5TQ2L

Crystal structure of amino terminal domains of the nmda receptor subunit glun1 and glun2a in complex with zinc at glun1 and glun2a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
209
structure length
202
Chain Sequence
DIVMTQAPATLSVTPGDRVSLSCRASQSIADYLYWYQQKSHESPRLLLKYAIPSRFSGSGSGSDFTLTINSVEPEDVGMYYCQNGHSFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLAAGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords NMDA glutamate receptor subunit
publication title Molecular Basis for Subtype Specificity and High-Affinity Zinc Inhibition in the GluN1-GluN2A NMDA Receptor Amino-Terminal Domain.
pubmed doi rcsb
source organism Xenopus laevis
total genus 31
structure length 202
sequence length 209
ec nomenclature
pdb deposition date 2016-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tq2L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tq2L01
3D5OF 2BY2A 3S36H 1RPQA 5F89A 1LWRA 4XXCA 4JY6A 1T03H 3HG1E 3HNTL 4JCLA 4RWHA 4EI5B 1OTSD 1FYTE 1V5JA 4H20L 5JW3L 4HUVA 1ERNA 5EU5A 5DUMH 2PW1B 3RZCD 3F7YB 4DTGL 3D85B 3IGAB 3S35H 4NO5B 5IMMA 2Q76B 5LAXB 4GG6E 5TDPB 3HR5A 1VFAA 3BPNB 4POZC 3F8UB 3UEZA 4YHZL 3PWPD 2QLVB 4I0PB 4K3HA 3B9KB 4HC1L 4D9LL 3Q3GA 3STZB 5ICZA 1CLZL 1WITA 2WWMD 3QYCA 1BZ9A 2R2HA 4X5LA 1DQJA 3ULSB 4X7EC 4TNVK 2WW8A 3TA3B 5T1KB 1AHWB 1U3HC 4L4VB 5DDHA 1HIML 4WI3A 3QNYB 4JVUA 4W6WB 1A7QL 3KHOA 1QFUL 1UM4L 5GRWA 2GT9A 2QQNH 5MENA 2L7UA 4WWKD 5H35B 3EDFA 4MD0A 3JWDC 5DF0A 4K3EL 1IRAY 4HWBL 4D3CH 1CLZH 1G7PB 3ARDD 3TCLA 2WANA 4NQSA 3LKRB 5ID1B 1ORSA 3LMJL 4JM2C 1ODAA 1HIMH 1CGUA 3WIFB 2R0KH 1NFIB 1VKXB 5T3ZH 1A7QH 5JDSB 1QFUH 1UM4H 1N4XL 4XPBL 1WWBX 4OJFL 3ARFC 5E9DD 2HYMA 1S7VB 1MFBH 1HH9B 3INUL 2R29L 1MCEA 1DEDA 3NCMA 4HWBH 1HQ4A 3X11A 3MJ9A 4OFPA 3TO2B 2CQVA 4PJAB 4I48A 3B5TA 1IM9A 1H3XA 2H26A 4JDTL 2EH7L 4TYUA 1VFBB 3ME0A 3KWWA 4EUPG 5JW5A 3Q0HA 1QSEE 5ADOL 3S5LG 2P5EB 1A47A 4DAGL 1WCQA 2XG5A 3FQNB 3UTSA 5HDBF 4L3EA 3W11D 1LP9A 1AY1L 1N4XH 1DVFC 1RJLB 4N8CL 4OJFH 1WZ1L 5C0CE 4RFEA 3ZMRA 2XY1A 3BZFA 3INUH 2R29H 1RAMA 1JWUB 2R1XB 4JFPB 2Y36L 4F33B 3QEQA 5CZXC 4D9QD 5T1MB 2XXMB 5IK3B 3IDXL 5D5MF 2FZ3A 1H15B 4JDTH 1ZLUK 3T1FB 4K8RL 5HHOB 1PAMA 4BSVB 5ADOH 2HJLB 2R56L 2VXSL 4A2MA 1INEL 2O61B 2ZPKH 1JWSB 3KXFB 3MREA 1HWGB 1CD9B 2O26U 4PJIE 1T66C 1AY1H 5D7LD 4I18A 2HLFD 2WUCL 5C92A 2YC1B 4N8CH 1WZ1H 3NFPB 4Z9KB 1HYRC 4Q58C 3GSOB 1S7RA 4WGVB 5CJOL 3IVKB 2EDHA 1JHLL 4P3CH 2CH8A 3CFIC 4RSVA 4PRPB 4U3CA 2HKFH 1BP3B 1NDGA 3OKMA 4JFDD 3IDXH 2VDPL 3TJEH 4HGWA 4P5TB 1U8MA 2R56H 2VXSH 4HBQA 2GJZB 1U8LA 2D0GA 2YPLE 1FAIL 5HD8D 3IJSB 5GZNC 1AXTL 1IAMA 3DGGB 2NY0B 3IRZA 3QWQB 2YRPA 3QCUL 2WUCH 2EDEA 1S7WA 3P4NB 1HKFA 4CVZA 1B4JL 1JHLH 5F3BA 2R4SL 2VZTA 4V2BA 1QPXA 3PP4L 3GSRB 4FQCL 4ODXA 4PRAB 3T0DA 35C8L 5C0AD 1FAIH 1Z9MA 1AXTH 2Y23A 3UJTL 1A0QL 4H88H 5C9KA 1R24A 2DIAA 3SGDI 2N56A 3QCUH 4MJ2A 4DZBA 4R3SB 5TE6L 2Z93B 2R4SH 3RL2A 3U46B 4LRNL 4OAWA 1QSFE 3KS0J 4PJGE 1IC5L 4LAQL 1R5WA 4UDUB 4FQCH 3R0NA 2AK4A 3A6BL 3PQYB 35C8H 4MJ5B 4NKOB 1K4DB 3T0EE 3HMXA 3RVXD 4KJYB 4UINH 2NZ9C 3UJTH 1A0QH 4HS6A 4P46D 5EBGA 3Q1SH 5KANI 1IFHL 3U83A 4KMTL 2EXYD 1AGBB 1NSNL 3CD4A 1IGMH 4LPUA 5TE6H 4QRPA 1DR9A 1MQ8A 5GGRB 1CIDA 5TF0A 3MRDA 3JZ7A 4LRNH 4M6OH 5INCA 2C3HA 3KLAB 3T3PE 1X5IA 1IC5H 4HH9B 4LAQH 5FAAA 5LG1A 4XTRD 2FX7L 3RA7L 1Z9LA 3A6BH 3GKWL 1HHJA 2JJTC 1N5AA 1O7VA 3C60B 4WFGD 2CRYA 4RISL 5SV4A 4J3UA 5DMKB 5EO0B 4X0KA 4U0RC 1JP5A 2VLKE 3E0GA 4YEFA 4Z7NF 4KMTH 3QG6B 1YEJH 5IHZB 5GS1B 4C4KO 3GEWB 4MJIB 1AGCB 3DO7B 2ZUQC 4PG2A 1TJHL 3ZE2E 4FXGA 4KROD 4X6FA 3MNVB 4MAUL 4OGXL 5HDQL 1H3WM 1VESA 3B8SA 3HAEA 2NY6D 4KAQL 3WNLA 2FX7H 2VSDA 5DJ6A 3RHWK 1WIUA 3GKWH 2DDQL 3QO1A 4E41D 1LMKA 4ODWB 3U7WL 2VABB 3MLTB 3MV8D 4LLYA 4RISH 2NY3B 4EUPA 3HI5H 1I7RA 3S5LA 1YMMA 5IVXA 4M7ZB 4ZFGL 4KK8C 1WWAX 4A2LA 4R26L 2HFEB 1UCBL 1KPUA 4M5YH 1SYVB 3MJ9L 5C6TH 3ARUA 4MAUH 5HDQH 4CVXA 2CGRH 2R1YA 1CDIA 5DT1L 1HHGA 4L29B 4PREB 3PF2A 4OF6A 1RZJC 3PE9A 3KHQA 5E8NB 2Y07L 3G5VB 4BSJA 5SWZA 3O4LE 4PGBB 4W4NA 3ES6A 1C12B 4O51A 5GGVL 4K7PX 3DVFA 2DDQH 3VXRA 2R2CA 4FTVA 2V2WB 3U7WH 5C0BA 4W81A 3DMMB 3SE4C 2V5SA 5FHBL 3DRQA 3BHBA 5MI0B 4ZFGH 5IIEB 3H0TA 2YS4A 3QI9B 3ZDXE 3G08A 4MYWB 1UCBH 3MJ9H 4Y4FC 3DXAA 1GGBL 5DT1H 5F89B 3I6LE 1BAFL 3C2SA 1T2XA 4FOMA 3V6FA 3T2OA 5J1SC 4XCYA 5DVLA 1MCCA 4OD2A 3ZHKA 5GGVH 4HUVB 5AUMB 5EU5B 3QIBA 5IM7B 5DC0A 3E6HA 4MNQA 4JKWA 4NO3B 1ZV5A 5IMMB 5FHBH 4NFBA 3LRHA 5D9SA 3D3VA 4PJFA 4EDWL 2IAND 2AAVA 1VFAB 1WZLA 3HR5B 3RGVA 3PGCA 4CDGC 4S1QH 3GSUA 1A14L 3OAZH 2NXYC 1AKJD 5FB8A 3W9EA 4ZNCD 3KR3L 4ZTOL 4K94H 3EDJA 4MXWH 1W0VA 2FL5A 3MOQA 3V2AR 3NTCL 3W81A 3Q3GB 2JJSC 5ICZB 1FGNL 3VD3A 4YPJA 1BZ9B 4JRYD 4JZOA 4Z7OF 4OUUB 1DQJB 5EFIA 1E6OL 3H9SA 1TQBC 5H2BA 5JHLL 4HX1B 4JQIL 4NP4L 1ZTXL 4M61A 1YPZF 4O2EA 3DGCR 1P53A 4GW5A 5DDHB 1BZ7A 2JLLA 3HR6A 1TJIL 3RIFF 5IF0A 4E0RA 5DA4A 3C6SA 2YBRA 3LKNA 3V6BR 1F02I 1RUQL 2Y4SA 5HGHA 1A14H 4UU9A 2NTSP 5MENB 1QFWM 1YNTA 1K5NB 4OIBA 1OP5H 4R0LA 3S7GA 3GI8L 3GJFB 2HG5A 4QGYA 2B0SH 3NTCH 3WO4B 1FZKA 5IB2A 1FGNH 5C0GA 4B7LA 4ONFL 4F7EB 2W0PA 3TCLB 1K9TA 4NQSB 3KLDA 1E6OH 1M7IA 5EBWB 5JHLH 3KG5A 5CUSL 1RJCA 2FH6A 3H9HA 4CKVX 1DSFL 4NP4H 4I5BA 1ZTXH 1ORSB 1RV6X 3RUGF 3WO3B 4EI5C 4LLQA 4J3TA 5FA4A 2EC9U 5BQ7A 4OD1L 4N1HB 2Z31D 1BHGA 5D1XC 5T3XL 4I2XA 3MROA 5I66A 4G8FA 4KI5F 4JFOA 1HQ4B 3X11B 5J6GA 4Q9BA 3SQOL 3WEXA 4I48B 4ONFH 4LHUA 1IM9B 2H26B 3PDDA 3QFDA 3HMXL 4MD4B 5CUSH 2X41A 4PD4K 3G6AB 3UZEA 3UTSB 3MBED 1ZLVK 5DWUL 2CUIA 4KWUA 5ICYA 1U92A 2NCMA 3LD8C 4HUNB 2NLJA 4KGLA 1LP9B 5LGKA 4OD1H 4F2MA 1CICD 4ALAL 4X4MA 1O0VA 2QADB 5T3XH 1QFPA 3BZFB 3VRLF 4YR6B 4WW2C 3ET9F 3ARGC 3UO1L 4WCYL 1MI5E 4ZAKA 1E4WL 4NN5B 3QEQB 4OBSA 1TNNA 3BEVB 2JIXA 3HMXH 3BH9A 3MXVL 3L9RA 4AIZB 1KCVH 3VFSB 1LE5A 1Q9LA 1CGSL 3NOIA 5IWLA 3KYAA 3ZKSD 5DWUH 5IW1A 4W68A 2OJEA 1UEYA 5DZLA 2X4UA 4I18B 4ALAH 4KKNA 4I3GA 1A3RL 1XGRB 4AQ1B 1I8MB 3UO1H 4WCYH 1NDGB 3OKMB 5IW6A 1H3PL 4XNYL 5CJBA 3BD5A 3M17A 4LVNB 3BIAX 2ADFH 5D6DA 1NEZG 2PYFA 1SMOA 4HGWB 1G84A 1U8MB 2VSCA 2D7QA 5I30L 3MRLA 4BA8A 1CGSH 1U8LB 1F90L 3SO5A 2J5LC 3UJIL 4DK3A 4PGJA 1OAKL 5C0NC 1AD9A 1ES0B 4JRWA 3MFGB 1KIUA 2FIRT 2NX5E 4LCWA 1KELL 1KCLA 1KJVA 1AQKH 2MCPL 3HAEH 5I16A 1WT5A 2D7PA 1A3RH 3IF1A 3V5KA 5F3BB 3ZKNC 2RJMA 2FDBP 1H3PH 4XNYH 1WWWX 5T5NG 1UEMA 4ODXB 2VLLA 4HFWA 5ACLA 3LDBB 3ELAT 4EUPH 2DLFL 5I30H 2BOBA 4QRRA 3BDXA 2VDQL 3NFNA 5J0BA 2HN7A 3SDAD 1F90H 3UJIH 1MELA 1OAKH 2C7UB 1R24B 4U1KA 4N90E 1QNZH 1D5XA 4FXKA 1KELH 3S8WA 3VWKD 2MCPH 5MHSD 5ANME 4DZBB 1MCDA 3W39A 4UV4H 2Q7NA 2IC2A 1C7TA 5T1LD 4OAWB 4KKLC 1Q72H 1I3RA 1R5WB 3NZHH 4GXUM 5FYJE 1JMZA 1U8PA 1FNEB 4MCYA 2DLFH 1KTDA 1CE1L 4HS6B 3ULVL 4NUGL 4QHKJ 4NZRL 3A6CL 4P5TC 5CGYC 4OF0A 4MXVE 4G6JL 3BN9C 3GJEA 1YNLL 4QRPB 1FFRA 2APXA 5K9OA 2CIIA 5INCB 3QRGL 2ZUUA 4C59B 2ZUVA 2MNUA 1IQDA 2I07A 4PJBF 1HHJB 1N5AB 2BVQA 1CE1H 1NMCB 3B9DA 3FCTB 2F8VA 4X0KB 3V8OA 3ULVH 1ZXQA 1LK3L 1G0YR 5LGJA 3P0VL 5TDNA 3G6JA 4NZRH 5GJTH 1KB5H 1S78D 5DHVA 1B4RA 3AM8A 1FG2A 2OSLA 3A6CH 5DC4B 4G6KL 3GHEL 3BX7C 4G6JH 4M93B 3HI1A 4IBLT 1YNLH 3STBA 4FXGB 4X6FB 4C57C 2P47B 4A6YH 3HAEB 4JM2F 3JTSA 3MLSL 4JRXB 4LSTL 5DFTA 1U8KA 4EQ3A 5DJ6B 3MRCA 4GS7C 1DQQA 2XIDA 2W1NA 1M1SA 1FO0A 1H3TA 4EUPB 5F1SA 5SX5H 2PO6A 1I7RB 5F3HA 1LK3H 1YMMB 2Y7QA 3GMPA 3P0VH 4KQ4L 4WUUA 3S5LB 3VXMD 5IVXB 2PW2A 4AZ8A 2FCBA 4L4VE 4G6KH 3GHEH 1MCWW 5JZ7D 2EXWC 4PJ7A 4LOUD 1MCPH 1EMTH 1KPUB 4OCLC 1DBAL 5E5UB 3T2PA 2R1YB 2MQCA 5I1HL 1RIUL 4MSWA 4LSTH 5SWZB 4HJ0C 5FGSA 3ES6B 4YHOH 2VWEE 4O51B 3VXRB 5C0BB 1N3NA 2YD4A 1ZANL 2X09A 2EKSB 3CLEH 3GMNA 5CGTA 4KQ4H 4AG4L 4J2XA 3DRQB 3BHBB 1MFCH 3H0TB 1T89A 1XF2B 2P46B 3G08B 5DD3H 1M4KA 2OTUB 1QPPA 3IU4H 3C60C 3EOBA 3PWNA 5HDOA 3U7AA 2DQJL 3MLVH 3DXAB 4XVSH 5I1HH 5D7JB 3V6FB 3O11A 5GS1C 3AY4C 4XCYB 5HI5C 4OD2B 2Q7YA 2IQ9L 4PJAE 3VXSD 5F70A 3QIBB 1SBBA 1PKQA 1NEZA 1QFWI 4AG4H 3X14B 4JPVL 2P5EE 5D9SB 3D3VB 4PJFB 2BVPA 3BO8B 3RGVB 4OIAA 1Q38A 2CLRA 4AEIL 3QFJA 2C9AA 4K3JL 3TO4C 3GSUB 2HTKC 4N9GA 1P1ZA 3PUCA 3QUZD 3W9EB 1LO5A 2DQJH 2IPTH 5DEFA 1MLBA 1QRND 4M7ZC 1EHLH 5JHDD 1W0VB 2FL5B 5C09A 2E27H 4U7MA 3CSBA 4JZOB 4H5SB 2B4CH 2P4AB 5I9QB 1NUGA 5EFIB 2IQ9H 4OQTA 3H9SB 5H2BB 4NN7B 3LRGA 4M61B 3I75A 2HFGL 1A6ZA 4GFTB 5CSBA 5L2JB 4O2EB 5EWIL 4FQLL 4GW5B 5HHOE 4AQOA 1BZ7B 3CFJA 5IF0B 4E0RB 4JPVH 2YBRB 3LKNB 1DE4A 3UYRH 4PFEA 4PYHA 4U1GB 4MS8C 3KXFE 4PJ8D 4PRDB 4YEEA 5HGHB 3MV9D 4K3JH 5F1OB 1MQKL 1YNTB 4BZ1L 4R0LB 2VJXA 5FOJA 3QI9C 1FZKB 3P73A 4OI9A 5C0GB 4EI6A 2EYSA 4PRPE 3CUPA 1S5IL 5FKPA 1M7IB 2H2SD 3V7AE 5HXMA 4I5BB 2HFGH 4IMKA 4CMMA 4XZUA 5EWIH 4FQLH 1LGVA 4Y4HD 1N2RA 4RIRA 4ACPA 4EXPX 4NRZA 4MA7L 4YBQD 5J13C 5HGAA 1DBKL 4LLQB 5EN2A 5FA4B 3FQRA 5BQ7B 4M62H 1KTLA 3JV4B 1NL0H 4Z78A 4JQVA 1JZ4A 2NY4C 2OJZL 3TLRA 3PL6A 3VXTA 4I2XB 4MLIA 3ZYIA 1RZKH 3C09B 3MROB 3RDTD 4G8FB 5I66B 4JFOB 3ABZA 5D1QC 5J6GB 3RZCA 4LHUB 2C4XA 3UTOA 3WXWL 1NMBH 5C07D 1GGIH 1S5IH 2EIDA 5HYJD 3QFDB 3SOBL 2R2BA 3IXAA 5GPRA 4BQBA 3JVGA 3SGJC 2JK5A 1YN7A 3LY6A 4MA7H 1CIUA 3B6SA 5ICYB 1DBKH 1U92B 2NLJB 4F2MB 2NY1D 3FQTA 1OP3H 5FM8A 1Q9OA 2OJZH 1KN4L 4C58B 1VADB 5EIVA 5EC2B 3QXDA 5J1TC 3C08H 4ZAKB 5BV7L 1R3IL 2NTFA 3DIFA 3FOLA 2QHRL 3SGEH 3WXWH 5EZOL 4JAMB 2JIXB 1RK1A 3BH9B 3BW9A 2A6JA 2W91A 3NIDE 3KLSA 5HVHB 1NLDL 1DN2A 5EU6E 4TVPD 1LE5B 1Q9LB 2XPGA 4KV5F 3VA6A 5IW1B 4WWKA 5IEHB 1AJ7H 1P6FA 4LMQI 2X4UB 2QEJA 3RBGA 4L9DA 5E2UL 5HYSG 1KN4H 4XNXL 3LQAL 3GO1H 5J1AB 4NQUA 1AD0A 4U2YA 1EGJH 2VQ1A 5BV7H 4PJHA 5IW6B 5EUOF 4ZUTA 4LSUL 2WM0A 2GIYA 4ZSOA 5FKAA 3M17B 4L5FL 1FO0L 1PKOA 1JF6A 4WV1A 2PYFB 1NLDH 5F1IA 3MRLB 5DHVH 4ZOBA 2PETA 4Z7UF 2A83A 5E9DA 1AD9B 4IOSD 3TFKD 3QDJD 5I1GH 5F9DC 1AIFB 4LCWB 1KJVB 3TT1H 4XNXH 5I16B 3EDEA 3LQAH 3IF1B 3R06A 4LSQL 4MJIE 4UI2A 4XHJD 4DGYH 2GY7B 4LSUH 3IAPA 4L5FH 1FO0H 1EEYA 2VLLB 4FG6C 4BZ2L 4HV8A 2GTWA 4PTUA 2BOBB 2I5YL 4QRRB 3NFNB 3ULUF 2HN7B 5CJQL 1DBJL 5CEZH 4K94C 5FV1L 4U1KB 4RX4D 5CZVH 4NPYA 1QLEL 1HCVA 4FXKB 3R1GH 3MLRL 1BF8A 1DCLA 2BHUA 3W39B 2DS4A 5MEQA 4OZGB 3HC3L 1HOCA 1H5BC 3KPQA 1ZT7A 3V0VA 3BMWA 1OT1A 4PG9A 4WI4A 2FB4L 2IAMD 1T80A 4I18C 4IHOA 3IB4A 1I3RB 4O58L 4IRSD 1U8PB 4MCYB 3DOSA 3R0MA 4BZ2H 1W0YT 3CMGA 1S9XA 2GI7A 5D7LA 1MCJA 3F12A 5CJQH 1DBJH 1HI6A 3SKMA 2F54D 3K46A 1UG9A 5JO5A 1J7VR 1OD7A 4NM8L 3GJEB 3KYKH 4HMEA 3HC3H 3ZKQD 3UTPD 5K9OB 1INQA 2CIIB 4Y8AA 3CXDL 2G5BA 2D4DA 3A67H 4OQTL 4O58H 5C0DA 5JXEC 2I07B 5CSGA 5GSVA 1C8PA 1O5DT 2IADB 3JSSA 3O3AA 5KSBF 3VD5A 4KZEL 1II4E 1SHMA 3PP3K 1IZKA 4NJ9L 3Q6FB 1MFEL 4MD5A 5LGJB 4WY7L 5TDNB 3LDBC 1FG2B 4X83A 4NM8H 3HI1B 4HQQH 4Z76A 3ARED 3CXDH 1UM5L 3FB5B 3ZYZA 1JZ5A 4OQTH 4QLRA 4S0SD 5C0AA 1D9KD 1U8KB 1OAZH 2VXUL 5D7SL 1PG7L 2CXKA 3MRCB 1DQQB 3PG2A 3MJ8A 4KZEH 4JO1L 4IRJD 4P2OD 3IDYB 2CUMA 3H9YA 3ILQC 4NJ9H 2OR9H 2VDOL 3DNKA 2P48B 2Y7QB 4QOKD 4WY7H 5F3HB 4DUXA 1NUFA 1BEYH 2PW2B 1DZBA 1T0MA 3OB8A 4HHAA 4EOWH 2WQRA 2LU4A 4PJ7B 5HSFA 1OF2A 1GOGA 2A6DA 1JPTL 2BXYA 2ILLA 1TZGH 1FNFA 3EYFA 5SX4H 1UM5H 3HUJB 5MENE 4YE4L 4J3SA 3RPIB 4MSWB 4DQOL 3L5HA 1KEGL 1KN2L 3F7QA 1BOGB 2VXUH 5D7SH 2OP4L 4P46A 3WD5L 1NCCL 4CVWA 2MOVA 2X4PA 1N3NB 2O5XL 3GMNB 2VDOH 3QDGA 4FFWD 4QYOA 4GAYB 1X4ZA 4WU7A 3DBXB 2A77H 1BBJB 4M1GL 3ZE1E 2ERJC 3QSKB 2GTZA 2B7DT 3GM0A 3EOBB 3PWNB 3OKKA 1KFAL 5HYSA 9CGTA 4YE4H 4DQOH 1KEGH 3OF6D 3O11B 1IILE 2LFGA 4PG2C 1VEMA 1NCCH 2GEEA 2AEPL 3QISA 4OFDA 5AZEL 1TZIA 1JGUL 3TN0C 2EDFA 4LHQB 1P4IL 3QDMD 3OAYK 3QAZB 1KCSH 1J1OH 2VAJA 1R5IA 2CLRB 4OKDA 2QSCH 5DVMA 12E8L 4LSPH 4N9GB 1P1ZB 4YHML 1LP9E 4GRWF 5DEFB 1MLBB 2N1KA 4JKKA 1YEHL 3IS1X 5C09B 3RAJL 4E41A 4G5ZL 1NCTA 3QEQE 4TSAL 4YWGL 5E00A 5AZEH 4PD4J 5EULV 1ZMYA 4N1CA 5IW3A 3I75B 1A6ZB 1JGUH 5JA9A 3IAQA 2UUDK 1BLNB 2EDTA 3CFJB 4P2RD 4X7SH 1P4IH 5KVFL 1DE4B 3BVNA 3P77A 4XBGA 1FNSL 5I1EL 2R1WA 1C5BL 4YHMH 5DJ2A 1YN6A 2HAZA 2E7MA 2NXZD 2V2XA 5E0QA 3RVVC 3RAJH 3P73B 4APQD 4G5ZH 2X70A 1DL7L 2D2OA 3CUPB 3G5ZA 4RZCA 5FKPB 4TSAH 4YWGH 3NCJL 5B8CA 1AI1H 5C8JA 5DFVC 3OJMB 4CMMB 1BFOA 4H0HB 3ROLA 4HEME 1OHQA 4OV6F 4NRZB 1N6VA 5KVFH 5HGAB 1LO0H 3VI3F 3HKFA 1UZ6E 2W38A 5I1EH 4YO0A 4Z78B 1JPGA 4F7PA 4N9OB 3PL6B 3F7RA 4XPGH 3VXTB 1UJ3A 2Q3ZA 1KF9B 2F9BT 4PLJC 1G1YA 1F4WH 5DMYA 3GHBL 4LPTA 3RZCB 5JNYA 1DL7H 3OR6A 3WLWD 2VNCA 4J3XA 3NCJH 2R2BB 3IXAB 3WIHL 4NYLA 1FP5A 4H0IA 5LXGL 4FFYL 4HIHA 2JK5B 3FRUA 4KKAD 5DJZA 1AKJA 3HE7C 3B6SB 1X9QA 2R8SL 3RX8A 1LEGA 5KANG 5TFSL 4EIGB 1Q9OB 5TF1H 3VGFA 4QT5A 1JHKL 1YYLL 4JRYA 3QXDB 3GHBH 3DIFB 3FOLB 3S96A 5D1ZB 3KYNA 1E6JL 3AAZA 4Y4KA 2XY2A 1P2CA 4WFEE 2VC2L 3BW9B 4LQFL 4EXKA 3EYSL 5T3XE 2A6JB 4B7IA 1KB9J 5L6YL 1WC7A 3V6ZA 5LBSL 4TSBL 2XPGB 1P9MA 3VRIA 4JM2D 1RZFL 4WWKB 2YZ1A 5F7EH 5FGBC 1NC4D 2E5EA 5TFSH 1IBGH 3NACL 4AM0A 2QV2A 1JHKH 3S35X 1AD0B 2QHLA 2VQ1B 4OCYL 2HVKA 4PJHB 4BELD 1OLZA 4OGZA 4KY1H 4ZUTB 1E6JH 4ZSOB 5FKAB 2C3VB 2M2DA 2VC2H 4LQFH 3Q5TA 4WV1B 3U0TA 3ALWA 4OCRL 5L6YH 1G7LA 5DTFA 5F1IB 1IGYA 5LBSH 4TSBH 2Z31A 4JG0L 3GSQA 4AY0A 2QL1A 2A83B 5E9DB 4G42A 2LTQC 4KC3B 3NACH 5GS0D 5CS7A 3ECBA 3ZYOA 3WS6A 1I85A 3R06B 1DTUA 4OCYH 1AO7A 2GAZA 4PLOB 5DEGA 3UTTD 2FHCA 3HHRB 3MBEA 4JRXE 1NEUA 4HV8B 4PTUB 4QTIH 4UV7L 1CICA 1IAOA 3MLUL 1G7QA 4JG0H 4GH7B 3I6KB 1LHZA 4HJJH 4NPYB 1SEQL 5HVHC 3HZKA 1YMME 5IVXE 1P7QA 2X44D 2VDKH 2B4CC 1I3VA 5MEQB 1FFQA 3H6JA 1ZT7B 3KPQB 3V0VB 4PG9B 2AJYH 1WZKA 5GJSL 4XH2B 5KVEH 4IHOB 5D93C 4L8SC 3TJHD 2EC8A 2HT3D 3JV5A 4UV7H 5I1DA 1S9XB 3VJ6B 3F12B 3MLUH 3RJQB 4YHLL 3QO0A 4ODBD 2XN9D 5I8OL 1HI6B 3SKMB 3HI6H 4LP4A 3VXRE 1PW3A 1PG7W 5C0BE 4OFIA 5D6DC 3U9UA 1SEQH 2G60L 4JVPA 3RWEA 2GKIA 5JO5B 5E5RB 5F1NB 5IB3A 3IDGA 1BWWA 1S9KC 5DUBB 1HXMA 3SKNA 2BX5A 4LSRL 1INQB 1G6RA 2FX9L 2G5BB 5GJSH 2B8OT 4BUHA 4CBPA 3OAUL 5C71A 3DXAE 3DSNA 2WMPA 3NIGF 5GSVB 4CMHB 1NAMA 1BBDH 5K9JL 3O3AB 3IYLW 2NY2B 3FB8A 5EOCL 1RZKC 4K3DL 4OM1L 4MD5B 1M71A 1U8IA 1FIGH 1R5VA 3L3JA 2X4SB 2G60H 3LKSA 1T04A 3OZ9H 3D3VE 4PJFE 2GYSA 4YHYB 4WI2A 3ULVE 4LSRH 4Z76B 2DTML 1F42A 1L6ZA 3D0VA 3QXWA 3OAUH 1B9ZA 3G5YA 4LPWA 3NFSL 2V7NA 4QXGH 1ZLWK 5J12B 3H9SE 2W0KA 3T2NH 3VWKA 3GB7B 2UWEF 4Z7WB 3U4EA 3RNQA 1T0MB 5T1LA 4P4KA 4HHAB 2BOCA 1OF2B 3QIWB 1KGCD 1X6LA 2PR4L 3EYFB 4XXDA 2BSTA 4M7JL 3VFMA 5C9JB 4JFYA 1OSPL 1N7ML 5CD5D 3NCBB 3MV7A 1ROWA 3BE1L 3NFSH 4P46B 3QDAA 3EOTL 2GJJA 4ZS7L 2X4PB 4P0DA 3QDGB 5D2NE 3RFZC 4QYOB 3TH2T 1GH7A 4FQPA 5BV7C 4G6FB 2ESVA 4WU7B 1J0ZA 5C2BL 2DLIA 3DVIA 2ADGA 4LEOA 1MCWM 2GTZB 3OKKB 3WS3A 4Y16D 2FR4A 5HYSB 4XNZB 2WBKA 4DCQA 2GJ6D 1OSPH 2WQ8A 1RUMH 4I2XE 4X98A 1EJ6A 3QXVA 3BE1H 5CP7A 4KZDL 2CDEA 3EOTH 1TTUA 3GKZA 3FHQA 5K9QG 1TZIB 4UMGA 3LQAC 2E9WA 1XF3A 3AXLA 5E4EB 4R90L 4FFZL 1C16B 3H3BC 4OB5L 4GBXC 5C2BH 4I8DA 1SQ2N 2NY6B 1QOKA 5ITBH 4F7MB 5FIEA 2PO6C 1K3ZA 2FX8L 2ZCLL 3ARBD 4DGIH 4K71C 2O5ZL 4MJ6A 1MREL 1RURL 4M00A 3QULA 4XI5C 5E00B 4YGAB 5SV3A 3WHE0 5IMLA 3MLWL 3ZT7A 5F6IC 1MCFA 4HIXL 4GG6F 5IKCA 3ZE0E 2F53D 4NM4L 1HWHB 4QCIA 1MRDL 3BVNB 2DIBA 4OB5H 4XBGB 5CBAB 3HPJA 2MKWA 3OXRA 5EUKA 2R1WB 5FYKU 5DJ2B 1YN6B 3ULUD 2BY1A 2V2XB 1K2DA 1XH3A 2PCPA 3P4OA 1EO5A 4U1NA 3GMLA 1IGIH 4CGTA 5C2UB 4OLZL 2X70B 3G5ZB 4RZCB 5B8CB 3MLWH 3VG9B 2WINA 5C8JB 5DQ9A 4HIXH 5D5MA 5IROA 1BFOB 3ROLB 2A6KA 5IHLB 1MRDH 3ARZA 4HUWB 5DK0A 3RBSA 3RTQC 1OAUL 4P2QD 3SCMC 4YO0B 5IR1A 4F7PB 3MRBA 2NXYD 1FCCA 2VLRE 1UJ3B 4LCWE 3EJZC 4WTXA 3VXSA 2ITDA 5FGRA 3QAZC 5JNYB 5KG9B 3OR6B 1QLFA 4JPIA 2OR8A 1OAQL 3PWUB 5EDXA 1KT2A 3QR2A 4C56B 2CIKA 1A1OB 1JPSL 4HIHB 3LB6D 3DX6B 4H1LG 4UTAL 4UQ3A 4PYGA 2VZVA 1AKJB 2X4OA 3BH8A 1EEUA 4QRRE 5FDYA 4KUZL 3GI9H 1LEGB 5JHDA 4XP5L 4ODSH 1XF1A 1G6RL 1YNKL 2IFFL 3GMRB 4YH6A 4MA3B 4JRYB 4PJ5A 3TYGL 4YPGA 5FO8B 1QTYT 4G6AC 1T2QL 4OZGE 4NFDA 3B9EA 3S96B 1NAML 3P9LB 3MUY1 3KYNB 3QG7L 3AAZB 4Y4KB 1OAQH 4X7CC 4B41A 3CX2A 1D6EA 4ZO6A 4HWZA 3EFFA 1XCQA 3MV9A 4UTAH 5F7FA 1UB5A 3VRIB 4JQXA 2PN5A 5BOPA 1KIPA 4KUZH 1L7IL 4LLVB 3LRSA 4HF5L 3J7HA 2NY7L 2PKDA 4PR5A 4XP5H 2BNRD 2GSIB 5B39A 1G6RH 3BAEL 4IMKC 4HK3J 4AM0B 2KBGA 3CFBA 2IFFH 1RFDL 4Q9RL 2AW2A 3TYGH 3IAGC 3V79C 1T2QH 5CWSB 3V95A 3QG7H 4JQVC 2VKXA 4Y4HA 1F3RB 3L5XH 3SKJL 5JUEL 2P8MA 5IB4A 1WCBB 1OTSC 2BRQA 4PRHA 1IGYB 1CVRA 4X7FC 5DC9B 3RU8L 1GOHA 2Z31B 2VITA 5CILL 3RZCC 3GSQB 4XP6L 3X3GL 2ZG3A 4QKXB 5C0RH 4G42B 4ORZC 1L7IH 3RDTA 1Q1JH 4HF5H 3HNSL 2NY7H 5DURB 4U05A 1UKTA 3BAEH 4JFED 3ECBB 3QEHA 4RAUA 4ZUVA 5HYJA 5HYIA 2XTJD 3OPZL 5KW9L 3ARGD 1AO7B 2GAZB 1AP2A 1JL8A 2WWMC 3MBEB 3KPLA 5JUEH 5EU3A 1CGXA 4K55A 1NGZA 1QR4A 4G7VL 1CICB 3QUXD 3RU8H 4UTBL 1G7QB 5CILH 3QA3A 5ISZA 3X3GH 5IGXL 3UPRA 3HNSH 1MJJA 1CDJA 3FRPG 3HZKB 4GXVL 1CE6A 1DQMH 1EXUA 1P7QB 1IAKA 4KHXL 4PB9L 3WL9B 3O3UN 2PXYB 3SDDD 4WI7A 4WWKC 5I73B 4PJ7E 2F8XC 3MJ7A 3OPZH 2J1KA 3BT2L 5KW9H 5E24E 1ZLSL 3QCTL 3HUJE 3N1QC 3ARDC 4XMPH 1CR9L 3LS5L 3N0PB 5I1DB 1ED3A 4P57B 4UTBH 5KSAA 1A9BA 5FO7A 5IGXH 4WW1A 4NCC1 3WKNA 5C0FB 3U9UB 2Z8WC 5E1AB 3MLXH 4JPKH 3RWEB 3OKOA 2ATPA 4KHXH 5EBLB 4K23L 5IB3B 3IDGB 4PJGF 1HXMB 1ADQA 5F71A 3SKNB 4HJGB 3BT2H 1G6RB 4BFBD 1KJ2B 4PPTA 4GKNA 1WICA 2BHYA 2A6IB 3QCTH 1NC2D 3B3IA 3PDGA 2ZSWA 1CR9H 1MF2L 1NAMB 2VE6B 2ZJSL 3E6FA 4LDEB 4S1SH 5DO2C 5GHWL 2OXGA 1M71B 3O41A 1R5VB 3L3JB 2C1PA 3W11C 3LKSB 2FATH 5JPNA 2QQLL 3T3PF 4QHNA 4IOIA 1M6OA 1Q9WA 3L3IA 3D0VB 1TJGL 5JW4N 5I74C 1T0NA 4FQIL 3VXQA 5C09E 5GGSY 1I4FA 2V7NB 2D7OA 4RX4A 1G7HA 2ZJSH 5KJRH 4ZNEA 1KXQE 2G2RB 5GS2D 5GHWH 1P5UA 3U4EB 3RNQB 3D25A 4P4KB 5C1MB 2BOCB 2J88L 2IAMA 3WUWA 3ZE2F 2FBOJ 2QQLH 2HLFC 1FFOA 3FJTA 2FD6L 4XXDB 4IRSA 4E9LA 3C8KA 4S11A 4OFKA 3VFMB 2DLHA 1TJGH 5KSUA 2KZ1B 4D0BA 5KVDL 1A3QA 1TDQA 3MV7B 3N06B 3U48A 1CZ8L 2E9BA 3KPSD 2FJFA 4M03A 5A2IH 1FHGA 5EU7C 2XQYK 1AR2A 4X9BA 5HD8C 1CLOL 1UACH 2YN3A 4JO3L 2ESVB 3Q2CA 4HPYL 4LEOB 4X6BA 4X4YA 2FR4B 2FD6H 5JIKA 4HXAH 4DCQB 4NUJA 4LDOB 4X98B 2W60A 5KVDH 4YHYC 2V5MA 1NMAL 3J8F7 2I60H 2IBBA 1CZ8H 5CP7B 5HYEA 1AXIB 2DYPD 1JMXA 5C08E 2F5AL 1CGVA 1KG0B 1XF3B 3CZFA 3AXLB 3QCVL 2RCSL 3EBAA 4XGZA 3GNML 1CLOH 4JO3H 5HVFB 2AI0L 3AREA 3RUGA 2VMFA 1D6VL 1A7PL 4M4PA 1A6AA 3RWJB 1D9KA 4Z0BL 1I3GL 5TQ0H 2WBJD 2IPKB 3UDWC 3ARSA 2KH2B 2XACC 4D8PA 2C3GA 5IOPA 4QGTA 3FO0L 1NMAH 4MJ6B 4QOKA 1PLGL 3QULB 4HIEA 4M3JA 4Y2DD 1A22B 4R4ND 5IMLB 3C2AL 4IIQA 5IKCB 4ZFOA 3WHXA 2RCSH 4QCIB 4U0QB 3ILPA 1MJUL 3RVXC 4RA0C 2AI0H 3H8NA 4P46C 4UZGA 3BZ4A 3HPJB 3OXRB 4U3XA 1J87A 5B3JE 1D6VH 1A7PH 4Z0BH 2EXYC 1I3GH 3FRPA 1K2DB 1XH3B 1XCTA 2PCPB 3IFOA 3NIFE 3QPXH 2EYTA 2UV3A 3P4OB 4U1NB 3GMLB 4HK0B 4M6AA 4JB9H 3UC0H 4XTRC 4CVUA 3C2AH 2WINB 4ZSOE 5DQ9B 5GGSA 4RWYL 1U3YA 5D5MB 1BJ8A 5I71C 2CR3A 2DI9A 1MJUH 3CMOL 1GZPA 1FORL 4JO2H 4RMSA 4JFHE 4LNRB 5E9DE 2R0WH 3MRBB 1P4BL 1C5CL 3OF6A 3QQ4A 4TVPL 4KDWA 3DI3B 3VXSB 2ITDB 4KROC 2WP3T 3LEYL 5DD0L 3BFOA 4KI1A 4M8VA 1G7JA 2NY6C 3HE6D 2EE2A 4LQ1A 4JPIB 3NN8A 1KT2B 8CGTA 4RWYH 3CVIH 3W5MA 3WNNA 1MAML 3OQ3B 4UQ3B 2X4OB 1FORH 3BH8B 4RGND 3P0YL 5ENWA 4IS6A 4LARH 4X8JA 4MB4A 4NQTA 1P4BH 4R2GB 1C5CH 2M8XA 4TVPH 1Y18A 4PJ5B 1JTOA 2DLEA 3MV11 5D96B 4YPGB 5DD0H 2YRLA 1FNLA 4BH7A 3ZO0A 4I3RL 4GRLD 1EEQA 3D0LA 4R7DA 1D6EB 8FABA 4HWZB 1IKNA 3EFFB 5DRXA 1QBMH 1XCQB 1MAMH 1UB5B 2DLTA 3DSFH 4NO2A 3P0YH 3VGDA 3DX9A 3LRSB 3U2SA 4PR5B 3RWFA 5B8CC 1ADQH 1TLKA 4KRMB 2IG2L 4NO0A 1UKSA 4UDTA 5B39B 3CFBB 3ZDZF 3EUUA 3CSGA 2XRAH 2VL4A 1QUNA 2JJUA 3IFLL 5D1QD 2HMIC 3DVNA 3WYRA 3DVGA 1T20A 4Y4HB 4D9RD 4I3RH 1H3UA 3RI5K 3WFEH 5EU7E 5I8KL 2RBLA 1UJ3C 2P8MB 1SVCP 5IB4B 1KV3A 4PRHB 1YEDB 2VITB 3L5IA 2COQA 4HUXB 3F6LA 3IDMA 5I75C 2UY7A 4OZHB 4NOFA 2OM5A 2YPVL 2VXQH 2IG2H 3TT3L 2AJSL 3QEHB 4RAUB 3GSXA 5HYJB 2FO1A 3IFLH 1GIGL 1XZ0A 3FT2A 5IFHL 1AP2B 1QA9A 3BQUD 5I8KH 3KPLB 2FEEI 1NGZB 1T2JA 4H1LH 1Y0LA 3QA3B 4PJBA 5ISZB 3UPRB 4HFUH 3SY0A 4UNUA 3GMQA 4Z8FL 1CE6B 1EXUB 2AJSH 4XBEL 4Z7WE 2DJSA 1IAKB 1XF5A 1RU9L 2V17L 1N0LA 5CLTA 3MJ7B 5H37G 1J0KA 2ICEA 5E94A 1CDYA 1KIRA 4TOYL 4JM2A 1AR1D 5GGQL 1BD2B 2D7NA 1ED3B 5KSAB 1QP1A 2VISA 1A9BB 3TVMD 1RSFA 5FO7B 4CRPA 3HG1D 4F8QA 1HQRA 1BVLA 2OTPA 4X7DC 5L9DL 4OIIH 4PUBL 3IFNL 1SMAA 1FYTD 2EDQA 5EO1A 2CLVA 6CGTA 5L0QB 3QDGE 1VFMA 3OKOB 1U0QA 2ATPB 4JE4B 4XBEH 1HEZA 3AB0C 4HZAA 1RU9H 1RUKL 2Z31C 1YDPA 2V17H 3BN3B 4OGYL 1OPGL 2GQHA 1X6NA 4QWWC 3H7BA 1FNHA 3WNKA 4GKNB 2YWYA 1JZ6A 3WUZA 4MQ7A 2XNAA 1U8HA 2X1OA 4TOYH 1MPAL 4Q2ZA 3B3IB 4EN3D 5GGQH 1QFOA 4KJPD 2ZSWB 4FG6D 1QSZA 3WS6C 4ZFOL 1I85C 1HZHL 4XAWL 3HZVB 2WLYA 4KRPB 1S8DB 3VGBA 5L9DH 1DVFA 4PUBH 3IFNH 5SWSD 3O41B 3MRIA 2NW3B 3EO1B 3FMGL 2EDXA 2C1PB 3CNKA 1F8TL 1XAUA 1PY4A 4MLSA 1CICC 5JPNB 1RUKH 1CGWA 3LPGA 4QHNB 3UTTA 4OGYH 1OPGH 1M6OB 5CINL 4MNHA 4XRCA 4P59H 1T0NB 3VXQB 1HCFX 1FPTL 5GRYA 4M3KB 4M6MH 1HZHH 5EOCJ 1I4FB 4XAWH 5I73C 1A7OH 1G7HB 4GAGL 1IC1A 3MA7B 4NOBA 2GCYB 1OCWL 1QFWL 4M8QA 2EEAA 3D25B 2W07A 4P4RA 1F8TH 4KTEL 5JLZA 3WUWB 1MAKA 1U2HA 3OAYH 2C3WA 2YRZA 5BZWA 5CINH 4IRSB 3C8KB 3PV7A 2QSTA 3VXUD 1UWXK 2ICWJ 2YD1A 5KSUB 2XN9A 4GQ9L 4Y8DC 3MRGA 5T5NF 1EZVY 3MRMB 1NKOA 3QUYB 4GAGH 5E2TL 4GLRI 1D5MA 1HYSD 1OCWH 1BFVL 4KTEH 4OBRA 1QSED 3GUTA 5FCSH 4E5XA 5L7XL 2NW2B 4X6BB 2O5YH 2VOTA 4X4YB 3OJDA 5D70L 4TUKL 3S34L 4NUJB 2YZ8A 2JJWA 5DXWA 4IDJL 4YZFE 5BRZA 5C0CD 2OCFD 2I9LA 2P49B 3NGBB 2H2PD 5E2TH 5LWYH 3MBXH 3SDAC 3ILQD 5HY9A 4C56E 1M7XA 1EFXD 1BFVH 5F7HA 2VIRB 3IETB 4TNVF 3FL7A 1IC4L 3RUGB 3GFUA 5L7XH 5K9KB 1A6AB 1D9KB 4GKZA 3VWKC 5K59F 2UZYB 1G7MA 3QBTB 4L8CB 3S34H 2AJ3A 3SKOA 2OTWA 4D8PB 4PJAF 3SGEI 2YD5A 4QOKB 4HIEB 2K3TA 1LNUB 3LKPB 3THML 2HKHL 4WFHE 4IIQB 3RWIA 3CDFA 2A9ML 2H3NA 4XCNB 4Z77A 2NYYD 3ILPB 1D5ZA 2I24N 1ZWIA 3EO0A 4S2SA 4IJ3C 2DKMA 1IC4H 3BZ4B 1XGQA 2VLME 1KPRA 5D8JL 3B2VH 2YPLD 1XCTB 3FHAA 2IH1A 4QXUL 3U4BL 5IVOA 4P5KA 3I9GH 3MUJA 3THMH 1G9MH 4M9PA 2HKHH 4TVSa 4WO4D 5GGSB 3DHJA 3BGFB 3UJJH 1JHTA 4LL9A 3OR7A 4G3YL 3JWDL 1GZPB 4P23D 4O5LL 5GGUB 4XVTL 5GIRB 1BX2A 1S78C 1BJ1H 1QSVA 4XNUL 2CLZA 3QIUD 3M07A 1MUJA 1X5HA 4NQDE 2BVTA 3QQ4B 3FOMA 4LLWA 1EDQA 5FM4A 4QXUH 5HYQA 1N5YH 3U4BH 1N0XL 1J18A 1G7JB 2DM7A 5T5FL 1AO7E 3VFTA 5EUOA 3HZMA 1ND0B 2E7HA 5I6XC 1A7NH 1QSFD 3LEXA 4X6CB 4Z5RA 4MA1B 3H3PL 4G3YH 3JWDH 1R3LA 1VFUA 1PG7X 5ENWB 4PGEA 4O5LH 3QQ3A 4XCEB 4IS6B 1EX0A 4XVTH 5JORA 3KNBA 4WUKH 4X8JB 4Z7UA 3T8XA 3QZWG 3T0ED 3ARBA 2JTDA 4XMKL 5JZ7C 4WFFD 1AGDA 4CN4A 4LOUC 2KDGA 1WAAF 5CJXA 1HKLL 2ZSVB 1N0XH 4BH7B 2F53A 4OF8A 2WZPD 1PYWA 2BVOA 4WU5A 5C7XH 5DJAA 4R7DB 8FABB 2Q8BH 4OTXL 5DRXB 3X17A 1SJXA 1A2YA 5DFVD 4DKEH 3H3PH 5EZLA 3MXWL 4NO2B 1HHHA 4HZLA 5E56A 5ILTH 3U2SB 2OBGA 4Y4FA 3RWFB 3OSKA 3WN5A 4NO0B 4UDTB 4DKFL 1VGEL 4UAOB 4XP4L 5IROC 5JOFA 3FB7B 4NWUL 4DZ8A 3QWRD 4QHKI 4XPHL 1RUPL 2VLKD 1FL3A 1CFQA 1PY9A 3DARA 1HKLH 5HTSA 1MHCA 5C70A 5ECJE 5TGBA 3NIDF 3DVNB 4M7KL 4ODHL 3DVGB 4TUJA 1T20B 5DHYA 1MY5A 3WIIL 3MLZH 1NCBL 4MHHG 4Y88A 1ZA3A 5GS0H 5CFHA 2KQMA 4OTXH 5E5MA 4MB3A 4PTTA 1CXHA 4JCMA 3BD4A 3MXWH 1CFVL 2HH0H 5I17A 3IDMB 4FP8L 4QHUA 1UC6A 3V4PL 2H6PA 2P43B 4XP4H 2NNAA 4NWUH 4NKDA 2WSKA 4H26A 2JJSA 1RVFL 1RUPH 4P99A 1ZK9A 3QUZC 3PABA 1XZ0B 1N6QH 4ODUA 4QEGA 1OD9A 3VH8A 4ODHH 2R0LL 4BFGA 4P9HH 4RMQA 1ZKAA 1U3HB 3WIIH 1NCBH 3U1SL 1E4JA 2AV7A 2EZ0D 2X2YA 1JYXA 3GRWL 4CU7A 4L1HA 1Y0LB 2CD0A 4CW1A 4KK9D 3BP6A 3O4LD 4GAJL 5KSBA 1A8JH 1K3IA 1H3GA 4FP8H 3SY0B 4M48L 3GMQB 3V4PH 1CF8L 4PJ8C 1WBXA 5IB5A 3G5XA 4JFFB 1XF5B 3TBTA 4JQXC 4ONGL 4RGMB 5ESQA 2J8UA 3O6LH 4P2YA 5EOQL 2ZCHL 1YUHB 2ICEB 5DR5H 2R0LH 4Z18A 1KIRB 4WHYH 4JM2B 3T0BA 3U1SH 3T4YA 2H2SC 4KJWD 2IWGA 3MV7E 3I6LD 2VISB 3HRPA 1SM3L 2BNRA 4I4WA 1HN1A 4M43L 2EDRA 1BVLB 5J8OA 3RJDA 4GAJH 4JGUA 4Y4HC 3ARFB 5EO1B 2CLVB 4YBQC 3S6CA 3VFWA 1HEZB 1F6AB 5FECB 4R8WH 1F11A 4S10A 2YK1L 4AMKL 1YDPB 2ESVE 1JGVL 2CMRL 4X9IA 4UT6H 2VERN 5E70A 3RDTC 1BQSA 1JZ8A 5EOQH 2ZCHH 3HC4L 1K6QH 4MQ7B 5L8LB 2RAMA 1U8HB 3AVEA 5INDA 3LVEA 3OWEA 4XB8A 4YDIL 3ETBF 1W72A 1RJYA 4ODVL 2XA8H 3F6IA 4UILL 4AT6A 2FEDD 4B0MM 3OB0H 3TV3L 1DVFB 3RHWF 2P5WA 4NKIL 5TPWL 3MRIB 4UT7H 3ARGA 1LO2L 2IGFL 1KLGA 2FECI 2NY1C 3UZVB 2YK1H 3UTTB 5DLMH 1T7XA 4FMFA 3HC4H 4XRCB 1IEHA 1A6WL 3EZJB 2SEBB 4DVBA 4HUKB 1CYGA 4G7YL 1FZMA 3BEWB 5D6CA 3U4AA 4UILH 4BQ9A 4ZPTA 4QRTA 3ZTJG 3BZEA 1CXIA 1C7SA 4LVOB 3B5HA 4X9GA 3TM6A 4NKIH 4LSVL 5TPWH 1TPXB 3SDDA 1H9VA 2ENSA 3SE8H 2QKIA 2E9IA 4HUUB 5JLZB 1MRFL 2IGFH 3BKJL 3D6GA 1JBJA 1F4YH 1RHHA 1OARH 5BZWB 4Z7VB 1ONQA 2B5IC 3WDHA 2XFXA 2YWZA 1A6WH 3UTZA 2YA2A 3VDBA 5IG7A 5IFAL 1R3HA 1UWEL 3MRGB 3OKEB 4G7YH 2D0HA 1KLUA 4LU5L 5KTEL 3VU2A 3G9AB 3L5WA 1D5MB 3QT2A 3JV0A 4LSVH 5D5ME 3LZFH 1RZJL 3TFKC 1LQSR 1MRFH 3GUTB 4E5XB 3BKJH 4X6EA 4P5MB 3NBNA 5AAMA 3OJDB 2B39A 4J8RA 5BOZG 5EORH 4XHJC 4N0CC 3VXSE 5BRZB 3VXPA 1UWEH 3DUSA 3KYMA 4LU5H 1CL7L 5E8DL 4MWFA 1MI5D 4B50A 1JUFA 3CC5A 4GKSB 5JIIA 5HY9B 3ZE1F 4PIRF 3O6FD 3CDYA 2YXMA 4ZD3L 4LGSB 1I1RA 2QR0A 4GKZB 2LQRA 1K8DA 1G7MB 5ALBL 2XV6B 5GRUL 2AQ3A 3SKOB 4PJ5E 2IAMC 1MHPL 4ZFZA 1CL7H 4UBDD 4ZXBD 4IRSC 3L6FA 3ULUH 2WIIA 3RWIB 1JRHI 1FFPA 5MP6L 4Z77B 1D5ZB 3KYOA 1ZWIB 4BSWA 3EO0B 4S2SB 5FOBA 2QBWA 5I1AA 4ZD3H 3KAAA 3HC0A 1KPRB 3MGAA 4QY8A 3U0PA 1IGJA 4QRQA 4YDVA 3CU7A 2CRZA 4JG1H 5J11C 5GRUH 3GSNA 3KPSA 1IL1B 2IH1B 3SGKC 4GOSA 2Z8VC 2NX5D 1MCOL 3QXUA 3FO9A 4P5KB 1R3JA 3FQXB 4ZUWB 5E7FA 1IMHC 1U8JA 3H3KA 4XNQA 4XVUD 1JHTB 2HT2D 5MP6H 3OR7B 4PRHE 4C83A 2KPNA 1JGEA 1BX2B 5DVKA 3NGBC 2CLZB 4OZHE 1MUJB 5CD3A 1LDPL 3EKCA 5HYQB 3T3MF 4N90D 1EIBA 5BCAA 3AREC 2DYPA 1MCOH 2DTSA 3CZJA 4JM4L 1D9KC 1I9JH 4UOW1 5CEXA 3EYVA 1J11A 4DK6A 1GOFA 4OUOA 3VFNA 3HZMB 3V6OC 2BCKA 3F65A 4Z5RB 3LEXB 2ZUWA 2WK2A 4PP1C 5DJCA 4ZO7A 1R3LB 4IRJC 4P2OC 3I6GA 1UZ6F 1S7TA 3BPCA 4PGEB 5DHXB 3QQ3B 4LLMA 1XIWD 4M5ZL 3JWOL 2V7HA 5JORB 5GZOD 3KNBB 2JCCE 5ISZE 1U2CA 4UT9L 3T8XB 3ARBB 1DLFL 1HSBA 3B8YA 1LDPH 3K8LA 4Y2DA 1W72L 2F53B 1PYWB 2BVOB 5BZDA 4WU5B 2H45A 4HKXA 5DJAB 1PGRB 3WV0A 1F58L 1H8NA 2EIZA 3VXNA 1A2YB 1BD2E 3PDOA 5EZLB 4CNIA 1JI1A 3CFKA 1HHHB 4HZLB 1NUNB 1T1YA 3JWOH 4FFWC 4Y4FB 4G9FA 4UT9H 1SY6A 4PRIA 1ITCA 5JOFB 2EEBA 2IFGA 2AEWA 1E4XH 1ZGLM 1LEIA 3D85D 2DMKA 1CFQB 3EJZD 1W72H 5TGBB 1JCKA 3W0WE 4TUOA 1RULL 4TUJB 4YBHA 2H1PL 5DHYB 1ZA3B 1F58H 1YQ2A 3O4OC 4OI7A 5E5MB 1T7YA 4JY5H 4PTTB 4I0PD 3CX5K 3B9KD 3TO4A 5I17B 4JR9L 2NXYB 2BP3A 4QHUB 1UENA 3P4LA 4LIQL 2H6PB 1YEKL 2NNAB 4NKDB 4H26B 3HE6A 5HHMD 3QDHA 3TA3D 5T1KD 4WTZG 1QQDA 5JQ6L 3PABB 5FYJU 4L4VD 1TQBB 3NPSC 4ODUB 3S36L 1RULH 2VL5A 4P3DA 3VH8B 2H1PH 5F9OH 4W6YB 1T03L 2AV7B 2IEPA 1NBYB 1FNGB 1FH5L 4TN9A 2GITB 5HPOA 4RFOH 3BP6B 5KSBB 5ESVA 5E08L 4RMVA 4ZNEE 3UBXG 1JN6A 2ZUYA 2X89D 1YEKH 3V9FA 1IKNC 1QBLH 3G5XB 3TBTB 4GRWH 4NQCD 1GPOL 5ESQB 1V3LA 4GRLA 2J8UB 1TENA 1MLCA 3FQUA 2NXZC 3BP7A 4PBVC 3DV6A 2FIKA 4J6RH 1T5XA 3BGAA 4UAOC 4APQC 1I8KA 1J10A 3ARQA 4HWEL 5B38G 4LCCC 3EYQD 3T4YB 4WHCA 2DQDH 3KPNB 2C3XA 2BNRB 1FH5H 1RUAH 5D1XB 4EEEA 2E8ZA 5E08H 1UA6L 3VFWB 5BMFL 5D1QA 1YEGL 2UWEA 2CRIA 4BQ6A 1F11B 1XR9A 4ZTPH 5MEPA 1G9MC 1GPOH 2QQNL 2P5ED 3PXHA 1PSKL 1A1NA 5HHPA 5E4IA 5BVJA 1QD0A 3SGJA 5INDB 4HWEH 4O4YH 4D3CL 2ZCKL 2VLJD 3WLWC 1KCRL 1W72B 1XGPA 1RJYB 5F6HJ 5EA0H 3LD8B 2FO4A 4AT6B 3WFZA 4KTDL 3VFVA 5DJDA 4NZJA 2C4FU 4KKAC 4QRSA 1T1ZA 2P5WB 4G6ML 4YNYA 1UA6H 5EC1B 4WW2B 2R0KL 5BMFH 3ARGB 1YEGH 2VZ1A 5T3ZL 2ZOKA 3GSNL 3LOWA 4N1EA 1T1XB 1FFNA 1WUNT 4DUWA 1J0JA 3RUGE 2P8PA 4OI8A 5GS2H 1PSKH 3U30C 3KXFD 5TH2A 1MFBL 3K1KC 5CKAA 4JGMA 5JXAL 3SDCD 4S0TD 2IALA 2ZCKH 4DVBB 2AJXH 1KCRH 4RGMC 2H32H 4KI5E 4ZPTB 4QOKE 4KTDH 4QRTB 4Y5YA 3EHBD 1DUYA 4ELKA 3BZEB 4NQEE 4PRPD 3EW3B 4G6MH 2BSSA 3ZYJA 1MOEA 2W9LA 1S9WA 3GSNH 4NHCH 1RHHB 1KENL 4HCRA 4HDIA 1ONQB 1YEFH 1H8OA 4YUEH 4GRWB 1I1YA 2XFXB 2NY0D 5JXAH 3UTZB 5FYLD 3TVMA 3U6RA 2J5LB 5IG7B 3RVTD 4ZOEA 2A9NH 1KLUB 1X5AA 5BS0E 3NCEB 2EICA 1YYML 2BNQE 3E2HC 5EH1A 5AYUL 3LAFA 1CI5A 5DO2D 2ZPKL 4GG6A 3ARTA 4KMQA 1OGTB 4XNMA 2AK1H 5L2KD 1DQDL 3TNNA 3S4SG 4X6EB 1NCNA 5EPMA 5FF6A 1L9NA 1KENH 4QTHA 5GS0C 4OF7A 1UCTA 1NFDF 4N5UA 4G43B 3QJFB 3TBVA 4P3CL 1QR1A 3UPCA 1KBGL 1WBYB 4MXQD 2HKFL 3VXPB 5SWQB 3CDCA 3LN9A 3GBLA 3KYMB 5SWSA 3T0WA 3MNWA 4MWFB 1FDLL 1JUFB 4P48A 5IVNA 1YYMH 4Z6AT 3TJEL 4X7TB 2P7TA 3CC5B 1VDGA 1SY6L 5AYUH 5CIPH 1B2WL 3UMTA 1I8IA 3WFCH 3OXSA 4X6CE 3ZTNH 1Z2KA 1I75A 1H5BA 3RRQA 2Y06H 4HMDA 5EU6D 5F96H 1DQDH 4U49A 4P9HC 2NR6D 2QR0B 2HT4D 1OAYL 4N0UA 1GHFL 1K8DB 1J8HE 1MFDL 4LVOC 2CR6A 3GBNL 1TPXC 4L9LA 3VFOA 4PJCF 1KBGH 1OGAD 4KHTL 4ZFZB 1CGTA 3TJHC 3SPVB 2HT3C 4TTGA 3L3OA 3U36A 1FDLH 4U33A 3L6FB 4O02L 1EBPA 2WIIB 3ZTJH 5DMJB 2JB6A 3AFLA 1FFPB 5A16A 1MNUH 1SY6H 4M1CD 3KYOB 3VG0L 5BXFB 1B2WH 5DUPL 3VFGL 5FOBB 2EE6A 5I1AB 4CJ0A 5EZIH 4H88L 4AIXA 3U0PB 1IGJB 3VXUA 1IAIH 3UBXA 1GGCL 1YC7A 1OAYH 3SJVA 1GHFH 2KKQA 1MFDH 3T4AA 3GSNB 1L0XA 3GBNH 5JXEA 3QJHA 4K8RD 3RGHA 1BFTA 2Y9RT 5D7IF 2CJUL 3FO9B 5FK9A 1R3JB 3MRJB 4KHTH 4K7PH 4NHUB 3ZE0F 1U8JB 1QLRB 4XNQB 3E8UL 4MJID 4O02H 5C3LD 5FHAL 5B38A 1QSEA 3AS2A 3WE6A 4JHWL 5JA8B 3VG0H 3AMLA 4C83B 1A6VL 5CCKL 5DUPH 3VFGH 4UINL 5HI3D 1JGEB 4LAJH 4RAVA 2VYRE 3Q1SL 4LBEA 1GGCH 4H25B 1UADC 1VB9A 2EDLA 4YX2H 4GS7B 1IGML 2X4TA 1EA9C 2NY3D 2CJUH 1V05A 4M6OL 2EEDA 2IBZY 5IV2A 4S1DD 3EYVB 3E8UH 3VFNB 4Y1AD 2UZXB 3O6KL 3TBYA 4AYFA 5FHAH 5HHQA 3D1MC 2VKWA 5DJCB 1JPST 3C6LC 4JHWH 1S7TB 1A6VH 1A5FH 1FL5A 5CCKH 1L0YA 1U3ZA 4N0RA 3CH1A 1A64A 1CLCA 1F97A 4XBPA 1KACB 4Z7QF 3RIAK 3NZ8A 2J6EH 1YEJL 2D7MA 32C2A 4U6HB 3ZT5A 1NGQL 2J4WL 3DMMD 4JFFE 2YHGA 3PHQA 3ESVF 4KVNH 4LMQE 4YFEA 5HBBA 1JK8A 5CD5C 2EDJA 5BZDB 3NH7L 4HKXB 3O6KH 3W82A 4PY8J 2GK0A 3FO2A 3VXNB 3PNWA 3PDOB 4CNIB 3CFKB 4XC3H 1OWWA 1T1YB 3HI5L 3L5JA 4G9FB 1EVTC 2J8HA 2P1YA 4PRIB 2WWKO 3N85L 2D03L 1TXKA 4OZGF 2IPUK 1AXSA 2Q87A 2ZUTA 2Y5TB 1NGQH 2J4WH 4N5ED 4Y16C 1LEIB 4M5YL 2BNUB 4PGCA 5C6TL 4WO4A 3VFPA 2CGRL 4TUOB 1WSST 2PUQT 3TN0A 4DWHA 3NH7H 4GAFB 2ZG2A 4PJDF 4YFDB 4LLUA 1F6FB 4C4KT 5DFWH 2HJKA 5IJKC 3QIUA 4BFIA 4LASL 3TO4B 3S3PA 4YLQT 2FSEA 3WFBH 4HCRL 3C8DA 1HSAA 3HPLA 3B4NA 1F3DH 3N85H 2D03H 4S1RL 1X3DA 4FNLL 1QQDB 2LAGB 3UTTE 5T1DL 3D18A 4FQ2H 3VRJA 1QSFA 2VL5B 1J86A 5BO1L 3ARBC 1CD1A 2X1QA 3QHFL 3DUUA 4F3FA 5IBTL 1J5OH 3F58L 5CJXC 5MEND 4RMWA 3P11L 3VWJD 3TF7C 5EG6C 3Q6GL 4LASH 1L9MA 5KZCB 3OKNA 3KGRA 4I77H 4RQQA 5HI4D 1JN6B 4HCRH 4NNYA 2PTVA 5IB1A 4JFQA 4S1RH 4S1QL 3LS4H 4Q0XH 4FNLH 4GRLB 5ERWA 1MLCB 3ULUC 3FQUB 1BIIA 3BP7B 3D69A 5T1DH 3DV6B 4K94L 3WN5C 1QEWA 2FIKB 1H3VA 4Z7VE 4NCC2 1T5XB 1UVQA 4MXWL 5DQJA 3T0VA 1I8KB 3QHFH 4HIIA 5BO1H 2HMID 4JY6B 5CEYA 4XPFL 5IBTH 3NCYP 3F58H 5J13B 1KJ3L 3P11H 3HA0A 3Q6GH 1QKZL 1MHEA 1T7WA 4KDVA 4D0CA 2FGWL 2NY4B 4L4TA 3QWRA 2VLKA 2Z9TA 5D1QB 1IM9D 2UWEB 4F58H 3BRDA 2DN7A 1QO3A 1XR9B 5J89A 3GJFK 3LEVL 4HH8A 1HHIA 5MEPB 4XWOD 1KB5A 4LCUA 3HUJF 3PHOA 1A1NB 5HHPB 2B0SL 2BHZA 3EJJX 3H42H 4XPFH 1UWXH 5KS9F 4HWNA 1XGPB 3HE7A 2R2HB 4A6YA 1Y6KR 1KJ3H 3U7YH 4UIKH 5BRZE 2QADD 1QKZH 5DJDB 2FGWH 3LB6C 4QRSB 1T1ZB 4OCNC 4YNYB 2FRGP 2PNDA 2ZOKB 1BWMA 3LEVH 2GT9B 1FZJA 4FN0A 5TH2B 4MD0B 3OTTA 5CAYB 2IALB 5GGTH 1CTNA 3VW3L 3O4LA 3L7EA 2Y6SD 5FGBA 3MJ6A 2HRPL 4O2FA 1CFNA 2FH8A 3HRZA 1DUYB 2D31A 4ELKB 1BM3H 2BSSB 3BWUC 4MA8L 3NABL 1S9WB 1IEBA 4ZDHA 2CKBA 1MJ7H 3OAZK 3CXHJ 1Z3GL 4HDIB 1T6VN 25C8H 4F80A 2CSPA 3S98A 1PEZA 4QWWD 1J1PL 4V1DD 1I1YB 5HJ3A 3U6RB 3VW3H 1MIEH 1QZ1A 3JWOC 1GC1H 1W2KT 2HRPH 5C0JA 3KWWB 5JW5B 1KCVL 3K4DA 4MA8H 4XNMB 1K85A 3NABH 5KSVA 3OGOE 1W0WA 4L3EB 3WXVL 3TNNB 4Z0XA 3MCLL 4HWUA 5EPMB 2QQQA 4X4XA 1Z3GH 4QTHB 4NWTH 2YKLL 4RFEB 4E42A 1OP5K 2XTJC 1WTLA 4ODTH 1EK3A 1J1PH 3TBVB 1QR1B 3BJLA 3NCFB 4PS4H 4AH2A 5SWSB 4UQ2A 3MNWB 2FZ3B 2ADFL 4ETQA 5K9QI 4NNXA 2P7TB 3QUXC 4O2CA 1CDUA 1I8IB 1H5BB 1U8QA 3MREB 3MUGA 3ARYA 3RVUD 3WXVH 3MCLH 4NFCA 1BQUA 2BJML 4MX7A 4N0UB 4F37K 3MCG1 2YKLH 1AQKL 4L8SA 4WTWA 1I8LA 1S7RB 4L9LB 3SDDC 3VFOB 2V2TA 1U42A 4UUJA 3T1WA 3DROA 2YPKA 4FQXD 1F4XH 4FHBD 2EDKA 3L3OB 3U36B 2DBLL 1S5HA 4ZO9A 3L3HA 5D2LF 2JB6B 4R96A 2Z0BA 3BDYH 3HZYA 5A16B 5F7NC 1A7RH 5HYFA 5E6ID 3JTTA 3P2TA 1GCFA 1I1FA 3O8XC 3VXUB 3DWTA 3P30L 4RNRA 1QNZL 2BJMH 2DQGL 3SJVB 1S7WB 3D39A 1JI2A 2DICA 3T4AB 4CVZB 3QJHB 4HT1L 4YXLL 2FLBT 4F57H 4UV4L 1Z0NA 5FK9B 4JFZH 1Q72L 1JV5A 2BVEA 2DBLH 3FAXA 3NZHL 5B38B 1QSEB 3WE6B 2Z8RA 1KB9K 4I1NB 4JRXD 1ZOXA 4RAVB 4LBEB 3P30H 2DF3A 2DQGH 4Y0GA 2X1XR 1OW0A 3NIFF 1IZJA 1XEDA 4GRMA 1HXYA 4HT1H 1K4CA 4YXLH 1M05A 1MI5A 3RL2B 1XGYL 1JTPA 4WEMB 3TIDA 3LCYA 5IV2B 1WGOA 3O6ML 3TBYB 4I13B 5HHQB 2BK8A 2AK4B 3CX5J 3KS0H 1NLBH 5A3ID 1NCAL 1FL5B 4V2CB 4XCCH 3IDIA 3T09A 3CH1B 5E8OA 5GJTL 1KB5L 2VN4A 5DGQA 5KSBE 2ICES 4XBPB 3NZ8B 2AXGA 5I8CA 1LE9A 1BZQK 5C0BD 4ZXBA 1HDMA 3MRDB 1XGYH 4A6YL 2B20A 4ZOAA 2J8UE 5J4MA 5LGHL 3O6MH 1EGJA 3C5ZC 3FO2B 2FEEL 3PNWB 3WNMA 1W8NA 3L3DA 1BJMA 2ERJB 1NCAH 2AXJA 1MCSA 4OF5A 1KYOK 5D7JD 3RVWD 3V7MA 5F93C 1JGLH 2VXTL 4AEHL 2NX5A 1I7UA 4ZO8A 1IVLA 1RK0A 3QIBD 5D72L 1AXSB 1MCPL 1EMTL 4PGCB 3L3KA 3LH2L 3VFPB 3D3VD 3TN0B 5LGHH 3ULVD 1IJ9A 4LLUB 4YHOL 4GBXA 3RWGA 3QIUB 2BXZA 3QO1B 4XMLH 3I3EA 7FABL 4LLYB 1A6UH 2CKBL 3CLEL 2FSEB 2VXTH 4AEHH 1MFCL 1HSAB 4CL7A 2P5WE 4NGHL 3H9SD 5DD3L 3RX7A 5D72H 5EOTA 3IU4L 3AGVA 3LH2H 2WBJC 3CVHA 3MLVL 4CVXB 3D18B 4XPAH 1QSFB 3PWJA 3RWCA 4XVSL 3I50H 1HHGB 4OFYA 3V7AG 4HKZA 3DUUB 4F3FB 1G0XA 1WJ3A 2E6JA 1UH4A 4Y2DC 5B4MD 4R4NC 4FTVB 1R3KA 7FABH 2CKBH 3RL1A 4RQQB 3ZSTA 4LLAA 3SDXF 2QQKL 4NNYB 1F3JA 4NGHH 1KC5H 5IB1B 4JFQB 4G80A 3M1BA 3PJSA 3LPWA 5ERWB 1P7KA 1AGFA 2OQJA 3D69B 2IPTL 4LIQE 3B2UD 5DQJB 1UVQB 1EHLL 5CEYB 2E27L 2OL3H 4OLVL 2X42A 4GRWE 2PTTA 4YXHH 2B4CL 3RTQA 1QACA 4XAKE 4POUB 1VENA 2WV3A 3SCMA 1MHEB 4D0CB 3WNPA 3E6HB 4L4TB 4MNQB 5SX5K 4QO1A 4OT1H 4Z7WF 2VLKB 4LHUD 3RZWA 1C1EH 2QQKH 3IGAA 3UYRL 5ADPL 5DD1L 1ZAGA 1QO3B 4RFNB 5LAXA 3PGCB 2OZ4A 1HHIB 5TDPA 4TSCH 1KB5B 1AFVL 2VDRH 3EYUH 5FB8B 4QNPE 4LCUB 4PJEF 3DYPA 5I76A 3WDIA 4O9HH 4KDTC 2QTEA 2HRLA 3HE6C 1E28A 4OLVH 3HE7B 4A6YB 5TJWK 4AEEA 2PYEA 4JZJC 2VZOA 3OJVC 4ZAKD 4RGNC 3C6SB 3TZVC 1I1CA 6FABL 1V3MA 1E27A 2JIXD 5DD1H 5ADPH 4M62L 3ZSSA 3QEUA 1NL0L 1FZJB 4UU9B 4KK6D 1AFVH 3TBWA 2A2QT 3VI3E 4GW4A 4MDJA 1RZKL 3DLQR 4HIJA 3QQ9D 1J0IA 3VGEA 1UYWH 1D5BA 2HG5B 1Z0MA 1NMBL 1ZE3C 1GGIL 4GRLC 2K7PA 3LPFA 4O2FB 3BXNA 3H9HB 2X89A 3HRZB 2D31B 4W4OC 3VI4F 3LKOA 4GLRH 3FT4A 1AC6A 4Y5XC 3MOBL 1PZ5A 4NQCA 4K2UH 1MCKA 4FQJH 4JJHA 3EDDA 6FABH 2W65A 1IEBB 2CKBB 2IMNA 1ZSDA 2YD3A 4WI6A 5HJ3B 4PGZA 3C08L 5T3ZE 2XKNA 1HH9A 3WEXB 2VLRD 3CFCH 2WNGA 4PJAA 2APFA 2LTQB 5C0JB 4YDJA 2R23A 3MZGB 4NN6B 4NC0B 1YY8A 5JOPE 3MOBH 1R0AH 3KLHD 1CCZA 5F7KC 2IH3A 1P4LA 5KSVB 1WZMA 3L7FA 4RAHA 1W0WB 3PWPA 1D3CA 4Z0XB 1AJ7L 3D48R 3K81A 4ZQKA 2B2XL 4H8WH 4NQXA 4QRRD 2VLJA 4B53A 3GO1L 4PP2A 1EGJL 5BJTA 4AH2B 3BQUC 4JVWA 4UQ2B 1EAPA 2C5DC 2CKNA 1KPVA 4OGAD 3L9RB 2HTLD 4M02A 2ITCA 4CUCA 1H15A 4GMSL 1BVZA 3WFDL 4O2CB 1V3KA 2HFTA 3LN4A 4IRZL 3PQYE 2HJLA 1CLYL 1U8QB 3MUGB 3WFHA 1JWSA 1X5KA 3KXFA 2OJEB 2GFBA 3DI2B 3O45A 5I1GL 2R9HD 3C9NA 4Y5YC 2B2XH 3I02A 3SDCA 4MX7B 1X4XA 5D93B 4L8SB 3TT1L 1PBYA 5BVPL 3ARDA 1EEZA 2YC1A 3OV6A 2V2TB 4UUJB 3DROB 5DVNA 4DGYL 2YOCA 3AC0A 3VMNA 4YFLF 2CK2A 4LPYA 4PRPA 2YUXA 4YAQA 3GGWA 1AR1C 1S5HB 3VXOA 2APBA 2X1WL 3L3HB 3MQIA 3OG6B 4PRNA 4R96B 3HZYB 4GMSH 2FJGA 3WFDH 1PJ9A 3TVMC 4IRZH 5MEOA 3TPKA 5DI8A 1I1FB 1CLYH 2GJZA 1A3LL 5CEZL 3SO3C 2I9TA 1RIHH 3FZUD 5CZVL 4RNRB 1Z5LA 3CVHL 1OP3K 3UTQA 2JF1A 3R1GL 3D39B 4G9FE 1F2XK 1LD9A 2RHEA 4PRIE 4XB7A 3ZDYF 5BVPH 1JVKA 3V5KB 3TP4A 4R97C 2XI9A 1WAAA 4N0CD 1HE7A 4PLNC 1ACYL 2AJUH 5TE4H 1JV5B 4EN3C 4KJPC 4HFWB 2W9EH 5L2KA 1VPOL 3BRGC 5ID0A 1UQSA 4JN1L 2EE3A 3KPRD 3AUVA 1A3LH 5IQ7H 2D9QB 4XT1C 3F7PC 3OMZA 3O2DA 3CVHH 1D5XB 1V7MH 4WJ5A 4GRMB 1HXYB 1K4CB 3KYKL 4X6DF 2N7BA 2HWZL 4W70A 3MACH 3TIDB 2Z93A 1ACYH 1WFNA 1FGVL 3A67L 1BQHG 3U46A 2Z92A 5GRJL 4OZ4A 4L9LC 5F88A 4UOW0 5EU6A 3QPQD 1VPOH 4JN1H 2R4RL 1KTDB 1XF4A 3QUMH 2OZ4L 3IDIB 3NIGE 1X44A 3G9VA 4XWGH 2XWTA 5E8OB 1I9RL 4ONHA 2AXGB 1OGAA 4WNQA 3KJ4C 5I8CB 4N0YH 1LE9B 4JFDA 3LV3A 1FLRH 3N9GL 4HPOL 1HDMB 4HQQL 1V8HA 2HWZH 1FGVH 2X4NA 5DK3A 2XQBL 4D2NA 5GRJH 1I7TA 1OAZL 1IQDB 5BV7B 3TBSA 1EZVX 3L3DB 4HAGA 2R4RH 2BVQB 1KIQA 1HYSC 2OZ4H 4LPXA 2OR9L 3G6JB 1RZGA 1I9RH 5DHVB 5DMKA 1BEYL 3BPOC 2OSLB 1NUDA 1I7UB 1RK0B 4EOWL 5F7UA 1GC1C 4Y19D 2UWEE 3VDAA 3N9GH 4HPOH 4NZUL 1TZGL 3ZLQC 4ZPVA 1VACA 3WDJA 3JTSB 4JO4H 4OCWL 2XQBH 3M45A 1IGCH 2DQHL 4GBXB 2H2PC 4PP1D 1FO0B 2V9RA 4XP1H 4ZFFA 4X4ZA 5C09D 2PO6B 3GMPB 4WUUB 3MLTA 4F9LC 3UDWA 3DYMA 3MRFA 1DP0A 1I3UA 4LKCA 2A77L 2EE9A 2CO6B 4K71B 4NZUH 2FNBA 4Y1AA 4WI5A 3CVHB 4LRIC 4F9PC 3PWJB 3RWCB 5F6IB 4HKZB 3HFML 4OCWH 5J56B 3IDUA 3IKKA 1NPUA 4AJ0A 2DQHH 3O2VH 4GT7A 4FABL 3G5VA 2MWCA 4PGBA 2UVEA 1BGXL 1C12A 3RL1B 1NBVL 1T3FA 2NYYC 5A1AA 1QBAA 4I9WE 3DMMA 1FSKC 3GIVA 3WJLC 5HVWA 5C0IA 1KCSL 1J1OL 3M1BB 1X5FA 3PJSB 2FECL 2QSCL 2GY5A 2OXHA 4LSPL 1P7KB 1AGFB 4BH8A 2OQJB 4WENB 3MGOA 4M1DL 2JE8A 3HFMH 4JY4A 5CBEA 1F4AA 2PTTB 4Z95L 3RTQB 3PL6D 2ICWI 2Q7YB 4FABH 4WO4C 3FFDA 2AS5M 3SCMB 1BGXH 3CPLA 1PKQB 1NEZB 1NBVH 2HFFA 3QHZL 5AUMA 5IM7A 1YJDL 3MZTA 4P23C 4X7SL 4NO3A 3HCVA 5C08D 2BVPB 2YA0A 3QIUC 3QFJB 3UTSE 4L3EE 3MMEA 5FUOL 5FCUH 2LU7A 1LO5B 4YFLI 5I76B 4M1DH 3L3GA 3QQNA 3S9DB 3TNMA 2F19L 1E28B 3MV8A 1P6AB 4Z95H 2PYEB 3HNTH 2H9GA 1AI1L 5SWSE 4ZS6D 4H20H 2GW5A 4OUUA 5JW3H 3QHZH 4MVBD 5HHMB 4HX1A 1TCRA 1YJDH 1MVFA 4DTGH 4OCMC 5D1ZD 5FYLL 5JIPA 1E27B 1LO0L 4DJMA 3QEUB 3T0EC 2X7LA 3VCLA 5FUOH 3TBWB 4XPGL 4GW4B 4MDJB 4N0UE 4OLWL 2BVUA 4HIJB 4M7LL 4YHZH 3VWJA 1D5BB 1K5NA 1F4WL 5ICXA 2DWDA 4HC1H 2LABA 2F19H 3GJFA 1TQCC 1WLHA 4D9LH 4EI6B 2EYSB 3EJYD 2YD9A 2DQEL 4HG4K 1CL7I 3KJ6L 1BQHA 3MSPA 3QNZA 4F7EA 2ZP0T 2F15A 3BXNB 3LKOB 5EBWA 1ZLUH 3FT4B 2DM3A 4XZUB 1PZ5B 4NQCB 2O93L 3GZKA 3O2DL 1N2RB 4RIRB 5FYLH 1GZQA 4NT6A 2W65B 4WDIA 5EN2B 3FQRB 1KTLB 3S37X 3X13A 4DW2L 4GXUN 2L4OA 2M1KA 5TF1L 3VXUE 1BMGA 1ZSDB 3IJHA 4U1IA 4OLWH 1CG9A 4M7LH 3SJVE 4JFHD 5TE7L 3HAEG 5IBLD 3MC0A 4LHJB 5I1LA 2XKNB 4RFNC 5FO9A 4K3EH 1VSCA 2DQEH 2YSSA 1U95A 3C5SA 3KJ6H 3BP4A 3F7VA 4YDJB 2R23B 2IANA 1YY8B 4MD4A 4U6TA 1JRHL 1YN7B 3KPTA 3O2DH 2IH3B 1P4LB 3L7FB 3LMJH 3PWPB 5F7EL 3G6AA 2JB5L 3RX5A 4ZQKB 3UP1A 3FQTB 4DW2H 1IBGL 4NQXB 4G8IA 2VLJB 2AABL 4XPBH 4PP2B 5TE7H 1DDHA 3UXFA 2NTFB 4YR6A 5BJTB 1IAIM 4KY1L 1EAPB 2Z8SA 1RK1B 1KPVB 2EZ0C 3HB3D 2ITCB 3BEVA 3S36X 1TETL 3QNXA 4LVHC 2EH7H 1JRHH 3LN4B 4AIZA 2AK4E 1TFHA 4KK9C 1QHOA 3VFSA 1A1MA 4IM8A 3WFHB 3VE0A 2JB5H 4DAGH 2GFBB 4KXZH 4ZMAT 3O45B 3C9NB 3I02B 3SDCB 1JF1A 2WIMA 3PV6A 3T04D 43C9A 2ARJQ 2AABH 3K7UA 2ZKHL 1G6VK 3ARDB 1EEZB 4MB5A 4HS3A 3SKUD 3SN6N 1XGRA 5DMGC 4LCYA 2X4QA 4QRPE 1I8MA 4YAQB 2EECA 2I27N 2R69L 2Y36H 3GGWB 1FC1A 3VXOB 1TETH 1UT9A 4KJWC 1TITA 4PRNB 5D7KE 2FJGB 4K8RH 4QTIL 2NPLX 1AE6L 5MEOB 4TTDD 5DI8B 1MJ8L 4WGWB 1INEH 5E7BA 4U1MA 2I9TB 1L6XA 1ZT1A 4HJJL 1Z5LB 1S7SA 2I25N 4V1DA 4NN6C 3UTQB 1ES0A 2N4IA 4G9DA 2VDKL 1LD9B 2NY2D 2ZKHH 1E4XI 3BSZL 4R4FL 4OZIF 5CJOH 1WIPA 4ESKA 2AJYL 5KVEL 2R69H 1EEYB 4JHAL 3G04A 5L2KB 2GTWB 2VDPH 4Q6IC 1L4IA 3WJJA 1UQSB 1FYHB 5ID0B 1KYOJ 2FEDC 3U9PL 1AE6H 1OM3L 1CDBA 1MJ8H 3BKCL 3K4AA 3HI6L 4R6UA 2VO5A 3NCYS 1OQOA 4WJ5B 5I74B 5C3TA 2C7UA 2R15A 3BSZH 1HOCB 4R4FH 4JKMA 1B4JH 2AP2A 5KN5A 4DFHA 1WV7T 1OB1A 4URTB 3ESUF 2Z92B 2WBWB 4WHTA 2DAVA 1A6TA 1TIUA 1I8LC 3QIWD 4JHAH 4OZ4B 4YGVA 3PP4H 5F88B 5EU6B 4X8XA 1BBDL 3Q5OA 4RMUA 5SWZE 5D7LB 3U9PH 1FNEA 1OM3H 1XF4B 3BKCH 1OTTC 4K9EL 3BD3A 4OZHF 2OI9B 4FTVE 2NMSA 4WFFE 2XWTB 1PX3A 1FIGL 4ONHB 3WSQL 4WNQB 1OGAB 3OBAA 5A2LH 4FQXA 4JFDB 1FG9C 3OZ9L 5B3NA 3LV3B 4N8VG 3TEUA 1KCKA 2DD8L 1SJHA 3QDGD 4YHIA 1VERA 4DVRL 1DANU 4G6FD 2X4NB 4LHUG 4JHBA 4ONOA 5E6IA 1I7TB 2RB8A 4F15C 5C0DB 5F7DA 2DL2A 4MAYD 3TBSB 1P7HL 2D9CA 2JCCF 4QXGL 3RI5F 2C4FT 4HKJA 4TNWK 1KIQB 1GRWA 4K9EH 3I3DA 3T2NL 3TC9A 4MCZA 4L4TE 1RZGB 4MNQE 2VTFA 3FCTA 3WSQH 5IFJA 4ELMF 1JYWA 4JJ5A 5E99L 1IFHH 5BW7A 2DD8H 2LV4A 1NSNH 4DVRH 4ZPVB 1VACB 2HJFA 3N1FC 1OW0C 5C0AB 1SEBA 3SDAA 4MHHI 1GGTA 3C5JA 4JRXA 3NVQA 3MODL 3QH3A 2YUZA 3RA7H 4H8WC 3RKDD 3MJ8B 4CN1A 3C6LD 4NRYA 1MIML 4ZFFB 1B0GA 2P42B 3O6FC 3MRFB 4F7TA 4LKCB 5E99H 1ZGLA 5DYOA 1LVEA 5AD0A 2A6DB 3GJFH 4Y1AB 1TJHH 4AENA 1LO3L 1RUML 4OGXH 4KAQH 3O9WD 3MODH 4UBDC 4OFVA 4ZXBC 5FYKD 4J4PD 1MIMH 5GISL 1T3FB 4PJXF 2EKSA 3FTGA 3GIVB 3X3FL 3F62A 5C0IB 1T7VA 3PWVA 3V5HA 3ARWA 4Y5VC 1XF2A 3GSWA 1I1AD 3E1F1 5ITBL 4BH8B 4R26H 2OTUA 3MGOB 5F44A 1LO3H 4JY4B 1EH9A 1YEIL 4JKLA 5I71B 3BPLC 5CBEB 2VH5L 4DGIL 5JPMA 5D7JA 1ZVHA 2Y07H 3V4UL 4YIQA 2X1PA 3FFDB 4XVUC 4IOFD 2HT2C 5IP4A 3CPLB 4YDKL 2HFFB 5GISH 5JMOC 5C86A 3JWNC 1RZIA 3X3FH 3HCVB 4KROB 3X14A 1P69B 1PZUB 1R5IB 4C56D 3BO8A 3MMEB 3F5WA 5DZOA 1PDKA 4X4ME 1YEEL 3L3GB 1YEIH 3TESA 5F9JA 3TNMB 4E41B 1GGBH 1IGIL 2VH5H 4OLXL 3RKPA 3MV8B 1ZVSA 1BAFH 1IT9L 3WHE1 2R0ZL 2ICCA 3V4UH 3VXMA 5IHUL 2H9GB 1FAKT 4H5SA 4YDKH 1TCRB 4ETYA 1XIWC 5L2JA 4WFHD 3ARVA 4Y4KD 5GZOC 3P77B 2CDGA 4EDWH 1ZLVH 2X7LB 1QHPA 2ED8A 3VCLB 4PRDA 4GUPA 3T77A 1BVKA 2EYRA 1YEEH 3N1MC 1X5LA 2VLMD 5F21B 3VWJB 1N59A 5A2FA 3KR3H 4ZTOH 5ICXB 4JDZA 2DWDB 1NFDA 3UPAA 4OLXH 2XWBA 5KVGL 1IT9H 1BQHB 2R0ZH 2IJ0C 3QNZB 5IHUH 3KPPA 2D4FA 3O3EA 5D2NA 4JQIH 1YY9D 2BMKA 1GZQB 5DA0B 4NT6B 3LSOA 4U3HA 3JUZA 3IU3A 4WDIB 1OVZA 1CGYA 1TJIH 3GI9L 4R9HA 1IAII 3X13B 3CLFL 3ALXA 4ODSL 1JPGB 4BK4A 1RUQH 3MTRA 1OAXL 3JV4A 3S3JA