5TQVA

Crystal structure of nadp-dependent carbonyl reductase from burkholderia multivorans
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
225
structure length
225
Chain Sequence
b'MKTVLIVGASRGLGREFVRQYQRDGWNVIATARDDASLAALRALGAHAHALDITQPEQIAALGWKLDGERLDVAVVVSGVYGPRTEGVETIASDDFDTVMHTNVRGPMQLLPILLPLVEDARGVLAVVSSRMGSISEATGTTGWLYRASKAALNDVLRIASLQTRHAACISLHPGWVRTDMGGAQAALDPATSVTGMRRVIAEAGADVSQSNGRFFQYDGVELSW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH-dependent carbonyl reductase
publication title Crystal structure of NADP-dependent carbonyl reductase from Burkholderia multivorans
rcsb
source organism Burkholderia multivorans (strain atcc 17616 / 249)
molecule tags Oxidoreductase
total genus 87
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2016-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tqvA00
5AXDA 3MZ0A 4FQ8A 4DLLA 1UAYA 3L9WA 4J7UA 3VZPA 1YO6A 2ZB4A 3DZJA 3M6IA 3WYCA 1GUZA 4WEOA 4CR8A 2YHIB 3DTTA 2Q4BA 5AYVA 3WGGA 9LDTA 3GNSA 2PKQO 4IIVA 1GEEA 3G17A 5U1PA 4CM4A 3WQSB 4KTTE 1PL8A 4CV1A 2IZ1A 3QY9A 4OYRA 3RC2A 1BWSA 3PYLA 5BT9A 2EW8A 4O5OA 1KIFA 1QYCA 2P5YA 3JQBA 1JAYA 4BV9A 3LDHA 5FI3A 2ZTUA 2FSVA 3PWKA 4Z0TA 4OAQA 2WE8A 5CPFA 1XLTA 5THKA 4OSPA 4Z9XA 3H5AA 1JU9A 4YJHB 2V7PA 4UAGA 3C7DB 4CLRB 4UEJA 1TT7A 3A14A 2GDZA 1GCUA 4B4WA 5LC1A 1ENPA 4WOKA 1VLLA 3WS7A 5ADHA 3D4OA 4P4NA 4HXYA 3IC5A 4ND1A 1DIGA 4L74A 2FWMX 3GG2A 1YB1A 4CM4B 2O4CA 3V2GA 4Y6PA 5A9TA 2EG9A 2WJPA 1NHGA 2RIRA 1E7YA 3AUTA 1SOWA 3NGLA 4E13A 3ZWYA 4IMPA 1LDGA 5A9SA 3LVFO 3V1UA 2NVUA 3TDKA 3JYNA 4DIOA 1UXHA 3AI2A 3E8XA 4BO9A 5DBIA 3G0OA 1TEHA 1H94A 4K26A 4NBVA 3ZNQA 1K6XA 3ZHBA 5G2OA 4Q3CA 3IJPA 5CHEA 3SEFA 1GQQA 4DL9A 3TZCA 2Q50A 4BIIA 3LF2A 1NFFA 2ZB7A 8LDHA 3OEYA 1ZSVA 3KEQA 4JX8A 3BZUA 2YZ7A 4PLCA 4BO3A 4EJ6A 5CG1A 1QLHA 4GVXA 3WMWA 4NG5A 1F14A 1UP7A 3EZLA 3H9QA 4BMNA 1Z73A 1KC3A 4Y8VA 1M67A 2Y99A 1GQYA 3VAZA 3FN4A 3DQPA 3KXDA 4J9VA 2O4UX 3L6DA 3UCXA 5IG2A 4L4XA 3LYLA 3I3OA 2BKAA 5IFLA 5HA5A 4CMGA 5I9LA 4J0EA 3P2YA 1PQPA 3TN7A 3NT2A 4AJKA 3KLPX 3OQ1A 1DIHA 3PQFA 4RPGA 1YJQA 1HDCA 3RFTA 5IJZA 1PJLA 2X0JA 2Y0DA 1U2GA 1FDWA 3WTBA 2Q99A 4AL4A 3W8EA 4N5MA 4ZGWA 1A7AA 5G0WA 1Q0HA 1CERA 4E5YA 6LDHA 2FR1A 3KB6A 4QUKA 4JXKA 2Q2WA 2DTEA 1I0ZA 1CDOA 4RL6A 4JBHA 3WGYA 4YRAA 1DEHA 2B5VA 3GVXA 4R54A 5DBGA 4YAJA 3JCZA 1P1IA 5CP8A 2ZB3A 2WSBA 3AK4A 4NH4A 1HSZA 4RVGA 4R16A 3S2FA 3WGHA 3JYLA 5T8KC 4EITA 3ANLA 2VT2A 1X7DA 2FPGA 3ZDFA 5BNFA 1ISGA 4R5HA 5JAZA 1F17A 4ITUA 1GL3A 4C4OA 2J3IA 4A5OA 3K8ZA 3DO5A 4EW6A 2GRAA 1SC6A 2DFVA 5T67A 2EKPA 1XU9A 8ADHA 1OZAA 1BHSA 1ENZA 4E21A 3JQAD 5JCJA 2NTVA 3DHNA 2YFHA 5ES3A 3NV9A 1EUZA 3GR6A 4S1VA 3L9XA 1U28A 2EJVA 4E2YA 3MTGA 2P9GA 3I1JA 4KTVE 3H4VA 1EVYA 3GHHA 2GYYA 2B0JA 4WLUA 3U3XA 3RKUA 3EZYA 1PWXA 4AJIA 1J6UA 4QT0A 1G0NA 2IDZA 4R69A 3UAGA 4D3FA 1NR7A 2V6MA 4F6CA 3C7AA 3W4IA 3F3SA 1NHWA 1O9BA 2UV8A 4J7XA 5COBA 4CM7A 2BH9A 1QSGA 3CMMA 4GI2A 1IE3A 4HV4A 4UVHA 4FFNA 5EERA 1P44A 4EI2A 3U09A 1TA4A 1Y8QA 3IMFA 2NQTA 3JQCA 1DHRA 2BGMA 4NBUA 3RI3A 5KJEA 2GPTA 4PRLA 3SXPA 3NX4A 4Z0PA 4B3JA 2J3KA 1LSOA 4PZDA 1BG6A 3AOGA 3F1LA 1IZ0A 4EUHA 4JJFA 1E7RA 4BO8A 1LRKA 3TZ6A 3JQ6A 2PK3A 1ZIDA 4CUKA 1U8XX 4LW8A 1HXHA 4D41A 3Q9UA 3RCBA 4IDEA 2JFGA 5ENDA 4U6QA 1N7GA 4FOOA 1XR3A 3O38A 2Z1NA 3FRJA 1L1FA 3KSZO 4ZJUA 4NNJA 3P2OA 1ONNA 3WR5A 1KOLA 2EKQA 5FFFA 5JW6A 3BMQA 1Y8QB 4GH5A 4JNKA 2O50A 1TLTA 4B7XA 1MFZA 1PEDA 4WLEA 1N2SA 1SNYA 4RDHA 3PHLA 2R6JA 1I32A 3FSRA 3AOEC 2VHXA 3VOSA 4CMCA 3SLKA 5TJHA 2FRDA 2VQ3A 3RQSA 3HDHA 3MJSA 4WOJA 2Q45A 5IZCA 1P1JA 3FTNA 3CZRA 3I9MA 5G4LA 1U8FO 2NVWA 4FD3A 3S1LA 4BNTA 4XRGA 3W4KA 1ZJYA 1V9LA 2VYND 2VYVA 4TSKA 3STHA 2Q46A 3W8FA 2A9FA 3PIIA 3V5NA 3CTMA 1QYDA 2DAPA 2Q2VA 3L4BC 3RIHA 3AI3A 1I3NA 2EIHA 1H0KA 4FJ0A 1E92A 2B4TO 4EEZA 2IYPA 2OFPA 4ZRNA 3BMQB 5K6AA 3JD2A 3OIFA 3PIDA 2HQ1A 4J90A 4NQZA 4BNNA 5B12A 1SCUA 2B4RO 1H9BA 2PV7A 2G0TA 3IIEA 4GGOA 4YAIA 1WMBA 2NACA 5BSGA 4MP6A 2EF1A 5B37A 2P4QA 4YTEA 1E1NA 1E7WA 4CM9D 4IDDA 1SMKA 1XU7A 4PLFA 4CMHA 1QXSA 4FDAA 3QVOA 5L40A 3KV3O 3MEQA 1DB3A 4AJLA 2O3QA 5B1YA 3VZRA 4WPGA 5C7LO 4B4UA 3GRPA 3HB5X 1P74A 5AXCA 2VUUA 4Y6RA 2OL4A 2LDBA 3VTZA 2YUTA 3D64A 3QP9A 3HJAA 1XYGA 3HSKA 3MJ4A 4J2OA 2J8ZA 4MJLA 1P0CA 4IINA 4M89A 4IBOA 1FDSA 3PTZA 1F12A 2ZTVA 5CDGA 2GN4A 1D1SA 1OFGA 1ZNQO 4RF2A 1IB6A 2DVMA 2UUPA 3LT4A 1GZ4A 2JCVA 4ALLA 4CR7A 2A94A 2HU2A 3RASA 2OXIA 3BMCB 5A1TA 1ADFA 1PJTA 2W2LD 4EBFA 3HN2A 5JSFA 1B16A 1UP6A 2BLLA 2DBVO 4OXKA 3VH3A 2ZTLA 3DAFA 3X2FA 4I9NA 3PJFA 1HETA 1K6IA 2HK9A 4YT2A 1VJ0A 3VKUA 1NM5A 4ZRMA 4W9NA 2HRBA 4WNIA 2Z5LA 4CM1A 4CLXA 3ZWOA 3EYWA 1Z82A 3C1OA 5MGBA 4A10A 4PN3A 2C20A 4BNHA 1OC4A 2GN8A 5KJFA 3GZ4A 1HDYA 3D3WA 4AFNA 4LN1A 5JO9A 5AOVA 3I9OA 4P22A 1U4SA 3U62A 1K0UA 3WICA 1E77A 2VTDA 5DCWA 3FR8A 1N1EA 3HZZA 1IULA 3WLEA 1M76A 1NR1A 3GNTA 3O4RA 4J6FA 4LISA 3DONA 1E7MA 2FPIA 3RSHA 4CL8A 1WDLA 5FF9A 3TZHA 5COQA 3GQVA 1DSSG 2JAHA 1A9ZA 3E82A 2AQIA 2GUGA 3O9ZA 2YFQA 5KVQA 1YB4A 2EEZA 3AI1A 3B20A 3RJ5A 4R3WA 1DRUA 4YAGA 1XEAA 3LU1A 4WEQA 1VRWA 5T64A 4WLVA 5TS3A 3T4XA 3D3WB 5H83A 4IZHA 2CMDA 3PDUA 2PKQP 3ADOA 3HADA 1W8DA 1T1RA 4RF3A 2GN9A 4OKIA 1Q1NA 2E48A 2GERA 3PQDA 3VVCA 2AXQA 4I5GA 2C7VA 1X7GA 4AJ1A 4KDEA 1SB8A 1YQXA 1QP8A 2IODA 3UW3A 4DQUA 4BNGA 4ZQHA 1C0LA 2FZWA 3V1YA 5TIIA 4IJVA 1EBUA 1FDTA 1X0VA 2GLXA 1E7QA 1PR3A 4FCCA 4E0BA 4D79A 5IDXA 4JJGA 5DDIP 4ROSA 2Y0CA 2PZJA 4M55A 5IF3A 1YE3A 2V6GA 2W98A 5K0ZA 3OJOA 4IIUA 4QSMA 4XDYA 4MVJM 5CPBA 5HS4A 3ZWWA 4HFJA 2VUSA 1DFHA 3PFWO 5KVVA 1GUFA 5IN5A 3JQAA 4MOWA 4W99A 5A9RA 4YAEA 5FI5A 1DIAA 3CKYA 4PLTA 1R0KA 3NUGA 4AG3A 1JLLA 2JHFA 4RGBA 1LQUA 2F00A 3DOJA 4GLOA 3SC4A 4BB5A 4E3ZA 4J1SA 2Q4EA 4NIMA 4J91A 5TQVA 4MVJA 4RQUA 3CEAA 3OJLA 2DBZA 5A5EA 5KVSA 3JQ9A 4E4YA 2NSDA 4RVUA 3JV7A 1P9LA 5JMWA 3ICCA 3BMOA 4IXTA 4DLBA 1PGJA 1PGPA 2HO5A 1E5QA 4WKGA 3MJEA 4HX5A 2Q1UA 4E30A 4LVCA 4CMJA 3FPLA 4CMEA 1EK5A 3RC7A 1HDZA 4BO0A 4FR5A 1YH3A 5JYDA 4MVJI 2W2KA 1N7HA 1GYRA 1IUKA 3JQAB 5EL0A 1LLDA 1QYVA 1XQ1A 1LXCA 1T4DA 1KVSA 2QZ9A 2E37A 1DJNA 1GCOA 3LZ6A 3ZNOA 4E2WA 5JC8A 3VPHA 5LDGA 5AXAA 3HN7A 3OHSX 1P1FA 3IDSA 4ZN6A 4FGWA 1DIRA 3UCFA 4R68A 4F6LA 1YBVA 2NNLD 3JQ8B 3SX2A 2DPHA 1I01A 4XYGA 3FWZA 5I8WA 1RM3A 1H5QA 3PI7A 4UUOA 1H6CA 1FF9A 3VC7A 2UYYA 3ETDA 4DYDA 1DDOA 1GADO 3DZHA 1T2FA 4UVGA 5JDIC 3DMYA 4BNVA 3ZW9A 1N5DA 3NGXA 3HWRA 2JAPA 1KVTA 5A05A 4EJMA 3GY0A 3V2HA 1ZBQA 4TQGA 3HFSA 4LMPA 1A71A 4BMSA 1XSEA 3BXXA 1LUAA 4PGFA 1R4MA 2GASA 3E9QA 3WYEA 3IP3A 5G4KA 3PQEA 2BI7A 3PHGA 1DHTA 1L7DA 3RU9A 3KO8A 2BI8A 3PLNA 1N1GA 1LLCA 3R1IA 1XHLA 3RBXA 4I5FA 1BGVA 3TL3A 2GSDA 3M1AA 1DIBA 4YACA 5F1PA 3TZKA 3UHAA 4BGUA 4YCAA 5JCXA 3PHIA 3JYQA 4JQCA 2HJRA 4JGBA 4H15A 1A5ZA 2Y0EA 2B69A 4RVDA 1EZ4A 1ZK2A 4UVDA 2PZLA 1H2BA 1MV8A 2DTDA 4JP2A 4A73A 5JO0A 5L51A 1R4MB 1XKQA 1Y9EA 3QVTA 3P7MA 4AJOA 3A9WA 5JNLA 1WMAA 3KYCB 2CVOA 3R6DA 4RORA 5DULA 4DGSA 3GDFA 2PFGA 2RHCA 3WXBA 2EP5A 2JD1A 5COAA 3A4VA 3E5MA 2AA3A 3CZMA 2YQ5A 3S8MA 4CM9A 4KOAA 2I66A 5KCZA 1CF2O 4I8XA 4DPLA 4NBTA 3VDRA 2UUOA 3WQQA 2X22A 1Y5RA 3RUIA 5IZ4A 3GDOA 3UVEA 4IDAA 5L4SA 4JK3A 4RCVA 2DT5A 3ZWNA 3ZGYA 4Z3DA 1I24A 3GNQA 3QQPA 1XQ6A 1E3SA 5KJ6A 1KETA 3KEOA 3L6EA 2EGHA 2HDHA 4TZTA 3GT0A 1U5AA 3AU8A 3FNEA 1O95A 4HUJA 2X58A 1O89A 1MGOA 3NRCA 3K5PA 5AVOA 1LRJA 3IL2A 1W73A 4IJWA 1KVQA 3NEPX 5EESA 3I23A 3AY6A 4QFDA 1PJ3A 2IZ0A 1N8KA 4ZQGA 4IGFA 4E5KA 4WGGA 2VUTA 1PL6A 1ZZEA 2OOSA 4MVJE 4IXWA 2D3TA 4KUHA 4D45A 3RUFA 2VCYA 4FPXA 4XR9A 1EDZA 3ZWPA 1E0DA 3IQDB 1HZJA 2QIOA 3E03A 5F1KA 1KY4A 4YJHA 4ALIA 2WYVA 4W7HA 4RPKA 1PJQA 3FHLA 4PVCA 5DP2A 3T7CA 4I9UA 4OM8A 1CRWG 4C7JA 2AW5A 1PU2A 5F5LA 4BNJA 3JQBC 4MP8A 4CQLB 3GVHA 1E3WA 5TJ9A 2E4AA 2QRJA 4I5EA 4NU6A 3DAPA 1NFRA 4R4JA 5F1OA 3BTOA 3RUCA 1EE9A 3SBOA 3KTDA 1Y7TA 3RVDA 4CLHA 4LMRA 4WNCA 4XWYA 3C24A 1CJCA 1GDHA 2UAGA 4RLHA 5GZ1A 3QWFA 4DWVA 4KP7A 1NPTO 4DVJA 3H5RA 1GPJA 4BO7A 5LDHA 1EFKA 1V0JA 3ULKA 1ISHA 2VRCA 2WYUA 2WD8A 2X5JO 3Q2KA 1M2WA 1I10A 3BTUA 4XGNA 3OQ6A 5EQFA 5H82A 3DTYA 3S55A 4ZHSA 1X14A 2FN7A 3UF0A 3QWBA 4BO6A 4LCJA 1O6ZA 1JKIA 4J49A 4TROA 1E3WB 2P68A 1BDBA 1KBZA 3RC9A 1ZEMA 1UZLA 2ZKLA 1SOVA 4ZQBA 2X1HA 2QRKA 2EW2A 1I5RA 4M8SA 3ZH2A 1E1LA 3L0DA 1UZMA 2IE0A 1GFSA 2ZYGA 3S2GA 5GZ6A 4CLEA 4F45A 5IXYA 5JS6A 4TRMA 5KTKA 4YDRA 3WMXA 4RVFA 4TMFA 5JDCA 3TL2A 1LDMA 1V35A 5KJ1A 3D3EA 4DXHA 1CQIA 5JYEA 2ZJ1A 1YB5A 1NBOA 1PGNA 2I3GA 1NQ5A 4OXNA 1DPGA 2O48X 5CDYA 1ID1A 3E18A 4WLNA 3U0BA 4BKUA 1U9JA 1E3IA 4N18A 5L7TA 4IMRA 1YL7A 4EJ0A 4FOSA 1JVBA 1HYHA 4R51A 4ZICA 2C07A 3HDYA 3CE6A 4E5MA 3DZKA 1O94A 1Z74A 2G76A 2H6EA 4BMVA 3U49A 2IEBA 1SZJG 4CMIA 5BR7A 4IZIA 4WLOA 1KEVA 5IDYA 3RAJA 3SJ7A 3JD4A 4IJUA 1E6EA 1OAAA 2NU7A 4GGPA 1X13A 2NADA 4JROA 1MG0A 1ENYA 3F5QA 3MOGA 4TRJA 4ZVVA 5T6BA 1AHHA 3GMDA 1V6AA 3DMTA 3W6ZA 4IM7A 2LDXA 1N92A 2HMSA 3AU9A 4HFRA 4Y9DA 3RKRA 2P2SA 4QECA 2DBQA 4PG6A 1HZZA 2CVQA 2EKLA 3AY3A 4WE3A 3D1LA 1CYDA 2DM6A 3ANNA 1LQTA 4CV2A 5IAAA 2GCGA 1R12A 1RM0A 2J5RA 3IKTA 3PGJA 4HY3A 2CSUA 3TOXA 1HT0A 1YJ8A 3I52A 3NJ4A 1IHYA 2W90A 3Q1LA 4EUEA 4FFOA 1QLJA 1NNUA 4E12A 4Q3BA 5IDQA 3PJGA 3PK0A 4B8WA 1PIWA 4I08A 4A2CA 4ZQFA 4AJPA 3TSCA 4CMIB 1TT5B 1VKNA 2Q49A 4OO3A 3MJCA 4B7UA 4CQMD 5TSDA 1B26A 3WDSA 1QKIA 2HSDA 1E3EA 1B7GO 3DAGA 4D7AA 1LTHR 1DRWA 1QORA 2D2IA 4PG5A 5KKAA 3GC6A 3V8BA 3TPCA 5DT9A 4JBIA 2P5UA 2OHXA 1U5CA 3ENNA 3ADPA 1DC6A 1R15A 4RO0A 1DJQA 4DIFA 3EC7A 3RUEA 1ONOA 4XR4A 1FXSA 3Q0EA 5TF4A 1WVGA 3DXFA 1AXGA 1ISMA 1WZEA 4GAEA 3ZV3A 3IUPA 4BGVA 1VJTA 4Z6KA 5DCUA 1XA0A 3O03A 4RPHA 5A3JA 4DIBA 5HRUA 1Z75A 2R2GA 1XCBA 4P38A 1BRMA 1GYPA 1JWAB 2ZCUA 5ILOA 3WSWA 4R9RA 4U0JA 1W4ZA 3H3JA 4FFMA 2PGDA 3E1KA 4DREA 2IYOA 3PHHA 3RFVA 3VPXA 3KYBA 4WK6A 4FBGA 2Y1FA 2ZTMA 4U6SA 2TMDA 3CMCO 1NYTA 1YRLA 3EVTA 2FMUA 1D7OA 3GFBA 2GNAA 1NTOA 3OFSA 1L7EA 3P19A 3PLRA 3QWIA 3ZWBA 4FFPA 3GGOA 1GR0A 1B0AA 5H81A 2JKVA 5C7OO 4BNUA 4BQRA 4RPJA 4DQXA 1SEPA 1RPNA 4BO1A 1H93A 3UKOA 4DLAA 1LU9A 2XF8A 3B1FA 3F4LA 3OIGA 4GSKA 4R5MA 4Y6SA 3D4PA 1UP4A 2C29D 2OGUA 3DBVO 1WW8A 4DYVA 2DQ4A 1HYEA 1MXHA 2P9CA 1FDUA 5JC1A 1A27A 1YOVA 2V6BA 4O6VA 2EWMA 4ND2A 3ONDA 1I3KA 3GVCA 4HFNA 3B1KA 4AVYA 2Z95A 5FEUA 4O0LA 1P3DA 6ADHA 2X9VA 2O2YA 5GY7A 4F3YA 2BF7A 1P77A 3IP1A 3IS3A 3N7UA 2E49A 4R3NA 5CEEA 4CUJA 3AM5A 1JQBA 4XCVA 3ON5A 5HM8A 4XYBA 3NT5A 1GTMA 4PIVA 1VKOA 3OA2A 2QHXA 3OP4A 4RZHA 1R66A 4BHTA 4GPD1 1JWBB 2WD7A 5IZCC 2X8LA 1UXGA 1S6YA 1YOVB 2Q2QA 1UZNA 2J5QA 3H9JA 3ASVA 2D0IA 5IDWA 2AQ8A 1E7SA 3LLVA 1NWCA 1X1EA 4N54A 1K6JA 5KWEA 1P1KA 3GMSA 3GPDG 1PWZA 2CF6A 4CM3A 4UULA 1HDXA 5K6AC 3DBHB 1B14A 3PDJA 3WNVA 3ZV4A 3DHEA 2DFDA 3R0IA 1ARZA 1WAMA 5DCYA 2PA3A 1J49A 2I3AA 1XDWA 1P1HA 2PD3A 2WD7B 4PG8A 2YV2A 1ADGA 1PJCA 4DC0A 2I67A 3NYWA 1N9GB 3H9UA 3M2PA 3JQFC 1V3VA 1C1DA 1JA9A 1U4OA 4UEKA 4DC1A 5ICSA 3HB4X 4E33A 1PS8A 4BV8A 1HL3A 4FSHA 4QX6A 3QVSA 5TLSA 1X0XA 2J3JA 3RBZA 5A06A 3U4HA 4OIMA 1E1MA 3AOEA 3HDQA 4QFCA 4N5LA 3A28A 1VJ1A 4YQYA 1J5PA 5L4NA 2WTBA 3PZRA 1KYQA 1RYDA 7ADHA 1Z7BA 3PRJA 1DC3A 3QLJA 4BKRA 3GUYA 4XYMA 1JKJA 1V8BA 1I2CA 4B4OA 2OMEA 3BMCA 3VDQA 4WCFA 3UH1A 4BNZA 1GZ3A 1RJWA 4NDNE 1MLDA 4WUVA 4DPKA 4L76A 1DO8A 2GZ2A 4CV3A 1I3LA 3GUCA 3PEFA 1NPDA 1VSUA 4WCDA 3WGIA 1T2DA 5CAEA 3G49A 3Q9NA 4XQEA 1C1DB 3NAQA 1U3UA 2RH4A 2QX7A 5TC4A 3GVIA 3F4BA 5JPIA 1DBVO 1BXGA 4UVEA 2HUNA 3IJRA 3JYOA 1NFQA 2ZIZA 1YQDA 3E9MA 4F46A 4R41A 5A04A 4LRSB 5EMHA 4J4HA 4H3VA 2PTGA 4EGFA 3HG7A 3CXRA 1FDVA 3WGTA 1Z7EA 3INRA 4HKTA 3FCOA 2YV1A 2BHLA 4WJZA 2A4KA 1YONA 1C14A 4WCFB 4UUMA 2ZK7A 1X7HA 4GMFA 2HK7A 3EVNA 4MKXA 5L4LA 1F8GA 1E3JA 3G79A 4WASA 2C5AA 4LK3A 4ZA2A 1GYQA 2C2XA 3OH8A 3WJAA 2YY7A 1BXGB 3GZNA 2WMDA 5A5FA 4IY1A 2R00A 3I5MA 2JD0A 4PG7A 3AUUA 1IHXA 1YBAA 3ZHXA 2D4AA 3I6IA 1IL0A 1O5IA 2PD4A 4BS9A 3EUWA 1R4NA 4L4SA 2VWQA 5CFZA 3PPIA 2C82A 3BA1A 4DUPA 3WQRA 3GHYA 3ROMA 3INTA 1NAIA 4DQVA 2O2SA 4B8ZA 1YXMA 2Y66A 4NK5A 3PJDA 1U3TA 3DFUA 3RFXA 2ZJ0A 4J16A 3WG9A 1HWYA 2X4GA 2WE7A 2H5LA 2FSSA 2ZATA 3DZFA 4ILKA 3DBRA 3GZNB 1Y81A 1H9AA 4K1LA 3WLFA 3K9QO 3OBBA 4PLWA 1ZK3A 3C8MA 3RJ9A 4CV0A 5DZSA 4P8RA 2JD2A 4K6FA 5JY6A 5K9ZA 3S2IA 2VHYA 2IXAA 5G0UA 5BSFA 1R4NB 3H3FA 5JAQA 2PGJA 1AHIA 2IZZA 2RHRA 2FR8A 4GBJA 4M54A 4MO2A 3DB2A 3KSDO 1NXQA 2O3RA 1M66A 5ITWA 1ZXBA 4GWGA 4AJHA 1IZ9A 4GL4A 4HWKA 5G0SA 3CSDA 2NVBA 5ENVA 4ALJA 4B79A 1QYXA 1ZK0A 3F47A 4CQMA 2O3JA 1LC0A 3DBRB 3BIOA 1A7KA 2GF2A 4BNWA 1ZK4A 2PNFA 2ZQYA 3TF5A 1MB4A 3GAFA 4IPTA 4P4LA 4R1SA 1SPXA 5I8ZA 3H5NA 4D43A 2B4QA 3ORFA 3FWNA 1Y1PA 4QXMA 5FYDA 4BNLA 2NTNA 3K2EA 4ZQEA 3C1AA 1ZO8A 3N74A 1AE1A 4H16A 2X5KO 3GLQA 2YJZA 3LK7A 4LSMA 3CUKA 2CZCA 1PQWA 2X0IA 3JQGA 3NDJA 3WGZA 4E6PA 4YT8A 5ITVA 3A1NA 1S7CA 1HYGA 2QYSA 3COSA 3D4NA 2NU6A 1ADCA 1KC1A 3K73O 4Z0HO 3HQ4O 3L07A 4MP3A 4OOFA 4CQMB 1NPYA 2B36A 3HNPA 2CDBA 3PP8A 4GKVA 4CL3A 4CLDA 2QW8A 4L4RA 4URFA 5G0TA 2FP4A 4CMEC 2AQKA 1YDWA 4GLLA 4CJXA 3JQ8A 2D1YA 4TKLA 3AUSA 1P0FA 1UXIA 4MINA 1Q2XA 4AICA 3ZWMA 3VH4A 3ITKA 3G3EA 3I83A 5I7SA 2VHWA 4BKQA 4CR6A 1BXZA 1H2HA 2PH3A 3JQGB 2BGKA 1T26A 1VC2A 1NP3A 4LRTB 1I30A 3WBFA 1E6WA 1Q7BA 2VNSA 2BFMA 5T5QA 1K2WA 2YDYA 4YJGA 3NDIA 1MA0A 1YGYA 2DPGA 2VWHA 2Y1EA 3G1UA 3ZI0A 1OC2A 4N5NA 4MKRA 3F46A 3KYDB 4XJTA 3WIEA 1JVSA 4WECA 1YL5A 4W4TA 3BHJA 4IS2A 2QZZA 3D7LA 2J6IA 1ZKMA 1RWBA 4BQPA 4YT4A 3K6JA 2NM0A 4R9SA 3ROQA 1Y6JA 4B7CA 3RUHA 3VHRA 1XGKA 1IPFA 4M1QA 2BFAA 5JBIA 2FY8A 1MXFA 2PZKA 3C85A 4NBWA 4RDIA 2AEMA 3FD8A 2PWZA 3TOZA 4LSWA 3UUWA 3OECA 3KRTA 4KMSA 3ONEA 3FR7A 4YJGB 4CPDA 5L9AA 4KUGA 3OIDA 3AUAA 4Z9YA 3KYCA 2I99A 3IAHA 7MDHA 3NJ8A 4LVUA 4AJNA 5JXWA 1H6DA 3CIFA 4XRRA 3RC1A 4INAA 1U2DA 1T2EA 1ISIA 4CM5A 1ZFNA 1M6HA 2CFCA 3H6KA 4AJJA 2ZYDA 3TQHA 2Q1SA 1NVMB 2VYNA 2Q3EA 3EAGA 3LT1A 4I1IA 2E6UX 3FNFA 4G65A 3HDJA 3N58A 3Q3CA 1YL6A 2DU8A 3ZU5A 3JQ7B 3LC7O 4OSOA 2HKIA 2C0CA 3OM9A 2AHRA 4RPLA 2CDCA 3KZVA 5JDIA 1D4FA 4RV9A 3D5TA 3WFJA 4XIJA 2A92A 1RM4A 4ALMA 3GFGA 3UOGA 4KWIA 4YEDA 3ZWVA 3LT0A 1MX3A 1D3AA 3DL2A 1Q7GA 3DDNA 4EDFA 1W0CA 1PJBA 4J1TA 3ZNNA 1HRDA 3BHIA 3R3JA 4QTZA 1Y8RB 1ISFA 3O26A 3DOCA 1OI7A 2O3UA 1UXKA 3I4FA 4ND5A 3TWOA 5A03A 1IY8A 4PZCA 1TI7A 4DRYA 4IQ8A 3IUSA 4EZBA 3KBOA 5KVCA 1AGNA 3UGKA 4D3SA 2PKRA 3I9KA 1ZK1A 3W8DA 5L45A 1AN9A 1PTJA 1V3UA 2I65A 1KERA 5DN9A 1QV6A 4CQLA 3QE3A 4II2A 1YVEI 1UXJA 2NLOA 3JD0A 1ZXLA 1WWKA 3BMNA 4IDFA 4UUPA 1EE2A 1B8PA 5I7VA 3K31A 3FTPA 1LJ8A 3DFZA 3HE3A 3QRWA 4D46A 4E32A 1PSDA 2PH5A 4A7PA 2NUAA 2DBRA 4Q39A 3D0OA 2VHZA 1AXEA 2NQ8A 1HDGO 4OH1A 3ZU2A 3FF4A 4H7PA 4K28A 2V6FA 4N7RA 4NJMA 4XKJA 1EQ2A 1LI4A 2WDZA 2JFHA 3PYXA 3BYZA 2XXBA 2EERA 3U4DA 4ZD6A 5TNXA 2X9GA 5DBFA 5EIOA 1DOHA 2W2LA 4J7CA 2HMUA 4XX0A 4J4BA 4B3HA 3VVBA 2YV3A 1T4BA 3GGPA 4M87A 1KVRA 3F1KA 4YA6A 5JE8A 3PJEA 4A27A 2X9NA 4BNMA 3BMNB 1MC5A 4FW8A 2HMVA 5C37A 3JD1A 4MVJG 4GX5A 5G0VA 3IOYA 4GWKA 4BNKA 1IYZA 3OEWA 1BTOA 4FIZA 3ZWXA 4RVHA 3WTCA 4YBZA 2XXJA 3VPSA 1WZIA 2D59A 2XPCA 4RVSA 5CG2A 3ZNPA 4D0RA 4IQGA 4NJMB 4TZKA 3ZV5A 5HWSA 1PZGA 2HRZA 3DR3A 3SJUA 2GO1A 3PXXA 1YDEA 4BL5A 1PZHA 4YT5A 4PLYA 1NQOA 3C3XA 5DNAA 3EW7A 1WDMA 4IS3A 4W82A 1MUUA 1RYEA 3I4CA 4PVDA 1K89A 4CMBA 4HP8A 5JDCC 1C0PA 3WYBA 1ML3A 4NK4A 3GA0A 1ADBA 3TFOA 5CDTA 1ZSNA 3VKVA 2P9EA 4KWHA 3Q6IA 4FGSA 4IDGA 2OBNA 3AJRA 1EDOA 3ZN2A 1LNQA 2O3TA 2Y93A 1ZVMA 1DLIA 1UAGA 2NTJA 4E5PA 1MFPA 1NWHA 2QQ5A 4BB6A 1TVEA 1P45A 1WPQA 2V65A 3A06A 4JN6B 4YJFB 1HE4A 1PJ2A 3NT4A 4MVJF 5JMPA 3ABIA 1CETA 1A72A 1BSVA 4A03A 2JJYA 2SCUA 4PLHA 2BMAA 1EBFA 1G6KA 2IRWA 1VSVA 3FPCA 2HMWA 4GKBA 4EUFA 2OO5A 1SBYA 5JLAA 5BSEA 3EHEA 3ETEA 3WX0A 1P1RA 3QA9A 4BVAA 3GN1A 2NWQA 1DFGA 3DMTC 4UEOA 1YWGO 3GG9A 4J9UE 4L9RA 3GPIA 4U8GA 1LEHA 2I5PO 3JQEA 4OOEA 4CM6A 4XD2A 1TT5A 1Z6ZA 4BNFA 3CINA 1NQTA 4J1NA 3WGQA 4Q3NA 2O3SA 4DMLA 5BSHA 5KOIA 4IQ0A 1E1KA 3AWDA 4OGWA 1GQ2A 4ALNA 3KETA 1R37A 2EJWA 4E2ZA 4PG4A 2Y1CA 3WIDA 5ICMA 2GZ3A 4D44A 2O7SA 1HE2A 1F8FA 4FJ2A 2OZPA 1T25A 4AJEA 3U4IA 2GGSA 1R0LA 1DAOA 4M86A 1LDYA 3ZWCA 3V2UA 1E5LA 3L77A 3GDGA 3ST7A 1EUDA 1E3LA 1Q7CA 3PWZA 4D0SA 3MWEB 5A9SB 1FJHA 5GZ3A 3FI9A 2NVUB 5A02A 2F1KA 2GZ1A 5C3MA 4IDBA 4M49A 1UR5A 3E6AA 2GD1O 4Q9NA 2J5KA 2CD9A 3UN1A 1C1XA 3WB9A 2BFOA 4D3DA 1BDMA 1U3WA 1EVJA 4BO4A 4HNGA 3NDRA 2CDAA 3H9EO 3QIVA 4OQZA 4QO8A 1ULSA 3PVZA 5J23A 1QV7A 1TB4A 1U1IA 3H9GA 3VPFA 5EINA 1ZMTA 4RQTA 3ROKA 4FS3A 1HKUA 1U7TA 5EQDA 3QWHA 2QG4A 1NVTA 3MOIA 3ENKA 2CNBA 1LDNA 4B3IA 4BUCA 1C0IA 4OJNA 1Y5MA 1F06A 2OUIA 4TRRA 3TFQA 2JFFA 5L53A 2HMTA 2VRBA 1ZEJA 1C1XB 1DRVA 4YAKA 1UH5A 3ICPA 3JSAA 2OORA 5A4DA 1WNTA 1GAEO 1BMDA 4Q3EA 4XJSA 4NU5A 5CDSA 1IOLA 1KEUA 2AMFA 4UUNA 5JAMA 4BGIA 4OQYA 5T8KA 4L73A 3JTMA 2PGLA 3E5RA 2GR9A 5T57A 4DTIA 3H2ZA 1K5HA 5BQFA 1HDOA 5TT1A 1QG6A 1CWUA 3HHPA 3I9NA 3PWSA 4PCVA 3UXYA 4TWRA 4YVFA 1Q0QA 4GX1A 3GEMA 4KQWA 2W4QA 4MVJD 1A4IA 3KM0A 3K96A 2FR0A 3INGA 2VWPA 4A26A 1UJMA 3DHYA 4O1MA 3TRIA 1XELA 3EDMA 4PZEA 4JCOA 4MKZA 1M6WA 1EUCA 3H7AA 3ZW8A 1I3MA 3LSYA 3WNQA 4NFSA 4XA8A 1UDAA 4W6ZA 3QHAA 3SLGA 3H65A 1FK8A 1B2LA 3DBHA 2X86A 3ZHYA 4S3MA 3W1VA 5BNTA 3OMLA 4MIOA 1ULUA 1KEWA 1YKFA 1RKXA 3PZBA 2JCXA 2Q1TA 1VE9A 4QO7A 1K3TA 3PFFA 3O8QA 4FC6A 3VZSA 1C0KA 1SAYA 4PLGA 2VT3A 1DAPA 4Y98A 5U9CA 4J2HA 4R01A 2VOEA 1N9GA 2A35A 1H6AA 3V1TC 5JFOA 1EQUA 4OHUA 3BTVA 1LBEA 1ZSYA 1B15A 3GVPA 2W8ZA 4NFYA 1HF3A 1ONPA 2VTEA 5EN4A 4GX0A 5ILGA 4JP3A 1FMCA 3E48A 4AJ4A 1H6BA 2RAFA 1E6UA 1LDBA 1XG5A 2DKNA 1PS0A 3NTQA 3L6OO 3KHUA 3ZU4A 2WWRA 2Y05A 3DOOA 3T7EA 4YJDA 2X6TA 4RF5A 5DP1A 3B6ZA 5L7WA 3DZIA 3LF1A 3H8VA 5IXSA 4NJOA 4O59O 4D42A 3P5SA 3WWYA 2NU8A 3ROPA 3WOHA 1ENOA 1GPDG 1WP4A 3M1LA 3O8QB 3OJFA 4CMAA 1IPEA 2QRLA 3JD3A 3WBBA 4YPOA 5BNIA 4MDHA 4R1TA 1V3TA 2O23A 2NU9A 2EP7A 3U9LA 4OXYA 3S2EA 4RJTA 1D8AA 5L3ZA 3NTOA 2PR2A 4QEDA 5I7EA 5L95A 9LDBA 4QQRA 4WCFC 1A9YA 5C7IO 3CH6A 1HEUA 5EJ2A 3W6UA 1GD1O 2X5OA 5HBRA 1WDKA 4BNIA 3AFMA 2QYTA 3ONFA 1CQJA 1WLYA 4G2NA 3M2TA 2TMGA 3FNGA 3NTRA 1BW9A 4ESOA 4FFRA 1PGQA 1U7HA 3HFGA 4DBVO 2FOIA 3L4BA 2VNAA 1AUPA 3ZCXA 1NASA 2B5WA 1PS9A 4XYEA 2ZB8A 5CEFA 3QVXA 5TRTA 2Y1DA 4J0FA 4UVIA 2P4HX 4BKOA 4IJKA 2ZYAA 3WFIA 3JQFA 3GN2A 2XAAA 3F6YA 1LRLA 1YQGA 4G81A 2PZMA 1ZW1A 1GY8A 4YRBA 3C1TA 2J3HA 3JYPA 3AW9A 5KIAA 4GX2A 5B4UA 2G1UA 2VHVA 3MJVA 1CIVA 4JIGA 1NVGA 3KSUA 1PQUA 1UUFA 4ND3A 3W4JA 4R1UA 4IGEA 3DBLA 3X2EA 4G5HA 3QWAA 1PGOA 5JAIA 5DOVA 2OP0A 1BW9B 2BRUA 2B35A 4GQAA 2WM3A 5KJCA 1R0SA 2PLAA 1GUYA 4W9NC 4NMHA 3AM3A 3K2BA 1I36A 2D5AA 2R00C 5F3RA 4XB2A 2JL1A 3DC2A 1Q0LA 3QVWA 4HNHA 3UCEA 4TVBA 3ZWAA 1ISJA 5HTOA 1G1AA 4B4VA 3LC2O 3VTFA 4E2XA 1CEQA 3G1TA 4E5NA 2NV6A 1P33A 2VZ8A 2VN8A 2G17A 5IN4A 3TJRA 5TX7A 1VPDA 4HADA 1JW9B 1B3RA 1T1SA 4U0KA 2ET6A 1VL6A 3LLSA 3DZBA 3I9LA 4J43A 4NHEA 3DBLB 2BD0A 2HLPA 1PR9A 2CUKA 3MJTA 4IUYA 1I8TA 4NBRA 3ASUA 2POQX 1HE5A 1HE3A 3KUXA 2IEDA 5LCXA 3U4CA 1D1TA 4XIYA 4OMUA 2G5CA 2YHUA 4K6CA 1MC4A 2Y1GA 3EY4A 4NI5A 1YBMA 4NPCA 2D5CA 2YYYA 3SVTA 2AG5A 4XDZA 4MVJP 3UFXA 4W7IA 3ITDA 4RZIA 1X15A 4YWJA 1NX6A 4J3FA 3K92A 4L0QA 1PZEA 2C59A 3ZHZA 4WLFA 4JBGA 1LA2A 3B1JA 2YW9A 1YS4A 2VRCD 4PLZA 2P91A 5DOZA 1B3BA 4ALKA 2HJSA 2YDXA 2Z1MA 3WWZA 1HDRA 1JTVA 5F21A 1Z45A 1LX6A 2DLDA 2CY0A 5C5IA 3LQFA 1EVIA 4BOYA 2C5EA 4ZU3A 3VZQA 2B83A 1OOEA 2HAEA 4PLPA 1T24A 2EGGA 1HLDA 3Q11A 3H2SA 1C3VA 4J1QA 3BTSA 2OP1A 4U7WA 1GV0A 3AFNA 1LLUA 4BKPA 4GVLA 2X0NA 2JCYA 1O0SA 1VI2A 2FZEA 4FC7A 1QYWA 2AEJA 3RU7A 4U5QA 3BAZA 5B4VA 3FNHA 1P31A 5TGDA 2OBYA 5U4QA 1ZMOA 3KOUA 1UDBA 3OJEA 2CF5A 4YXFA 3HUDA 4CMKA 1KVUA 4II3A 1KY5A 5I7FA 3GOHA 5TT0A 3JQ9C 1T2CA 3EK2A 1SO8A 4MIYA 1EFLA 2VWGA 1VL0A 4FB5A 2C7GA 2RH8A 1LLQA 4GSLA 3NKLA 1EVZA 1EEHA 3KLMX 4O63O 3PYMA 4CODB 3KYDA 3F9IA 1G0OA 4JLWA 1B8VA 3I6QA 4PRKA 4E31A 1BVRA 1J4AA 2G82A 4TKMA 4BO5A 4KQXA 2H1SA 3GRKA 2PY6A 2ZCVA 4YQZA 3RBVA 4ONEA 2GN6A 2DUWA 2JHGA 3ANMA 3GK3A 4P4GA 4A0SA 4I9HA 4Y67A 4Z3KA 1VM6A 4IDCA 3LC1O 3KVOA 3GAZA 1KEPA 1R16A 2VZ9A 3OQBA 4R1NA 2X23A 3QV1A 5B4TA 4CM8A 3E9NA 4YB8A 1DLJA 1I33A 2C54A 5CEJA 3UICA 2FPPA 2AG8A 1O8CA 4CLOA 1ZJZA 4K9DA 3QJ5A 3WSVA 1HTBA 2XOXA 4XQ9A 4BO2A 5F5NA 1DC5A 3OSUA 3Q2IA 2EHDA 4LGVA 5JY1A 1B8UA 1JAXA 3RD5A 2D8AA 2RCYA 1HSOA 4XQGA 1GU7A 3GEGA 1A4UA 1F0YA 4LCEA 2O7QA 2UVDA 3TZQA 3JQ7A 2VOJA 3ZV6A 4PLVA 1QRRA 1QR6A 3L4SO 2I76A 4OKNA 4Z9FA 2C2YA 1VL8A 1BXKA 2I9PA 3FBGA 4MVJH 4CUZA 1LSSA 3ZU3A 4CM8B 1XWFA 5JCJD 2Y1OA 4KDFA 4MPDA 5FWNA 1UDCA 5L7YA 2PD6A 3SC6A 1R6DA 4CLOB 3CPSA 3BMOB 5KKCA 1WXDA 3T4EA 4NFHA 1I2ZA 3VH2A 2HCTA 4XGIA 5I9NA 3MWDB 5AXBA 4GMGA 3K30A 4FJ1A 3BHMA 1Y8RA 2YQ4A 4DBZA 2W2KB 4YRDA 5ER9A 3OF2A 1GEGA 2DUUA 2E82A 3PHJA 2B37A 3D5QA 4XB1A 4RF4A 4JJIA 1XIVA 2Q1WA 2H9IA 1KS9A 1X1TA 1PJ4A 4EYEA 1DXYA 3OICA 5ER6A 2AE1A 3OJ0A 2FHSA 1LSJA 3B70A 4FN4A 1SB9A 3FBTA 1EK6A 4DPMA 4BNXA 4HFMA 1ORRA 5MDHA 1HLPA 2H63A 2BFPA 3GH3A 4AJ2A 3ETGA 3GF4A 1U3VA 3DZGA 2AE2A 2BELA 4NR0A 4TVOA 5EPOA 3RUAA 4I5DA 2WEKA 1OBFO 4RLSA 3C7CB 2DC1A 3RROA 1JN0A 2ILTA 1JDJA 1I2BA 5KNLA 2EXXA 4L75A 1LSUA 3TNLA 4KZPA 4C7KA 5G4KB 4NZ9A 3MTJA 1MG5A 1PL7A 1M75A 5A3VA 4YR9A 4OL9A 1GZ6A 4KUEA 1DFIA 2IXBA 4XZ3A 2WYWA 2CVZA 2UDPA 4MIEA 1ZH8A 2VZ0A 4BNYA 1ZUD1 3IKVA 2RBEA 3EGOA 1NQAO 3EMKA 4ID9A 3QSGA 2EV9A 4X54A 1MP0A 1SEVA 1ZCJA 5DF1A 1RM5A 3R3SA 5HS6A 3GEDA 5AQ1A 2Y68A 1PJSA 1OMOA 3VPGA 3GGGA 2VYVD 2AQHA 3MCVA 3QW2A 4ND4A 3OETA 4Q3AA 4J4TA 4EEXA 1W6UA 2X7HA 3JQDA 4FFLA 1T2AA 4XGKA 3LT2A 4TRNA 1BVUA 2BGLA 4BGEA 1TXGA 2YHIA 1EMDA 4L8VA 5THQA 3DWFA 3PGXA 4DMMA 4YYZA 4XEHA 4DA9A 4XYLA 1LC3A 1JKFA 1QMGA 4XQCA 4PFJA 2HK8A 1NAHA 5GMOA 2AEFA 3RUDA 1J0XO 1PZFA 3VH1A 3U5TA 1LDEA 1PX0A 3DEYX 1Y9AA 2DTXA 1DC4A 3ZZNA 4UREA 5CDUA 3AY7A 3WJ7A 4HBGA 2Y67A 1GV1A 2X0RA 3OA0A 3WGOA 3RWBA 4Q3DA 3F5SA 5I9MA 2ZQZA 2I6TA 4CLRA 3AM4A 4YJFA 3I9JA
chains in the Genus database with same CATH superfamily
2ALJA 2XWSA 1KWGA 4DLLA 1UAYA 4RS3A 1X7ZA 1PR5A 3TEFA 3U48A 3Q8KA 4EG1A 4ISBA 5AI5A 3TLEA 2J6BA 4YJ3B 4WEOA 2AZTA 1FX0B 2OLJA 3LD9A 9LDTA 2Q27A 3A1CA 4HGQA 3BSWA 4H27A 1TIKA 4KTTE 3WQSB 3RC2A 1A5AB 1EVEA 2A0FA 3PYLA 3M6AA 3PKZA 4JB8A 5E0KB 5BT9A 3ND5A 4PYOA 4B0PA 2P5YA 3LQYA 4AYTA 5JQGA 5T4FA 2P1ZA 1Q5PA 2AGVA 1M1NA 4F9TA 2FSVA 4P7GA 3U4GA 1G60A 1LY1A 3PE3A 1DTEA 4JZKA 3WI7A 1W29A 1XLTA 5BOVA 4Z9XA 1RXYA 2UUBB 1SU6A 4NCJA 1JU9A 3G8CA 3GLTA 1NBHA 2V7PA 1R6TA 4KFRA 4DIEA 3C7DB 5KNDD 1O0CA 1TT7A 4ZJZA 3SYNA 1U6JA 3C5HA 3F6EX 1QOZA 1JG3A 5EEGA 3GCWA 4B4WA 3NHMA 4RKYA 1TZKA 2YIDA 3ZKWB 1ENPA 1TPZA 1DTWB 1LLFA 2H7YA 5E9AA 4P4NA 5J2TA 2FK8A 3IC5A 3TTTA 5IULC 2IY8A 3OTQA 2FWMX 4I1RA 4EYOA 2IVZA 2O4CA 4WBNA 3FOZA 2ATIA 5JU6A 5A9TA 2WY2D 2EOAA 4EQZA 1V5GA 4JELA 3GROA 4NV1A 2A5LA 3ZJYA 1NHGA 4F8EA 1J99A 1U3CA 2JH9A 1YZNA 2XMCA 3NGLA 1IHOA 4E13A 1SU7A 3TIGA 4QBTA 3V1UA 3VR6A 5D86A 4D97A 1TCAA 2P62A 4YHHB 2OUKA 4EF5A 2Y0PA 3TQRA 2HMYB 2I8LA 5DBIA 3TM4A 1H94A 2C3UA 4NBVA 3ZNQA 1K6XA 3QLEA 1QF7A 5G2OA 3R5HA 5JHHB 3A6ZA 3IJPA 4IHJA 4WIAA 2CBGA 2EZTA 2L0XA 4YRPA 2ETXA 1KE2A 2GT1A 3QKRB 1YCDA 1CR0A 4FZRA 3TZCA 2Q50A 2XZPA 4BIIA 3LF2A 2JARA 1RR6A 4M7PA 8LDHA 2WSIA 3R8XA 1W1UA 2VVTA 1DT3A 1ZSVA 5CG1A 1T9GS 1MX5A 3DEFA 3N2GB 2GH1A 3TTVA 4C7VA 1QPBA 4EW1A 1H4SA 3WMWA 2O5EA 1NXPA 2XMSA 3WAKA 2IDJA 4QREA 1QX3A 4FI3C 1F14A 1UP7A 2VLBA 3EZLA 4H0FA 4I1UA 1KC3A 2FEMA 1IJFA 2QMHA 2Y99A 1GQYA 2YUIA 3AEQA 1FTNA 5BQPA 1J2UA 3DQPA 4J9VA 2D2VA 1I6LA 4OLBA 4ZO4A 5IG2A 4L4XA 1YFKA 2W0SA 4B3DA 3I3OA 5LBTA 2GZAA 4FMCF 3L7KA 4K05A 4V24A 4AG6A 1QMPA 4CMGA 3Q3EA 5I9LA 3RAFC 3KUDA 3CT6A 4UTZA 3P2YA 3AHCA 2OENG 3REQA 2ZBEA 2YZKA 4EVSA 3G7NA 3D7RA 3W5UA 5T4HA 1DIHA 2CHUA 2FJUA 2H4JA 3B3FA 3PQFA 3OPYB 4D6YA 1J2EA 1EJBA 4RPGA 4NATA 1YJQA 1JHMA 1NNI1 2PT5A 3HCNA 1QFSA 3SE0A 1O08A 2Y0DA 4KXFB 3D0RA 1U2GA 3OFKA 1Z08A 2GDJA 5FTWA 1HT2E 3PFHA 3DDHA 5G0WA 4IMJB 1Q0HA 4AKTA 1CERA 6LDHA 3FCSB 3OTWA 1HYBA 3IT3A 5JNVA 4JLBA 4JXKA 5BSVA 5EHQA 1Z7YA 1I0ZA 2C92A 3OCUA 4IUCS 4JBHA 3L8EA 1DEHA 1ZRSA 3GVXA 4E7OA 4R54A 4FXPA 3UENA 3S5UA 2AMYA 1JHAA 1CY7A 3VM6A 5AVWA 2CDRA 3ELBA 4OSEA 3H5WA 5KQSA 2ZB3A 5CNIA 4XPIB 3E8SA 3I3SR 5LU9A 2HHCA 1AN0A 2G77B 3BDVA 3S2ZA 1Y89A 3C14C 4MUXA 3USZA 3UJ6A 3JYLA 3WGHA 3ANLA 1C7QA 2VT2A 2ZSIA 1KDTA 2FPGA 4OIFA 3ZDFA 4BV3A 4N39A 3IB3A 4Q9IA 4GLFA 4I6EA 4R5HA 4O4IF 5IYZB 3B1WA 1Q50A 3P94A 2ZUTA 1F17A 5DGTA 2SECE 4C4OA 2FE1A 2J3IA 4OP1A 2NV0A 4JUCA 1EX1A 4KGVA 2R7KA 1TYEB 2PMWB 3TQCA 4FGLA 4S04A 1G4UR 5J5CA 4NXMB 4A4DA 4EW6A 2BDEA 4D4LA 3PDCA 5TMEA 2ZLBA 4AMZA 2GBLA 1XI2A 2R751 3GP5A 2EKPA 4TXJA 4RJ2A 1Z4IA 1BHSA 1ENZA 1C4WA 3JQAD 4YAOA 4DAEA 1KBOA 2YXEA 3QEMB 2NTVA 4PQGA 2FWJA 1S1CA 1EK1A 2YFHA 4XE5A 1QHXA 2JBAA 3BHNA 4QVGA 4QYWA 1ND5A 5E4TA 5C8ZA 5AUQA 4DV3B 1TK9A 1M7BA 5EP4A 3DOIA 4GICA 3GR6A 4IO1A 5FTLA 4BU0A 4Q37A 1ZN2A 2JGMA 3OZWA 4XM1A 5MFPA 1S2LA 1YS7A 2AXNA 1KMCA 2CXSA 2J46A 2P9GA 3DBOB 1XF1A 3H11A 4KJXA 5FOSA 2ISSD 3QEOA 1Y1RA 2JI4A 3SXUA 1EVYA 3SYKA 3T7DA 4ARZA 1I4WA 1RCTE 3EXHC 1M1ZA 2R1VA 1J6UA 4RKFA 2ZRPA 4RADA 4N5HX 2CW5A 1PUIA 3QVUA 2IDZA 4JFAA 3IAM1 3UAGA 1FLNA 1K7XB 5TVKA 4HN4B 1OLUB 3E27A 4JA0A 4HWPA 3W4IA 1V4NA 3E9DA 3LBHA 4CKBB 3OY7A 3WLKX 3CVJA 4J0CA 3U13A 2XODA 2P9ZA 3L7JA 5ABPA 1QAQA 1YRBA 2YZMA 5COBA 2VYFA 3M5CA 1IE3A 3L7AA 3IAM6 4UVHA 3NP9A 4FFNA 5AKZA 3U09A 2B94A 5MHTA 4BQQA 2CHEA 4Q1AA 1TAUA 4ZAYA 1O03A 2NQTA 4L5YA 3FROA 2XCQA 1N9KA 1NP7A 2BGMA 5DGIA 3RI3A 5KJEA 3O4GA 2QL6A 2IHZA 1IDN1 3RRYA 1UBLS 4OJYA 5CNMA 3KCQA 5BQXA 3NX4A 1JIQA 1Y3CE 4B3JA 4CWAA 2RHGB 3NTUA 4UBLA 3PR2B 2V7WA 3W5SA 4AW9A 2B8WA 3D7NA 4PZDA 1BG6A 3PEVA 3SHQA 2PXXA 2ZJ3A 1F8YA 1BCRA 3AX6A 3EARA 4DKXA 2CJFA 4EK9A 2NW6A 4EUHA 1T2VA 1NSYA 5LZ7A 4I1SA 2VFAA 4K6GA 5CX1B 1DMSA 3UXMA 3A1UA 3Q9UA 4RH1A 2W58A 3EBPA 4PF1A 4ZO7A 5CURA 3WNBA 4DDTA 1XR3A 5A2QA 3O38A 5J63A 2ZUFA 1KEEB 2Z1NA 3TE7A 3UUFA 5KYWB 3FRJA 1NJ2A 1L1FA 4EFKA 1R8JA 2GPYA 5HCIA 2R68A 1DG9A 1F6BA 5F7ZA 3SX0A 4NNJA 4V38A 1SXPA 1N33B 3L8YA 3B3JA 5AVJA 2D3WA 3AV0B 4NS1A 3WV5A 1KOLA 4BLUA 2GZMA 5GPBA 3VTAA 3RSCA 4GH5A 3IP9A 4EI7A 2XKKA 1TLTA 2HI0A 1MFZA 1I14A 2GPAA 4UMFA 1J5XA 3A6KA 3FWPA 1SNYA 4UM7A 1VI6A 4M0DA 5A4JA 1QDLB 2R6JA 5IRCD 5ALJA 1SC3A 2C00A 3QUCA 5KAPA 3E1GA 3VOSA 2ZBFA 2WTEA 5TJHA 3SLKA 2FRDA 2VQ3A 5LJIA 1X1BA 2HV8A 3EGEA 4EMUA 3P9IA 4Y30A 2XKAA 3CZRA 5G4LA 2FZ4A 1VSTA 4FD3A 3S1LA 4LRQA 4GDMA 1ZJYA 1V9LA 3CLUD 2VYVA 4ZIRA 1M34B 1D2CA 3GEHA 2RGWA 3W8FA 4R2IA 1IOZA 2DAPA 1SIUA 3D6VA 3L4BC 4ZT7A 1U1CA 2Q8NA 1N3LA 4YPVA 1XOIA 5DCLA 4WDQA 2Z56A 1H0KA 4H3SA 1E92A 3G6KA 1DAGA 2Z9DA 2X5NA 1VYHA 2B8EA 4CIAA 4GI1A 2OGTA 2OFPA 4F3KA 5AHOA 1SWVA 4NCHA 1BROA 2JK1A 3NNSA 4ZYVA 5K6AA 3T7SA 4BNNA 4UJ5A 1YD7A 5JD5A 2WHQA 2B4RO 4WNAA 2JVKA 1L1EA 5A6SB 3HMKA 4CETA 1VFNA 1E60A 1WMBA 1DV1A 2NACA 3K9BA 4PYNA 4JP1A 1CS0B 1EM8A 5DW0A 2EF1A 1XAGA 1GNSA 1E1NA 3DZ8A 4TLMB 2JH3A 5E38A 1F5SA 1VMAA 1GUBA 3CKKA 5KTTA 5ED0A 4FDAA 4FFVA 4Z2AA 3ELUA 4P3XA 1DB3A 3L7NA 4RD4A 1GARA 3CCFA 1A04A 1QRDA 1XF9A 4P4TA 1C81A 2JLCA 3GDWA 5C7LO 5CD1A 1JDUA 2Z5VA 1P74A 1BVYF 1JF8A 3CH7A 3QLVC 1G3QA 1L7BA 4Y2YA 5AXCA 3LL7A 3QA3E 2P3LA 1R9GA 4WOBA 5FHRA 2OL4A 1HOXA 2LDBA 2Q6OA 3QP9A 3D64A 5BN4A 3HJAA 1TMYA 4TLLB 4B7AA 3B51X 1G38A 2PFKA 4EGJA 4J2OA 4IINA 4M89A 2AJBA 2XUOA 4PQFA 3TLGB 4LE1A 1GLNA 3O7WA 3QXJA 2HSWA 1XMSA 3TW6A 2C4TA 3EXEA 3IOCA 3DC7A 2DWOA 3ITEA 3GRVA 1GPNA 2DVMA 3CRZA 4LRUA 4YV7A 3AF0A 4HBZA 3VNSA 5LQRA 3KTAB 4HMPA 5BUCA 3F78A 4YUXA 2PXHA 1GGEA 3F3YA 4B6SA 1JU3A 1RXWA 2RSLA 2QMUA 1O58A 3ORQA 3R09A 4RWZA 4UEWA 2VTBA 1AA9A 4IRUB 2W2LD 1R0RE 4QBIA 3UOWA 4N8EA 4W5QA 5JSFA 4LHWA 3I9V1 1KZYC 2ZEJA 1OBOA 2BLLA 3CGWA 2DBVO 3VH3A 2ZTLA 5IUNC 4ZODA 1DX6A 1JFRA 1P1CA 4DNFA 1FPMA 1JDBC 3M89A 1E2NA 1QHHA 3HI6A 2P5SA 2ATVA 4OHYA 3I9V6 3WL4A 1NQWA 1OT3A 3GW8A 3P0HA 4JLUA 4RHTA 2QOEA 4UUAA 5EWMA 4ZARA 4A10A 2C20A 5KNDH 5T4EA 1GSOA 4REQA 3T9EA 1VOTA 3BRWA 3ZIDA 1AKYA 2AN4A 5BPHA 3R2JA 2GCEA 4RK0A 5EXTA 1XVUA 4AFNA 2FOXA 3TBFA 3K0KA 5C32A 4LN1A 1QAMA 1Z33A 4P22A 3OMXA 3EQ7A 2ZVJA 1K0UA 1JH9A 1N1EA 3HZZA 4Y2VA 1T8TA 1XD2A 3GNTA 3KELA 4ZAZA 4B47A 3DONA 1P18A 2FVXA 1RRFA 2O0KA 1FQJA 3CN9A 2FPIA 3N0TA 3CVOA 1MW8X 1FNSA 1N5JA 1Q6YA 4FN5A 2FKAA 4AP5A 3PC2A 4MPJA 1YMVA 1JIJA 2X4LA 2Y92A 2Z6VA 1GG5A 1PSZA 1O96A 2AOUA 4FINA 1C9MA 4U7FA 4L7QA 5DYNA 3MBIA 3SEZA 2EEZA 1XDUA 4H3HB 4LYDA 3TQFA 1LPAB 2J7PA 2VAMA 4AQDA 1PYGA 4R3WA 3ZEAA 1NBIA 2R3SA 1GN9A 3UIEA 2GJKA 1PF7E 2ZU0C 3LU1A 4C88A 4PQEA 3H5OA 1X1DA 1Z6YA 5T64A 5HIJA 5ESWA 2QLLA 3T4XA 1CJSA 5I7UA 2CMDA 3ADOA 3HADA 4UPVA 2ZYVX 3QENA 1R9JA 5JNTA 3L79A 1Q0TA 4RF3A 4NZZA 4YBRA 3IX7A 1A98A 1OCEA 3SZRA 2CXQA 1P60A 1SRQA 2BSAA 3ACBA 1FSGA 3NC4A 4AJ1A 7ABPA 3W2GA 3Q98A 1QP8A 5JASA 9MHTA 3KAJA 3FYCA 4POOA 3HVIA 1F60A 1TUGA 1R50A 4HAWA 1CUGA 1Z3IX 1P4HA 1TJ3A 2WG0A 2CHGA 2QVBA 2Y1KA 5CIWA 4ZQHA 5LQCA 1AZLA 4GP9A 1KZ1A 3D8UA 1P7VA 4IJVA 4CU5A 3WL7A 1BA2A 1O94D 1M5TA 1WHSB 4LXIA 1BFKA 2OQVA 3C3MA 4D79A 5JYBA 2L19A 5DDIP 4UU8A 5JNWA 3C3DA 3KFXA 4M55A 4PZ0A 5J4HA 2A7QA 2QTWB 5ADWA 1SC1A 1ND6A 1I94B 3OJOA 1SR8A 4L2IA 5GGYA 4XDYA 1X87A 4P0PB 4QOHA 3I28A 5H02A 4N47A 4LYJA 2VUSA 5CT5A 4DQDA 4G1CA 2VHEA 3PFWO 5KVVA 1GTSA 3WJ2A 5IN5A 5C80A 2K7FA 4DA6A 4NY1A 1ZYUA 1UIRA 2F00A 3KPJA 3Q3VA 4MHSA 1TM5E 4GLOA 4Z7QB 1UPAA 3OD5A 4PQRA 4IXDA 3J80A 2QLNA 5B5SA 1NKVA 4J1SA 3F7OA 1FFGA 3QNMA 4MMXB 4NIMA 3VO1A 4HNSA 2BHNA 2X14A 3AH8A 1YA6A 3GCGA 4MVJA 4GUDA 2YJNA 3OJLA 4G56A 2DBZA 2QYOA 1JLHA 1NVBA 4E4YA 3B7GA 3PE6A 4MA5A 5JMWA 3JAWA 1YBFA 3HL0A 3QVJA 2VS1A 3GLGA 2B8NA 4DLBA 2XKJE 4G8JA 2CDNA 3O1IC 4MSUA 1TX4B 2GPNA 4F5ZA 2QTAA 4M7OA 3GJXC 3TMAA 3VR5D 3FPLA 5JJ5A 1EK5A 3DYVA 5J5VA 1YH3A 4TWIA 1O5TA 3SWWA 4MVJI 2QUBA 5EL0A 1QYVA 1RWXA 1T3LA 4TS3A 1AA6A 1T4DA 2E37A 2XQKA 3M5DA 4P9NA 2WM2A 2J0EA 3LZ6A 4QQFA 4E2WA 2MIIA 3LYUA 4JJ4A 2OYRA 16PKA 1QQ5A 2PWPA 5HIIA 2UZ3A 5ALSA 4LWZA 3PQ8A 3OHSX 4KJZA 5AKIA 1FP2A 1KY2A 2L82A 4ZN6A 1XKXA 4H1VA 5A7HA 4C5BA 4DNQA 3CBGA 4DRZA 3SX2A 4BJ6A 4HHEA 2IELA 2EJCA 4I50F 4K6KA 3FWZA 1XNRB 1RM3A 1H5QA 1X92A 2SHKA 3HP4A 1QCZA 3QVGB 5EUMA 4GZMA 1E2HA 1PTKA 4BNDA 2JFOA 2QJOA 2XE6A 1DDOA 3R9IA 3LHFA 1N0UA 3CNOA 4C20A 4UVGA 3NIWA 3AJ8A 4CCYA 3MUNA 3CX7A 4CKYA 4UU1A 3NGXA 4F12A 3KQMA 2C2OA 2JAPA 3EC2A 3G0DA 3P0FA 3PCXA 2YVQA 5FL7A 4XB6B 5A05A 2JGAA 3GY0A 3OPNA 4EJMA 3V2HA 1EG2A 4FFSA 1CT9A 3O1JC 2XNKA 3HFSA 4LMPA 1A71A 1T8WA 3EQ2A 4QSHA 3BXXA 3C15C 1U04A 1Y1KE 1V7ZA 1KJWA 4GKKB 4GE0A 3NKFA 3UHJA 4CG3A 2IS2A 2BI7A 3LFTA 4HGNA 5K0SA 3HGQA 3MTEA 3R3HA 1KK0A 3Q7EA 2RI6A 2QZ4A 3PUWA 2CD7A 3A36A 2P1DA 1QIHA 3QMWA 3R1IA 4I6JA 2XWJI 4O29A 2FRVA 2X6RA 3AP3A 1SBNE 3AVYA 2A9QA 1BGVA 2V5VA 2Q7OE 2GSDA 5HUQA 1XPRA 5IUJC 2V6JA 2VQDA 5F1PA 4DYHA 2VUIB 5I7OA 3NATA 2N0SA 3PHIA 3PXUA 2NUPA 3S1AB 2ZJ7A 2DFKB 4S1PA 2B92A 1ULHA 1FUYB 1FA9A 1WBJB 3NBFA 4IJMA 4JOBA 5F51A 3ZPXA 2CFOA 4H15A 1L3CA 2B69A 4RVDA 4EMTA 2EW1A 2PZLA 3HYNA 2JH8A 4DLZA 4JR1A 2GEUA 4WXRA 5JO0A 1Z5ZA 2R44A 4CNBA 3E35A 2FZVA 1IATA 4IFIA 4DWWA 1S3FA 1FW8A 2CVOA 1IQ0A 2ZVDA 4OBXA 4RORA 4EWLA 5EHZA 2RHCA 3PQ4A 3WXBA 2EP5A 1DEXA 3CZMA 3MSCA 4Q48A 3VQTA 1EHCA 4HB3A 3ZWQA 4JSTA 3HL4A 1G5TA 1F2UB 1HPLA 4I8XA 4M21A 3OZIA 5HKOA 3D7MA 1H85A 1CJBA 4P33A 2X22A 1Y5RA 2IV7A 2O8FA 4Q0MA 4RJIA 3AKZA 1ZJJA 4N7MA 3KJHA 3LCRA 5BN5B 1KZ6A 3UC9A 5HX7A 1KQFA 3IQFA 3CA8A 1T4CB 4LJLA 3H04A 4X1OA 3GNQA 3U9SA 3QQPA 2PS0A 4JQSA 4XAQA 4AB1A 5B1DA 3BCHA 5KJ6A 3B6EA 3RWMB 5CR9A 2EGHA 1Y5LA 4YCSA 3R4CA 1RWOA 2F3PA 1KI7A 2GWHA 1L8OA 3AU8A 3GT0A 1J0CA 1PJ8A 1T36A 1U7PA 2FDXA 3DS8A 3GFSA 4HUJA 5TR9A 5AVOA 3VOAA 2XGGA 4MW5A 3QBTA 3TLKA 1ZA2A 3DNPA 5JD6A 3NEPX 3UMRA 1OYOA 3H19A 1UBMS 5EESA 3I23A 4AO6A 4DA8A 4P7FA 1N77A 3AUKA 1KYWA 2CJWB 4GOOD 1KDVA 1DKLA 3NHKA 1MZPA 5KSYA 1L0BA 2C98A 2LTAA 4KMOA 4Q4JA 4BMDA 4E5KA 1PL6A 3NM5A 3KVYA 4IXWA 3IMEA 2D3TA 4PRYA 4L8YA 4DNPA 4E22A 4EMSA 2ZIGA 4EPWA 1EDZA 1UK8A 1X70A 3PL5A 3OPMA 4O4JB 1HZJA 2QIOA 2HPHA 3K0CA 1JQKA 5C1IA 5JANA 4HH4A 2PIDA 2VH5R 3HVKA 4ZOEA 3FHOA 5AVKA 4XDHA 1QOQB 4PVCA 1KOFA 4MNTA 4ZI7A 1VLJA 4JP8A 5E6UA 3MK31 3KQLA 2IL1A 1SPBS 1X1CA 4KGZA 1IXKA 5LQAA 2QQEA 3G2KA 3GJ4A 1JLSA 1KAQA 1Y98A 2QDKA 2BFBB 1AKMA 4CTKA 4I5EA 1G21E 2FEPA 2QN6A 2WYOA 5LKRA 1NA5A 1NFRA 1XRNA 2XMBA 1K75A 3DAPA 4N0EA 3BTOA 1J39A 3CO0S 4YMSA 5F1OA 1XLTC 2R4UA 3RUCA 4R40A 3SBOA 2GETA 5I4BA 1JIXA 4Y2PA 2CUZA 2OVBA 3TR6A 3U40A 3URMA 2UAGA 1GTL1 3AJEA 1B00A 2XH8A 4TUYF 4KP7A 3JTEA 2PMDA 4PTZA 4OHFA 3VDNB 4AZWA 2I6XA 4BO7A 1V6CA 5LDHA 2G80A 4U7PB 2J6CA 2A0YA 4ILEA 2XXAB 1H2YA 2A7XA 2DT8A 3GJ8A 2VAWA 2X5JO 4RZ3A 5FPTA 5DNCA 1GA1A 1JFVA 4K3UA 3OF5A 2F3SA 2ZU6A 4HZGA 3RU2A 3AEXA 2X2EA 3OQ6A 1EX9A 4MGYR 4B6GA 2N3ZA 5EQFA 1SCNE 4B2IA 2GUWA 1X14A 3UF0A 5KU1A 3QWBA 4F1JA 2VH2A 1O6ZA 4ZO8A 5KSOA 1CJUC 3VC1A 4QIHA 2IYSA 1M2NA 2ZKLA 3HMQA 3QKTA 3OKPA 4YNBA 4M8SA 2EW2A 4JENA 1G5QA 1F7UA 1E3TA 4FDLA 3NFYA 2O19A 4UNIA 4F45A 2CVHA 4CLEA 1HLFA 2O2XA 4MUIA 4WESA 3RVRA 2XWBF 3WMXA 4IICA 1ETUA 3IMKA 4RVFA 1LBHA 3RNOA 3ET5A 1UK9A 4N8DA 4RZXA 5EVJA 3TG2A 4R9VA 4I46A 2PQ2A 1R64A 3DUFA 3E3NA 5JYEA 1XZMA 1EE1A 1NBOA 3CRRA 4PM4A 1PGNA 2YASA 4OXNA 4NYMQ 2PJUA 2QD4A 1DPGA 1JJAA 1TIPA 1X7WB 2WHYA 3G2MA 3BX1A 3GQBB 3SSNA 5CDYA 3EIXA 3E18A 1JFFA 3OZRA 4E5SA 2Z9BA 4BKUA 3WIOA 2YQZA 4OJMX 5EJEA 4DCOA 5AW6A 5AKEA 1E3IA 4PZYA 5KNBA 2VO1A 1U0OC 3JATB 4GOMD 2ENWA 3AR6A 4JL6A 4X92A 4GVPA 3HDYA 3CE6A 3HKCA 1YQEA 2QGNA 5EMMA 4KXYA 3DZKA 3GJ6A 4AYWA 3JWIA 2H6EA 1P2UA 1QUFA 2VJMB 3DD1A 4FX2A 4XGQA 3U49A 5GJWC 4BVBA 4CMIA 1V26A 1KEVA 2O1XA 2UZ1A 4WLOA 3W1EA 3P9RA 4AD8A 1U2GC 3T3PB 5HDQA 1Q44A 2MMCA 3L1UA 3JVDA 2NADA 3KXIA 1NE2A 3NP7A 4TL9A 3E2MA 2WKSA 3MOGA 4UHKA 1SUAA 2QGZA 4V1CI 4DLUA 2C3YA 1FIUA 3ZQKA 2HMSA 5FNVA 1SA0B 4TLDA 3RKRA 1Y5NA 2IXTA 2P2SA 1QO0D 5AVXA 5EP3A 2SCUB 1KJ9A 1MDBA 2OECA 2XNHA 3BWVA 1WW2A 1ZCZA 4NYJR 3NHWA 2P2YA 5A5GA 2W6IA 1MO5A 2P67A 1KNQA 5GP1A 4UXJA 4U7HA 4HY3A 8MHTA 3UH0A 3FWYA 3NJ4A 1KAOA 1FUIA 1CIPA 1P4JA 3R0XA 4HH1A 4L9AA 4FFOA 2GPJA 4D9NA 3PK0A 4RD1A 4F93B 1QB8A 3BFPA 1Y1LA 4I08A 4IFEA 5ALFA 4DCNA 2BFFA 1U81A 1FZQA 2ZUDA 4ZQFA 4FDUA 3KKKA 5SY4A 1IUOA 3S0JA 2WJHA 3C3JA 3T34A 4AJPA 2YXNA 1TT5B 3EODA 4BVGA 4NDAA 4DJDC 4OO3A 4NEGA 2H7XA 1B26A 1TIBA 1TOAA 1ICEA 1QKIA 1UANA 1YHYA 2CMGA 1E3EA 2CFSA 5D6NA 3IUMA 4UU0A 3K6SA 5JPCA 4D7AA 1KYVA 4XD7D 5KKAA 4PG5A 2QK4A 3IVMA 3OT1A 1JI3A 2VP3A 4A0HA 2OHXA 4ZZIA 4C29A 5LXTA 5DX8A 4MR8B 4DIFA 3RUEA 1ONOA 3NRJA 4JL5A 4XR4A 3LHDA 3Q0EA 3OUZA 1N2HA 4DV7B 1WVGA 2HQSA 1ISMA 1P1BA 2G4LA 4L95C 5FUVA 4HDNB 5ICFA 3ZDRA 1VJTA 4U3JA 4Z6KA 4MVWA 5DCUA 4RPHA 5EXDA 3VKWA 4HCJA 5IJ0A 5HRUA 2A9OA 2RONA 3L01A 3R77A 4FMPA 2PA0A 1A69A 1SG9A 4P38A 4ZT6A 2GYUA 2YV4A 3GD7A 1WSDA 3WWPA 4QULA 4R9RA 4U0JA 3ZE1B 1XZ8A 1W4ZA 5HYVA 3H3JA 2PGDA 5E9JA 1FLAA 2XF2A 4ZRDA 2BGGA 3TRDA 2NP7A 4J0GA 1AD2A 2R1TB 4FSDA 3VR5H 1G2QA 2Y1FA 5CGZA 3VPXA 1AHPA 4U6SA 5KQRA 3CMCO 1YR2A 4B9AA 4C4PA 1YRLA 3EVTA 2FMUA 1D7OA 4N0MA 4OCZA 4BPRA 2ORYA 4GT1A 1T0JB 2J30A 4MZXA 3PLRA 1E5VA 3QIAA 3X1WA 2XNCA 1GGFA 4G41A 3IRUA 2FPWA 1MH1A 4JITA 5H81A 4EKGA 3ZVLA 2JKVA 4BQRA 4J03A 1KSGA 2GOYA 2O8NA 3UKOA 2ZVPX 1LU9A 2XF8A 5EPUA 3KOMA 3TK1A 4Y6SA 5TS2A 5C4MA 1HNWB 1UP4A 3AG5A 1Q7TA 3AIIA 1NQXA 4HC4A 1EFDN 3DAHA 3DXXA 1YU9A 2C9MA 4Z49A 4PYKA 5KQGA 1A27A 2EFDB 1YOVA 2IPLA 2R65A 1EHIA 1J8DA 2G04A 1FL9A 2V6BA 1AOXA 4O6VA 3ONDA 4N0DA 3GVCA 4HFNA 2BMVA 4R98A 3B1KA 5TPZD 2Z95A 4KIUA 1U4NA 1XX6A 5EHNA 3V1LA 1HDIA 4DCMA 6ADHA 3CXUA 1QM5A 2D1FA 2VP5A 2AR9A 3FKSA 1BOOA 5CYOA 5BV1A 4MS1A 1OLXA 4AURA 4J76A 5FV7A 2JDIA 1CJKC 4CZ2A 2PMKA 3IS3A 2E49A 1NOIA 1G2PA 2GN2A 5CEEA 1IONA 3AM5A 4F72A 1ZJ5A 4O1HA 4XCVA 3WV4A 4D9EA 3EIWA 4XARA 5IT5A 3N2KB 4XYBA 5EHXA 2QR2A 1RQRA 4G0QA 2A86A 1GTMA 2H4XA 5EIHA 3M6UA 5K51A 4BHTA 2QAGC 4U2EA 1T43A 1BQ4A 3D0KA 5FWYA 2PSEA 1J7JA 4X8HA 1G6Q1 2DFLA 2I1WA 3NOXA 1VRCA 1ST2A 2YS6A 2QI9C 1OIWA 4JC4A 4QJBA 1UZNA 3SBEA 1Z07A 5DYIA 1QIEA 2D0IA 1DPFA 3TGLA 3T7TA 1A9TA 3AERB 1SY7A 1NWCA 4M8LA 5SYMA 1JU4A 4UU7A 5AVVA 4B2LA 2BPOA 3G1WA 3TLBA 3CLKA 3JVVA 5K6AC 3EXHB 3VR4D 2YRFA 2I91A 3TTSA 4FGZA 4EHFA 4E5UA 2Z6AA 1ZQ1A 1J9GA 1W0JD 3PFGA 2IHBA 4MAMA 3G88A 4G37A 1XTBA 5DCYA 4EJFA 4LHEA 4UC0A 1AQIA 1XDWA 2I3AA 4AX4A 3RRZA 2XRZA 2JZCA 1T0UA 3QELA 5BSUA 1L5VA 1RPTA 2I29A 2BKEA 3RJMA 1ZZGA 4DC0A 1C3OA 2FFHA 3DA8A 1ZOSA 3SFTA 3BIFA 3MN1A 3WZ2A 4LV6A 1RKUA 1X77A 3KQYA 5ICSA 3OQHA 4QARA 4CDNA 1EXMA 3EDOA 1GGKA 4LYFA 2Z4RA 3G68A 1PS8A 3A6FA 1WUTA 3KBBA 2NV2B 2B9VA 4QX6A 5TLSA 3QGMA 4CDRA 3NASA 1MENA 3U4HA 4B71A 2RHHA 3AOEA 3K0EA 2NAPA 2FETA 4QFCA 5H3CA 3V55A 1KFEB 4RXUA 3QMPA 1M33A 2YHAA 5F76A 3DD5A 1W5TA 1JAIA 1XE3A 2BRUC 5FO0A 1OH7A 5K2OA 4DDMA 1DC3A 4WJKB 4DLSA 5H9WA 2HCBA 4RQAA 5FQOA 3P2EA 2YC2C 3DCJA 3GUYA 4JOCA 5L3QA 1I2CA 3KWJA 4LVNA 5DM60 3BMCA 3F67A 2NU8B 3UH1A 3ABSB 3C74A 1KQ3A 3PNBA 3C6QA 4NV3A 1W2GA 4TSFD 1L1QA 1GDDA 3WGIA 1I3LA 3GUCA 4MRSA 3JS5A 1V45E 2LR0A 2ZJYA 1VCOA 5CAEA 3W5BA 1C1DB 2QTZA 1FTSA 4Q9DA 3KJGA 4TTAA 4FKMA 5B6JA 5HKKA 3GVIA 3LX6A 3F4BA 3ONNA 2IWRA 2RGXA 1ZS9A 2HUNA 2O8VA 3IJRA 4LI0A 4B74A 4BMOB 5ISMA 1NFQA 5ELXA 2WVJA 2ROQA 1G19A 3L46A 1I5OA 4CI0B 1YE5A 1DBRA 4KACA 3Q7QA 3COZA 5I47A 3BJZA 1LJLA 3CXRA 2WNSA 4AMUA 3ZYZA 4ECAA 1LVGA 2REQB 2YN2A 5HRAA 3IEVA 5DBEX 1Z7EA 5C1PA 2IIPA 3INRA 3VJMA 1QQ7A 2I8AA 1II8A 2GO7A 1JKJB 2X8JA 2YV1A 2BHLA 2V9PA 3QG1A 4WCFB 5E4JA 3R76A 4TS4A 5AM1A 5TMDA 1X7HA 2GEKA 3R3XA 2AF4C 4AUKA 4MICA 2HADA 1UQTA 3QYFA 4G8DA 4EL0A 1F8GA 3HBAA 1ILEA 1W48A 2PUGA 4NOJA 4ZVKA 2C2XA 2EDAA 4H3KB 4ZDKA 3OM1A 1M9NA 3OH8A 3WJAA 3GZNA 2WMDA 3COPA 5DRYA 5DX0A 4TWZA 3EXG2 2OBMA 5ITVA 7YASA 10MHA 3BUSA 2JD0A 3AETA 2FMXA 4PINA 4PG7A 3ZOZA 2EX1A 2WJYA 2KQUA 5GM2A 2VQFB 3I6IA 2XBLA 1E1RA 2PD4A 1P75A 3C7TA 1R4NA 2PH1A 2VWQA 5F2NA 3ZJ4A 3WQBA 4UHBA 3LUPA 2ERXA 3BA1A 3QHQA 1G59A 2G63A 4XVHA 3LY5A 5HMLA 2JGDB 2WAXA 1DBWA 3AEUA 1JX6A 2IK8A 3ECSA 3PE4A 3ROMA 3T3GA 3ZY5A 4MXDA 1NAIA 4LTDA 4DQVA 2YWXA 3LPCA 4UARA 3TX2A 4WZBA 4B8ZA 1U3TA 3R7DA 4YFYA 5BUZA 4FB5A 3A1WA 4Q7QA 2VNHA 1EK0A 1N6IA 2R1UA 1F4VA 2OO3A 3IKLA 3OQIA 2ZATA 1Y1QA 3WLFA 4LJRA 1H9AA 1XZGA 2QAJA 3IUBA 4ZOQI 2O06A 2DECA 4CV0A 2D7CA 5DZSA 2GVZC 4R8KA 1JPNA 1BCSA 1CFJA 2IXAA 3L06A 1MQ8B 4NU8X 4QGGA 5SZKB 4QTYA 4CEHB 2PGJA 4JUDX 4GKJB 4JXJA 4RW0A 4RZUA 3RVNA 5KYGA 2RHRA 1HFJA 2E3JA 4M54A 1KBQA 3WIUA 1TVMA 1EDBA 3K8QA 2BIFA 4FYIA 3U56A 1NXQA 5B1EA 3AXTA 1SQFA 1M66A 1MJFA 3HB1A 4GMDA 4PPYA 4C78A 5FWDA 3STXA 2G7ZA 2F43B 4H60A 4HWKA 2Y71A 1B8OA 5CVDA 5ENVA 1Z29A 4M8NE 1ZLYA 4TPKA 1G4HA 4MQMA 1E4EB 2XUIA 3OZUA 1YK1A 4CQMA 3TR0A 2XJ4A 3F8SA 2QVLA 4K8OA 3ZOKA 4DCGA 1THTA 1L2TA 4ACAA 1JDBB 1Z3CA 1RRKA 4HSGA 1RQ7A 2Q8QA 5IABA 2PNFA 3OOEA 1VJGA 1KKLA 2ZQYA 1Q1GA 2EZ8A 4QG7A 2ZTHA 3JY6A 2ZIUB 4IPTA 2HRDA 4GYKA 5I8ZA 1K2VN 1NW3A 3H5NA 3T5CA 3OTOB 3TECE 3IOEA 3L4KA 3FWNA 3RSGA 2NTNA 1N2CA 3M4YA 4G89A 4XFKA 1O1YA 1U80A 2PX3A 2X76A 3PRHA 5LIRA 1PR4A 4CIDA 1YFZA 1PWYE 1A4XA 3CUKA 3WGZA 3NDJA 4RHEA 1B1AA 2PBLA 4DB2A 3M4JA 2NTYC 4D6PA 5J43A 5JOQA 3VVMA 4AP9A 1KC1A 3HQ4O 5GJBA 4RZ2A 1A8SA 2DHQA 3OZCA 4DHWA 4MP3A 1HTTA 2MYTA 3PP8A 5JD3A 4C6RA 3WYDA 3ABQB 4PO8A 2QW8A 2F1JA 3AJ9A 5CTJA 3GRCA 4HS4A 5EKTA 5G0TA 1UCFA 1YDWA 4JI2B 3AUJB 4XIGS 1UT5A 2ZULA 2W2NA 3DT8A 4LV8B 4TKLA 3L7CA 3EISA 2YBDA 4DRXB 3T9DA 4UAVA 5E7QA 1NONA 4I2VA 2AOWA 5JJIA 1QP4A 1MC8A 1NDUA 2ANBA 1QCCA 5BNWA 3VH4A 4U4AA 2AN1A 4NYIQ 3UMBA 5GOTA 1YDGA 3WGUA 4Z7NB 1BXZA 1PZNA 4O08A 3TW8B 1X19A 2PH3A 4GNKA 5LOVB 4GMHA 1E6WA 4UHDA 3G0CA 2G9RA 3OKFA 5DH9A 4H1HA 1JE0A 5JATA 2XT0A 4BE4A 1BJRE 2C9OA 3NBAA 1K08A 2ID4A 2YDYA 4LZLA 4JNCA 4YJGA 3NDIA 2ZWIA 1YGYA 1U65A 1EFUA 1UKYA 1V11A 4FYVA 2GFQA 2VWHA 1K4YA 2Y1EA 4KPUA 4QD3A 3NHPA 3N8HA 3UWSA 1J33A 1ECBA 2ONCA 4TV9B 3A6JA 1SCAA 4L4ZA 2FP4B 2X6QA 5MN4A 4NCAA 2GHRA 4XJTA 3MVEA 4L1KA 1JVSA 4WH0A 4WECA 1YL5A 1OTXA 4FHDA 3BHJA 3K4HA 1MHTA 1RACA 1RWQA 4AS3A 1QX4A 2NZWA 3IUQA 1VE1A 2YHSA 4BQPA 1G5IA 1RHQA 3GBPA 4R9SA 3ROQA 3AW8A 1ZCBA 1U3FA 2PBZA 3EB9A 4UBKA 4B7CA 4ZWNA 1F3LA 1SBCA 1IN8A 3NIFB 4OJTA 5LB2A 2Q5LA 4MWZA 5FPKA 1MXFA 1T1JA 3C85A 4JQOA 4RDIA 4JXXA 3W7BA 3H7IA 1S9HA 3WQHA 1AMOA 2TMKA 4BFCA 1N25A 2OQRA 1ZG3A 1QGAA 3UUWA 1HR0B 3AHJA 3FFTA 2GKOA 3CLTC 3ONEA 4KMSA 5L9AA 4HN9A 1UPXA 1R0CA 5GIPE 1CE8B 3KYCA 1TZCA 2B30A 4HUTA 3OLCX 1RAHA 4HLUA 5C18A 4LVUA 1G7RA 2V3CC 2I55A 1R27A 2OWDA 4BAZA 1B41A 2FRXA 2Y0BA 1D04A 1T8YA 3N28A 3PUKA 3O9VA 3DE0X 4CTNA 3WKCA 4AF7A 1WPRA 4AJJA 1XL1A 1L7QA 2Q1SA 3TQHA 3OE1A 3AWIA 2WUWE 2CLSA 4G65A 4JLPA 3N58A 3UHFA 5UKDA 1YL6A 2ONKA 3H1EA 1X2EA 5TV2A 3ZD9A 3ND9A 3FVWA 3LC7O 2RD2A 1LWOA 5DHFA 2G67A 3OM9A 2OD9A 3KKOA 3OZDA 2CDCA 3STYA 5JDIA 4RV9A 5EPEA 3D5TA 1BQ3A 2ZRGA 4XIJA 5G40A 1MA3A 3R7WB 5E2BA 3WFJA 4P35A 1KE1A 2I62A 4BFUA 4ZC8A 2I8CA 3B9PA 4R9NA 1WHTB 3GCXA 2HIMA 3UOGA 4XVCA 1KQOA 3EDCA 1D6SA 4QOEA 3OOHA 4R8RA 3SNHA 1C9JA 2H1WA 5HZHA 1E0KA 1JHVA 5BWOA 5BYKA 3AJAA 3PRKE 2OHOA 3SOPA 2BZSA 4BVEA 5KCMA 3BHIA 1DUIA 4F84A 4ZC1A 3R5TA 1MOPA 3S2UA 3W77A 4IVRA 2G9NA 1ISFA 4K9QA 1GZSA 4ESHA 3EMVA 1UXKA 1V6SA 2AFIE 3FPBA 3I4FA 2BN4A 2JBHA 1TTPB 3C3BA 3I6BA 3RYHB 9GPBA 1ID8A 1X3LA 5PNTA 5TMPA 3UYKA 2C2WA 3D3JA 3LCVB 1G8GA 2W22A 2GBIA 4EZBA 2QY9A 3IUSA 2XE4A 3H5VA 2ZSUA 1AQ6A 2BZ0A 4ADSG 4R2MA 4DSAA 3I9KA