5TQVA

Crystal structure of nadp-dependent carbonyl reductase from burkholderia multivorans
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
225
structure length
225
Chain Sequence
MKTVLIVGASRGLGREFVRQYQRDGWNVIATARDDASLAALRALGAHAHALDITQPEQIAALGWKLDGERLDVAVVVSGVYGPRTEGVETIASDDFDTVMHTNVRGPMQLLPILLPLVEDARGVLAVVSSRMGSISEATGTTGWLYRASKAALNDVLRIASLQTRHAACISLHPGWVRTDMGGAQAALDPATSVTGMRRVIAEAGADVSQSNGRFFQYDGVELSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NADP-dependent carbonyl reductase from Burkholderia multivorans
rcsb
source organism Burkholderia multivorans (strain atcc 17616 / 249)
molecule tags Oxidoreductase
molecule keywords NADPH-dependent carbonyl reductase
total genus 87
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2016-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tqvA00
5COBA 3AM3A 3QHAA 5A4DA 3QWHA 2PTGA 4L73A 4CMHA 2P9CA 2XXBA 3EVNA 1GUZA 3TQHA 3WMWA 3ZHBA 1K0UA 1I0ZA 3ZW8A 3GNSA 5L51A 2X9NA 3CIFA 1XU7A 3HN2A 1WMAA 2YFHA 4E12A 4A7PA 3HG7A 1G1AA 3PFFA 4CR6A 4FFNA 5EMHA 4G2NA 3K9QO 3DAPA 2W98A 1WDKA 1AXGA 3ANMA 1K89A 3V8BA 4DLLA 1QYDA 3U49A 3GMDA 3BHIA 3DFZA 3OF2A 3WQQA 5HTOA 3LC2O 4Q3DA 3CEAA 3NX4A 2JD1A 2B37A 4MVJH 4BO8A 4NBWA 5FI5A 3WGGA 4RORA 4UVGA 3ULKA 3DBHB 3IOYA 3WNVA 2Y0EA 2GZ2A 2AQ8A 4TRMA 5LDHA 3BYZA 4HFMA 1MUUA 4YT8A 3JQ8A 4OQYA 1YH3A 4XZ3A 3DOOA 3RSHA 2H5LA 2Q45A 2YFQA 1IPFA 3ICPA 2PD6A 4YVFA 2OBYA 3WXBA 3VTFA 5CG2A 4U6SA 1QV6A 4HNGA 3AI2A 1HSOA 2J5RA 1R66A 3DBLB 3H5AA 3V1TC 3TSCA 3M6IA 3VHRA 2VOEA 3OECA 3DZFA 1NP3A 2NLOA 3ZV5A 3IKTA 4PZDA 1NFQA 4E32A 4DPMA 1H6AA 3GH3A 2OHXA 4WCDA 4J2HA 1PWXA 1Q7GA 3WTCA 1MC5A 3GHHA 1VL6A 2WYWA 3JQ6A 3CH6A 2VHWA 3LDHA 4E4YA 3S2GA 1UP7A 1ZNQO 3BHMA 3LYLA 2O4CA 3RJ9A 1VRWA 4DVJA 4O1MA 3GK3A 4ZD6A 1AHHA 4D0SA 2YYYA 3ADPA 2IEDA 3UXYA 2WD7A 3PFWO 3AOEA 3QY9A 5BR7A 3CINA 1YVEI 3NGXA 3D3WB 3GZNA 1E3JA 2EJVA 4Q9NA 1R4MA 2V6BA 1YXMA 3JQCA 3E9NA 4MVJD 4W7HA 1DAPA 3K92A 1LQTA 5A9SB 4D0RA 3PJGA 3SLKA 4FJ2A 1GUYA 3LSYA 1LA2A 3ASVA 5F1PA 4A26A 3E8XA 1B0AA 1P3DA 1P0FA 4BMNA 1DDOA 3FI9A 1GR0A 3OJEA 2QW8A 3OQBA 1L1FA 1HDXA 3ITDA 4IS3A 2BGLA 4CMGA 3PDUA 4CQMD 4BNFA 3KYBA 2B5WA 1SMKA 5BNFA 4CMEC 4NFYA 4IGEA 3RBVA 3HJAA 3RASA 4C7KA 4YEDA 2VWQA 2D4AA 1DJNA 2NVUA 2Z1MA 3ENNA 5TT0A 4AJLA 4Y6RA 4W9NC 1QV7A 2XPCA 2EEZA 1C14A 5G0VA 2V6FA 4L8VA 3LT0A 3AFMA 5KJEA 4UAGA 2RH8A 3EMKA 3VPHA 1E1NA 4ND2A 5L4LA 4GH5A 2Y1CA 4PVDA 2Q4BA 1OC4A 2IEBA 4GI2A 5JDIA 1T4BA 1Y7TA 5DCYA 2GN6A 1RYEA 2IDZA 4IPTA 5C5IA 1BHSA 2CD9A 4ID9A 4P8RA 4WOJA 4HUJA 2BKAA 4PGFA 1GTMA 4C4OA 2OBNA 1GEGA 4U0JA 2Y68A 4MIOA 3WTBA 4O59O 1FJHA 4GAEA 3W6UA 1FDSA 3OJFA 4ZHSA 2RH4A 2OXIA 3GDFA 2DM6A 3L6DA 3RIHA 3HFSA 2DPGA 3AY7A 3PP8A 1RPNA 1I5RA 1Y1PA 3QWBA 3GC6A 3B20A 3JSAA 3KSDO 1OZAA 1P1RA 4WPGA 3Q1LA 3DZIA 1F0YA 2GASA 4XDYA 3NTOA 2OUIA 3UVEA 4WLVA 3DHYA 1HWYA 4IDGA 3UCXA 5F5LA 1YONA 1W73A 5B37A 2VWGA 2CF5A 2O3QA 4FSHA 2R00C 3K96A 3QVOA 1PJ2A 3VZQA 1E6WA 3DOJA 2FRDA 4LCEA 1HYHA 4BNJA 1EVIA 1M6WA 3UICA 3KETA 2X0NA 1NWCA 3WBFA 1E3LA 1XSEA 4H7PA 4OMUA 1IPEA 4Z0TA 1KIFA 1ID1A 3BMQB 1RM4A 4K26A 1JKFA 4Z3KA 4FOSA 2AQIA 3O03A 4DYDA 4R5HA 1IY8A 4P38A 1ISJA 3H7AA 1B8PA 1I01A 2YZ7A 4YA6A 1PIWA 3SJ7A 1P1IA 1R4NB 4EZBA 5TS3A 3JD3A 4RPKA 1FDVA 1VL8A 4G81A 1GEEA 4YDRA 1N8KA 2D2IA 1BXKA 1MC4A 1R6DA 1V35A 3X2FA 4J3FA 4CLEA 3RD5A 5KJ1A 3ZH2A 4EDFA 1I32A 1PJTA 2NUAA 3HB5X 2CY0A 4CQLB 3ZV6A 1WMBA 2D5AA 1YJ8A 3BTSA 3ZW9A 2O3RA 3BHJA 3QVTA 3GN2A 5JAZA 1I3NA 3C1OA 4OL9A 3OQ6A 1YQXA 2C54A 3RUDA 2Y1DA 3GPDG 1H94A 4L76A 4DXHA 1P44A 1R15A 4MP6A 3NT5A 1MFPA 2JD0A 2UV8A 3SC6A 3Q0EA 4BQRA 2HMTA 2W2KB 3FSRA 4BS9A 4Z6KA 2AMFA 2ZYGA 5JY1A 3A06A 1KERA 3PLNA 1HZJA 5LC1A 3NDJA 4TVBA 1A4UA 1T1RA 1UXGA 1PGJA 4M1QA 3PWSA 4CL3A 3CPSA 4LW8A 4OKIA 5K0ZA 4L74A 4XD2A 1DIAA 4J4TA 1HXHA 4W82A 1GFSA 2XOXA 3IC5A 1X15A 4UEKA 2FR0A 3SJUA 4CLDA 2WYUA 3HWRA 3QP9A 2HMSA 1NYTA 1ZCJA 2OMEA 1GZ4A 3FTPA 4YWJA 1X1TA 3VKVA 1EK6A 4R9SA 4E5YA 4RDHA 1GZ3A 1QYVA 1DHTA 4ZVVA 3R0IA 2EKLA 2WSBA 3NEPX 4JBIA 2VWPA 5HM8A 1BXGA 3NAQA 5KIAA 1DFGA 3H5NA 1UXKA 1JAXA 4IDFA 2AE1A 1WW8A 1VE9A 4BV9A 2PGLA 3E1KA 2BI8A 2W4QA 3KO8A 3PTZA 3PYXA 5AXDA 3ZZNA 1XCBA 4OSOA 4KUHA 3RFTA 1IE3A 4M55A 3I9NA 2NU7A 5L3ZA 3E18A 3IP3A 4DYVA 2GDZA 4HADA 4RF2A 2D8AA 3RUEA 4XGKA 2I76A 2VZ9A 4WNCA 4GX2A 3AU9A 1X7DA 1BXGB 1Z75A 3H2SA 5BNIA 1Z73A 3JQAA 4FR5A 3RC7A 1GCUA 2DTEA 3U4DA 1DRVA 1U3TA 3WYEA 1GAEO 1UH5A 1Y6JA 5JPIA 4BNUA 4H15A 2PNFA 4HP8A 4L4SA 1T25A 1FDUA 2HKIA 4RVDA 4UUPA 2DTDA 2DU8A 2VHVA 4BNIA 1Y9EA 4J16A 3WSWA 2HRBA 1TT5A 3NTQA 1O8CA 2FY8A 4BO1A 3I4FA 1I3MA 4BUCA 3A4VA 1ZK1A 3B1FA 2PA3A 1Q0QA 1JU9A 1UXHA 1ZMOA 4QTZA 1DSSG 4LSWA 3ZV4A 3B70A 4AFNA 4F6CA 4U8GA 2Y93A 2Z1NA 1JDJA 2HMVA 3I83A 3P2OA 4G65A 4F46A 1WPQA 2NU9A 1KEWA 1OMOA 1LDYA 3H9QA 1O94A 3NRCA 4RQTA 1ISGA 2YHIB 4B7XA 1U3UA 5KJFA 2C29D 3DZKA 3MOGA 5CAEA 5KKAA 2B4TO 4GLOA 1T2CA 2ZCUA 3DZJA 2Q1SA 3AWDA 4DMMA 1DC6A 4MIEA 3F4BA 3GG9A 3ICCA 4OKNA 1LRJA 4Z9XA 1A71A 2X0JA 3GFBA 2Q1WA 4BO0A 5K9ZA 2P9GA 4GMFA 2NNLD 4PRKA 1K3TA 4IJWA 5T64A 4BKPA 3OEWA 5BQFA 3U4HA 1V8BA 2I66A 4IUYA 5I7FA 4PLYA 4J0FA 1XHLA 1Q1NA 2O3TA 4OIMA 3GRPA 5JC1A 1ZSNA 1HTBA 1OOEA 2FZEA 3F5SA 4R4JA 3RC9A 4BNKA 2J8ZA 4BKUA 3IP1A 3LT2A 2JD2A 3SEFA 1E7WA 4K6CA 5A9TA 3GVXA 3WGYA 3V1YA 3KM0A 1ZSVA 3NUGA 3KHUA 2RCYA 3U4CA 3VH2A 2NM0A 5JAQA 1QXSA 5EIOA 2SCUA 3RBXA 3DO5A 1XA0A 1CQJA 1I3KA 5DCUA 3CMCO 1H9AA 2GZ1A 4IMRA 4R41A 1HYEA 3RAJA 4EJMA 5IZCA 1PJSA 3TL2A 3WQRA 6ADHA 3CZRA 1D8AA 5F1OA 3JTMA 4GGPA 3G79A 4II3A 1BG6A 1A9ZA 3D3EA 4RVHA 3GT0A 1M6HA 3C1TA 4AJ2A 4M86A 5HA5A 4CQMB 5JO0A 4AL4A 2FP4A 2H6EA 1KC3A 2JKVA 3JQBA 3OSUA 4XYMA 3JQ9A 1UZMA 4Z9YA 4CM7A 2PLAA 4FS3A 3AW9A 1T1SA 3VOSA 2D5CA 2PR2A 2I65A 4YJHB 3U0BA 5EQFA 4D7AA 4NU6A 4AICA 1QYWA 1SOVA 2Q49A 1Y8QA 3BTVA 1C1XB 4DRYA 3AUUA 2CZCA 3A9WA 4JP3A 3OA0A 2VN8A 1NX6A 4IDAA 3IIEA 2I5PO 3AM4A 4L9RA 1DFHA 3WJ7A 3TN7A 4N18A 3K2BA 1TVEA 2W2LA 1LDGA 2ZIZA 5JLAA 4B4OA 4MVJM 1DIGA 1PL6A 1B3RA 4NK5A 4Z9FA 5CEJA 4FC6A 2R6JA 3UW3A 4XRRA 4D42A 3PZRA 1ZK2A 4CM5A 4BO5A 3ZI0A 4DIFA 5T5QA 2LDXA 1VL0A 1HEUA 1MP0A 4OHUA 1W8DA 2X9VA 3DR3A 1HDZA 4PLPA 1OI7A 3W4IA 3OQ1A 5A9SA 4KOAA 4TRNA 3WBBA 2PZMA 1RKXA 3DBRA 1MB4A 3N74A 4JK3A 4YAJA 1RM0A 1PR3A 2VT3A 4UVHA 1L7EA 4CV0A 3ITKA 3OA2A 4MOWA 5DF1A 4INAA 4NBUA 2ZATA 1EE9A 3DHNA 3QIVA 5AXCA 3JD0A 1EUZA 2D59A 5TGDA 1X1EA 2P68A 1GDHA 4PZEA 3V2GA 3GAZA 3OP4A 4YAGA 4IQ8A 4NHEA 4E5PA 1DC3A 3FNHA 5KKCA 1ZK3A 3KB6A 2ZB8A 2C7GA 3ONDA 4XRGA 2XXJA 4R3NA 4BNTA 2VOJA 2P5YA 3PHJA 3G0OA 1KVUA 1KVSA 3AU8A 5CDYA 1PZEA 1YDEA 2BI7A 2VRCA 4GQAA 2OGUA 5CHEA 4CUZA 1ZKMA 1NNUA 3AY6A 1ISFA 2Y67A 3R1IA 2AG8A 4CLOA 4R16A 4NNJA 1TB4A 1I2ZA 2AW5A 4WNIA 1YBAA 3I9KA 5IFLA 1MLDA 1NFRA 3H8VA 4JNKA 1WZEA 1R4NA 3FWZA 3NYWA 3IL2A 4YQYA 3L4SO 4BMSA 1SB8A 2I67A 4R5MA 4RJTA 3LK7A 3FN4A 3S2EA 3AI3A 4XIYA 4R1TA 1YDWA 4TRRA 3WMXA 3EY4A 2CDAA 1U2GA 5EQDA 4ALNA 4XQ9A 1B3BA 1PGPA 2PV7A 4Q3EA 4XR9A 2C2YA 3G49A 5KWEA 4MINA 4NJMB 3OICA 3ZWCA 1BXZA 1E3IA 5IN4A 1GQYA 1E3SA 1LSJA 2HJRA 2JJYA 2VUUA 4GSLA 4BQPA 3FRJA 3Q11A 3DDNA 4HV4A 3DAGA 3WGTA 4RF5A 4CMKA 2NACA 4QFDA 3GDOA 1J49A 5DNAA 2O3JA 4RGBA 3CSDA 4YTEA 5L40A 2YUTA 2CFCA 3CMMA 3H6KA 3AI1A 4RCVA 3NT2A 4E2ZA 5TT1A 4PVCA 3GGGA 5TJHA 3C24A 2W90A 3KYDB 4MIYA 1XQ6A 4BO4A 1CRWG 2O7QA 2FSVA 2NQ8A 3GAFA 3KOUA 4YXFA 3GGOA 1C1XA 1LDBA 3JYPA 2NV6A 3JQ7A 3DXFA 1UDAA 3O8QA 3UH1A 1HE4A 5GMOA 3VPFA 4N7RA 1LUAA 4JBGA 2JHGA 3TWOA 3AY3A 3R3JA 3RKUA 1LSOA 2VZ0A 1GYRA 1AN9A 2C59A 1DIHA 3WGHA 4DQXA 4ZQBA 5TC4A 4JJGA 3ENKA 4UUOA 3EC7A 1FMCA 1P1JA 1NR1A 3SBOA 4BKOA 1O6ZA 3QWIA 3O8QB 4HY3A 1DPGA 4DREA 4ZJUA 2IZZA 5JNLA 3F4LA 5HWSA 4PLHA 5A3JA 1NAHA 3H9JA 3OETA 4JP2A 3WIEA 2IXBA 4PFJA 2QZZA 5B1YA 4S3MA 2Y1GA 1ZSYA 3VZPA 3WJAA 1EQUA 1LDNA 3GVPA 1T2DA 5TJ9A 3PJEA 2YQ4A 3A14A 4ALJA 4NK4A 2IODA 5TLSA 4YJGA 3Q2IA 3OJOA 4CMJA 4DQUA 1DC5A 4TQGA 4CM4A 4BGVA 5EESA 4BNVA 1ISIA 2BHLA 2HRZA 1T24A 3WR5A 1ZO8A 1EFLA 1I10A 2C7VA 2R2GA 1Y8RA 4ZRMA 1GU7A 4GMGA 4ND5A 1NQAO 4J7XA 4BVAA 3TZQA 4RVUA 1WNTA 2CSUA 2ZQYA 3OFSA 5F21A 1QSGA 1G0NA 1CJCA 3LT1A 1E5LA 3A28A 4Q3BA 3I9MA 3VDRA 2GCGA 3L6OO 1F06A 2GD1O 3PIDA 4XYEA 3K2EA 3D4OA 3DB2A 3RU9A 3GVCA 2B83A 2WDZA 4DIBA 1IZ0A 5A5EA 5JE8A 1YBMA 3U9LA 1ADGA 4OAQA 3UHAA 2VTEA 4G5HA 3JD1A 2Q46A 1GV1A 3AFNA 2FWMX 3HDJA 8ADHA 3CUKA 4DIOA 4LSMA 4CR8A 3GN1A 5A04A 1U1IA 4O63O 3DZHA 4PLCA 4YCAA 1MV8A 3U09A 5HBRA 1JLLA 3INGA 1IOLA 4YJFA 1GADO 1T2AA 2BRUA 1U8FO 3A1NA 3F6YA 3S2FA 1O0SA 1S7CA 5B12A 5KVCA 3NV9A 4WLUA 2CNBA 1CETA 2J5KA 1K5HA 1UUFA 4S1VA 3F46A 1R12A 1DJQA 3TZ6A 3BIOA 4FCCA 2PWZA 4XYBA 3H5RA 1LLUA 1ENYA 3GQVA 3I9OA 3PEFA 3KLMX 1LI4A 2B35A 4FJ0A 2QRJA 4ILKA 3GVHA 3OHSX 4D45A 4EUEA 4IZIA 3OH8A 1H5QA 4R3WA 2RHRA 2WM3A 3H9UA 4R51A 4BHTA 2DFVA 1G0OA 2QX7A 3O38A 3WYCA 2AEFA 3GRKA 3HADA 2JFGA 3GOHA 3V5NA 5DZSA 5L53A 3E03A 4BOYA 3ZNPA 5L4SA 4WJZA 1PGNA 4FQ8A 4ALIA 1M76A 2Q1UA 3FBTA 4XB2A 3AOGA 4TWRA 3FCOA 4NJOA 5JY6A 2VHXA 3I6IA 4XDZA 4R68A 3GUCA 1IULA 4J2OA 2IZ1A 3W8EA 1YQDA 3JQBC 3MJ4A 4LVUA 2TMDA 1KEVA 4WECA 4IY1A 1OAAA 4J49A 4A0SA 2EKPA 3WYBA 4XGIA 4NDNE 3JQFA 3NTRA 4R54A 4WLNA 2OL4A 1Y8RB 1NPYA 1ZZEA 1M2WA 3D1LA 1E6EA 3H3JA 3T7CA 3TPCA 3ZHYA 4BO7A 5GZ1A 5MDHA 4BNMA 4IGFA 2HMWA 4IIUA 4B3JA 5JMPA 3GR6A 2EP5A 2V6MA 4YJGB 2HJSA 1WVGA 4C7JA 5BSGA 3DONA 2UAGA 3PGJA 1YB5A 4O6VA 1Y8QB 2GLXA 1UZNA 2J3KA 4Z0PA 3H4VA 2NQTA 1N7HA 2ZTUA 1K6JA 4CMIA 3VPXA 3KV3O 1MX3A 1U7TA 4W9NA 1D1SA 4J91A 1CIVA 1JVSA 2OFPA 4FGSA 1X13A 3FPLA 3UN1A 3ROMA 3UUWA 2AQHA 5I7EA 1RM3A 4YRBA 1BMDA 4R1NA 4ZQHA 4CM9A 4RVSA 1LBEA 3OEYA 1LQUA 3RI3A 2O2SA 3I6QA 3W8DA 4JN6B 3BTUA 1P9LA 3N58A 4UEOA 5CG1A 1ZEMA 3ZWPA 3P7MA 4LVCA 3C7AA 4DBVO 5ILGA 4HXYA 3ASUA 4BO2A 4TZTA 1E92A 1U28A 1P33A 1F17A 1O89A 2Y05A 1V0JA 3RFVA 3K5PA 4MP3A 2GERA 3NT4A 3QW2A 3TOZA 3WQSB 3HSKA 3VH1A 5JDCA 1YB4A 1YJQA 3HNPA 5DOZA 4II2A 4OH1A 4BNLA 2YDYA 1XKQA 4AJIA 3P5SA 3PJDA 3FPCA 3UCEA 4A5OA 2AEMA 4I08A 4IJKA 4YT2A 5C7IO 1HZZA 4XGNA 4N5LA 4WCFB 5F1KA 1PU2A 4YJFB 1PEDA 1H9BA 1I8TA 1KOLA 2PD4A 3JQDA 4QEDA 3EK2A 1JN0A 1WZIA 1LX6A 4TRJA 3G1UA 4RF4A 4AJNA 3E82A 1PJQA 1ULSA 4E21A 4TKMA 4B4UA 3F9IA 1BW9A 1DB3A 3ETEA 2C5EA 4FFRA 3ZDFA 4IDDA 4GSKA 3TL3A 1I36A 5G4LA 4B3IA 3K31A 1CWUA 1DFIA 1U5AA 2E37A 4CM1A 2P9EA 1PJCA 4CLOB 1NM5A 1QRRA 4XCVA 2HK7A 4YR9A 1BVRA 1ULUA 5JAMA 4FC7A 2ZYAA 1B26A 1VJTA 3TDKA 1BVUA 2EJWA 1U2DA 4UEJA 3GZ4A 3DAFA 3PI7A 1E0DA 1XLTA 3PHGA 4XQGA 5AXAA 3QE3A 3JD4A 2GNAA 1EVYA 2J5QA 3OBBA 5COAA 2I99A 1RWBA 1UJMA 3GDGA 1I2CA 4ALLA 3GY0A 1U7HA 2NADA 8LDHA 3L4BC 4Y67A 4OXNA 3ZWOA 4Y6SA 3ROPA 4AVYA 4LGVA 4UREA 4H3VA 2ZB4A 3K30A 3E5MA 1HLPA 1HYGA 4J1TA 3JYQA 4QECA 2DPHA 2V65A 1SAYA 2HQ1A 1R0SA 1DOHA 1SEPA 4DC0A 2QZ9A 1Y9AA 3F5QA 2CDBA 3OIFA 5H83A 2X8LA 1K6IA 4TKLA 3DBRB 1BDMA 3IAHA 4CV3A 2H1SA 3BMOA 1SCUA 2GZ3A 2JHFA 3MTJA 3QJ5A 1VJ0A 4J6FA 5DT9A 2NTNA 1XQ1A 1YL5A 4CMIB 3E9MA 3KYDA 2YV1A 4EUHA 2E82A 3FD8A 1JTVA 1W0CA 1EZ4A 3UGKA 1GQQA 1EDZA 3PJFA 4BL5A 3O26A 1QLJA 1XU9A 4NPCA 1HDYA 1ENZA 3LU1A 1XGKA 4BNNA 4MVJF 5FYDA 2ZJ0A 4BO3A 2WYVA 4ALMA 4J9VA 2Q2WA 5J23A 3SC4A 4YPOA 4IQ0A 3DC2A 4KP7A 3M1LA 1QORA 4CM4B 2VYNA 2GGSA 3LF1A 4XJTA 5FF9A 5JFOA 3V2HA 1VLLA 1TT7A 3FWNA 4BO9A 9LDTA 4JXKA 4GPD1 1Q7BA 4YJHA 1GV0A 2Q1TA 3W6ZA 3W4JA 1QR6A 3SVTA 3BZUA 2YQ5A 4EI2A 4FOOA 2BELA 3I5MA 3VVCA 1F8FA 4EJ0A 5L45A 3WFIA 4ZQGA 2BLLA 1YL7A 3LT4A 2PKQP 1HLDA 1KVQA 5C3MA 2DAPA 4FJ1A 1ADCA 4HKTA 2IYPA 3KYCA 3QLJA 5TIIA 1ZXBA 1LNQA 4DLAA 4EW6A 4JIGA 4R9RA 3QWAA 5B4UA 1PR9A 3RQSA 2EKQA 1D1TA 5BSFA 5B4VA 5IDQA 2W2KA 2DKNA 1PGOA 1XIVA 3KRTA 1DBVO 4E3ZA 1A7KA 4NZ9A 3VAZA 3RJ5A 1VM6A 3RWBA 1W6UA 2B4RO 5EJ2A 3U62A 2O7SA 3KVOA 1LSSA 5I9LA 3WS7A 3WWYA 1KC1A 4EITA 2YHIA 4A27A 1PZHA 4QX6A 3DFUA 2AE2A 3VDQA 2ZB3A 1OC2A 1LXCA 1BTOA 4P4GA 3UCFA 2NVBA 1RJWA 3RUFA 3WLEA 4M8SA 4GLLA 1XWFA 1V3VA 1GY8A 1KS9A 1VKNA 2HK8A 2XF8A 4IBOA 4AJHA 4PG8A 2I9PA 2FR8A 4A73A 4DQVA 3DTTA 2AHRA 3JQGB 4MDHA 3P2YA 4YB8A 4DA9A 5AQ1A 2Y1EA 3JQ8B 1FDTA 1X14A 3QQPA 2X9GA 4DPLA 1JQBA 2NWQA 3GNTA 5IAAA 1VI2A 1JVBA 2VYVD 3Q9UA 3U4IA 3ONEA 1JW9B 3W1VA 3WGOA 1T4DA 1HE2A 3MEQA 5U9CA 5CPFA 3RC2A 2JCYA 1F8GA 1X7HA 3I9JA 3NJ8A 4RLSA 1JWBB 3MOIA 3RUHA 3GF4A 1LC0A 4PG5A 1H6CA 1U3VA 3IKVA 4BGEA 2UUOA 2C07A 1U4OA 3H9GA 4EGFA 9LDBA 1J4AA 5DOVA 4YRAA 3RUIA 2AG5A 2I6TA 2A9FA 2PK3A 3WLFA 4CMCA 3DOCA 4PG7A 3LVFO 5I9MA 5A02A 1HRDA 4D3SA 1X0XA 3TFQA 3HDQA 3B6ZA 1VC2A 3NDIA 4WLEA 2NSDA 3F47A 2NTVA 2JCXA 3OM9A 1Y5RA 4J7CA 4D79A 2QYTA 4J4HA 1O95A 2E49A 5CDSA 4I5DA 3NKLA 4W99A 1NPDA 2AEJA 2Y0CA 1RYDA 5JSFA 3Q3CA 3L4BA 4PLWA 4QT0A 1NPTO 4PLZA 3OJLA 4W6ZA 4E30A 5DBIA 4QO7A 5IXSA 1KEPA 1U5CA 4OXYA 4B7CA 4E0BA 1E7RA 3M2PA 7ADHA 3ZNQA 2H9IA 3DEYX 4L4RA 2VRBA 4FW8A 4MKZA 4DPKA 1PJ3A 4MVJI 1BWSA 3HUDA 3QVXA 1R37A 1TEHA 2CDCA 1B14A 4RV9A 5C7LO 3ZN2A 2B5VA 2ET6A 2G82A 3JQ7B 4IJVA 4RPJA 4AG3A 2X86A 3C3XA 4B79A 1ZUD1 3UKOA 2O50A 3OIDA 3PHIA 1IZ9A 5K6AC 1E6UA 3MCVA 5A1TA 2C20A 1PJ4A 1ONPA 4FFMA 3PPIA 3RUAA 3AUSA 2GPTA 3EZLA 3BMNB 1IB6A 1CEQA 1LSUA 2BFOA 3KEQA 4UVEA 3VKUA 4I1IA 4YBZA 1LJ8A 3ETGA 1K6XA 2DUWA 3AUTA 4XJSA 5I7VA 5CDGA 1H93A 1DRUA 4CM8B 1G6KA 1D3AA 4NJMA 1I2BA 1GQ2A 3ZU4A 2PY6A 2BMAA 1TLTA 3EW7A 1YB1A 1ZFNA 3CZMA 2DBQA 4CLHA 3CXRA 2V7PA 4R01A 3EYWA 3ZHXA 3P19A 2BFPA 2Y99A 3H3FA 4CLXA 1MA0A 1NBOA 1B2LA 1ONOA 3GHYA 4IQGA 1QYCA 4CUJA 4FD3A 2HUNA 2GN8A 3MJSA 1R0LA 5U1PA 4BIIA 4NBTA 4LCJA 2VTDA 4E5NA 2Q2QA 2WD7B 2DVMA 4HBGA 5BSEA 2HLPA 3D3WA 3WGQA 1VJ1A 1SZJG 3AK4A 1E3EA 2Q2VA 3HHPA 3TRIA 5B4TA 3WICA 1LC3A 1W4ZA 3K8ZA 4I8XA 1P45A 4CLRB 1H6BA 1ML3A 1NXQA 4XIJA 1LTHR 3S1LA 1ONNA 1ISHA 5ENDA 4FFPA 4KUEA 2GRAA 1E7QA 3MJEA 4OXKA 2DC1A 2EG9A 3U5TA 4BO6A 1MFZA 2AXQA 2CVOA 4XYLA 5KTKA 5EINA 3C7CB 1Z74A 2Q3EA 1N2SA 3PQDA 3PDJA 1C0KA 2UDPA 5JO9A 1MXHA 4IDCA 4WEQA 3ZU3A 1LLDA 1O5IA 1EBUA 4QO8A 3I52A 1QG6A 4PRLA 3F1KA 4LK3A 1Y81A 3C1AA 1XDWA 4GX5A 4OJNA 4I5GA 3VPSA 5G0SA 5F3RA 1HKUA 3D0OA 4ZN6A 1KBZA 1A72A 1BGVA 1V6AA 2JL1A 4UVIA 3H65A 4NBRA 1JKJA 1JWAB 2G0TA 4PLGA 1YO6A 3RU7A 2H63A 3LQFA 4DBZA 4J1QA 4NFHA 2X6TA 1D4FA 1E5QA 1GYPA 1WP4A 4WLOA 1EQ2A 1DRWA 2A4KA 4PIVA 4F45A 3GFGA 1F12A 3I1JA 4JCOA 4AJJA 4LMPA 4AJKA 3SX2A 2AA3A 1PTJA 3HQ4O 1MXFA 1YE3A 1D7OA 4RVGA 4GGOA 2PZKA 2Z5LA 3FHLA 1IHXA 4M87A 3IJRA 3JQAD 4BV8A 3Q6IA 1B8VA 4NR0A 3I23A 3O9ZA 4D44A 5DN9A 3AJRA 3ONFA 4JQCA 3ZNNA 3WG9A 2BF7A 2IE0A 1FF9A 2B4QA 2WEKA 1AE1A 1HDCA 3RCBA 4BNGA 2NVUB 4FBGA 3KZVA 4QFCA 5KJCA 2WWRA 3G1TA 2W2LD 1ZBQA 2ILTA 2PZLA 4Q3NA 4U0KA 1I24A 4L0QA 1SBYA 2BFMA 5EL0A 5THQA 2DT5A 4KDFA 4ZA2A 4B3HA 3T4EA 1EVZA 1E3WB 2GYYA 1DXYA 2B36A 1ZK0A 2YDXA 5I9NA 1NAIA 4UUNA 3HE3A 3S55A 4D3DA 4DWVA 1UR5A 3K73O 3Q9NA 3NGLA 1XEAA 1Q2XA 3STHA 2FN7A 1QP8A 3G3EA 4JGBA 3K6JA 4WCFC 4A03A 1NFFA 1NR7A 4J0EA 3ZWNA 4B8ZA 1ZH8A 1PJBA 3JYLA 4CJXA 1NHWA 3VH4A 2X5KO 4OGWA 3W4KA 3ORFA 5L95A 1PL7A 2ZTMA 4CQMA 4NBVA 4OYRA 1EK5A 5IJZA 4BGUA 4E2YA 1M75A 4YAEA 2E48A 3IUSA 4CPDA 5JYDA 3PQEA 5ITVA 3LF2A 4MPDA 1CYDA 5COQA 4YACA 2VHYA 1NQTA 4E31A 3ZWYA 4L75A 4P4NA 4QUKA 1C1DA 4WOKA 5ENVA 5DULA 1U8XX 4EUFA 3ZWBA 1EE2A 4XEHA 4DTIA 1U4SA 1P1HA 3JQ9C 2QRKA 3ABIA 4GVXA 4L4XA 5AYVA 1B8UA 2FPIA 3L6EA 5K6AA 1V3TA 1Z7EA 3RUCA 3CTMA 2DLDA 3BTOA 5IF3A 1A5ZA 4BNHA 4J90A 2EW8A 4DC1A 4Y9DA 4N54A 5CFZA 4K28A 3GGPA 2NU8A 1WLYA 4JJFA 3PLRA 3VZSA 3ZU2A 5L4NA 2GN9A 4YQZA 1UXIA 4PLVA 2P91A 3AOEC 1KEUA 2GO1A 2FPPA 2WMDA 2UUPA 1T2EA 2HSDA 2FR1A 1H6DA 2VUSA 4E6PA 1KVRA 3TZHA 2QRLA 2DBRA 1VKOA 5A06A 2O48X 4N5MA 4MVJA 4WK6A 2Q50A 3EZYA 3PRJA 3RROA 1V9LA 1YOVB 2A35A 2ZQZA 2GF2A 4EYEA 1C0PA 4DMLA 5JAIA 1CF2O 1UZLA 2CMDA 4M54A 1J0XO 3DWFA 2E4AA 2WD8A 3L07A 2HMUA 3QV1A 4MVJE 4TSKA 1HL3A 2EV9A 5ER9A 4BMVA 4YT4A 2ZCVA 3C85A 4R1SA 1H2HA 4URFA 2X1HA 4GKBA 4CM9D 1E7SA 1B16A 4MKXA 2VRCD 4DUPA 5JC8A 5G2OA 2A92A 4R1UA 1ENOA 2FSSA 3S2IA 5KVQA 4E2WA 4Z0HO 1ZW1A 4GBJA 4GWGA 4FFOA 4XQEA 3AUAA 4I5FA 1JAYA 3ANLA 3CKYA 3B1KA 4J1NA 3PWKA 4NU5A 2HDHA 1UDBA 5T8KA 4JX8A 2CF6A 3MWDB 4W4TA 3EDMA 3T4XA 1OBFO 1Z45A 1L7DA 2X0RA 1DEHA 5IG2A 1HE5A 4CQLA 2FPGA 3DBLA 3GMSA 2DTXA 4TVOA 4BNWA 5IXYA 4U6QA 4CUKA 1ZMTA 3FNFA 3IQDB 2DBZA 3VVBA 4YAKA 1PGQA 3SXPA 4J1SA 2EW2A 2VYND 2Z95A 1TT5B 2B69A 2GR9A 1F14A 1PX0A 3ZV3A 4HFJA 5TF4A 4Q39A 4BGIA 1P77A 4HFRA 4IDEA 5CDTA 3N7UA 1WWKA 5IDXA 2R00A 4BKQA 2YV2A 3PGXA 3S8MA 1KETA 2ZB7A 1SPXA 2X22A 1IYZA 2OP0A 5JMWA 5JCJD 3WOHA 1GUFA 3WFJA 1DAOA 1PQWA 2QYSA 1O9BA 1C0LA 1V3UA 2RHCA 3KXDA 3TZKA 3LLVA 1N7GA 3M2TA 4RPGA 3JQAB 3F3SA 4I9NA 3LLSA 1Q7CA 4D41A 2UYYA 2X58A 3M1AA 3X2EA 4NIMA 4EEZA 1OFGA 2NTJA 3RKRA 2I3AA 3QA9A 5C7OO 3COSA 1N9GB 3E9QA 1AUPA 4HNHA 1LDEA 5TNXA 4E5KA 1IUKA 2LDBA 1DLJA 5JXWA 1E77A 1P1FA 3UAGA 2O4UX 4LN1A 3TF5A 4K9DA 3ZHZA 2HCTA 1EUDA 1RM5A 1YRLA 3ROKA 1SO8A 3EAGA 1GZ6A 2C5AA 4OO3A 4RZIA 1UDCA 3QVSA 5MGBA 1A7AA 3TOXA 4QXMA 3GEMA 4W7IA 3GA0A 3TJRA 1NTOA 2PD3A 1T26A 2OZPA 5HRUA 1EUCA 4B4WA 2VHZA 4EBFA 3I3OA 2QIOA 1PQPA 1KYQA 2WE7A 4FGWA 4IMPA 3EGOA 1HT0A 2RIRA 3G17A 4CV2A 3CE6A 1ADFA 1R4MB 4YJDA 4IS2A 3C8MA 1MG0A 1U9JA 4Y98A 1EDOA 1PZFA 5GZ6A 4XYGA 3D5TA 2BFAA 1BSVA 3FNGA 3L0DA 2X0IA 5G0UA 1LRKA 5I8WA 4DL9A 1HETA 4PLTA 4WGGA 1PS8A 3QWFA 1A27A 4YAIA 4D3FA 3DMTC 3UF0A 1ZK4A 1K2WA 2Q99A 4X54A 3IUPA 5DDIP 4CL8A 3D5QA 3KUXA 2Y0DA 4RLHA 1DIBA 3H2ZA 4P4LA 1NVGA 5KOIA 3ZU5A 1S6YA 3L77A 4AJ1A 1ENPA 3MWEB 1ZJYA 2A94A 1SNYA 1PS9A 1GYQA 5ITWA 4MP8A 1C1DB 4ITUA 4XB1A 2BGMA 4E2XA 4B8WA 2C0CA 3JQFC 3ROQA 5CEFA 5CEEA 5L9AA 4KQWA 3VZRA 1E1MA 4WKGA 5DCWA 1E7YA 1EMDA 4IIVA 3ADOA 4JBHA 3HZZA 4GX1A 3AM5A 1PWZA 4KZPA 4XQCA 5JCJA 4EJ6A 1AGNA 5L7WA 4DLBA 3ZNOA 3JYNA 4E13A 4CMAA 4CR7A 1PJLA 3BMQA 4CM6A 1DIRA 4EEXA 4ZICA 2VNAA 2YV3A 3D4NA 3PHLA 1EVJA 2D0IA 5ER6A 3PXXA 3HFGA 4KMSA 3T7EA 2W8ZA 1LLCA 1ORRA 3DHEA 4D46A 3WX0A 1JA9A 2C2XA 3V2UA 4LRTB 4ZRNA 1FXSA 1I30A 2X7HA 2YY7A 2JFFA 3GEDA 4LMRA 4UVDA 3PWZA 2X5JO 5EN4A 2JAHA 2P4QA 2HO5A 3UOGA 3E5RA 3KSZO 3FBGA 1X7GA 4M49A 2EWMA 4RVFA 4U5QA 5FWNA 2D1YA 3JCZA 1YS4A 3RC1A 3GEGA 3ZWWA 2VYVA 4AJOA 4BNZA 1P31A 3PHHA 2ZYDA 3PVZA 4ZGWA 4Q3AA 1WAMA 3BMNA 4HWKA 1N9GA 4KDEA 2EF1A 5HS6A 1GL3A 3OMLA 5U4QA 3I9LA 2FOIA 5ICMA 1N1GA 3WGIA 5HS4A 2I3GA 4NQZA 3TNLA 4IINA 4KWHA 4WEOA 5T8KC 1GCOA 2D3TA 2O3UA 1E1LA 2ZK7A 1YGYA 4TMFA 3MTGA 1HF3A 2DQ4A 7MDHA 4IZHA 1J6UA 2X23A 5JDCC 3TFOA 4D43A 3ON5A 5JS6A 1UAGA 4FIZA 3NJ4A 4WLFA 4FN4A 2V6GA 4IXTA 3DBVO 1NVMB 4XKJA 3B1JA 4PG6A 1TXGA 3ANNA 1R0KA 1PZGA 3KSUA 3QSGA 4KTVE 1QKIA 3D7LA 3BMCB 3MZ0A 5GZ3A 1Q0LA 4CV1A 2FZWA 1SB9A 4BB6A 3PYLA 4OSPA 3KTDA 5G0TA 1BRMA 2IZ0A 4RL6A 2J3JA 1MG5A 2EXXA 1YQGA 1TA4A 3EUWA 3JD2A 3KEOA 3DTYA 3QVWA 1VPDA 5G4KB 3VTZA 1PL8A 3HN7A 3VC7A 4RDIA 2YHUA 2O23A 2EP7A 2RBEA 4PG4A 5IDYA 1NHGA 5FFFA 2EGHA 4A2CA 2IRWA 1FDWA 3L9XA 5DP2A 2WE8A 5A05A 1LDMA 1Z6ZA 5DBGA 5L7TA 1NASA 2Y66A 4TZKA 1HDOA 2GSDA 1EFKA 4QSMA 4XA8A 5KVSA 4CLRA 1DHRA 5L7YA 1QLHA 4OQZA 2BGKA 1P0CA 3O4RA 1EBFA 3WGZA 3SLGA 4P22A 1BDBA 3LC1O 1C3VA 1XG5A 1YOVA 1C0IA 1QMGA 2VWHA 1XR3A 4J4BA 4J9UE 4ONEA 5IZCC 1SOWA 3GLQA 5H82A 1M67A 1DC4A 2UVDA 4J7UA 3VH3A 2YJZA 3GZNB 1HE3A 2AQKA 1A4IA 2POQX 3QRWA 2O3SA 4UULA 3JYOA 1Q0HA 1BW9B 4FDAA 4WUVA 1LLQA 1E1KA 1CDOA 1X0VA 3GG2A 3ETDA 1TI7A 1DO8A 3WIDA 4ESOA 2P2SA 3R3SA 3U3XA 3MJCA 5T57A 3ZGYA 4A10A 4BNXA 4GWKA 1U3WA 4WCFA 5F5NA 3DQPA 3HDYA 4FPXA 3PQFA 1B7GO 4IDBA 2G76A 4I5EA 3ZWVA 1P1KA 3DMTA 5AOVA 4HFNA 3L9WA 5ILOA 5ES3A 3ZWXA 1UAYA 5KNLA 2P5UA 3PZBA 3PK0A 2X5OA 5I7SA 3MJVA 2EHDA 5CP8A 5JBIA 5CDUA 3TZCA 3VPGA 2E6UX 1ZIDA 5LDGA 5TX7A 4E5MA 2YW9A 2O2YA 4JJIA 4AJ4A 4I9UA 5JYEA 1E7MA 1YKFA 1WDMA 1N92A 3GUYA 2OO5A 3PIIA 3R6DA 4MJLA 1MGOA 1NWHA 2PKQO 5TSDA 2X4GA 3E48A 2PH3A 4AJEA 3W8FA 2DBVO 4BB5A 4UUMA 2J3IA 4Z3DA 3DBHA 1GD1O 4RQUA 4B4VA 5BSHA 5IDWA 4MO2A 3DZBA 1P74A 4ROSA 2IYOA 5ADHA 3DZGA 3GNQA 3FNEA 4WASA 1NQ5A 3RFXA 4CM3A 4NMHA 1A9YA 2FMUA 1DLIA 1B15A 4ND3A 4Y8VA 2ZKLA 3IS3A 5JCXA 4CMBA 4GL4A 2HU2A 1AHIA 4RO0A 1JKIA 2FHSA 2ZJ1A 3GPIA 4IXWA 4RZHA 3JQEA 4NFSA 3FTNA 1QYXA 1SEVA 5ICSA 2JAPA 4CODB 5JW6A 5A5FA 5T6BA 2XAAA 4WE3A 5C37A 1ZVMA 4JROA 2DUUA 5G4KA 4OOEA 4JLWA 1FK8A 1WXDA 2DFDA 1NVTA 1H2BA 2NU6A 4R69A 5FI3A 2ZTLA 4NH4A 4B7UA 3V1UA 3WDSA 4XX0A 1CQIA 1ISMA 4NI5A 4ZQFA 1GPJA 1UP6A 3IDSA 3WNQA 4YRDA 1GPDG 1ARZA 3FR7A 4N5NA 3LC7O 4IM7A 3IJPA 2PGJA 4GVLA 1KY4A 1N5DA 1ZEJA 3BMCA 4MKRA 4U7WA 1XELA 3BMOB 2Q4EA 2JCVA 2HAEA 5KCZA 4PZCA 4XR4A 2F00A 2WJPA 4TROA 4NG5A 3UFXA 3JQGA 2QQ5A 1YBVA 4MVJG 5CPBA 3I4CA 2J3HA 4M89A 3HDHA 2VUTA 1T2FA 3INTA 3FF4A 4LISA 5I8ZA 4YT5A 4BNYA 1NQOA 1LU9A 4OOFA 1IL0A 1E3WA 5THKA 4ND1A 5EERA 3BA1A 2Y1OA 3BXXA 4KQXA 5LCXA 3GVIA 2ZTVA 1ADBA 2WTBA 2Y1FA 3EVTA 3KBOA 4HX5A 2VNSA 4GX0A 4RF3A 1IHYA 4FFLA 4PLFA 3KLPX 1EEHA 1ZXLA 4IJUA 1R16A 5AVOA 5AXBA 3RBZA 1WDLA 1HDRA 4O5OA 3ST7A 3INRA 2PZJA 2G17A 4LRSB 2OP1A 4ALKA 1HSZA 2CVZA 2IXAA 4O0LA 5TRTA 3ZWAA 1VSVA 4XWYA 4QQRA 2JFHA 2PH5A 5A3VA 3KYCB 3H9EO 4FB5A 3PYMA 2G1UA 2J6IA 4PN3A 3C7DB 5KJ6A 1M66A 3DL2A 1UXJA 5DP1A 2F1KA 1Z82A 2EGGA 2PGDA 3FR8A 4DGSA 2EIHA 2VT2A 4KTTE 4K6FA 3OJ0A 1LRLA 3RVDA 2G5CA 2GN4A 2VZ8A 3Q2KA 3D4PA 1Z7BA 4YYZA 4CM8A 5G0WA 4RPLA 1XYGA 1PS0A 2RAFA 2VQ3A 1AXEA 2QG4A 2NVWA 1ZJZA 3D64A 3JV7A 1H0KA 5GY7A 1N1EA 3HB4X 4F6LA 2QHXA 5T67A 1KY5A 1YWGO 4KUGA 4MVJP 4PCVA 5TQVA 2GUGA 5A03A 1UP4A 2B0JA 4BKRA 3IMFA 5H81A 4CMEA 3MJTA 3OIGA 4F3YA 1I33A 4J43A 4RPHA 2BD0A 3NDRA 3EHEA 5EPOA 3WWZA 2EERA 2C82A 4K1LA 5FEUA 1PQUA 3WB9A 1Y5MA 3F1LA 4OM8A 1PSDA 5JDIC 3WSVA 4I9HA 3DMYA 4E33A 1HDGO 1YL6A 4Q3CA 1LEHA 5BT9A 2BH9A 2PFGA 2VCYA 4KWIA 1I3LA 3BAZA 3E6AA 2PKRA 1J5PA 4H16A 6LDHA 1CERA 3ZCXA 1KVTA 4AJPA 5A9RA 2CUKA 2OOSA 5IZ4A 5BNTA 2OORA 4Y6PA 1SC6A 5DBFA 3LZ6A 4GKVA 2CVQA 4ND4A 1VSUA 2TMGA 5IN5A 2HK9A 5KVVA 4ZQEA 3ZWMA 4ZU3A 2P4HX
chains in the Genus database with same CATH superfamily
5COBA 4KLZA 5K6RA 1WD5A 1Q3KA 2BR3A 3EF0A 3PEWA 2PTGA 4L73A 5ILQA 2A0UA 2P62A 3DXZA 4XFKA 4CMHA 2XXAB 3AFGA 1U8AA 2O14A 2WLTA 4COKA 1KNXA 3T52A 3LFUA 2P9CA 1GJRA 2ZM5A 4I50B 2FWBA 3QOWA 3ILXA 1BRTA 1I0ZA 3C48A 5JG7A 3K71B 2NO6A 1Z18A 3KSMA 1TADA 2BEVB 4FDUA 3B9QA 3N75A 4TMKA 2J3LA 1ST3A 1WMAA 2YFHA 1F5SA 1K5PA 1RVV1 2AMYA 3FUXA 4A7PA 1X38A 2FUCA 3KJNA 3PFFA 4WADA 5EMHA 2ZLBA 4HXGA 2P90A 5KOHA 3K9QO 3EOZA 1L3IA 1QRAA 1GNLA 1YDFA 1AXGA 1R4ZA 2R48A 3LUFA 4G84A 4HDSA 4HDRB 3UT0A 3IDFA 1JG7A 3S27A 4DLLA 1QYDA 3U49A 3ESRA 3M82A 3TR5A 3DF9A 3AKDA 3J7TA 3OQMA 4OFBA 3CEAA 4Q3DA 3D6NB 2D5BA 4NBWA 4H9GA 5FI5A 3EEQA 4UVGA 3ULKA 3L8GA 1PQ4A 2KX7A 2LIPA 1FRVA 2ISCA 1D0IA 1H1DA 1NYLA 2AQ8A 2GZ2A 5D5HA 3EIFA 5J59A 3SCZA 2PS1A 3BYZA 4GR5A 4B2YA 4XVCA 1YVPA 1GPNA 1Q1BA 3RVPA 2NIPA 3GFVA 4QYIB 5JTTA 2W2PA 4C5CA 1KAMA 1YH3A 1T8YA 1UDXA 1U6IA 4KC0A 4B44A 3FNBA 1IPFA 1OLUB 2R96A 3I1IA 4EPXA 3W9YA 3KEFA 4EGAA 1D03A 1OILA 2BAGA 1EI9A 3EVDA 5EEGA 4EY6A 2OBYA 2PH1A 3VTFA 4ZMBA 4U6SA 5CBPA 5IK2A 1COZA 5BV7A 1BFKA 2EWWA 2FPGB 3A0UA 3KZXA 1BA3A 3TSCA 2GEFA 3C14C 4QPPA 1M5UA 1WMDA 4HXEB 3IAUA 1VP9A 3LVBA 5JALA 2A5LA 1UBCA 3GIDA 1LX7A 2QZSA 5LUAA 4AKIA 1XTQA 2QL7A 1OB2A 4I50F 3CISA 5FHQA 1AQYA 3EXEB 4X7PA 4C0KA 1Q7GA 1J9ZA 4KRFA 4RLQA 1ONSA 1VL6A 2WYWA 4BLSA 3JQPA 4N8DA 1FY2A 2VHWA 3K2QA 3LDHA 1U63A 3AZQA 3PUXA 4IDNA 3S2GA 1XZAA 3FYSA 3P2JA 1ZNQO 3OM1A 2IK8A 3A2LA 1YIDA 4ZXPA 4MGYR 4ZD6A 3B82A 2HU5A 1L7QA 1Z3IX 4D4GA 3FNIA 3BJZA 4F5DA 3UXYA 1DKNA 1XEWX 3LX6A 3QY9A 5BR7A 3NGXA 5EWMA 1E3JA 1YUNA 4M83A 4W5TA 1R4MA 1YXMA 4AN4A 2FSHA 5EZSA 3JQCA 3E9NA 1RLOA 3Q7SA 4FEEA 2JHAA 3GQBB 4GPAA 4MVJD 3D43A 4PS0A 4W7HA 5FOSA 1NNLA 3NJRA 3K92A 1LQTA 5HRCA 3CZAA 5CNKA 3SLKA 1ZQ9A 1CJVC 4EFNA 4KIFA 4EI8A 4JSTA 2PX6A 4TUYA 4WXRA 4HMPA 4XW2A 4PQYA 4A26A 4LXXA 3E8XA 5CX1A 1P3DA 1P0FA 3KJXA 4Q1FA 3DH0A 2PFSA 3BK7A 1XNGA 3FI9A 2GBPA 2CJWA 2WTMA 3NWBA 2J41A 5ALMA 3ZCVA 5AKIA 2NU8B 1L1FA 1HDXA 1F2TB 2AR7A 2GPWA 3UV7A 3BK1A 3QELB 1NVEA 1R6VA 1L7AA 5TXGA 2XCUA 1VG0B 5GQSA 1TRKA 2PT5A 3MXOA 4OHYA 2FVXA 2WUDA 1PJZA 3RASA 3HJAA 4C7KA 4D2IA 4N48A 1KH3A 1UF9A 3D5EA 1ECLA 1KTVA 4KIGA 4DJAA 3EQ6A 1TZCA 3JVDA 1KZ4A 3BM5A 1FX1A 4B6JA 1TE2A 2EEZA 3QMVA 1C14A 4IIJA 4CN8A 4MV5A 3EEOA 1BZYA 2M32A 2V6FA 1SBNE 3PBKA 3VJMA 1WCYA 2VDKB 3LT0A 3LPLA 1F2UB 3P9PA 1WOMA 1T9DA 1GZDA 3WWPA 4YQEA 3EMKA 4ND2A 4UHCA 1JFVA 4L57A 4O1HA 4FTWA 4AG6A 4DILA 2FSGA 3A4IA 1OC4A 4IOKA 4WKNA 4GI2A 3A4LA 3AVXA 1U1DA 1T4BA 1GNTA 1Q95A 3ZYCA 3AYZB 4AW9A 1XPOA 1SRRA 1THTA 1O57A 1OFIA 1GGNA 1ZITA 2DRIA 4ZGWA 4ID9A 2CD9A 4P8RA 2SHKA 2LWIA 1IIRA 1P18A 3T06B 4U0JA 2Z2YA 3EGWA 3WTBA 4MS1B 4TMWA 3OC0A 3OJFA 2RH4A 1CUUA 3RIHA 4KQJA 1QYRA 4QDUA 2YQZA 4CI9A 4UOEA 4H4DA 2LXNA 1Y1PA 3WFZA 1OIWA 2EFCB 2MDTA 2JAOA 5EI5A 5K20A 2HCFA 2IYFA 1OZAA 3KLNA 3MW8A 4PGMA 3GBPA 1EXDA 3OKPA 4WPGA 2XB4A 1F0YA 3AFIA 4X1OA 4XDYA 4HI0E 5AFSA 4JLNA 1Z63A 4JI2B 3CWQA 2ZUDA 2JG3A 2OUIA 1RQXA 4KVZA 1EXNA 1KOFA 2CNWD 3L93A 3FSGD 1OJ7A 1PBTA 4KZKA 5F5LA 1YONA 1W73A 2VSXA 2O3QA 2V4ZA 2V97A 3QXJA 2J6BA 4FQ7A 1GGJA 1MC1A 1NR5A 3PC7A 3DOJA 3ROGA 2IS2A 2XQVA 1MHPA 5A4KA 1M6WA 2JK0A 3UICA 2I3DA 3F67A 5HF8A 1TVKA 5EMNA 1JRLA 4DMKA 1XSEA 3FGNA 4H7PA 3VZBA 3NVKI 4NZOA 5H4GA 3HB1A 4Z0TA 2EOAA 2JFZA 1E2PA 1ID1A 3SXUA 3BMQB 1SCUB 5JVDA 1RM4A 3GI1A 1JKFA 1JLRA 4K26A 1GG8A 1QB7A 4LHEA 1XPJA 1E3DA 3P94A 2O8NA 1KTIA 3O03A 4DYDA 2ZR8A 3UPUA 1B8PA 1M1XB 1XJWA 4DDTA 4N5IX 1F4VA 1PFGA 1P1IA 3RADC 4HNQA 3OCCA 4LXTA 4AN1A 3ML1A 1VL8A 1JQLB 1P39A 4TXMA 3MCTA 2KWIA 4ARCA 3RD5A 2I0FA 3GP5A 3O84A 3W8NA 1NDQA 1LPMA 2PRIA 3F71A 2B1JA 4JASB 4GXNA 4YV0A 1JE1A 1J1UA 2DWUA 4REMA 3QE0A 4RM3A 1V2HE 3BTSA 2O3RA 5EKXA 5DNYB 1NJ6A 4JJKA 3BHJA 3QVTA 4TXLA 3A6ZA 3OQ6A 3RUDA 5FFNA 3CH4B 1MX9A 1LBSA 4BFXA 5I45A 4RCZA 2GN0A 1AG9A 3ABSB 3I04A 4RBNA 5HUJA 1NSTA 1VJCA 2A7QA 4MYHA 1R15A 4NCHA 3R3YA 2I8CA 4WY8A 5CNMA 3UKJA 3RTGA 6PFKA 5THXA 3WMRA 2V4MA 3Q0EA 5JY1A 2HMTA 1CK4A 1ZJWA 4Z6KA 4AS3A 4QJ5A 3SF8B 1T15A 1ESMA 3NDJA 4LY3A 1A4UA 2VJOA 4NCBA 1T1RA 4K6GA 4TV9F 2G8LA 1K7EB 1FP1D 2I33A 3JX9A 3NCHA 4LQ4A 2G6TA 1N57A 4OKIA 1B2RA 5JJKA 4Q82A 2EGUA 1HXHA 1N8NA 1C9MA 1GARA 2DLNA 1GFSA 2IHVA 1F0NA 1U2GC 4BLQA 1M83A 2QGFA 3LNCA 3SJUA 3UG6A 2E2WA 1A5BB 1Q12A 3E7XA 2KB0A 3IUBA 4UBJA 2H51A 2H7YA 4G1MB 4FNGA 1IVSA 3GFQA 2OMEA 1GZ4A 4YWJA 5TMDA 1DAHA 1C3EA 1X1TA 2H1RA 2H1WA 2X3FA 3DOHA 3L4EA 4MR7B 3WNZA 1JQAA 1EK6A 4R9SA 3TTSA 1KRXA 5EE0A 5EHIA 4CKXA 5IW8A 1MRSA 4OI2A 1QO0A 2D2XA 1DHTA 2XADA 2XTMA 3C16C 3L1KA 3S5UA 4CT5A 3SSMA 2W93A 2WSBA 3HK2A 1U98A 4H4EA 1VPTA 1N2IA 3OPXA 2WJGA 5E9WA 2UYOA 2ZZMA 5KIAA 1DFGA 3MSCA 1E5TA 1UQUA 1WUHS 4KR0A 4Q4HA 2YZGA 2B3DA 4Z3DA 1VE9A 4ZCMA 4ZT4A 3U7JA 1QJ4A 4IXDA 4DSNA 3E1KA 2Q62A 3FZGA 5AXDA 1ODTC 1VP3A 2H0RA 1CS0B 1KJ8A 2FLKA 5E7IA 4TYNA 2ZRNA 4KUHA 3NOQA 3C5EA 4URWR 3B9RA 1NLFA 1VIYA 1ZAKA 2GDZA 2P6UA 2D8AA 3EIWA 4OQNA 4ZAXA 4BFUA 5LBIA 5H68A 1QRTA 1G6OA 3C43A 1NT4A 1RPZA 3LCVB 2D4HA 2AIRA 5BNIA 5K4GA 1Z73A 1P7ZA 2NO9A 3JQAA 3U4DA 2ZYRA 4JX9A 3WYEA 1Y6JA 4BNUA 4LYHA 5EIFA 5JPIA 4EHIA 4IILA 2W5UA 4L4SA 3W6PA 4D9MA 1XFDA 1NF3A 1FFHA 4HJRA 1A2BA 1W30A 2IU6A 2HKIA 1XZMA 4MR7A 1DEAA 1E0KA 3LUAA 3BKWA 1BJKA 2R11A 1W93A 3N8DA 3P2KA 5M34A 1ZIYA 3HCRA 2ZVPX 2WUWE 1Y9EA 3L7CA 5IDVA 3ZS9A 2XT9A 4EDHA 4E2FA 2J31A 4HGOA 4UDNA 1AC5A 3BB3A 2W8BA 4KAJA 1BAPA 3AEQA 1TT5A 3TIGA 3L0OA 4MV3A 3R2JA 3UJAA 3DE4X 2FP4B 4MUNA 3SEQA 4BU1A 1T9AA 2GBCA 2IPNA 1VSQA 3A4VA 3ZQ6A 5FTNA 1JU9A 4UXHA 3QIAA 1SGWA 3R74A 3UK1A 3ZV4A 1YHZA 3B70A 3HEMA 5ALQA 1N9ZA 1JDJA 1XLUA 2FPLA 2QSZA 1Z83A 3DP7A 1WPQA 4IUDS 5EZQA 3ROXA 2QRGA 3RVOA 4UMDA 1OMOA 3HU2A 5HKBA 2BTOA 2YNMD 1WBDA 2P79A 5IEBA 4EB8A 5C52B 2ICAA 2WU3A 4OQLA 5IM4F 4G36A 3T7AA 2EDAA 2YXBA 4MS3A 3AR4A 1PHRA 2ZRBA 5IVKA 3D0KA 1II9A 2QAGC 2V7XA 3SVLA 4RWZA 1EAMA 4WZAA 3MOGA 5CAEA 4YGYA 5BR4A 1K06A 1Q19A 2B4TO 1CLEA 1XTUA 3EQZA 4GLOA 1GO2A 2WVGA 4Y3UA 1M5RA 2AVDA 2Q1SA 4ME6A 4XGRA 2JGLA 1UK8A 4HEHA 1T8WA 4PYQA 5IASA 1P9OA 2XR1A 1DC6A 4MYSA 1XYYA 5C8YA 4Z9XA 1AVTA 1LRJA 4V0RA 2HX1A 2JBHA 3Q9LA 2P5SA 3IXQA 4BFYA 3GFBA 3AVWA 3WLQA 3RG8A 3VPDA 3B8EA 4H7IA 1L5LA 3SX0A 2P9GA 2MSKA 4BO0A 5K9ZA 1XTBA 2NNLD 4PRKA 4DYHA 1CQWA 4Q9KA 5T64A 1ITZA 1J23A 1Z0IA 4FE3A 5BQFA 1HMPA 1V8BA 4LXGA 1NRXA 3QBVA 4AUEA 2A5GA 3ES9A 1Q1NA 1WDWB 2RGNA 2ECOA 5BSMA 5JC1A 5JZBA 3EH1A 1YJCA 1JG3A 1NUSA 1TTHA 1NATA 4UPDA 1EB8A 4R4JA 1GKLA 3MPUA 2ZAGA 4ER0A 2C7QA 2CLMB 1QIIA 4ZOLF 4BKUA 5IK2D 2P6PA 3R44A 4I81A 3HL4A 3PFIA 2JD2A 4EKEA 4NSNA 3RV4A 1XZQA 2LNDA 1YC2A 4XJVA 3IAEA 1XROA 5A9TA 3GVXA 1OH8A 1T2UA 1TA9A 3GJSA 1YJXA 2F9MA 3OWHA 4K9PA 1ZSVA 1EFHA 2HCBA 3NUGA 4H7HA 3SZOA 3DFIA 3P32A 3VH2A 2YC2C 3MJRA 3EOAI 3OZEA 2OCAA 3N5KA 4Q7KA 2SCUA 1C1HA 4MCJA 3DO5A 4Z9BA 1H4TA 2QZPA 3WIUA 5JECA 3FGOA 2B1GA 4R41A 3RAJA 3SSNA 3MM4A 3ISJA 3UQYS 2WB2A 3TL2A 1EZZA 4JQZA 4K0KB 1E58A 2C04A 2AFIB 1I51A 3H1GA 1EB9A 1ZOOA 1J24A 4GGPA 3WWDA 5DKFA 2FEMA 3H42B 5HG0A 3THSA 1BG6A 1A9ZA 1FOEB 3D3EA 2JFOA 5SYAA 3DEAA 4AJ2A 5HA5A 1YIAA 1KRHA 4BFTA 2FFHA 3G85A 2H16A 2H6EA 3T7TA 4IUBS 1SZPA 1T91A 4GUDA 4RD2A 2VA8A 1KS2A 5DTIA 5EWJB 4ABYA 5EUQB 4HQLA 4BFWA 4RJIA 3OEEA 1EWYA 2J09A 2CFTA 3FROA 3K3PA 3OPNA 1WOYA 2Z4SA 1HT1E 1RYMA 4N3GA 3JARA 4QFBA 3X2SA 1QYIA 2D5CA 3O4IA 4YJHB 3U0BA 2FX2A 1MEJA 1G9SA 4LBYA 5EQFA 1DXQA 1JZQA 3M4YA 4NCJA 1Y8QA 1TA0A 1DNPA 2P9JA 2OPHA 3AUUA 4DRYA 4OHWA 4AF6A 4DCSA 2IPLA 2B4YA 5CYOA 3OA0A 2VN8A 2JH9A 1IN6A 2Y4NA 3HVKA 4L9RA 4HWGA 3WJ7A 4UDXX 2PU5A 2O1WA 1MAHA 3TECE 1CQJB 2L2QA 1N2GA 3PCXA 3TSOA 3VGJA 4OLAA 3A70A 4Q4JA 2WTXA 4KHPB 1O5OA 5K5EA 4FC6A 2FW9A 1MHTA 3QTBA 3I39X 4XRRA 2IZ7A 2E5WA 4FS8A 1NW3A 4HLQB 1QGZA 4PS1A 4PQRA 5LJLA 2LTAA 4YRJA 2WTEA 3ZI0A 3UHFA 5C5DA 5MN5A 1Y0BA 2LDXA 1VL0A 2CJWB 2OBBA 3LPMA 5IVDA 1QPZA 3D6FA 2HWUA 2JAWA 4KX5A 3O91A 1L5ZA 2NGRA 3A10A 3I61A 4PLPA 1OI7A 2AOUA 1V43A 2AMLA 3OQ1A 1V5WA 3NIWA 5WRFA 3BJMA 1ESCA 1L5WA 3VKFA 4B33A 3P2IA 4KV9A 3FX2A 4M9ZA 3WBBA 2QTZA 1FYVA 2FG7C 3KHTA 5HJ5A 1EGQA 2WZDA 4HYEA 2IF0A 2ZBRA 2W6ID 4MCIA 4YAJA 2VT3A 1PNRA 1C9NA 2QMUA 4J16C 4MOWA 2V59A 5D6NA 4AI6A 2FWIA 4REQA 4CG2A 4X94A 2J9ZB 1Z33A 1EE9A 4F8EA 5AVJA 4OJKA 4YLGA 5EY5B 4S1TA 2MJLA 1RQRA 2BM1A 4YRFA 4AU1A 1ODFA 1VLJA 3ADCA 1GDHA 3FMPB 1G3RA 3S3TA 2Y8EA 5LB2A 2HA6A 2LPMA 2P3OA 4IOJA 4YRLA 1F0KA 1SKYE 4NHEA 1L0BA 1U0SY 3EFHA 2AC4A 1WHTB 2CLHB 3E0QA 3FNHA 1T8TA 3QPBA 4LMAA 4X24A 5KKCA 3QF4A 4J75A 3EGDB 4JL6A 2QUBA 5AJHA 4CFYA 1O94C 3M6XA 2JIRA 4R3NA 1SUDA 4N6GA 3B6EA 1RDFA 3OM0A 3ICWA 2GCPA 1P6XA 1B42A 3G0OA 3H99A 4L9AA 4FOLA 3AU8A 1Q74A 3KDPA 5CDYA 2BI7A 2VRCA 3V4OA 3KT8A 3N6VA 3NHPA 1Z35A 1QZTA 1MGPA 3MQFA 4Q9HA 5CHEA 5HDQA 3WKAA 1RKVA 4F86A 3Q7PA 2AN1A 4KI0A 4PTLA 2Y67A 2ZYWX 1N32B 4CLOA 3REQB 4L5BA 3EDCA 1UBMS 2C98A 4WNIA 3I6ZA 1J7JA 2FWPA 3H8VA 2X3UA 5LQAA 3FWZA 1KFCB 3NYWA 4IWNA 3ZLUA 4ZOCA 1U2PA 4G0QA 2FCAA 4M2LA 4N9WA 3O75A 4DOMA 2QTRA 2XBMA 2YC4C 3MB5A 1BE8A 4R1TA 4V2UA 4NBNA 5E4JA 4D9IA 3VR5D 5HKOA 1P60A 4K5QA 4ALNA 2NUBA 2PBRA 2X4IA 4YRZA 5K51A 1UC9A 4RMGA 1MCZA 3T12A 4C87A 2C2YA 1L6RA 3EGCA 3ESXA 1VB5A 2QVGA 3IV7A 1I2AA 4MINA 2AWNA 2X6QA 4NJMB 4QT4A 4YI3A 1BXZA 2H2DA 1T13A 2C5GA 3S5JA 4LE0A 2FQWA 1GQYA 2QZ4A 2JJYA 3DW3X 1V39A 3OTGA 3OZTA 4M98A 4A92A 4CKBB 4HV4A 3J7AC 2QUZA 1R0RE 1BU8A 1PWHA 2IZ5A 2X77A 2NACA 3E2MA 5GWXA 5KYXB 4Q15A 5DNAA 3ZBUA 5K3SA 4AMUA 4EY7A 1O97C 2VK1A 2K5UA 3DMNA 4ZAVA 4YTEA 1QF6A 2YUTA 1OTYA 4WVLA 1P4AA 1V37A 5DPMA 3GGDA 4P4SA 4EMSA 3AI1A 1O77A 1UDRA 4P5DA 5TT1A 3LHIA 2CZQA 4PVCA 4DB2A 3GGGA 3HP7A 3B52X 3D4BA 2JVJA 2AT1A 1KO7A 1L5HA 2XZLA 3QBJA 3AG5A 3IVGA 4RVOA 3JYPA 3WYAA 1C3XA 4AMZA 1U9CA 3DXFA 2AMVA 3M6UA 2ZT5A 1QIJA 5DE3A 3TWOA 1QO9A 1V8OA 3AY3A 3JARB 2Q3FA 2VZ0A 2YASA 2Q5HA 3GRCA 2AYXA 4TYMA 3CF4A 1VL1A 4IDHA 1DIHA 1XEXB 4IKPA 4M7RA 4JJGA 2VYCA 1FMCA 3DTNA 3L6RA 4JLPA 5F12A 4DJFC 2IHUA 4ND8B 1JLMA 2BE7A 3KTFA 3RODA 2IH2A 1OWPA 1Z5GA 3VU9B 5EMKA 4DREA 4JR0A 2WSMA 3TCKA 1A8UA 2KBFA 3EWAA 4ZVKA 4OMFG 4ZVTA 1WULS 3EGVA 3H9JA 4L4ZA 1KZ6A 3DMGA 3WIEA 2IXBA 3EBOA 5DYGA 4AX4A 5JS7A 1BDIA 1HGXA 4PFJA 5TMBA 3RRZA 2WWYA 2ESRA 1ZD5A 1DEKA 2WOJA 3I9V1 4Q1EA 3W1WA 1JMKC 2XGJA 3TI7A 3BSWA 3T9AA 1I7QB 1EQUA 3GVPA 4ZPJA 3EQ2A 5C4IA 1ZRNA 4HZIA 1SUAA 4EGQA 2I4OA 1X2EA 3CEJA 3GUUA 3IUQA 2RE8A 2II6A 4GFDA 4TLBA 1OXTA 2QN2A 4PSCA 3RFFA 3WWEA 4BGVA 4C06A 4Y0NA 3ZX5A 4BNVA 4M53A 1ISIA 1IM5A 2BHLA 4I1RA 2W42A 1JX6A 3CJRA 4NC9A 5D3ZA 4ZCQA 1I10A 3DEHA 3UV3A 4L07A 3UAYA 3U7FB 4KEAA 4J7XA 5K3DA 4BVAA 3TZQA 1RXCA 2HFKA 1WNTA 2ZQYA 1EX1A 4NENA 3MOSA 4QPDA 2JA2A 3AL3A 3LT1A 4LTDA 4BNDA 2AOTB 2UUAB 2E1RA 1Z29A 2OD9A 2OQVA 1E2DA 4BLPA 4MUXA 3U7HB 4YUYA 1ODLA 4MW6A 2GD1O 2ID9A 3D3JA 4OFZA 3DWGA 1A2QA 2RONA 3RRXA 5LXTF 3O8DA 2Y6UA 2BGTA 5C1IA 5A5EA 3ZVKA 2F3PA 3N3AC 1AQ6A 2B9VA 3NLLA 4OAQA 4OHZA 5LNK6 3SZRA 4C2UA 2WOOA 1L4LA 4GPIB 3UHAA 4CN9A 3M89A 2B0CA 3SR3A 2I62A 3AFNA 2FWMX 1QB8A 3LYUA 2ACKA 1DT3A 3O92A 3RIGA 5LMNB 1FLAA 4GPZA 4ZOLB 4KDRA 4DIOA 3ZCRA 2PN1A 3GN1A 4DLXA 2H92A 5I7FA 1GGMA 3TMKA 1USKA 1MV8A 2R8BA 3M34A 2PGIA 4X1YB 4DLTA 3DQQA 4ZAYA 4ZCIA 5C8YB 1OY1A 1IOLA 9GPBA 2EYUA 5J2UA 1FMLA 1DGQA 4BWYA 3EMVA 4B6EA 5K8IA 1NBWB 1O0SA 1S7CA 2HADA 3MQ2A 1WL8A 5EC8A 7AT1A 3A11A 4WLUA 4TX1A 1RXYA 1SBQA 3IULA 3CRNA 2ZJYA 2OHJA 5DIZA 3QPVA 3LPNA 1NRJB 4NICA 1R12A 2BC9A 2CWDA 1V1RA 4RHEA 4XYBA 1RRKA 3IQGX 2G08A 1ENYA 1M2KA 3GQVA 4E5NA 3KLMX 1WS6A 4K6HA 4DMGA 4MS3B 4F2PA 2B7CA 1V71A 2PRSA 2RGCA 3UBTA 1RI2A 5DN6A 1K7YA 1SUEA 1SVNA 4KMOA 4RVNA 2HY7A 5DXAA 1T3GA 4QU9A 5LA6B 1NMZA 3MSXA 1D6NA 3OH8A 1F8XA 1U2ZA 3OZVA 5IT4A 2ZJFA 4CQJA 5HOEA 3H9UA 1WXGA 2IY8A 2QX7A 3AYXB 4C4PA 7ADHA 5IHXA 2DECA 4C3ZA 1G5RA 4Q19A 5FWYA 4JYPA 2FSFA 3ONWA 5G53C 3R3ZA 4BOYA 3AF6A 1WSDA 1ZD1A 4LWQA 1TUBA 4JZKA 1X7XA 2CSXA 2A5DA 3HKCB 3CRQA 5EYPB 5H3LA 1VZ2A 1BCRB 1M76A 2W71A 3JQRA 4XB2A 5CA1A 3AOGA 4TWRA 3ABZA 4F56A 3DYVA 2DCMA 2P6MA 2W58A 3M81A 2LCIA 1C5KA 2C77A 3GO4A 5BORA 4QREA 4D9KA 1MJGA 5AW5A 3TD2A 1HT2E 3M6MD 1NVUQ 3W8EA 1T4CB 1YQDA 4JKYA 3QUAA 3JQBC 1ND6A 3MTQA 2TMDA 4ZHQF 3IUNA 3RAGA 1OAAA 1YVRA 1F1JA 2UZ3A 3RF6A 1J20A 4HDRA 5C0OE 1QG0A 1S4MA 1DAGA 4NDNE 5SZHB 2QX9A 3JQFA 2EF0A 1CTQA 3NTRA 4P4SB 3PC6A 3T9DA 3E7FA 4N0MA 3H8WA 4C78A 4GNKA 4KLNA 1NPYA 3H3JA 2IHBA 1RJEA 1E6EA 2JIMA 2R66A 4BO7A 4D8UA 5F78A 1H4SA 1W5EA 1JJBA 1Q3HA 1OFTA 4NZZA 5JMPA 1A8HA 3GR6A 1LNSA 4MI3A 2QRPA 5DBEX 4IHJB 2FCRA 2CXHA 2FSVC 4YRNA 2HJSA 1JA0A 3AR5A 1NQVA 1OLXB 3DV0B 4C7JA 4R0VA 3BERA 4C4RA 1QC5A 1TK3A 1Y8QB 4EFMA 4Z0PA 2NQTA 1N7HA 2JGDB 3Q1KA 5TQ0A 3VPXA 4A27A 5AI8A 4CMIA 1MX3A 4AY6A 1CY7A 3RVMA 1PFYA 1JVSA 1US8B 5CA1F 4FGSA 1DC8A 1PNQA 1X13A 1AY0A 2H3EA 3FPLA 1YMUA 4WZBE 3T34A 2NP7A 5CFMA 1YIOA 3NW9A 1CR0A 1WEKA 5CT8A 3FTDA 1KFJB 4YRBA 1Y1KE 1D09A 1E2MA 3MAGA 3AUJB 4IFEA 5HFJA 1PO7A 4ZQHA 3EUEA 2B8NA 2E5FA 1KFEB 1FQOA 2CDNA 2KPOA 4BASA 5AW0A 2YVUA 4GM0A 3V42A 4FLFA 4CM9A 1S8FA 3AWIA 3OUTA 3PQ2A 4FYXA 3BC1A 2FX5A 1YQUA 3DKKA 1E9FA 1JF8A 1LQUA 1UC5B 3KQMA 4N6NA 4RQAA 5E1DA 1Y5IA 3O93A 5FWYB 4AT1A 2DF8A 5A4FS 1Q21A 3VU8A 2PYDA 2GA9A 1JJ7A 4JN6B 4UEOA 1P9LA 2IHNA 1T29A 1MIHA 1ZEMA 3DS8A 4MRSA 1OE0A 1XOIA 3ZWPA 1UAAA 4WD3A 4F2DA 4DEYA 3A6PC 1XQVA 3M3HA 1SHZA 3PXBA 5JYBA 3IBFA 1Y7HA 4TZTA 1E0AA 2Y05A 1O89A 2W6JA 3QYFA 3U2QA 2EW1A 3RFVA 3K5PA 2EJUA 4MP3A 3L82B 1P2GA 1L4HA 1EQAA 2AKAB 2GERA 3QW2A 3UMVA 4NS1A 4DG9A 5KSOA 2XNCA 3R4VA 1TQ6A 1W0KA 1XXHA 4F0JA 4KR9A 3DEZA 2JI8A 2ZAYA 4XX1A 1YJQA 2HPVA 5EOVA 4RHFA 4D9BA 5DOZA 2Z6QA 2O8EA 5KNCD 3KKPA 5HUHA 5IJ0B 3CG0A 3PC8C 3NBUA 3ILYA 3Q7EA 5AVXA 4ZJZA 2XH8A 3PJDA 1UMKA 4A5OA 1GDDA 2BEJA 2D74A 1HZZA 3N6RA 1LWNA 5J4KA 4UAUA 4RK0A 4GOKA 1KO5A 1YNSA 1H9BA 4X63A 3QLTA 2CCJA 2R85A 1JFFB 2WBLC 3QUBA 4TRJA 3G1UA 4RF4A 4X8LA 5K4HA 3G82C 3OE5A 5H7XA 4RMNA 2BKUA 4CF3A 3GJRA 4KI7A 2V7TA 3DFKA 3EOBI 3F9IA 4WA8A 3RK4A 1JEAA 2GYVA 1DB3A 2E85A 3Q0TA 4I4IA 4TTQA 1WR8A 2GK7A 4FFRA 4RGVA 4IDDA 3TL3A 5KQRA 4YCNA 3SQXA 3PE3A 4B3IA 3PUKA 5F7JA 1XDUA 1RQ7A 1LS1A 1H5UA 3E0XA 3AUXA 2NXNA 2J3MA 3QXGA 1JDPA 4E22A 4QRHA 2QRQA 2P9EA 3GB9A 1R27A 2P3LA 3OFVA 1DQPA 1NM5A 4JOBA 1KGDA 1NMSA 2HK7A 3EXG2 4G26A 5BQ3A 3CF2A 4FC7A 4DSAA 3PCTA 2ODQA 1B26A 3LW8A 3NIDB 5FR2A 2IUYA 4HLUA 4MVWA 3TDKA 5KQLA 1FFXB 5KYGA 5KX5F 5KYVA 3ZGVA 1D5CA 2J3QA 4EY3A 4G24A 3DAFA 5DTJA 5HQ3A 2SNIE 4N47A 1E0DA 4DXDA 1A7UA 1JI3A 3CKMA 4BX9A 2BFBB 3MT7A 3CLUD 4D8WA 1KK2A 2F8TA 2E87A 4OCZA 1FJGB 1BEUB 3C6KA 4O29A 3GDGA 3C3JA 3LO8A 1TF2A 4Z0NA 3GY0A 2OESA 1W96A 4YJ2B 4C0BA 1H9CA 2X14A 3ZWOA 4HK4A 3RSFA 1MAVA 3O6VA 4URZR 2QLFA 3C0KA 3M5WA 3VR0A 4K87A 2IDJA 2JF0A 2EG5A 3IDZA 4YO8A 5K2MA 1N0IA 4DY4A 3LKBA 3DL7A 5KOIA 3G5MA 1HYGA 5BOVA 4BCDA 1VL5A 2GJSA 4JP5A 4P3XA 5JOQA 1SAYA 2PT9A 4BY9E 1IWOA 4WZBB 1M1YB 1IJFA 1EH5A 1GSHA 1Z2CA 4UHHA 4DC0A 2QZJA 4F11A 1ZCBA 4JXJA 3DUFA 3KXPA 2QZ9A 5FAXA 4C4SA 3UFXB 1WB5A 2VDNB 1AUXA 2P3SA 4YN3A 3A37A 4RTSA 1TKBA 4WNYA 5I4BA 4QDJA 3GPBA 2XLBA 1RRMA 1NBEA 1NZFA 2W2MA 5F9MA 1ECJA 5YASA 1X8XA 4Z53A 3OCWA 2GZ3A 2JHFA 4ID3A 5J4VA 1VJ0A 4OY3A 3PRKE 2Q1YA 5DT9A 3KYIB 1IVNA 2NTNA 5BRJA 2EEPA 2C92A 2H1FA 1XZJA 2W4MA 1TUIA 2G72A 3E9MA 3UK0A 3ZDQA 2E82A 1W0CA 1EZ4A 1GQQA 1GU1A 1KGSA 4KODA 2DHQA 1KI7A 4LSZA 5FRDA 3MRXA 3O26A 2ZXUA 4KH1A 2B99A 1HDYA 1ORHA 2QE7A 3FMGA 5FORA 1B4DA 1P4SA 1ODIA 1XGKA 3E5NA 3K0EA 4BNNA 1BU5A 3H5IA 3WRYC 2I7VA 5KNCH 4ALMA 3LHKA 4X65B 5K3BA 3SC4A 1LY1A 3CEMA 3DC2A 1UBHS 1QDLB 1MRZA 3PDCA 1DP4A 4MB2A 4MW0A 4OAPA 5KSYA 1SC9A 2VYNA 5AO9A 1V4VA 4KYUA 2A1IA 4L5CA 4YIHA 3KX2A 4RJ2A 5K1ZA 4R6WA 4LZJA 2ZREA 5FA5A 2B6NA 1RYZA 1TT7A 3KKZA 2E7ZA 3GLFA 4E5SA 2IU3A 1PW7A 1XZFA 4CVNA 4EF4A 2CT8A 9LDTA 2M6LA 3LCCA 1OZFA 2Q1TA 3BRWD 3KYJB 3RYTC 4FFWA 3W6ZA 1MW8X 3FYTA 1NXSA 3VR5A 1QANA 4FOOA 3JATA 1L5FA 3I5MA 5JSKA 5FUQA 3VVCA 1F8FA 5C7YA 1HQCA 4P3KA 3T5AA 3ASZA 1C9EA 2VHQA 5ALPA 1EU1A 4G85A 3LT4A 3PFBA 3TTYA 2W6ZA 4FJ1A 3ZLTA 4A1OA 4HKTA 2IYPA 4XCQA 4DFDA 1U94A 5TIIA 1ZXBA 3L7MA 3LHDA 1DCKA 4EHKA 1H23A 5I7AA 4EW6A 5B64A 5BWBA 3REQA 3T1TA 5F9HA 5BYBA 3DDOA 3QWAA 1PR9A 4Z8YA 1PT9A 1D1TA 2PSFA 3N7AA 3EJ6A 4EG8A 4LDNA 4ZXFA 1C9KA 3KRTA 3VAZA 2VHCA 3RJ5A 5LU8A 2CVPA 2ZWAA 1W6UA 1CB0A 3CB2A 1PZXA 5EJ2A 2B4AA 2O7SA 2FGKA 3CPEA 5LQNA 1KRWA 3OOWA 3PEEA 4GMHA 3LAWA 1KC1A 3FPFA 3MWEA 1EVEA 4YCSA 2AE2A 4UM8B 3CKKA 2X2OA 1BTOA 4UHKA 5CVEA 2LVBA 3RGWS 3H84A 3T9EA 1KR2A 2K87A 3QJYA 5EIAA 1RJWA 4XDGA 4DV1B 2OHFA 4M8SA 4NLLA 4M0FA 2WQ6A 1XWFA 1V3VA 1CDZA 1KS9A 2FJ0A 2R8OA 2XF8A 3Q6NA 4B3CA 5MF6A 3I5XA 3KAPA 4G09A 3CG4A 5IF9A 2F67A 1FSZA 4MWGA 1EZ1A 1PK7A 1Z5WA 3FOZA 5FYQA 2Z4RA 1TCCA 4IJ5A 1L5YA 2DWQA 4QYIA 5DTRA 2AKEA 1BMQA 1JW9B 4HTAA 1IY2A 4EA7A 3DT6A 2C7OA 2RK4A 2ODNA 3FPEA 1V96A 1HE2A 4LC9A 4PYLA 4M1TA 2Y6VA 5IM5A 1QUFA 5J5VA 1CVLA 2HR1A 3RC2A 2JCYA 1F8GA 3MBKA 3RYIB 5T41A 1JWBB 2WHQA 3IE2A 3MOIA 3RUHA 5JZMA 3GF4A 7GPBA 3ZDBA 3G7SA 3DZDA 5SV2A 2UUOA 2FFBA 1AA6A 2N47A 5FLEX 4QG7A 2BR4A 3WLFA 1F5NA 1OROA 1T3ZA 2A3NA 4OEHA 1FTQA 5FBWB 4KBFA 3UG7A 5F7OA 1O5TA 4PPQA 3DVSX 2Z3WA 1MPXA 4NF2A 5I9MA 5A02A 1KSGA 2WF6A 1BOOA 3AP1A 1Q1ZA 3AHEA 1UKAA 3ENWA 1MABB 1QH1B 5EVJA 1VXOA 3HB9A 1KEKA 2O06A 4WLEA 4BLRA 4U7DA 4G0MA 4PWYA 1JYSA 2I6FA 3OM9A 1UKCA 3I8XA 4CDRA 3RK0A 3UZUA 3VV3A 1EYZA 2EX1A 2PBFA 2PWAA 4GRDA 5CDSA 4LJ4A 1T9ZA 3UMBA 4KNYA 2FW0A 1QH0A 1GCGA 1COWA 1X70A 1Z6PA 2ODEA 3JAKA 2J7PA 3NKFA 4KQ9A 2CLDX 2GHTA 1RYDA 4PQFA 5AJZA 3L4BA 2XYRA 4PLWA 1PDVA 3LDUA 3AG6A 4W6ZA 1G2IA 3F0TA 3QOXA 3D9QX 4MHOA 5K8JB 4E0BA 1MA3A 3W04A 1JNXX 3BICA 3ZZUA 4PGGA 2R6CA 4WN9A 2WWFA 4BEVA 4L4RA 4N03A 2C8JA 2HA3A 1KJNA 4MKZA 1M73E 4PHGA 5AVTA 4FE7A 4C6HA 1CJKC 1PJ3A 4PC1A 3COPA 1ZISA 1XK6A 3G9XA 4MQMA 3RIEA 5ERXA 3H5TA 1QZZA 3IEPA 1A1SA 1B14A 1HORA 1S5PA 3QPAA 4ND6A 2ET6A 2CW5A 3M7IA 1LV7A 4R1LA 5LZ7A 3ZW7A 2DFNA 2JZCA 4CT4B 5KQGA 2JNWA 5KAPA 2R1VA 1FNDA 3FKSA 4YJ2F 3IR5A 4AIRA 2TS1A 2X86A 1VXRA 3Q3VA 1K3FA 3JWJA 4CIXA 2VQFB 5E6SB 2O20A 2Q6KA 2UXBB 3OIDA 1L1QA 4K2AA 4DTCA 2GPAA 1IZ9A 2Z2XA 3FI0A 4CI0B 3MCVA 5C34B 2C20A 1NF8A 1RACA 1PJ4A 4BX3A 2GOYA 2XMBA 3C5WP 3DOIA 1V5FA 2Q6VA 3UJNA 1A8PA 2XKJE 3S1AA 1AN0A 1DJPA 2HV8A 3D0QA 3NVMB 2GPTA 2RG1A 3T1YB 2O2GA 1N5MA 3BMNB 1AV6A 4G0VA 1RAHA 1LSUA 3H11A 4UVEA 5G3ZA 4LJ9A 4YUXA 5KB3A 3DLHA 1K7SN 3ETGA 2G9NA 4KACA 4CKWA 3R9XB 1EWTA 4IXNA 2DUWA 2YZKA 3B8HA 1NDHA 5I7VA 1H93A 2XIQA 2PXXA 4CM8B 1D3AA 3ISTA 1VJ5A 2CL0X 2R68A 4A15A 1FFWA 5HZKA 2BMAA 3DXXA 1TLTA 1DCMA 1A4XA 1YULA 3L41A 2QD3A 2QL6A 3KE9A 3ETJA 4REOA 1YB1A 4ZI7F 5LWQA 3NBYC 4P36A 1XKLA 3CXRA 3LBAA 4A6XA 2P9YA 1U8UA 1WABA 2BFPA 2Y99A 4CLXA 5C7IO 1ONOA 2GARA 2CUTA 3EPKA 1XP8A 2YOHA 4IIDA 2W2NA 4EG1A 2HUNA 2BGIA 4BCCA 3KKEA 3M9LA 1Y8CA 4E1AA 3MJSA 1R0LA 3M3PA 1WZUA 2WW8A 4F4DA 4ASUD 5F2NA 4DCPA 1EM8B 2DVMA 1V9CA 2HNBA 1LZKA 4O4IB 2FZKA 2WAXA 3WGQA 4ZJYA 4B7AA 5FPSA 3TRIA 2Q2VA 4OK3A 1F48A 1MB2A 1J22A 2QU8A 2VSOA 2VJYA 3WICA 4QGFA 3K8ZA 4I8XA 2HSZA 1Y4SA 4L2IB 1JIVA 1XD2B 2C9YA 3L6CA 1H6BA 3GELA 1RPJA 2YJGA 1ONNA 3FZNA 1HK7A 3K0BA 2ZRCA 5ENDA 3L1JA 3C39A 3PSHA 5IM4A 2HQBA 3MJEA 3RU2A 2DC1A 1CPYA 4HLUC 2EG9A 2H06A 2HJWA 3ZIUA 2GEVA 4QE3A 1FNNA 1OT5A 2AXQA 1Y3CE 2CVOA 3NI2A 3QUCA 4MAFA 4MGZR 4DABA 5ITZA 1Z74A 2VL7A 2Z58A 4IOLA 4TGLA 2R4QA 5BQPA 2IS4A 5AOAA 3VAYA 5FP0A 1OX4B 1PNVA 2SCUB 1C8BA 2IA5A 1XF9A 3HABA 3I52A 1OTXA 2AOWA 3B5JA