 1CR9H 2PNDA 5JXED 1C16B 3E3QC 4QRRA 4P59H 1OP5K 5C0AB 2R23B 4D9QD 1CK0L 5EB9A 3TJHD 3MLZL 3VXUE 1FNSL 2ITDA 5CEYA 5I1IL 1WWAX 4RMQA 3QNXB 4PJFE 2XXCB 3WS6A 3NZ8A 2PETA 3UDWC 4CMHC 1S9VA 1UVQB 1P53A 2P49B 3QG7H 1BOGB 3MOAH 1JHTA 1QOKA 3K80A 3AM8C 4XPFL 1IARB 4PJEE 3FOMB 2DQJH 3ELAT 2C3VB 4PJ9D 3TWCL 2P24B 1KT2A 1BZ7B 4GRMA 5GRUL 5AZEL 5I8EB 3SDAC 3W2DL 4BFIB 3WHE0 4KDTC 1BREA 1DN0B 1T22A 1QBMH 5KS9E 3U2SB 3W82A 2VN7A 1F4AA 5EZOH 4ISVB 5F21B 3I9GH 4NQDA 2XZCL 2ESVD 2F58L 1SEBA 5D1XC 1FNEA 2Z0BA 2G5RA 5SWQB 1IGML 2Z4QA 1FLRL 5DFTA 1JTPA 5A2LH 1S7XB 5GS0C 5I1HH 4O02H 2QSTA 1JPSH 3ROLB 3PP4H 5TPWH 4Y1AB 3WL9A 3WUWG 3WLWD 3PIQA 4PTUB 4QY8B 4PJFA 4KHXH 1RVFL 1INEL 5DRNA 3HNTH 4RBPK 4MWFB 4GG8A 2B1AH 1HZHH 4RGOL 3TN0C 1DLFH 1TVDA 3T65B 2XRAH 4PJEA 3O3AA 3PP3K 3OL2A 3AXLA 2KZ1B 3G5YA 1FO0H 3CXHK 1SYVB 3SE4C 1FO0B 5CAYB 3DYOA 2CK0L 4KK5C 2BNQB 3DBXB 3CFCH 1VEMA 5KS9A 4KZDL 4L9LC 5KSAD 4Q9CA 3VXTA 2BSSA 5AG8A 2Q86A 3SCMD 2YSSB 1E4XI 3DX6B 3B9DA 3ES6A 2H45A 1U41A 3BKCL 4OZ4A 1ORQB 1ZLUH 1XR8A 3SDAA 3H9SD 4KDTA 2XN9D 1SYSB 1I1CA 4Q0XH 5B39A 3FO9B 3FMGL 5C0AD 3TT3L 3WFBL 5HHOD 4OD2B 3QIBC 1NC4A 3F65A 1CFSB 1RJZA 1FC2D 2VLJE 5F9AC 4HJGA 1IFHH 1F2XK 5DZOA 3RWEB 2CGRL 4GKZA 4JDZA 3ZT5A 2UWEA 1HWGB 5DSCA 3I02A 3TBVB 3OF6D 4NNYA 1J9CT 2QSCL 1UB6B 4GQ9H 2Z8SA 3SDYH 3EYQC 4L8CA 2HKFL 4MCYA 2A74B 3QIUC 1WIOA 5HI4C 4ORGB 3G9VA 3C5JA 2H2PC 4OT1L 3LN9A 5D9SB 3RZCD 1S9YA 2GFBA 3PWLA 4UT6H 1KELL 3GBNL 3GSNA 2ED9A 1I1AD 3MNVA 1B6DA 1ZSDB 1RZ7H 2A0LD 1MCPH 4G3YH 3DROB 3SE4A 1H8SA 3TPUA 1P5UA 5DMGC 4YXHL 4KKCC 1DUZB 4TPRH 3C2SA 4L29B 4QWWC 1MRDH 5F96H 3RTQC 5DJDB 2A73A 3CCHA 3RWIA 2ICWJ 3EYOB 3VH8G 1BLNA 1KTDA 1Q72H 1TQBC 4UTBL 2OXHA 2VLJA 4Y1AD 1XF4B 5F6IB 5BV7H 1M6OB 1R3IL 1QRKA 5BV7B 1DBAL 3MJ8B 1FBIH 1A6WH 2IADA 4NZTH 3ILQD 5CJBA 5SV3A 1CQKA 1F90L 4PGDA 4IBLT 1FH5L 2AAVA 4D9RD 1VPOL 3KLAB 1J05A 2VR4A 3AMKA 4FQHB 1RJCA 3QIBA 4LAQH 3UZEA 2UUDH 4IMLA 3U9PL 2HVKB 2WBJB 3FZUC 4Z6AT 1RK1A 1OM3H 1BF2A 1I1FB 5GZOD 3VFPB 3RWHA 1ED3B 4PB9L 5BRZA 3CNKA 4G9FB 4UT7L 3TYGL 1K8IA 2IAMB 4J8RA 4YFLI 2MNUA 2AK4E 3DX8A 1U8IA 5DK3A 3CC5B 3QIUA 4HS3B 4AT6A 4MNQE 5E00B 1AXTH 5ABDE 3IU4H 3OPZL 3FQTA 5EO9A 2J6EH 4M1CC 2ADFL 1J88A 1MPAH 1JFQH 3S36L 4N0FB 1LO5B 1TJIH 2P7TA 1PKQA 4G80A 1IGFL 4U3CA 4GFTB 4ODUB 2FRGP 43CAA 2DQIH 2GJ6E 2F5BL 1ND0B 3ILPA 4FXGB 1JGUL 3RTQA 4WTZG 1HH6B 4DQOH 4B7LA 5FKPA 4D0DA 4OQTA 4H8WC 5I74B 1ACZA 1AHWC 4ETYA 2JKXA 4P57A 4JAMB 2YKLH 3ZKQD 5E9DD 1VFAB 4RGNE 2Z31A 2YPKB 3W9DA 3HC3H 1DVFC 5IESH 5LCVL 1YNKH 3UTSE 4PRDB 4PP2B 2AK4A 2J8UA 3LEVL 1B0GA 1R3HB 1JGLL 1RFDH 1NBVH 5EU6B 3MRPA 4L4TA 4N8VB 1QFWH 3W11C 4H1LH 3BZFA 4H1LB 3B9KB 5K59E 2H26A 1MJ8L 4RQQA 4P9MH 3MO1B 5FUOL 4ZG1A 4EN3C 4X6FB 4PJ7B 1TZHA 2GW5A 2NLJA 3AB0C 2NW3A 3WCYA 3TA3B 2BC4B 3X13A 1DANU 1U91B 3SY0B 2NR6D 1LP9E 4OIIH 3O6LH 4XP9H 3OB0H 5I76A 5I18H 3ARFB 4TSCL 4OF7A 5IEHA 5JQHC 4HG4J 5HVHC 3BWAA 3V0VB 2JLLA 4Y4HD 4MYWB 2AJXL 3KG5A 4X7CC 5K9KA 1LQSR 5HI5D 4M48L 1KB5L 5DD3H 3S35X 5J56B 1Q0YH 2F8XC 4OFVA 3UJIL 1KTLA 1MCHA 2VSCA 1NFIA 1T1XA 2V17L 2C4XA 2CH8A 3O9WC 1AIFA 1I75A 1QEWA 3MV9B 3L3IA 2BJML 4OIBA 2WBJD 2Q8AH 4WUKL 4GAGL 2XZQL 2O5ZH 2Q7YB 4XX1G 4LARH 3L3HA 4GMSL 5DR5L 5FEBA 2DI8A 2YPVH 3LH2H 4MA8L 1A3RL 4G8FA 1U8QA 3S88H 2OTUB 4M4PA 1A2YB 1MJUL 3B2UC 3NZHH 1XZ0B 3OAUH 3ZE2E 5KJRH 4OKVB 1DVFA 5TE6L 3NH7H 1LP9A 3C2AH 2BHYA 1WQVT 3FQUB 2RHEA 3GMLB 3GK8H 5IB2A 4F58L 4MXWL 3VXRB 4FQ2H 4XVSH 3O2VL 4PFEA 4DEPC 3F58H 3IETB 4JFED 3WFEH 4P4RB 2OMNA 2CKBA 1WGOA 5E5UB 3GMOB 3VMOA 1FSKB 4IIQA 3FB7A 3BX7C 5FDWB 2LU4A 4BSWA 4IDJL 3VE0B 3C60C 2OK0H 4JRXD 1AI1H 1R6VA 5ID0A 3MRCA 2PF6A 4ZPVB 2I9TB 1T03H 4Y2OA 1FIGH 4JZJA 2X4RA 2B4CC 1ZT1B 5FK9A 1YMME 5DMKB 5C0FA 4Q6IB 4JDTH 4MJ5A 1I7TB 2SEBB 3C6SB 4OLEA 5GSVB 1OARL 3BIKB 1NCNA 1HCFX 5IEKA 1H5BC 5CZXC 5IVNA 2HWZH 3ARFD 2NX5E 1TZIB 2A6IA 1HNGA 5ADPH 1HKFA 1FL3A 2YEZB 2R2HB 4X7EC 3I3EA 5DMIL 4YHZL 2P8LB 2BVUA 3D3VE 2H1PH 4HDIB 4PRPE 4Y5VB 4FMKA 5DDHB 3MV9D 4GRWF 4LRIC 3EOAA 1AGFB 4PLJD 4E41B 5T33L 2F53E 4UILH 3ULVH 1I9RL 1A22B 1VEOA 5AEAA 4OF5A 1FG9C 2V5TA 4N0UE 3K1KC 3ZDYE 5LGHL 5E03A 2F74B 3RNKB 4PV8A 4ACPA 1EMTL 1YMMA 5E8EA 1B4JL 2E8YA 1N6UA 4PY8I 3TIDB 3EGSA 2W59A 5GSRB 4UIKL 3EHBC 3C60A 3V4UH 2R0LH 4RISH 1CYGA 2WSKA 5GJSL 3RDTC 4QHNB 4ODVH 4JG1H 3T1FB 2OQJB 3WBDA 1B9ZA 3S34L 1ETZA 3T4AA 4OF3A 1UH2A 3QEQD 4K7PX 2NX5A 3KPSB 4S0TD 3WSQH 5FM5M 7CGTA 1SJEB 4WFHE 3TV3L 3U36A 3T2NH 3KXFD 3RIFF 1FL5A 3BUYA 2VDOL 2ZSVA 3ESUF 2DM2A 4P3CH 4I2XE 3QCTH 4Z7VB 5F1SA 3D3VA 5JW5A 4OD1L 2AW2A 1H5BA 3MXWL 4MD4A 3FO2A 1EEYA 4X4ZA 5HHPA 1ZT4A 4L4VE 1JNLH 4OCRL 3K8MA 5JOEA 1XH3B 5F6HJ 2HH0H 3PDOB 2NXYB 1F42A 5CFHA 2FR4A 1IEBB 4QXUH 1UXWA 1DUYB 2A6DA 3K81A 1H15B 4HK0A 5GRZA 1UC6A 4CMMA 5IHBA 4LRIA 1KEMH 4G42B 4JPIB 4LVNB 2BVQA 4RAUA 3RRQA 2YC1B 3IS1X 1CR9L 4K71B 1U2CA 1IE5A 4P59L 3WFCH 1K6QL 4HZLB 3TBWA 1DN2A 1C12B 4U1JB 1D5ZB 1AFVH 2B5IC 2R0WH 4HKXB 3ARUA 2VQTA 2EIZA 1Y6NR 1R24B 4UUJA 3QG7L 5EFIB 1W8NA 3MOAL 4H26B 4YQXH 4I2XA 1WIPA 3RDTA 4EI5B 4HT1H 5I1JH 5DFVC 4CADA 2DQJL 4YBQD 3RI5F 5I1LA 1OLLA 1A7PH 1OSPH 1TJHH 4D0CB 5DI8A 4HWEH 5AWNH 3T0EC 4UAOC 3QEHB 2MKWA 4PGBB 2V9QA 1GOGA 1BMGA 3DRTB 5DVMA 3CDCA 4JE4B 4E41D 4B7IA 5JO5B 4Q7DA 1QBML 3G08A 2BY3A 2JK5B 3QUZB 1CE6A 1N7MH 2A6JA 5EZOL 5DRZA 1UWXH 3BIBX 3ULVD 4OI8A 3MA7B 2OLDA 1XF2B 2VC2H 4HLZH 4WW2B 1ITBB 5ALBH 1KB5A 2IBBA 4FQXC 2P8MA 2PW2A 3R1GH 4O02L 4QF1B 3HPLB 3PP4L 3QDME 5TPWL 1J87A 1VACA 5J13C 1MEXH 3VRIB 1QSZA 1UJ3B 2HYMA 4BUGA 3LS5H 3DSNA 4KHXL 1SBBA 3HNTL 5I1EH 3HPJB 3JV6A 2B1AL 1CGTA 1F13A 3HCVA 5TDPA 5FA3B 2J88L 1DLFL 2P46B 2QQQA 2EKJA 1MCQA 3DYMA 2XRAL 3TN0D 1L7IH 1IZKA 1BVLB 5HYJD 1FO0L 1A9EA 5EOTA 3OKKB 2LTQC 1MELA 5DQ9B 4D9QE 3H7BA 3ZYIA 4DWHA 4KK5D 2CDGA 4ZAKC 5HVGB 3OJDB 4WI8A 5DJ0A 1RJLB 4PJHF 2FIKA 3VG9C 1DE4A 2PN5A 3VXSD 1EBAA 2IPUG 1LEIA 3T0EA 3ARRA 4TOYH 4YPGB 3D85D 3LKPB 2VDLH 1MFNA 2X9WA 4Q0XL 2VLKB 1CU4H 5JNYB 5HHNA 5JMOC 4KDVA 3MV8B 3QDMA 3IB4A 3I75A 4UNVA 3T4YA 3VD4A 2V9TA 3LN5B 2FBJH 5HHVH 1U92A 1IFHL 1DDHB 4ZUVA 3CVIH 4M8QA 2VZ1A 3HZVB 1TNNA 2ESVE 4YNYA 3D9AL 4LKCA 4I48B 4RWHA 4EI5D 4ODHH 4GG6B 4GQ9L 5LBSH 3SDYL 5KOMC 2H2SD 1SEQH 3BP6A 5GHWL 3EYQD 3UYRH 3QHZH 5DEFB 1XT5A 1EXUA 2FWOA 2CR6A 3BPLC 3QUZD 4HJJH 2VWEC 3MCKA 1OQOA 3NCJH 4UT6L 4F15B 4XH2A 2ZG1A 1OOAA 2X4NA 1MCPL 4G3YL 4XTRC 4ELMF 4RWYH 3IFOB 4XPTH 4X6BB 4TPRL 5C0BB 2V5RA 2HT4C 1S7RA 3DV6B 1ZHKB 4PJDB 5F96L 4KKCD 4OGAD 4HXAH 4ZFOL 3LAFA 4QWWD 2V2XB 1YUHA 3WMSA 1QRNB 3AS0A 4C56D 3DUUB 1URLA 4Y4KC 5FCUH 3SKOA 5BV7L 2RBLA 3F7RA 4P5TB 2EO1A 1A6WL 4NZTL 3BD4A 1OB1B 3Q5TA 4HX1A 3ZKNC 4KJQD 3UTZA 5C0IB 1GC1H 1OGAB 3V5DB 1WC7A 4LAQL 4C55A 3H9SE 4HAGA 3HB3C 5DQJB 3IFPA 1U8HB 3ME0A 3PWNA 1R0AH 3JWOC 3O4LD 5C0AE 1OM3L 1LK2B 3PGCB 3KLDA 5HHOE 3H0TA 5HGAA 4AK1A 1QBAA 4FTVB 3CSYA 1WF5A 1A7OH 3GGWA 2Y36H 5F71A 1PZUB 4MZ2A 3BQUB 1OW0C 1X5ZA 5C0CB 5D6DC 3GSXB 3SKNB 1GJIA 3O11B 3TCXA 1AXTL 3IU4L 5JDSB 4P4KB 1K3ZA 2C1OB 2J6EL 3BEWB 2MKLC 2VLKD 1MPAL 1JZ3A 1JFQL 3MODH 4QRTA 4U1NB 2FH6A 4OV5A 4M1CD 3PWVB 1F4WH 1NAMH 2AJZA 1NEZA 1IQWH 1NAMB 1ZVHA 1Q9WB 2FNBA 2H3NB 2IH3A 3SCMA 1W8OA 4XCFL 5LJYH 2ADJA 3GSOB 2DQIL 5E99H 1RIVH 1T20A 3MJGX 4DQOL 1AH1A 3OKYA 1DSFH 4XRCA 1RZ8B 4AQ1B 2VXSH 1NCWL 4Y4KA 5J1SC 3QIWA 4F9PC 4PBWD 3LQMA 4PJXF 1C16A 2YKLL 4NM8H 1LGVA 1TETH 4WENB 3IJSB 4EIGB 3GMMB 2AP2A 1EJ6A 2PYED 3HC3L 3MRGA 4Y1AE 1YC7A 5IESL 1YNKL 3QNXA 4XP5H 1HE7A 1I85C 2A77H 1A4JB 1RFDL 1NBVL 1UVQA 1YPZF 3B6SB 2PTVA 1KACB 3DI3B 2IPUK 3RVTC 3W11D 4D9RE 3ARYA 3FOMA 4P9ML 3DJ9A 2C3VA 4LVOB 2AJYH 3WLBA 4P2RB 3CK0H 2P24A 1E4XH 1BZ7A 4EN3D 4MNGB 4OIIL 5I8EA 3O6LL 1QRND 4ODSH 4XP9L 1KXQE 1OY3B 1DN0A 3WUWB 1OW0A 2G5BB 4XMPH 3U2SA 1GGCH 1TZGH 2VO5A 3BKYH 5ICZA 3NCCB 2QL1A 3V5HB 1OVZA 4NN7B 4ENED 5FYKH 2VAAB 2Y6SC 5DD3L 5SWQA 1Q0YL 4GAFB 4ZO7A 5IHUL 2YPLA 4X7TB 2X41A 1S7XA 3ARDB 3O9WD 5E4IA 2LABA 3GI8H 3ROLA 2Q8AL 1ITCA 4KTYA 4FHBD 1JPFB 4PTUA 4QY8A 2VZOA 4LARL 1TTGA 4L3EA 4MWFA 4FG6D 2ZUQB 1KEGH 1BWWA 3S88L 1AD0B 3UBXI 3BQUD 3T65A 4JZOB 3NZHL 2P8PB 2P5ED 2C4FT 3TO4B 4ZFFB 3OAUL 4DKEH 2HFGH 5DRWA 3ULVF 1X4XA 1SYVA 3KPNB 3UTTB 1FO0A 2HTKC 3NH7L 5ISZB 4TYUA 3C2AL 1Z3GH 1U95A 2JJSA 2CO6B 1I85A 2Q1EA 3W9EB 4Z78B 2BNQA 2X2YA 3LEXB 5F89B 4ZTPH 1EHAA 3GK8L 1QNZL 2GK0B 3MLUH 2ICWI 4BSVB 2YSSA 5I73B 1X7QB 4Y8DC 4FQ2L 4XVSL 3DX6A 2AJ3B 3TJEH 3F58L 1A6TB 2Q20A 3WFEL 1ORQA 3QNYB 3LRGA 1EERB 4L4JA 3RY6C 4Z9KB 1S7VB 4Y19D 1SYSA 3FO9A 4J3WA 3PWUA 4JFFB 4OD2A 4DVRL 1CFSA 2OK0L 3G5ZB 3G6JB 1AI1L 4U1IB 4AENB 1T66C 4S1RH 1FIGL 4K23H 3TBVA 2NY4D 3LRSB 2OS7A 4GO6B 4ZOCA 3UC0H 1F3DH 1UB6A 2IAMC 4JDTL 3BGFC 5T3ZD 3O6ML 1KYOK 3FRPA 2A74A 2YBRB 2EDKA 4PJHE 1O7SA 4XBEH 3VH8B 4LLYB 2DN7A 4NQCA 4ORGA 4C4KO 1X5KA 4YDIH 1Z6JT 3DO3A 2HWZL 3UTPD 5D9SA 1WSST 2CMRH 5CZXD 5ADPL 4WI2A 4G9FE 1CIUA 1EBPA 1ZSDA 1IGJB 4W70A 3I85A 3DROA 2WWKT 5FYKD 1DUZA 4L29A 2WWMC 1P9MC 2H1PL 5HI3C 1X5LA 5DJDA 3EYOA 3HAEH 2YD6A 3MPCA 3N0PB 4TRPH 3HAEB 3V8OA 5I74C 1GL4B 3P4MB 4XC3L 1NUDA 1IJ9A 5IK3B 1M6OA 4UILL 3ULVL 2R2EB 3MRRB 3MJ8A 4LLVB 3SE9H 4XAWH 3RY6A 3I6GB 5DO2C 4FA8A 4JFEE 3NAAH 3KLAA 4ZQKB 2X09A 3FQXB 4XVJH 3N1GC 1FGNH 3V4UL 2R0LL 4RISL 3WNLA 2HVKA 2WBJA 4FMFA 4MB5A 3B9KC 4JG1L 4ODVL 5ISZD 2XIDA 4ZO9A 4MJ6A 1I1FA 4MQXC 4ELME 1X5YA 3WSQL 3VFPA 3TA3C 4JRXE 1ED3A 4MHHI 4EQ2A 2IALB 4JANB 4G9FA 4KJWC 2IAMA 4KI5D 2GKIA 4IJ3C 4FZ8H 4P3CL 3CC5A 4XCCH 1ODAA 5E00A 3UP1A 1MCFA 4PJ7E 3L5WB 2J6EA 4I3GA 4N0FA 5MHSD 1LO5A 1NGYA 2I26N 5KOVC 5IB3B 3QWOB 2DB8A 4WHYH 1ND0A 4FXGA 4H0HB 5BVJB 1J0YA 1HH6A 3RL2B 4NBYB 3N9GH 4JN1H 5HPOA 1KPVB 2YD2A 4RX4D 3WFCL 3D87B 4JAMA 3CFBA 4N0RA 2CJUL 3MV9E 4WY7H 4XI5D 2X9XA 5KANI 3P4LA 2WNGA 5FUCC 2YPKA 4XXDB 1AFVL 1J0KA 3O2WL 4FFWD 3W0WD 5F70A 2X4OB 3DSFH 3QHTC 4PRDA 4PP2A 5GRXG 1R3HA 4YBHA 2HFTA 1A6AB 5EU6A 4LQFH 4YQXL 4N8VA 1ZHBB 5I1JL 4HT1L 2IEPA 5KAQF 3ET9F 3B9KA 4CJ1A 2OR9L 2VQUA 5BS0A 1OSPL 3MO1A 5DFVD 5FUCE 1TJHL 5C2UB 4X6FA 4PJ7A 3ZTNH 2H41A 4OFYD 2BC4A 3TA3A 2MOVA 1HEZB 5IF0B 3VA2C 1U91A 2PXYB 1HDMA 5GS2D 4XNMA 3V0AC 3QEQE 3ARFA 3P73B 1LEKB 2D2OA 3OBAA 1FSKC 2VXUH 3V0VA 5C0NC 3MNZB 4PJXE 4S1DC 3HG1D 2VC2L 1S9KC 3ZL4L 1IC4H 1CWVA 1QVOB 3I50H 3SOBH 4M1DH 3R1GL 1YN6B 2ZOLB 5ALCH 3MV9A 2R1YB 3U46A 2BY0A 1RUPH 3CVHL 2IAND 4HC1H 4Q6IC 3LS5L 3QDJD 1DQJB 2Q7YA 4M3JA 1X3DA 5BZWB 4O51B 1P7QB 1T7VA 4L9DA 4R96B 1XMWA 4JGUA 3UTQA 2DJ4A 4KDWA 2FH8A 3N1QC 4G6AD 1L7IL 4PBXA 2EO9A 3CFEB 5E94B 1XZ0A 5E8DH 3T77B 4OKVA 4FQJH 5DEZA 3O6FB 2YK1H 3KDMB 1W0WB 4X5LA 1UYWH 3EOTH 2Y06L 3FQUA 4N5EC 4Y5VC 3GMLA 1HXYB 5A43C 2NPLX 5GGSY 4U31A 5CUSH 2JJTC 3TH3T 3VXRA 4X99B 4HQQH 3U7WH 2CO7B 3ZSSA 5C08B 3C8KB 3IETA 2HTLC 4TOYL 4P4RA 3DLQR 3QQ4B 3LRHA 3TBTB 5BOZG 3L7EB 1MCCA 4JDVA 1CU4L 1G9NC 3GMOA 3L3DA 2D7MA 1R3LA 1TQCB 1EZVX 1RUAH 4XMKL 3U7YL 1H3PH 4E41E 3LZFH 2FBJL 5HHVL 5ITFB 3VE0A 2X89D 1FORH 2IH1B 3MJ7B 3CVIL 3BWUC 2I9TA 1INQB 3ULVE 4KKBC 4KKAC 3RIAK 4YDJB 1KJVA 4ODHL 3L5XH 3U48A 5F7LB 4GLRI 5LBSL 4Q6IA 2GAZB 2LAGB 3E8UH 3UYRL 2OJEB 2SEBA 1I7TA 1JPTL 3C6SA 1DBKH 3BIKA 3QHZL 5EUKB 3MLSH 2FJGB 5GSVA 1JYVA 1MCJA 2ZUTA 3VCLB 4HJJL 5KZCD 4N5UA 1TZIA 3NCJL 4EDWH 1X6NA 3SE3C 2YA1A 3BGAA 2R2HA 1EDQA 4WUUD 4NUGH 3VFNB 5F6HI 4XPTL 4N1EA 2AJSH 2NXYC 2P47B 3KVQA 2P8LA 5DZLA 4Z7VE 4NN5B 4HDIA 4X6CF 4HXAL 4Y5VA 5EOQH 4KXZI 3KJ6H 2AXJA 5HYJE 3QUYB 2HT4D 2J12B 2K1MA 5DDHA 3ZT6A 4YK4B 2JJTA 4X4ME 1AGFA 2YS4A 4NUJB 4DTGH 5FCUL 4K71C 5FGSA 1SVZA 2F8OA 4PS4H 1GOHA 2VDQH 4NWTL 5DJ6A 3NCYS 5IW1B 4QCIB 1RUQH 2IBGA 4MJID 3RP1A 2F74A 3RNKA 4D94A 1GC1L 3ZKND 2CLRB 3MBEB 1EAPB 4P2CG 3TIDA 3QNZB 5GSRA 1NCBL 1H8NA 4Q58C 4P46C 2ILLA 3HTLX 5JORB 4XHJC 4QHNA 3T1FA 5ADOL 4R9HA 4X7DC 4YHPB 3T1WA 43C9B 1A7OL 1AGDB 3KPSA 1BVKB 1SJEA 3FFCB 4MDJB 2VZ3A 3ETBF 2E7LC 5DJ2B 1QSFD 4ZTOH 4OCNC 2DICA 4Z7VA 1TFHA 4WW2C 4X4MA 3MODL 1WTGT 3SE3A 2XA8L 3SO5A 1WCQA 1F4WL 3U0TB 1XH3A 1IQWL 3PDOA 4BELD 2L7UA 2HP4A 2H8PB 1EUTA 4FFVC 5E99L 2RAMA 1IEBA 1RIVL 1DUYA 1UJ3C 3F6LA 1H15A 2C5DC 1DSFL 4NJ9H 4G42A 4JPIA 2VXSL 1ES0B 4RNRB 15C8H 2FIRT 3BMVA 1BZ9B 4NM8L 3TO2B 2AEQH 1TETL 4HZLA 1C12A 4I18B 4C56E 4U1JA 1P4IH 1D5ZA 1G6RB 1T2XA 4QOKD 5F7UA 1N2RB 4HKXA 4PJAB 4XP5L 2A77L 1R24A 1T2JA 4Y16B 5EFIA 4H26A 4EI5A 4P46A 4LPXA 4NGHH 1H3UA 4JJ5B 3H9ZA 4MNHA 3DHMA 2VN4A 5JHDD 2AJYL 1IEHA 1Q8MA 1UADC 3CK0L 4D0CA 1E4XL 4MXVF 3QUYD 3WJLC 1OCWL 2Z8WC 4OLVH 1S7WB 3QEHA 1K9TA 4PGBA 4CU6A 4ZS6D 1MCKA 3DRTA 3H8NA 5JO5A 4JR9H 1CFTB 3VGEA 2JK5A 4XMPL 1GGCL 2D7PA 2G75B 3INUH 3QHFH 1TZGL 2EYRB 3BKYL 1PJ9A 3MA7A 3P0GB 4YFLF 5FYKL 1Y0LB 5AYUH 4M9OA 1XF2A 4WW2A 1IAOB 5DUPH 3TFKC 3JWDC 3MBED 4ZMAT 3IFLL 2JB5H 5IJKC 1PY4A 4OZFG 4QF1A 5JW4Q 3RWJB 4TVSa 4U1HB 3HPLA 2VLKE 3GI8L 1QSEB 3VFMB 3OQ3B 1VEPA 3MV8E 4OZIB 4FOMA 4OSUH 3VRIA 4NRYB 1D9KD 1UJ3A 4Y2DB 1SY6H 2CLVA 5EC2B 3SBWA 4I4WB 5TFSH 4N0CD 3KYOB 3HPJA 1G7LB 3KPRD 1KEGL 3BMWA 1TLKA 4JRYA 5FA3A 3QRGH 5IHZB 5DVOA 2VQ1B 4QEGA 1JYWA 3TZVD 1G0YR 4ESKA 4JFDB 3SDCB 3OSKA 3NFSH 1RZIA 4DKEL 1C5CH 1YJDC 2HFGL 1BVLA 4AG4H 2FB4H 2OL3H 5MI0B 3OKKA 1Z3GL 4IHOB 1JCKA 5DQ9A 5LKNA 2HTKD 2PCPB 3HKFA 4ZTPL 3Q5YA 3PGDB 3MLUL 1S9WB 2R29H 4Y4FD 1PFCA 1MF2H 1RJLA 2ARWA 3TCLB 2MPAH 5K33A 3TJEL 3F62A 2XQYG 5B39G 1NCCL 3WJLA 4JFYB 4U6TA 4YPGA 3LKPA 5C0BE 4FQQB 1SMOA 1QBBA 1X4YA 1VADB 5JNYA 3MV8A 1QRNE 3N1MC 3LN5A 5EO0B 4BH7B 1DFBH 3U6RB 3C6LB 4C54A 1P7HL 4GUPB 2AV1B 1DDHA 3MROB 4YBLC 3Q6GH 4S1RL 5IJKA 4K23L 1F4XH 1HHHB 1D5IH 4S1SH 4I48A 3UC0L 1CFVH 1K3IA 4GG6A 1OGAE 4F7CA 1AQDB 4OCWH 2RCSH 2CUIA 1J5OL 4KVCL 1WFNA 3LIZH 4XBEL 1QLRB 4HV8B 5DEFA 4P2OD 4YDIL 5TH2B 4X0KB 5FUZH 3ROOB 4P4KC 4IRSD 2CMRL 3IFNH 1W0VB 1CVSC 2PTUA 1EEQA 5C3TA 2KQNA 4JFPA 4APQB 3CLFH 3IFOA 4X6BA 2D31B 4G8IB 5C0BA 4PLKC 3PHOB 3DV6A 1ZHKA 4PJDA 1SM3H 2R39A 3HI6L 3PQYB 2V2XA 1BFTA 5IBLD 4TRPL 1EFXB 3DUUA 3IGAB 4XBGB 2E3VA 3OJMB 4XPHH 5JA8B 1U8OB 4P5TA 2Z9TA 3I6KB 1E6OH 3SE9L 4XAWL 1WITA 1AJ7L 1JWSB 1OB1A 2CRMA 3MRQB 5CEXB 4NDMB 1P4LB 1OGAA 3NAAL 3BP7A 4XVJL 5JR1H 1P4BH 4RSVA 1FGNL 5DQJA 5B8CB 1U8HA 1ADQH 2J2ZA 3AAZB 5GRJH 3RX5A 1X9QA 3ZHDA 1LK2A 1DBJL 2L7JA 3PGCA 4LVOC 4FTVA 5D7LD 4JG0L 2FGWH 4NKDB 1NL0H 4RZCB 3TYFB 3BHBB 3BQUA 4FZ8L 4KJWD 3ARBD 4XCCL 5C0CA 3SKNA 3GSXA 3O11A 4M6OH 5JDSA 1YC8A 4P4KA 2C1OA 1WFOA 3BEWA 1DQDH 1A7QH 4U1NA 4LRNL 1AKJB 1PW3A 2N1KA 1NAMA 1Q9WA 4BA8A 3E1F1 3C6LD 3GSOA 1MSPA 4LNRB 2UYLB 3GNMH 5DD0L 5EZJB 2GYSA 3NIFF 3N9GL 4JN1L 5FYKE 5H2BB 1RZ8A 2ZUQC 2ADGB 3ULUH 2XTLA 1GIGH 2WANA 3DX9B 4WY7L 2E27H 3TO4C 3GO1H 4GBXB 4O2EB 5D8JH 2X4UB 3UAJD 3GMMA 1IRAY 4G6ML 4LCWD 3Q0HA 3DSFL 3FO0H 3VG0L 1HIMH 4G6FB 1AC6A 4ALAH 3C5SB 1A4JA 3U4BH 3D69B 4LQFL 4PYGA 1MQ8A 3B6SA 2EDNA 4PUBH 3T0DA 1G9MH 4JO1H 5KSUB 2XQYK 5HHMB 5I73C 1QD0A 3WXWH 4NCDA 1KJ2H 3ZYOA 1M7IB 1KJ2B 3PQYD 4PGZA 4P2RA 3QXAB 3VXQB 4MNGA 4JB9H 1AR2A 5ISZE 2E9JA 2CIIB 2EZ0D 3WUWA 2PW1B 5B21A 2G5BA 1MOEA 3CDYA 1S7UB 1QYGL 3V5HA 1CD1B 4KI5E 3S37X 5DD5L 5DS8B 4W4NA 2VAAA 1F8TL 3V7AE 4X80H 4OD3H 5EIVA 1N64H 3I50L 3SOBL 4M1DL 2O93L 3Q2CA 2DL9A 3OGOE 2VUOA 3ARDA 5ALCL 4HKBA 1FZMB 3QDGD 1OAKH 1RUPL 1JWMB 4HC1L 4LDLB 5MHSE 1NC2D 4DKAA 2VAJA 1JPFA 5SWSB 3JV0A 4XPGH 4F7TA 1C8PA 1MQKL 5HGGS 2FZ3B 5L6YH 4LLMB 1UH4A 4MXVE 2YD1A 1AD0A 1R3KB 5FM8A 2P8PA 1U3HB 3TO4A 1WAAE 4ZFFA 2OI9C 5FYLH 1CGWA 4RMSA 3BRGC 1I9JH 4FQJL 3FN3A 3KPNA 4P5KA 2ATKB 2XZAH 3UTTA 3ALWA 4CDGC 5BXFB 1JNJA 5ISZA 2GCYB 4Z78A 3W9EA 1ZT7B 3BO8B 3EOTL 4PJ8B 3R0MA 5F89A 1UM6H 5J12C 2GK0A 2J3SA 5FXCH 5CUSL 3THMH 3W0WE 1JGEB 1MCRA 2JCCF 4YGVB 4BSVA 4HQQL 1X7QA 2D7QA 3U7WL 4O00A 2AJ3A 2AQ1A 3MGOB 4LF3B 1A6TA 2DWEB 2X4SA 3CFKB 1PX3A 4FQIL 5DHXB 5LGJB 4LSTL 1S7VA 2NY1D 3O3EB 3QSKB 3ULUD 3WD5H 1RUAL 1YEKH 1H3PL 3RPKA 3LZFL 4JFFA 5L2KD 2HMID 4HZAA 3G6JA 3WUZA 1FORL 5T1MB 5FV2A 1VHPA 3ARGB 4U1IA 4G6FD 3MJ9L 3L3GB 4AENA 4MLIA 4JM4H 4JO2H 3HG1E 2XACC 3LRSA 3L5XL 4H0GA 1WAAA 4KKBD 2DDQH 2ITCA 4AMKH 1DBKL 2YBRA 3MLSL 4XWOD 3VH8A 4Z5RB 4UIMB 1U6AL 1WT5C 4X5WA 5CSBA 2NXZC 5KG9B 3X3FH 5C8JB 4EDWL 4M5ZH 4NUGL 1KLUB 1T5WB 1IGJA 1UZ6E 2AJSL 4EBQH 3UPAA 5EOQL 3KJ6L 4K9EH 4RIRA 5C0EA 3KPOA 4HUWB 1K4DB 1ZXQA 5DXWA 2ZNWA 4DTGL 1MCSA 2MMXA 4PY7B 3HAEA 2FX9L 3P4MA 4PS4L 5EC1B 1ZEAH 5EZLB 5FO9B 5IK3A 5SWSD 2VDQL 2R2EA 5MEOB 3MRRA 4LLVA 3O0RH 4PJGF 5J11B 4HK3N 1X5IA 1RUQL 3I6GA 3WEXB 1B88A 4ZOBA 5IMMB 1JI2A 1NCDH 5KN5B 3WIHL 3VFVB 5J1AB 1U3HD 4NQTA 4ZQKA 1BJ1J 3FQXA 2ICCA 1IAKB 1WWBX 3OKOB 4I3RH 2PO6C 2NCMA 5FGRA 3IDNB 35C8H 5L2JB 4XHJD 2LVCA 4Z7UF 1I1RA 1HNFA 4L3AA 2DQCH 2IALA 4JANA 2EXYD 5GGTA 4ZTOL 2PXYC 5HD8D 2IJ0C 2YXFA 4F3FB 4WTZA 5T5FH 1S78C 5GGVH 2VYRE 3VXMD 1T4KB 1QQDA 1WT5A 1IKNC 5MEQB 3PWPD 3I2CH 3L5WA 3S6CA 3STBA 1GPOH 4QHKJ 4OZGB 1BQSA 5GGSB 2G9HA 1MCNA 1TJGH 5JIIA 5IB3A 3QWOA 2A83A 3ARGD 4X6DB 2VDMH 1IMHC 1T0PB 4IEFB 5BVJA 4NJ9L 3RL2A 3TF7C 5ERWA 15C8L 1KPVA 1CXKA 1A7NL 2IFGA 1FHGA 4A2LA 1P4IL 2K7PA 1MCBA 3WN5C 2AEIT 2JIXD 4XXDA 3ZSTA 3NBNA 1FDLH 1ZGLB 4RGMB 2X4OA 2DQDH 4K94H 3WDHA 4NKMB 2YZ8A 4NQEB 4J4PD 3K7UA 1A6AA 2KH2B 4MJIE 1ZHBA 4XPAH 4NGHL 3BVNB 3EJYD 1T5XB 1NBYB 4JM2D 4UTAH 1YEJH 3BDBA 4PJBB 3QG6A 4OLVL 1CGVA 2QR0B 5IF0A 2XA3A 4XBPB 1JV5B 2PXYA 3HI1B 1U93B 4GOSA 4HAFA 4JR9L 4MS8D 3QPQC 4OZHB 4HIXL 3NIFE 3QO0B 3P73A 3D0LB 3A6CL 3INUL 3QHFL 4MXQD 1LEKA 4M8VA 1M05A 4DGVH 1TQCC 4LHUD 3MNZA 1BJMA 4S2SB 1IKNA 5AYUL 5DUPL 1V3LA 2D4DA 1GHFH 4MB3A 1QVOA 1MI5D 2JB5L 2O5YH 3TT1H 1YN6A 2ZOLA 3PV6B 2YUWA 2R1YA 3MC0A 3JBG7 4OSUL 3RWCB 4HC1A 2AQ3A 1SY6L 2N7AA 1DQJA 3EOYG 4GLRH 4LGSB 2ENYA 5TFSL 1NFDF 4HIIB 1XCQB 5BZWA 4O51A 3WIFB 1L0XA 1P7QA 3V7MA 3QRGL 4AL8H 3T09A 4QGYA 5F1KC 4HWZB 3NFSL 5JIHA 1C5CL 5ESAB 5E94A 3QYCA 4AG4L 2FB4L 2C1PB 1G7PB 1IM9B 3T77A 2OL3L 4PJCB 3MUY1 2VR9A 3HZKB 3ARTA 3O6FA 3V4VH 2ZWLT 1W0WA 3D6GA 2PTTB 4QRPD 1UKSA 4NN5C 4QOKE 2R29L 4LVEA 1HXYA 3C09B 2VLLB 2G2RB 5BQ7B 1MF2L 3IDMB 2MPAL 3UYPA 5C08A 5DLMH 3C8KA 1IGCH 3FT4B 3P9LB 3QQ4A 3TBTA 4R2GB 3PJSB 5JHDE 3L7EA 3JSSA 5JPMB 4YC2B 1JZ8A 4TUKH 5CIPH 3KJ4B 1DFBL 5CD3B 3EJZD 2IH1A 3MJ7A 2VMFA 1INQA 1RUKH 1RUMH 3Q6GL 2YD9A 1I8LC 3U4EB 1D5IL 4YDJA 1MCLA 1CFVL 1IGIH 4OCWL 3VD3A 1J0JA 2RCSL 4JGJA 1BAFL 4GRLC 2GAZA 5KVEH 2FLRT 1CXEA 3SQOL 4KJYB 4DN4H 1DQMH 3LIZL 2OJEA 2FJGA 1FZOB 4ZO8A 2BVOB 3NIDE 5FUZL 5DK0B 1XF1A 4Z7NF 3OR7B 3BZEB 3HUJB 1UQSA 3IFNL 1B0RB 4DVBB 3QB7C 3ULUF 3KPRE 2FGZA 3VFNA 5FHBH 3MRDB 3DMMB 3H42H 2DS4A 4LOUC 3S96B 5CLTA 4NUJA 2OCFD 4TVPH 1U36A 3LS4L 2R56H 4XPHL 5EH1A 2XY1A 3ECBB 4WWKD 1E6OL 4R7DB 4L5FH 1JE6A 3HHRB 4QCIA 5F9OL 1KSRA 2N7BA 1CD0A 3WNMA 4S11A 2XI9A 2X4PB 3ZMRA 2CLRA 5F7DB 4MQTB 1EAPA 5JR1L 1MNUH 3QNZA 1QO3B 4RFNB 3V5KB 1ADQL 4Y16C 3T3MF 1U42A 1IM9D 2BNRD 5GRJL 2AEPL 4ONFH 5JORA 2X1QA 2EEBA 4K3JH 3BFOA 2FEDD 4YHPA 2C3WA 4JLRB 1I8LA 43C9A 1AGDA 1BVKA 4HKJB 2J4WH 2FGWL 4PJAE 3FFCA 1NL0L 2FD6H 4MDJA 5AZ2H 1I8MA 1CDGA 2V7NB 3RVVC 5DJ2A 3QUXC 3OKDB 3EYSL 1QR4A 4JJHA 1U3ZA 4RA3A 5HGBB 4EDXA 3LQAC 2UVFA 2UV3A 3B3IB 1NEZG 1DQDL 1A7QL 3GUTB 1YEHH 3QXTA 4M7LT 3U0TA 3NN8B 5CBEB 3MRHB 2H8PA 5F1IB 4RCAA 4CW1B 5D6CB 3MLXL 1JHKH 3GNML 3R4DA 4N90D 1YNTB 5TDOB 4JFXB 3NABH 3O81A 4KRPC 1CXIA 5FGBA 1ES0A 3P40A 2X6MA 1Z9OA 4RNRA 4Z7UE 3PXJA 3TVMB 3ULUL 1CTNA 5I17B 1BZ9A 3TO2A 1GIGL 3RVWD 2E27L 2JELH 4I8DA 3SDCC 1E4WH 3GO1L 4I18A 5D8JL 1QSEE 1XF5B 1G6RA 4OZIE 5DUBB 2ARJQ 1QG3A 1N2RA 3FO0L 4PJAA 1HIML 2UZYB 4ALAL 5T3XH 1A14H 1P7KB 2KDGA 4M43H 3CX5K 2VKXA 4Y16A 4PUBL 1NGZB 5MENB 4YHOH 1G9ML 4PRIB 4JO1L 1T0MB 3VXUB 4CL7A 3WXWL 4JJ5A 3DMMD 2F5AH 1KJ2L 1J1XH 2N56A 5EPMB 3VRLE 1E4JA 4OQ1A 4DZ8B 5ID1B 4OZFB 5E8OB 2FBOJ 3E2HC 1J10A 1S7WA 2DQTH 3VWJB 4JB9L 3RNQB 2KPNA 4JQIH 5I0ZA 3NVQA 2WUBH 4TVPD 2G75A 3QQNA 4XP6H 1NMCC 5C07B 2EYRA 5D5MA 2VLRD 3WE6B 3AU1B 4YDVB 5BJTB 3L3KB 3QEUA 4CUCA 1Y0LA 5CCKH 1B2WH 3IF1B 4U1GC 4X80L 4OD3L 1N64L 4YXKH 3BH8B 2XKSA 1EX0A 2DI9A 3H3PH 3RWJA 1VA9A 1OAKL 1NJ9B 3X11B 4U1HA 3VFMA 1QSEA 5TE7H 4OZIA 1I7RB 1G84A 1OAZH 4PBVC 4NRYA 4JM2F 4Y2DA 5EC2A 2X70B 4I4WA 1RK0B 1F4HA 3QUMH 3KYOA 1I9IH 2D03H 2LV4A 3QUMB 5L6YL 1G7LA 1RHHB 5IHZA 2DQHH 2VQ1A 4JFDA 3SDCA 5E8NB 2VDNH 4NHUB 1T6VN 1I9JL 3U9UB 2XZAL 5F7YC 2P5WD 4AIZA 5FAAA 5L88H 4IHOA 4Z8FL 4YUEH 2PCPA 3BH9B 3DRQB 1RHFA 5IB4B 1UM6L 3PGDA 1F2QA 1S9WA 5C09B 3THML 4LLQB 5EBMB 9CGTA 4DZBA 4R0LB 3KS0H 1J0IA 1FNAA 3GDBA 3EFDH 3QH3B 3TCLA 3P11H 5C92A 4LGPB 3M17B 4WJ5B 4JFYA 4HMEA 3AGVA 4ZXBB 2WP3T 4FQQA 3M1BB 1NFDE 3PQYE 2NY6B 1VADA 3PHQB 3WD5L 1YEKL 4RA0C 1HK6A 1KJMB 4FP8H 4W6WB 4NRZB 3RU8H 5EUOB 4BH7A 4NZDA 4PLNC 1HOCB 3C6LA 2VUYA 4GUPA 3MGTA 2AV1A 3MROA 5I6XC 4JM4L 4JO2L 5T3XD 5D1ZB 2WW8A 4GMTH 1HHHA 3BI9X 5EN2B 4WHTB 2DDQL 1AQDA 1DTUA 1ZS8B 2EXWC 2D0GA 3AFLA 5D72H 2A6KB 1MFAH 3A6BH 3QDGE 1QLRA 4HV8A 1AO7D 5TH2A 4X0KA 3ROOA 3X3FL 4LASH 4NO0D 1W0VA 2APVA 4M5ZL 1LDSA 4APQA 1KENH 1LEGB 1XGYH 1BPVA 4EBQL 2GITB 1DQTA 2D31A 4G8IA 3ZDZF 3PHOA 4K9EL 4OLZH 4KROB 2DLTA 4WI3A 4Q9RH 5DURD 1EFXA 4XBGA 3IGAA 1ZEAL 1U8OA 3I6KA 3O0RL 4C4KT 3EUUA 3X14B 1JWSA 3MRQA 1NCDL 1NQBA 2Q3AA 4P23C 5CEXA 4EQ3A 5EU4B 1P4LA 4XC1L 3FQNA 4ZYKB 1GSMA 3H6JA 4I3RL 2NY5H 3AAZA 1ADQA 4NN6B 3ULUE 4NNXB 4MCZB 4MVBC 2VDRH 3DGGB 35C8L 1XIWB 5IHLB 3S4SB 1CIDA 1EEZB 4V2CB 5FGCB 2DOCA 4LVHC 2DQCL 1I8KB 5SV4A 4NKDA 3TYFA 3BHBA 5T5FL 4QHMA 2GEEA 4O9HH 1CQYA 5GGVL 3VGDA 1CK0H 3RIFK 3MLZH 2DLFH 3G5XA 4HUMB 1T7WA 4ZXBD 1MJ7L 3QWRD 1F6AB 5I1IH 3B5HA 3I2CL 4KQ3H 5GISH 5T1KD 3C5ZD 3W5NA 1N4XH 2NY6D 3LOWA 3RVXC 2O26U 1GPOL 2BCKB 3SGEH 1AKJA 1TJGL 3RGVD 4AY0A 5F9DC 4MNQB 2ZP0T 3QT2A 1KTKE 1U8KB 2VDML 1CD8A 4LNRA 1U8JB 5IFAL 2UYLA 5D1ZD 5EZJA 1HILB 1A5FH 4F7PB 5KTEH 5H2BA 3RHWK 3W2DH 1FAIH 1F6FB 2AXGB 2ADGA 1BHGA 1R3JB 1ZVYA 3O8XD 3D39B 5SX4I 4WO4B 3DX9A 4G8GB 3MV7D 2GJ6B 2WZPD 4GBXA 2X4UA 1FDLL 4ZNCD 4N8VG 1H3WM 5JIKA 1ZHLB 2DQDL 4H1LG 4K94L 5D1QB 5SWSE 4KRLB 4PRNB 1EPFA 1ZVSB 4YJZL 5C0DB 3D69A 5A40E 1T1YB 4M93C 4MD0B 2IQ9H 4U1KB 4NQSB 3RPIB 2APFA 4M3KB 4UTAL 5KSUA 1YEJL 4XVUD 2WMPA 2NY2C 1M7IA 4LSPH 3CX5J 4B50A 5FYLE 3UTSB 4YO0B 2XYCA 5KSVB 3QXAA 4KROD 3VXQA 4KK8C 3W39B 1M7DB 3RI5K 1ULVA 2BOCA 2W60B 2CIIA 5C6PB 2PW1A 3DUHA 3GRWA 4DGVL 1S7UA 1S7SB 1CD1A 4ZUUB 4ODTL 1P2CB 1EEUA 5DS8A 1GHFL 1S5HB 5CBAB 3ZHLA 1CXLA 2EDHA 4LCIH 3SDXF 4A6YH 3MFGB 2O5YL 3TT1L 4DJMA 1RZKH 4FQCL 4M02A 3BRFA 2YHGA 4CVUA 2FL5B 4HH9A 5FOBB 3K8KA 3O41B 2YZ1A 2FZ3A 3WDIA 4AL8L 4NKQB 4LLMA 4XNQB 1R3KA 3FMGH 4MA1B 3RY5A 4EVNA 2HA1A 2DIJA 4M62H 3HC4H 4P3WA 1F4YH 3WFHB 4QRUB 5BO1H 1JZ7A 1BX2B 3V4VL 2ATKA 4HD9A 5BXFA 2WWKO 5I75B 2GCYA 4Y5XB 1ZT7A 3BO8A 4PJ8A 1DBMH 4Z7QF 4BKLB 2ZNXA 2B8OT 3S5LB 3MLVH 2CD0A 4NZJA 5FA4B 1JGEA 1N5AB 4M7LH 4YGVA 4IRJB 4JCMA 1KN4L 4CAGA 5DLML 4LF3A 1IGCL 1S7TB 2DWEA 3IAPA 1GAFH 1OT1A 4HLJA 5SWZD 1YEEH 1VFUA 2UUDK 3CFKA 1T83C 2HT3D 5DJ8B 5J11C 5LGJA 3SHSA 3LKNB 3O3EA 1CXFA 2R0KH 1G7QB 3V8CA 3PUCA 3ZDXF 3T3PF 2GJZB 2MJWA 2W0PA 4U7SA 1CL7H 1EVTC 4LL9A 4HWBH 3BT2L 5T1MA 3VMPA 5D1QD 1NGXB 1WTLA 1RUML 1RUKL 3L3GA 3CIQA 4Z76B 5A2IH 4JZNB 4NQUA 4Q2ZB 5C7XH 3FRUB 1IGIL 1MHHB 1OPGL 1KN2H 3RFZC 1YEGL 1A6VH 3X12B 2CPCA 3NA4A 3NA9H 4DN4L 4PV9B 4GRLD 1PDKA 3AS1A 4Z5RA 3LV3B 4POUB 4UIMA 1MLCB 2MHAB 2EDBA 1J8HD 2APBA 4RMUA 5C0GB 5KG9A 1WFUA 1I8IB 5IB5B 5C8JA 1AE6H 5IB1B 1BD2B 5C6WH 5BVPH 4UNUA 1U8NB 5IVXF 1BFOB 1CICB 4QHKI 1KLUA 4EKXA 1T5WA 4R4NC 3V6FB 5FHBL 1YY8B 1MCWW 1G0XA 1YYLH 2NZ9D 4J3XA 2R4RL 3H42L 4ZNEE 5D7IF 4F8QA 1PYWB 3WXVH 1IL1B 1M7XA 4HUWA 1K4DA 3RWDB 3KLHD 5D2LF 4LOUD 4PY7A 4TVPL 4V1DB 2R56L 2YA2A 4HBQA 4QRPE 5EC1A 5EZLA 5FO9A 5CHNB 4L5FL 5MEOA 1A7BA 1ROWA 4PRPB 3VXPB 1T83A 1BFVH 2R4SL 3WEXA 1JF5A 2DMCA 2YXMA 5KN5A 2FLBT 2HT2C 4RGMC 5J1AA 3VFVA 1PEWA 3GSWB 4GS7B 1EGJH 1UENA 2CDFB 4QYOB 1IC1A 1MNUL 4X8JB 4O2FB 3EZJB 3FB5B 4KKLC 3OKOA 4N0UB 2UZIL 1P6FA 3IXTB 2CXGA 4NQVB 4K3JL 1J1PH 3CU1A 3IDNA 4BH8B 5L2JA 1J11A 3REWB 1HN1A 2J4WL 3B4NA 2FD6L 3EOBB 5AZ2L 3ZDZE 5J4MA 4TNVF 4CVXB 4F3FA 3L1OH 3ZE1E 5J8OA 4HFWB 2OSLB 1ZV5A 3MRKB 4G7VL 1KCRH 3QUXD 1MIEH 3IDIB 4XB8A 2QADB 1ACYL 5E70A 2W0LA 3HI5L 1T4KA 4MAYD 1VERA 5DUMH 1ZLWH 3IKCB 5MEQA 4PJBE 2F8VA 2NY3B 5LCVH 1YEHL 1Q9OB 4OZGA 3S35H 5KBNC 5GGSA 2BXZA 2AGJH 3ZKMD 3MQIA 4O5LH 4X6DA 1FFQA 1JHKL 1H9VA 4L4VB 2F15A 1XGTB 3NABL 2A1WH 4U33A 3ALXA 4JY5L 3HMXH 4MMZC 3RVUC 3CAFA 5D2NC 3QUKB 1I9EA 2DBLH 1UT9A 2JELL 1E4WL 1FFNB 2Q76B 3MLTB 3F7YB 2XKUA 1F11B 3MTRA 3BN9D 1ZGLA 5T3XL 1A14L 5IIEB 1KIRB 4NKMA 3KYKH 4NQEA 2EDXA 4M43L 3C09C 4D0BA 4YHOL 3LB6C 2XFXB 5C2BH 3BVNA 2VKWA 3R0NA 3NGBC 1T5XA 1NBYA 2F5AL 1J1XL 3GMNB 2Y4SA 3PE9A 5DA4A 4PJBA 3U1SH 3TBYB 5A2JH 2BRRH 2QR0A 2DQTL 4PJCE 1CFNB 4XBPA 1NAKH 1JV5A 4R2GC 1U93A 2WUBL 4V1DD 4IS6B 1A3RH 1OTUC 4OZHA 1PX4A 3QO0A 3D0LA 1X5GA 3QRFM 4HLZG 3U0WH 4G6JL 1MJUH 1KCVH 4NM4H 4GKNA 3WIIH 3BRDA 4S2SA 5CCKL 1B2WL 3O2DA 3KJ4C 3MBXH 4YXKL 4PTTA 5LGKA 4WEBH 4W68A 3VXNB 2K9UA 2FEEI 3H3PL 4XAKE 1AC0A 4NIKB 5TE7L 4R6UA 2YWZA 1T21B 3RWCA 4GW4B 4EOWL 3KPQB 1I9IL 4U1LB 2D03L 4HIIA 1XCQA 3WIFA 4OLWH 3L7FB 2NY0D 2WIMA 2ZZUT 1SQ2N 4K8RH 2DQHL 1OAYH 4HWZA 4N90E 2XT1B 2VDNL 5ESAA 2QADD 3ZKSD 1NGPH 4I13B 1G7PA 1IM9A 4PJCA 5CJOL 5L88L 3LSOB 1JNNH 1IILE 4YUEL 2PTTA 4MD5A 5LVEA 3CDGB 4RRPG 2Y5EA 3F7QA 3UMTA 1U8MB 2G2RA 1QFWM 5BQ7A 3CU7A 1N0XL 3IDMA 3P11L 3SDXE 4LP5A 3FT4A 2R15A 3P9LA 3T04D 4OGXL 5I8KH 4K07A 1P1ZA 3PJSA 4BUHA 4OGZA 5JPMA 4Y88A 4X4YB 2I9LB 1FYTD 4W4OC 5F1OB 4FP8L 3RU8L 2YRZA 4KY1H 4RFNC 3M8OH 4TVPE 5F72S 3P4NB 2GUOB 5DMIH 2VLRE 4PJ9B 4OAWB 5JDJA 4GMTL 3U4EA 2BSED 1BJ8A 1JN6B 4NO2B 4K7PH 4TQEH 5I8OH 2EEAA 4PG9B 1SVCP 3MRBB 4HGKC 5D72L 3OB8A 1MFAL 1QFHA 4KJYA 3A6BL 1MVFA 1FV1B 1CFQB 4U6YB 2BVOA 4XMLH 2ESVB 5DK0A 4JREB 3OR7A 3BZEA 3HUJA 4LASL 1SJVA 5CD5D 4M1GH 1EMTH 1B0RA 3WS6C 4MX7B 4DVBA 3IDJB 1PG7W 3C87A 1KENL 1XGYL 2DYPA 1PSKL 1G7MA 1IC5L 3ZDXE 1QUNA 3GJEB 2UVEA 1TPXB 3DMMA 3MRDA 3MUJA 5HPMB 1Q9LB 1HHIB 4HIHB 1VFOA 4OLZL 3SJVB 4LSUH 1JF6A 3S96A 3P30H 4M6NH 3TV3H 2BY1A 2CK2A 5IROC 1HYRC 3TVMC 3ECBA 1NUFA 1G7IA 1KV3A 3QXDA 5GS1B 1DANT 4K8RD 2X4PA 4P23D 5F7DA 5CZVL 4W4OA 4HUKB 4U1MB 3MRIB 4Z7WF 5ECJE 1TXKA 5KSAB 1BBJB 1QO3A 3V5KA 1FZKB 4DCQB 2NY5L 2F54A 5IVXE 2VDRL 3V52H 3DHJA 1ZAGA 2R9HC 2XTJD 4ONOA 3HRPA 4JLRA 1UWXK 4YAQB 4HKJA 1CLCA 1ZANL 3VWJC 1MAML 4XPBL 2V7NA 3RX8A 2XN9B 4L8SB 1DQQB 1RY7B 3OKMB 5T3XE 4O9HL 1K6QH 5HGBA 5HHOB 5MENE 4PRIE 2DLFL 3ISWA 5EOCJ 3B3IA 3VI3F 4KQ3L 5GISL 1N4XL 2FECL 1KIPB 2DQEH 2ZUYA 3QI9D 5CLWA 3D2UD 3GUTA 4GRWH 2LU7A 1AO7E 4GRWB 4JO4L 3NN8A 3FB8B 3MRHA 4G9DB 2HKHH 5F1IA 5C07E 1OD9A 1UACH 3MV01 1A5FL 5KTEL 3TH2T 1YNTA 5TDOA 4JFXA 5HDBE 1FAIL 3J8F7 1AQKH 3QFJB 5IROA 1CGXA 3TVMA 1ONQB 3RZCB 4X98B 4J3VA 2EE3A 1PG7X 2X4TB 4YDKH 1I1AB 1XF5A 2VE6B 5E2UL 2CDEB 4RMWA 4WI6A 1MFEL 5DUBA 2HLFC 4FQPA 4GT7A 1P7KA 1BQUA 1TTFA 4JVPA 3K2MC 4Z77B 2RJMA 2IQ9L 5KSBF 2J1KA 3P0VH 1NGZA 5MENA 4R0LC 4PRIA 3VXUA 1T0MA 3NACH 5A1AA 4LSPL 3FKUS 5EPMA 4DZ8A 4P2YA 5ID1A 3KHOA 3L5IA 3VWKB 4OZFA 5E8OA 3SJVD 4HPOH 1QPPA 3VWJA 5IWLC 5IMLB 2ENSA 3RNQA 1G7HB 3MRMB 2J88H 4FRWA