5TQVA

Crystal structure of nadp-dependent carbonyl reductase from burkholderia multivorans
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
225
structure length
225
Chain Sequence
MKTVLIVGASRGLGREFVRQYQRDGWNVIATARDDASLAALRALGAHAHALDITQPEQIAALGWKLDGERLDVAVVVSGVYGPRTEGVETIASDDFDTVMHTNVRGPMQLLPILLPLVEDARGVLAVVSSRMGSISEATGTTGWLYRASKAALNDVLRIASLQTRHAACISLHPGWVRTDMGGAQAALDPATSVTGMRRVIAEAGADVSQSNGRFFQYDGVELSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH-dependent carbonyl reductase
publication title Crystal structure of NADP-dependent carbonyl reductase from Burkholderia multivorans
rcsb
source organism Burkholderia multivorans (strain atcc 17616 / 249)
molecule tags Oxidoreductase
total genus 87
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2016-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tqvA00
3JYOA 2NSDA 3GN1A 5KJ6A 4YACA 5DT9A 1IPEA 1XELA 1XDWA 4I8XA 4WLNA 5ICSA 1TI7A 2O3UA 4PG7A 2OUIA 1XEAA 1EDOA 2HSDA 1ULUA 2C07A 1Z75A 2W2KB 3QWHA 1H0KA 1U5CA 4R68A 4BNTA 6LDHA 1MG5A 3OICA 1PGOA 1PWXA 1PIWA 3DZHA 4MVJI 5L3ZA 4Q39A 5A06A 5HRUA 1H6CA 2PK3A 5DBFA 4MPDA 3MWDB 3FWNA 3GF4A 4UVHA 5KWEA 1JVSA 1QYDA 3GPDG 3VVCA 1R66A 4GMGA 2VHVA 3W8DA 1PS8A 4CV3A 3E82A 3HFSA 3PGJA 2FR8A 3TWOA 3ENKA 4OXNA 5DCYA 2C5EA 1A7KA 3TZQA 3WWZA 3OIFA 1LDGA 5IJZA 1J6UA 3FTPA 4BUCA 4RV9A 4ZRMA 3H65A 4DXHA 2HMWA 3QP9A 4M54A 5G4KB 5T8KC 1DBVO 7ADHA 3ZWMA 3PYXA 2WWRA 3Q6IA 4YAKA 3AM5A 4QT0A 1FK8A 1CDOA 1DEHA 4L8VA 4EW6A 3ZWWA 4CLXA 2C0CA 2G82A 3S2IA 2UDPA 3G0OA 4E2WA 2ZB8A 3TL2A 4D3FA 1EEHA 2IXBA 3FF4A 3RC2A 4CMKA 1NR1A 1V3VA 1V6AA 2IZ1A 1Y7TA 3HSKA 3H2ZA 3NGXA 4XR9A 3TFOA 2XOXA 1JLLA 3V1TC 1UZNA 1ZK2A 4N7RA 5IAAA 2YDYA 4B4VA 2X23A 2DU8A 3DZJA 4CQMB 4W9NA 4IY1A 3DAFA 4EI2A 4A03A 1Q0HA 3PHHA 4B7XA 2Q4EA 1WZEA 5HS4A 5HBRA 4NBTA 4DIBA 2Y67A 3H5RA 4UAGA 2I3AA 4IQ0A 3S1LA 2BI7A 3JD2A 3MTGA 4CV2A 5JO0A 3LC1O 4OYRA 3H9UA 4NK5A 1E0DA 4PLTA 1QG6A 2Q3EA 5DOVA 3QW2A 5ER6A 3F9IA 5U9CA 2HK9A 3I23A 3JQEA 3C7AA 1NQAO 2OBYA 3F1KA 1C0KA 4JX8A 1H6DA 2W98A 5BNIA 1MXHA 1HDXA 2VUSA 4BNZA 1A9YA 2P91A 4K9DA 5F5NA 5JPIA 3PEFA 4XA8A 5TRTA 9LDBA 1LBEA 3E9QA 1ARZA 2J3JA 3FWZA 1E7SA 2B0JA 3R6DA 1ZNQO 4YJFA 2HDHA 3HFGA 2Z5LA 4CL3A 3RJ9A 4YRBA 1NPDA 1TVEA 4MOWA 1SCUA 4KTTE 2Q46A 3GMDA 1G0NA 2O2YA 2HUNA 2OMEA 4GI2A 5HWSA 1U3WA 2GZ3A 3TZKA 4FQ8A 2VUUA 4GVXA 3H8VA 3MOGA 4BO7A 1JN0A 3GY0A 3CTMA 4L74A 4YAIA 2HMSA 3KUXA 4UVDA 1AHHA 3QQPA 2QX7A 4XIYA 1NHWA 3OFSA 1JAYA 3KEOA 3VPXA 4KQWA 1ZK0A 5ER9A 2HMVA 2Q2VA 3H5NA 4WCFA 5EQDA 1U3VA 1HDOA 3D5QA 5BSEA 2QRKA 1UXJA 4FJ1A 3F4LA 3RUIA 4GX1A 5JAZA 3OEYA 4AJNA 1EVJA 3W4JA 1P1JA 3RFTA 1IL0A 4QEDA 5FYDA 1DSSG 4N5LA 3ZNOA 3COSA 3BHJA 3OSUA 2HRZA 3ITDA 3KLPX 3RBXA 2JCXA 1ZUD1 2HAEA 4W99A 1GEEA 4WLOA 4DVJA 2PY6A 3WDSA 5HTOA 3LVFO 3JQBC 2JCVA 4J4BA 2C7GA 4ID9A 3VKVA 3ORFA 5L4SA 5CHEA 4KUHA 4R3WA 5F1OA 2WJPA 3OMLA 3JQ9C 3GG9A 3H4VA 3UGKA 3WQSB 4PLYA 4IDBA 4CLHA 3KETA 1T1RA 3WX0A 4YJDA 1VPDA 1U28A 2JFHA 4YT2A 2CDCA 1P1IA 1DC3A 3AY6A 4NFHA 1V3UA 4PG6A 1R4NB 4HFRA 4JJFA 2NNLD 1DXYA 4DIOA 3BMCA 3AOEA 4MIOA 2GN6A 3O8QB 4AJEA 3RJ5A 3DMTA 3C85A 3L9WA 4BV8A 5H82A 2FSSA 1KEVA 1OAAA 3UXYA 5JC1A 1L1FA 3EVNA 2C59A 2VWPA 4D0SA 4Z0TA 4ZD6A 1LUAA 1I32A 4OQZA 3VH3A 5CEJA 3PQDA 4MIYA 2AMFA 3DB2A 3W8EA 3ONFA 3JYLA 3EHEA 4OXYA 3KYCB 4QUKA 2VRCD 2J3HA 5G4LA 1NYTA 5ADHA 3LLSA 1X7GA 4XRGA 4QXMA 3TZ6A 1DFHA 3OJFA 3MEQA 4MP6A 1GPDG 3VAZA 5BSGA 1B14A 2QYSA 1Y81A 3VPHA 3U4HA 1HE5A 4ZQGA 2O2SA 1L7DA 4KP7A 4N5MA 2X5KO 2HU2A 4WLVA 4PG4A 5THQA 5B4UA 1ORRA 2ZB3A 4J6FA 1JTVA 2IDZA 1PR9A 5JE8A 1G6KA 3OM9A 2IODA 2XXBA 4Z3KA 3I1JA 1U4SA 5DDIP 1E1LA 1DLIA 1U1IA 2AE2A 5B1YA 1OOEA 4DTIA 4TVBA 3ZV6A 1P9LA 3BTOA 3OJLA 3RWBA 3T7EA 2EW2A 4KUEA 5A9TA 3JQ8A 3WXBA 3QWAA 1BW9B 5ITVA 4OOFA 4U0KA 1HDGO 4MVJH 1KC3A 3ETDA 5EIOA 3U3XA 4WJZA 1E7MA 4IBOA 4DYVA 1XCBA 4X54A 3FNGA 4PLHA 1HSZA 2DVMA 4BQRA 3NYWA 1YKFA 2GZ2A 1ZXBA 3VPFA 4DQXA 1O5IA 2J5RA 3I3OA 4IM7A 4J7CA 3QE3A 4WKGA 2H1SA 4CLOA 1DHTA 4FFRA 4BNLA 4CM8B 3QVOA 4D41A 1HWYA 5F1PA 3U62A 1LRJA 4FW8A 1GDHA 3WLEA 1J5PA 2ZK7A 4FC7A 5FWNA 4NK4A 4NJMA 2DUUA 1QYXA 4CM5A 1Y9EA 1Y9AA 4II3A 4PLPA 2EIHA 4YWJA 2OXIA 4BGUA 4XDYA 4WUVA 4GKBA 4YBZA 1FXSA 1T4DA 2ZB4A 3P2OA 1C1XB 3DTTA 2D5AA 3DOCA 1YBVA 1YJQA 1ZEJA 5ENDA 4B7UA 1KVRA 1YBMA 4XRRA 4E21A 2P68A 1E1KA 4PRKA 1XHLA 3WFJA 1VSUA 3UFXA 2EP7A 3FI9A 2RAFA 1ONNA 3AFNA 1HZJA 4XEHA 1C1DB 3D0OA 1UXKA 3KYDA 3G1TA 5LCXA 2WMDA 1O0SA 2CFCA 2CF5A 3HN7A 3OECA 4RF5A 3JTMA 3UF0A 4XIJA 2AEFA 4CMBA 5G0SA 2ILTA 3Q3CA 3TOZA 3KRTA 2HMTA 5IZCC 3DBLB 4R1UA 3ZW9A 3VTZA 2YW9A 4NIMA 4IMRA 4U6QA 1T26A 5L51A 4CQLB 3H9JA 2RHRA 2O3SA 2RBEA 5KJEA 3GN2A 4MKXA 4BO3A 4CMCA 4BNVA 3GAFA 3WMWA 2BF7A 4OO3A 5IG2A 1DIAA 2P5YA 4XYMA 2Y0CA 1S6YA 1ZSVA 3ZW8A 4CM1A 3EYWA 4OGWA 2OHXA 3ZWBA 1M6WA 4E2ZA 2QQ5A 4YJHB 3EY4A 2X5OA 4RPHA 1SPXA 1M75A 4DMMA 3I83A 2GYYA 5IF3A 1VE9A 3G3EA 5T64A 2POQX 2VN8A 2UYYA 2O3TA 4J4TA 5BSFA 1NR7A 2VRBA 4LISA 4PLVA 3KYBA 3MOIA 3OA2A 3ROKA 1BDBA 2BKAA 4PGFA 2R2GA 4FR5A 4J91A 5A3VA 2I65A 4QSMA 1GYQA 1PJ3A 3PHIA 1R4MA 5T5QA 5GZ3A 2H6EA 1YWGO 1B26A 2XXJA 5C37A 1ZK3A 3HZZA 5JSFA 2EF1A 3NT4A 1NTOA 4Y6RA 3O03A 4BNJA 5CEEA 5DBGA 3VH2A 1DAOA 4Q3DA 1NWHA 4ALKA 5L95A 1YOVB 1ADBA 2J5KA 3GHHA 1T4BA 4KQXA 4NU6A 4BO6A 2A4KA 3DOJA 4EEZA 1AXGA 2CMDA 1GEGA 2OFPA 3DR3A 4J16A 4QFDA 4CM3A 1IULA 1ZXLA 3KXDA 4INAA 6ADHA 4LMPA 3PYMA 4CM4A 4D44A 2Y05A 2C82A 2H5LA 4QO8A 1M6HA 4GX0A 4RQUA 2GPTA 1SB8A 4BMVA 1LLQA 1PJ4A 5LC1A 3B1FA 3GHYA 1FDVA 2JJYA 1KVTA 2NVWA 3MTJA 4A27A 4FCCA 4KZPA 3IS3A 5F5LA 4IDFA 3P19A 4NQZA 3QY9A 3V8BA 2XPCA 3W6ZA 4B3HA 1ISIA 2PTGA 4YAJA 2A92A 2WTBA 2VHWA 3GRKA 4CMIB 3PIDA 2EEZA 1DIGA 3FPLA 3A14A 4GPD1 1I10A 4K6FA 2ZQZA 1SC6A 5G2OA 3ZDFA 3JQ7A 3VZSA 4XKJA 3ZHXA 4BKPA 2AXQA 3GNQA 4J1QA 1TEHA 3U4DA 3BA1A 5EJ2A 3UN1A 3VZRA 4JBIA 1GZ3A 2Z1NA 3P2YA 1UDBA 2HQ1A 3AFMA 4RVFA 4RVHA 4CUKA 2B36A 3LT1A 3GR6A 4RF3A 4YDRA 2VHZA 5IDQA 3NGLA 1B3BA 1WPQA 3LYLA 1QLHA 1SNYA 1BXGA 2ZB7A 4DA9A 4OMUA 3KHUA 3M2PA 1AXEA 4I5FA 4R1SA 2NVUB 5IFLA 2RIRA 3ZWYA 3KB6A 1QYVA 4OKNA 3O9ZA 3FBGA 1P74A 4CUJA 3WSWA 1BVUA 4ONEA 4I5DA 1X1TA 1TT5A 1O8CA 1ZMTA 3GAZA 5TT0A 3NT2A 3OJ0A 4LW8A 3I6QA 2EKQA 2V6GA 5DULA 2D4AA 1EVZA 4H7PA 3GC6A 2HLPA 4IJWA 5DNAA 5U4QA 3UVEA 4E5NA 2ZIZA 1ISHA 5JDIA 1ZJYA 4BQPA 2FSVA 1B15A 1PZHA 1YQXA 2J6IA 4PVCA 1TT7A 2GCGA 1GCUA 1NNUA 1XA0A 3DDNA 4J4HA 5BSHA 4BO5A 1F8GA 5A02A 4FIZA 4IINA 3S55A 3C1OA 3PVZA 1BMDA 5C5IA 4OOEA 1I3MA 1VLLA 3D3WB 9LDTA 1F12A 3GDFA 3PLRA 4J9UE 4J1NA 5JXWA 2PZJA 3GNTA 2YFHA 3X2FA 1GUZA 3QWIA 3B70A 3HJAA 3PZRA 4IZHA 1I24A 1UR5A 3STHA 2WD7B 4G5HA 1VKOA 3SC6A 3C1TA 4TRMA 1T25A 1M67A 5T57A 2LDBA 1LSSA 3DZIA 3B6ZA 2VCYA 4CMHA 1RM3A 2I3GA 1U8FO 2J3IA 4XQCA 1OMOA 3L77A 3GG2A 2W2LD 2DKNA 4TZKA 1X13A 4MVJE 3I9JA 1UJMA 3ON5A 2GZ1A 3VDQA 5JS6A 3W4IA 1Z6ZA 4JLWA 4R01A 1HL3A 2BGLA 1ENZA 1A9ZA 1PWZA 1SEPA 3IL2A 1W8DA 1ZZEA 1H6BA 3HN2A 4RDHA 4YB8A 2WE7A 5K6AA 1RWBA 4FFMA 4DLLA 5KCZA 1K5HA 4P4GA 4L75A 1P44A 1P1HA 1H94A 2A35A 4XB1A 3CMCO 5JYEA 2ZTLA 4Z9FA 3WMXA 1GYRA 2YYYA 3FN4A 3WGHA 4L76A 1Q7BA 4GGOA 3WLFA 1LLUA 2P9GA 1LX6A 5TX7A 3FTNA 4LVUA 1I3LA 3NAQA 4CL8A 1UP4A 1HLPA 3ZNPA 4CR8A 2BH9A 1I2CA 3RVDA 1WAMA 4XQEA 5KKAA 4D42A 3IUSA 3JYNA 4Q3BA 1DIBA 3A28A 4J90A 3RD5A 2OOSA 2I99A 4GGPA 4R9RA 4YEDA 4EZBA 4PLFA 2QIOA 2PGLA 4L9RA 4DBZA 4RPLA 3ANMA 2IE0A 3OH8A 3L4SO 3L4BA 2X7HA 3GLQA 4N18A 2P2SA 3QWBA 1KC1A 1SMKA 4RJTA 1XU7A 1XR3A 3DMTC 4GQAA 4CM9D 3MJVA 3H9QA 3E8XA 1UP6A 4A26A 3B20A 4IJUA 1XG5A 2Y1CA 4R4JA 3TFQA 3CEAA 1LEHA 4Z6KA 4WEQA 4GKVA 3UOGA 4RVGA 1GADO 1E6UA 1XGKA 3VKUA 2VWGA 2D0IA 4BO0A 1ADCA 2DPGA 5IXYA 3I5MA 3SBOA 4RPJA 2VUTA 4O0LA 2Z95A 4PLWA 4OSOA 2C5AA 4M89A 5AXCA 4MVJA 2OP0A 5A03A 2O48X 5G0WA 2BD0A 3QWFA 4Q3AA 2DBQA 4XJTA 1U7TA 2O4UX 2C7VA 3NUGA 4DIFA 1FMCA 2B35A 2PR2A 4PLCA 3ONDA 3DOOA 2EKLA 1LSOA 1HT0A 4UULA 1EBUA 5ICMA 1H93A 2EGHA 2ET6A 4DYDA 3Q2IA 3JQGA 4FFPA 4J43A 3A06A 5TLSA 4F6CA 2YFQA 2VT2A 4NPCA 4EYEA 1WW8A 1PJQA 1CRWG 3GH3A 4GWGA 2B37A 4AJ2A 2B83A 3FD8A 3IKVA 1DOHA 4P8RA 1MC4A 2DBRA 4IGEA 3B1KA 3ITKA 3KM0A 5U1PA 2NQ8A 4WOJA 3IAHA 3DFUA 3PXXA 1V3TA 2D59A 2GN4A 5B4TA 1CQIA 5CFZA 3WQRA 3TZCA 1I3KA 3GFBA 1MA0A 2Y1OA 5A9RA 1LDNA 1UAYA 4ALNA 4RLHA 3UCFA 2HK8A 3ZNQA 1ZO8A 3EAGA 3Q0EA 1BRMA 1XQ1A 1SOVA 3QVWA 3BMQB 1ISGA 3C24A 2Q4BA 4GMFA 4RF2A 3AUSA 5MGBA 1YO6A 1D1TA 5FI5A 5FF9A 3A1NA 4L0QA 4OHUA 4U8GA 1LSJA 1OFGA 5EL0A 3V2UA 3MJEA 1R0SA 1PZEA 1PGNA 3WGIA 2B4QA 4NBVA 4BNXA 1LU9A 3D7LA 2NTVA 5CPBA 2ZCVA 3JCZA 2GN9A 4BO1A 2NU7A 3ZWAA 5CDTA 3JQDA 1ISMA 4ITUA 3HDQA 4S1VA 5H83A 1O6ZA 3C7DB 1IZ9A 4TQGA 1ZMOA 2NQTA 3GUCA 4UREA 1C0LA 5BNTA 4JBHA 4F45A 4C7KA 3UCEA 4QQRA 1E6EA 3QRWA 2WSBA 3ZV5A 3PHJA 4ND1A 3GZNB 2B5VA 1C0IA 3Q9UA 4TVOA 2R6JA 4O1MA 3WB9A 2G17A 3GNSA 3H5AA 4NU5A 3VDRA 3JD4A 3K6JA 4E3ZA 3WSVA 4IMPA 4ROSA 2EJWA 5DOZA 3LF1A 2DFVA 2OZPA 4I5EA 4JJGA 1PZGA 1UAGA 1YL7A 3UAGA 1PQUA 4JN6B 1JA9A 5F3RA 1N1EA 5CPFA 2NUAA 3SVTA 1A72A 2YV2A 4NBUA 3ICCA 5CEFA 2UUOA 3NDRA 3D4NA 4TRNA 3G49A 3AW9A 3PI7A 3PDUA 4K1LA 5C7OO 2VZ8A 3GEMA 4ND5A 3BZUA 3KEQA 2W2KA 2PGDA 4WASA 3INRA 4JROA 4FDAA 4QFCA 3ZWPA 5KTKA 3VZQA 4NFSA 3F1LA 4UEOA 1MFZA 4BB5A 2FWMX 4BGIA 2BRUA 2E82A 4ZICA 3QJ5A 3I9LA 4Y9DA 1AUPA 4LRTB 2H63A 2BFOA 2WD8A 3KSDO 3H7AA 3O26A 2AEMA 1YDWA 5DCUA 5C3MA 5JLAA 5LDGA 2NU9A 1I2BA 2NVBA 4IIUA 3RC1A 3WWYA 2XF8A 1N7HA 4IS2A 3CKYA 4ZRNA 4A7PA 1W73A 3OIGA 3EW7A 1YRLA 4J3FA 5G4KA 3X2EA 1Y6JA 5CG1A 4AJLA 1BHSA 2BHLA 3GVCA 1AE1A 5DP1A 2PZMA 1LDYA 1T2EA 1CETA 4E0BA 3RI3A 1N2SA 3OJEA 1A5ZA 4C7JA 2E48A 3NJ8A 2PH3A 1Z74A 1PR3A 4W7HA 2JAPA 3QVXA 4IUYA 4NR0A 1LTHR 4QO7A 4BB6A 2QG4A 3GK3A 3CSDA 1HF3A 4ZQEA 1IZ0A 1EZ4A 1NM5A 1NQTA 3K96A 1P45A 5CP8A 1ZSYA 1E5LA 1A27A 1P0CA 3M2TA 1WMBA 3U5TA 2V65A 3C7CB 3OEWA 1R12A 5G0VA 4MKRA 5A4DA 2FR0A 4CLOB 3BMOB 3PK0A 2NTNA 3BMNB 5JCJA 3FNFA 4BO4A 1EBFA 4K6CA 1HETA 4A0SA 2R00C 1YL6A 4CQMA 1VSVA 5DN9A 5A5EA 5L4NA 2P4HX 2O4CA 3RCBA 3ADOA 5KVQA 1C0PA 1JKFA 3A4VA 1N9GB 4NJMB 1JWBB 5I9LA 3PGXA 1GUYA 3AI2A 2BFMA 5JAQA 4BNKA 4I1IA 5TSDA 2Z1MA 1MUUA 2ZYAA 4IDDA 1I2ZA 3UH1A 4F6LA 1R6DA 2QRJA 3AI3A 1N5DA 1PX0A 4AG3A 3DBHA 5KVVA 1B8PA 2X86A 4H16A 3DWFA 4F46A 3BHIA 3WJ7A 1PTJA 3JQFC 5F21A 3JSAA 3ENNA 1IYZA 2X0NA 2FZWA 4WK6A 3OHSX 1VJ1A 3WICA 3ZH2A 3EMKA 3RC9A 3W4KA 2GUGA 3WYCA 4AL4A 2DC1A 1HTBA 3PDJA 1RM4A 4RCVA 3KYDB 4EJ6A 3E6AA 1PS9A 4P4LA 3H6KA 2FY8A 1U2DA 2VT3A 4GL4A 4ALLA 4OXKA 4NBRA 1YBAA 2J3KA 4YQYA 4YTEA 4AJ4A 2NU8A 4GX5A 5THKA 1HYEA 2O3QA 2P4QA 3HUDA 4R1TA 1GAEO 5L53A 2EGGA 2JL1A 4L4XA 1SEVA 3T4EA 4GAEA 4BO2A 2IYOA 2EP5A 3KOUA 4AICA 4R16A 1B8VA 4FJ0A 1EDZA 4D7AA 3WFIA 5JMPA 1E1NA 4RVDA 2PD4A 2VNAA 1CJCA 3K9QO 4TMFA 2X9NA 3EZLA 5COQA 3RU9A 2HO5A 2BGKA 5JY6A 2FMUA 1WXDA 4HFJA 3VPSA 3S2FA 5CDUA 4M49A 3O4RA 3G79A 4Y8VA 4YPOA 2P9EA 3Q2KA 1Y8QA 1MP0A 3CPSA 3V5NA 4NBWA 1YQDA 2C54A 1ZK1A 1O94A 3FPCA 3C1AA 3WIEA 2AQHA 4B8ZA 1DAPA 4J0FA 4E5MA 1PSDA 1E7QA 2VHXA 3CZMA 3M6IA 2DTXA 4D46A 2A9FA 3P7MA 3IOYA 3PZBA 5FEUA 3KSUA 1P1RA 2PGJA 8LDHA 1E77A 1E1MA 1XYGA 3ST7A 2RH4A 1RYEA 4FPXA 5AXBA 3TZHA 2IXAA 1TB4A 3ULKA 4YRAA 4MINA 2AQ8A 1E3WA 5TQVA 4RLSA 1VL0A 1R0LA 4DPKA 1DHRA 1DLJA 5EESA 3ZU4A 4UVGA 5EPOA 5EQFA 1YS4A 1GZ6A 3HADA 4IDGA 4MVJD 5A04A 1F8FA 2UUPA 5K6AC 2P9CA 3QV1A 2LDXA 4XWYA 2PD3A 3K30A 1ONPA 2QHXA 4AJPA 4Y98A 1T2DA 3OQBA 2ZCUA 1BGVA 1W4ZA 1JVBA 3I9MA 4LGVA 3ZU2A 3GGOA 1FF9A 5COAA 4BKUA 3CMMA 4OKIA 3ROQA 4A5OA 4CM4B 1V35A 2G1UA 2JD2A 3O8QA 4AJOA 4W82A 3V1UA 3GGGA 3N74A 5JAIA 3FBTA 4JK3A 3K31A 1PGPA 4S3MA 1ZBQA 2DUWA 1ZVMA 3QIVA 4RPKA 3GVHA 3VH1A 4B3IA 1EK6A 4XCVA 4W4TA 3KBOA 3VH4A 4HBGA 4AJ1A 1B3RA 4MP8A 1ULSA 4UUPA 1PJBA 4LN1A 3ZCXA 5JY1A 4P4NA 2GD1O 3E18A 3L4BC 1CQJA 3JQCA 4XR4A 1TLTA 4GBJA 4IGFA 3P5SA 2PH5A 4XYBA 4NMHA 4MDHA 5ENVA 1T2CA 5MDHA 3D1LA 1LC0A 2NACA 1YONA 4DGSA 4FC6A 4KTVE 1F06A 4IQGA 4WCDA 3JQ7B 1NPTO 2NTJA 3PJGA 3SLKA 4JXKA 3JQ6A 1C14A 4RZIA 2YJZA 1PJTA 2QW8A 3IP1A 1HDYA 8ADHA 3LZ6A 4O63O 3GZ4A 2CVZA 2PKRA 4LK3A 3AUUA 4HWKA 3KZVA 3OIDA 1GQYA 2Q1WA 4RGBA 5F1KA 1E92A 2X4GA 1BDMA 4ILKA 3WGTA 3ROMA 3ZI0A 4D0RA 1NVTA 3HB4X 4WEOA 3E03A 3E5RA 1V9LA 1X14A 4CR7A 1AN9A 1U3TA 4YJGA 4BO8A 1IHXA 5A9SA 2O7QA 2BFPA 3M1AA 3E9NA 3G1UA 1UUFA 3IIEA 4IJKA 4O6VA 4EITA 5DF1A 2CY0A 4FJ2A 3DTYA 1I8TA 4Q3CA 1CERA 1HLDA 1HDRA 3HWRA 3ADPA 2W90A 1ADGA 1UH5A 1D3AA 3WNVA 3I9KA 5TJ9A 3CE6A 2OP1A 1NWCA 5TJHA 5AOVA 1VL6A 4HNHA 4R5HA 2I76A 2X0JA 4TRJA 2Q99A 2FOIA 3BAZA 3JQAA 3GVPA 2EERA 1LDEA 3A9WA 3BYZA 3PHGA 1P3DA 3IQDB 4BOYA 4FFLA 2HMUA 2UAGA 4HKTA 4J2HA 5TF4A 1TXGA 2JD0A 2UV8A 3CXRA 4NI5A 1GPJA 1NFFA 3WBBA 2BMAA 5L7YA 4H15A 4ZJUA 3HDYA 3E5MA 3ANNA 3S2EA 1XQ6A 4WECA 1LA2A 2VWQA 3JD1A 3PQEA 3NDIA 3F5SA 4IXWA 3JQBA 4P38A 3DBRB 4BVAA 1K6IA 1DC5A 2HK7A 4ALJA 4Y6PA 1UXIA 3WOHA 3SJUA 3DXFA 1EQ2A 1IOLA 2JHGA 3M1LA 3WIDA 1R0KA 3OP4A 2YQ5A 1HE4A 1HXHA 4RL6A 1GQ2A 1LLDA 3H9EO 2X9VA 3RUDA 4O5OA 4XYLA 4M55A 4CODB 1LDBA 1MLDA 1P33A 1PU2A 4HXYA 4CLRB 4CLEA 3GQVA 3DZFA 3NRCA 2EKPA 1ISFA 4W9NC 3V2HA 2TMGA 1PJSA 3EC7A 2EV9A 4MIEA 4G81A 1G1AA 5FFFA 4RQTA 3AOGA 5TS3A 4JQCA 4Q3NA 1A4UA 4WPGA 1PJ2A 1BXZA 1E7WA 4UEJA 1VL8A 1E5QA 1L7EA 2DBZA 4BNUA 5IZ4A 1P0FA 2FPIA 5IDXA 5L4LA 5TIIA 2GASA 3RKUA 1Z45A 2A94A 4I9UA 1KVUA 5B37A 1Y5MA 1Y8RB 1D4FA 1IB6A 2NLOA 5HM8A 3SXPA 2CZCA 4E6PA 1YDEA 2RCYA 2EW8A 3GT0A 2BGMA 4DBVO 3RFXA 4E31A 3W6UA 3RUHA 1MV8A 5COBA 3ZHYA 3NDJA 2Y93A 4MJLA 5DBIA 4BL5A 4HFNA 2YHIB 4F3YA 1OBFO 1XLTA 4GVLA 3T7CA 3AUTA 2PLAA 1PGJA 2X9GA 3C8MA 1DDOA 1OZAA 3WQQA 1J4AA 5G0TA 4CUZA 4E5KA 3PP8A 1JW9B 2WM3A 1EVIA 1QV6A 1IPFA 2JKVA 3LDHA 4J1SA 3DHNA 1LNQA 3QVSA 4NG5A 3UKOA 4YXFA 1LLCA 2ZYGA 2J8ZA 3IJPA 1LQTA 1DJQA 2PKQP 3BTVA 4R3NA 2AQIA 2VYVA 3R3JA 3INGA 5A5FA 1KS9A 3F47A 2XAAA 5GY7A 2IZ0A 4TZTA 3LSYA 4WCFC 4AJIA 4FBGA 1GV0A 2D8AA 3TL3A 2ZQYA 1SZJG 1QORA 3K92A 4YQZA 2Y1EA 3SC4A 1HEUA 4TWRA 4J7XA 2CSUA 2DTEA 1HE3A 4BKQA 1ID1A 3GGPA 1KEPA 5AVOA 3VHRA 3O38A 4GH5A 1GYPA 1ENPA 1KVQA 3QHAA 3WGQA 3OJOA 2AHRA 1TA4A 4OAQA 4KDFA 2VOEA 1X0XA 5FI3A 4J2OA 3RUEA 4BV9A 1BXKA 4U6SA 1I0ZA 5TC4A 3U09A 1JWAB 1NQ5A 2BELA 1LJ8A 1MB4A 2VRCA 4BNYA 4E30A 2VYNA 3FRJA 1PL8A 2PZKA 3ZU5A 1LXCA 2I67A 1UZLA 5IN4A 4RO0A 2YQ4A 3ASUA 1M66A 3AOEC 3DQPA 1ZFNA 3JYQA 3GVXA 1QRRA 1R16A 2EHDA 3OQ1A 4M8SA 4JJIA 1QMGA 5EMHA 3GPIA 1T2FA 5JAMA 4TKLA 1Q0QA 1KBZA 4K26A 5IZCA 3TNLA 4ALMA 1GY8A 3T4XA 2Y68A 2FHSA 1GR0A 3LK7A 5JMWA 1AHIA 4BKOA 1NBOA 4CMAA 2IRWA 2NV6A 2PKQO 4AVYA 4ZHSA 4MP3A 2VQ3A 2DM6A 2F1KA 4KMSA 3GFGA 3EGOA 3GEGA 2HCTA 1CEQA 1U2GA 1I36A 1UDAA 4DLBA 3AU9A 5JDCA 1Z7BA 2Y0DA 3K2BA 1QV7A 1Q0LA 2JD1A 5AQ1A 5H81A 2AEJA 2X22A 4AJHA 2W8ZA 4YVFA 1V0JA 4I9NA 3WYBA 1YE3A 3HQ4O 3AY3A 2GNAA 4R51A 4LCEA 1ZIDA 3D4PA 4ZN6A 4GSKA 1Z7EA 1DRUA 4BGVA 3D4OA 3KO8A 1I3NA 3LT4A 4OM8A 4XZ3A 1KY5A 5JYDA 3RUAA 1Y5RA 2FN7A 4EEXA 1IUKA 3PFWO 3OBBA 2JFFA 5KOIA 5JCXA 3PHLA 1ZSNA 2QZ9A 4HADA 5IXSA 2EG9A 1NAIA 3FR8A 3GA0A 1UXGA 1ONOA 3DHEA 3DFZA 3WG9A 3D3EA 2X1HA 3N58A 3CH6A 2C29D 4B79A 4JGBA 3G17A 2NU6A 2B4RO 1ZEMA 4MVJF 4HUJA 4YJFB 5A1TA 3E9MA 4P22A 5I9NA 4A73A 3KTDA 4C4OA 5DP2A 5I7FA 3IP3A 3PYLA 3FR7A 4RORA 1N7GA 1VJ0A 5DCWA 1DO8A 4FOSA 5TNXA 3WTBA 5L9AA 1B2LA 3GRPA 4J9VA 3GDGA 2E49A 1YVEI 4KDEA 4FOOA 2YY7A 3DZGA 1Q7GA 4D45A 3RQSA 3MZ0A 1VRWA 3V2GA 3QLJA 5ES3A 5KKCA 1ML3A 1YB5A 4EGFA 2C2YA 3AU8A 3KV3O 3RSHA 4UUMA 1HSOA 4YRDA 1OC2A 2GDZA 2CDAA 4WCFB 1ZH8A 1NAHA 4BKRA 4I5GA 4IPTA 4JBGA 2Q1TA 1D1SA 2WEKA 3HDJA 1KY4A 4XGKA 3R0IA 1MC5A 4CMEA 2JAHA 3S2GA 4BNMA 1UDCA 4G65A 5I7VA 3LU1A 3DO5A 3NV9A 4XDZA 4M87A 5C7LO 4IS3A 1H2HA 1X15A 3JQAD 3TJRA 3Q11A 2IEBA 2TMDA 1M2WA 2X5JO 3RUFA 4MKZA 3ABIA 3E48A 1K3TA 3HB5X 1YB1A 3DEYX 3ONEA 4GWKA 1QSGA 4WLFA 1GTMA 4OH1A 4FD3A 3RROA 3PPIA 4YAGA 1JQBA 1P1KA 1SBYA 3PJDA 4ZU3A 2IYPA 4XQGA 2CD9A 3QA9A 3BMCB 3ZWXA 4E33A 5A3JA 5CDSA 1I30A 3NEPX 2HJSA 1O95A 4XB2A 4CM6A 3IKTA 4CR6A 4OIMA 4PZEA 1U7HA 4ESOA 3DBHB 4NH4A 2GN8A 1UXHA 3F3SA 3HG7A 4YA6A 4DPMA 2X0IA 3KLMX 1PJLA 4CJXA 4ZVVA 4R1NA 2HKIA 2CF6A 1JAXA 2E6UX 4DQUA 5HA5A 4CPDA 1EQUA 2B69A 2QZZA 3U0BA 4KWIA 2Y66A 3WBFA 3L6DA 2Q45A 1A4IA 7MDHA 4IQ8A 5LDHA 4EJMA 1BWSA 3UW3A 2OGUA 4BNFA 3K2EA 1WZIA 4DC1A 1PZFA 2GR9A 3F5QA 1RPNA 3NTOA 2E4AA 4I08A 1WP4A 2AQKA 2GGSA 3BMQA 3UUWA 4B3JA 1I01A 2O7SA 4BO9A 3WGZA 2V6FA 1O9BA 4PFJA 3AJRA 1HZZA 1LRKA 4XJSA 2Q1SA 2D3TA 1CF2O 4FS3A 3OF2A 3PJEA 1VI2A 2AG5A 5CAEA 1PL7A 2AA3A 4XGNA 2V7PA 4ND4A 1BTOA 3JQ8B 3UHAA 5KVSA 1NASA 2ZYDA 4DPLA 4PZCA 1YJ8A 2GSDA 1J49A 1DFIA 1ENOA 4RZHA 4UUNA 1Y8QB 3RFVA 2Y99A 1GL3A 3RC7A 1RM5A 4IDEA 5L40A 3W8FA 4DWVA 2Q50A 4GSLA 3H3FA 1F0YA 3LQFA 5BT9A 2YHUA 4Y6SA 3PTZA 5ITWA 1B7GO 3TRIA 4HP8A 3DAGA 3GZNA 3EDMA 4Z3DA 2CDBA 1QLJA 1D7OA 1YGYA 1YQGA 2X58A 1WDMA 3BHMA 4DQVA 4DUPA 1E3WB 1DB3A 2WYVA 5HS6A 4UVIA 4BMSA 1NX6A 3BIOA 1T24A 3ANLA 3B1JA 2CVOA 1U4OA 2FZEA 3WGOA 3PRJA 2NADA 4HNGA 4IXTA 1X7DA 1HDCA 3OA0A 2VYVD 3R3SA 3HNPA 4BNIA 4II2A 4B4WA 4R54A 3R1IA 3EUWA 2VOJA 1KERA 4K28A 4D3DA 1PGQA 2B4TO 4U7WA 4J1TA 1HYHA 5BQFA 4XYGA 1U8XX 3F6YA 5EINA 1QYCA 2GLXA 1MGOA 3MCVA 1F14A 3GMSA 1HDZA 1X0VA 2Y1DA 3IJRA 2P5UA 3AM4A 2SCUA 4ZQBA 5A05A 4JP2A 4AFNA 1VM6A 4PG5A 5KJ1A 2DT5A 1QYWA 2W2LA 4L73A 5JDIC 4BMNA 1XSEA 2JCYA 3TDKA 2G0TA 3AM3A 1EFLA 2IZZA 5AXDA 2VZ0A 1FDTA 3ZWCA 2CUKA 2CVQA 4EUFA 3LT2A 4FFOA 4WNIA 5GMOA 3TPCA 2VYND 5TT1A 2F00A 1WDKA 3ICPA 2Q2QA 5CG2A 3S8MA 1U9JA 1DC6A 2G5CA 3RKRA 2FR1A 2J5QA 3PIIA 4O59O 5JO9A 4A2CA 2WDZA 3ZNNA 1HYGA 4MVJM 2PNFA 1P31A 1Z73A 4KOAA 4NNJA 3KVOA 3EK2A 5J23A 3GEDA 2BLLA 3DBVO 1AGNA 2I5PO 4QX6A 3ZN2A 5KJFA 3PQFA 1KOLA 5EN4A 4LMRA 1JKJA 1A71A 4XYEA 1WLYA 3BTUA 1R37A 2AG8A 4BNHA 2RH8A 3W1VA 3WS7A 4R5MA 2YV1A 1E7RA 1R4MB 2DPHA 2GRAA 2EXXA 2VHYA 3PLNA 3L6OO 3DL2A 3WTCA 4CLDA 2DLDA 4TRRA 1C3VA 5KIAA 3UICA 3NJ4A 2E37A 4YJGB 4B8WA 3ZWNA 4U5QA 5A9SB 1GUFA 2YV3A 3VOSA 3ZWOA 3BMOA 3BMNA 4CM9A 3TF5A 1VC2A 5I8WA 4YAEA 1EK5A 1EVYA 2HJRA 1CIVA 1DRWA 1LDMA 1BVRA 3K8ZA 4M1QA 4WNCA 1MFPA 2ZTUA 1R4NA 1N9GA 4ND3A 4RVUA 5T8KA 3ETGA 2EJVA 3ZU3A 5BNFA 1N8KA 3ZHZA 5L45A 3PWSA 1NVMB 4ND2A 4DMLA 3JQAB 4PN3A 1KEUA 2ZTVA 3N7UA 1XWFA 1NP3A 4JNKA 4LVCA 1CWUA 4DREA 1W6UA 5JFOA 2ZKLA 3L9XA 1DIHA 1HKUA 1X7HA 4EUEA 1H9BA 1NFRA 4MO2A 3WJAA 1K2WA 1QKIA 4BNNA 5I8ZA 3KYCA 2ZTMA 4YT8A 3IUPA 5KNLA 4CV1A 4IJVA 1WDLA 4EJ0A 5ILGA 5L7TA 4ZA2A 5JW6A 5DZSA 2DAPA 3WGGA 1UP7A 3Q9NA 4R69A 2ZJ1A 3DC2A 2Q2WA 3TN7A 1B16A 3I4FA 5IN5A 1YXMA 1HRDA 2D1YA 3Q1LA 2BI8A 4DRYA 3LF2A 2HRBA 3ROPA 2DTDA 4J0EA 1DPGA 2PV7A 4W6ZA 1Q7CA 1YH3A 1BW9A 4JIGA 3FNEA 1GV1A 1Q2XA 5JDCC 5B12A 5BR7A 1BXGB 1IHYA 4AJJA 4KWHA 5K0ZA 2I9PA 1OC4A 3LLVA 1SB9A 2V6MA 4E13A 4FSHA 1H9AA 1PS0A 3AK4A 4HFMA 2X0RA 2BFAA 1CYDA 4WE3A 4CV0A 3RU7A 2V6BA 4CM8A 1U5AA 4WLEA 1PEDA 1TT5B 3MWEB 3TSCA 1J0XO 5T6BA 1H6AA 1FDSA 3ASVA 4PZDA 4BNGA 1RKXA 4RDIA 1PJCA 3PWZA 4UUOA 2DQ4A 2FRDA 2O3JA 1E6WA 2Q49A 2AW5A 4N54A 3KSZO 4G2NA 2PA3A 4D43A 2C20A 3BXXA 5I7SA 1K6JA 1Y1PA 4W7IA 1FDUA 1QR6A 3BTSA 1GQQA 3MJ4A 1EE9A 4MVJG 3I9OA 1C1XA 3RASA 4CMJA 1E3SA 1P77A 5IDWA 4B4UA 4I9HA 2W4QA 4E2XA 1S7CA 3CIFA 1ISJA 2VWHA 3U4IA 2B5WA 4E5YA 3C3XA 2OBNA 4DC0A 2GF2A 1N1GA 1UZMA 2AE1A 3H9GA 4Q9NA 1G0OA 1YL5A 2VNSA 2Y1FA 3I9NA 4FN4A 1R15A 3ZV4A 3WNQA 2G76A 3MJCA 3LT0A 4GLLA 4E12A 3AWDA 1WMAA 1EFKA 4NFYA 1C1DA 3SX2A 1YB4A 2FP4A 1BSVA 3VZPA 3IC5A 4GX2A 4CMGA 4RPGA 4IZIA 4UVEA 1HE2A 1B8UA 3JV7A 3DAPA 1GCOA 2OL4A 3DBLA 3CUKA 4AJKA 3NTQA 3HDHA 1DRVA 5CDGA 1NFQA 2O50A 1XIVA 4OQYA 4CQLA 4E2YA 2VTEA 4MVJP 5G0UA 1WVGA 4EBFA 4EDFA 1RJWA 3JQ9A 1PL6A 2D2IA 1I33A 2CNBA 1EUDA 2GO1A 3NKLA 1GFSA 3ZWVA 1ZJZA 3DHYA 4Q3EA 2R00A 1EMDA 2DBVO 3SLGA 4JCOA 4CMEC 3EVTA 1ZW1A 4WGGA 4YJHA 4TKMA 3K5PA 1GZ4A 1SO8A 2PD6A 3JYPA 1F17A 2RHCA 1RM0A 3HE3A 4ZQHA 2YDXA 4J49A 3VPGA 3V1YA 3OQ6A 4BIIA 1E3EA 3ZGYA 1BG6A 4Z9XA 2IEDA 3GVIA 4OSPA 3UCXA 4TROA 4YYZA 5B4VA 5GZ1A 3PFFA 3U9LA 1DIRA 3H3JA 1H5QA 4NJOA 1W0CA 4E5PA 3JQFA 2WYUA 4YCAA 1GU7A 1I5RA 3L0DA 4XX0A 4M86A 1H2BA 1U3UA 4FGSA 1WNTA 1MXFA 1LRLA 1A7AA 1O89A 3K73O 3L6EA 5K9ZA 3U49A 4NDNE 3DZKA 3AY7A 2Y1GA 4BHTA 1MG0A 5JCJD 5KJCA 1JU9A 3F46A 1YOVA 4CQMD 2UVDA 2WYWA 4ZGWA 4R9SA 1E7YA 3HHPA 3WR5A 4Z0HO 1ADFA 5I9MA 3F4BA 3VC7A 4E4YA 4Z9YA 1SOWA 3MJTA 1Q1NA 1E3IA 1LQUA 4NZ9A 2OORA 1PQWA 2YZ7A 3CINA 1B0AA 3QSGA 4XGIA 5I7EA 1D8AA 4B7CA 3I6IA 1NVGA 1N92A 1EUCA 1LSUA 4B4OA 3I4CA 3OETA 4JP3A 3H2SA 4E32A 1EE2A 4URFA 4Y67A 5AXAA 3ZZNA 4LSWA 4YT5A 4CM7A 1ZK4A 3EZYA 1WWKA 2FPGA 3MJSA 1E3LA 1GD1O 4IDAA 1K89A 4KUGA 4QTZA 3RAJA 1DFGA 1ENYA 3LC7O 3D64A 3SJ7A 4R41A 5T67A 1P1FA 3JQGB 3E1KA 3PJFA 4HX5A 4HY3A 3FHLA 4YT4A 4CMIA 4RVSA 4TSKA 3GDOA 3RUCA 3D5TA 1K6XA 4ZQFA 2ZATA 3NX4A 4OJNA 3CZRA 1LC3A 4L4SA 5EERA 4D3SA 3VTFA 3RIHA 3AI1A 2YUTA 1VJTA 4H3VA 3DBRA 4GLOA 4A10A 4PIVA 1SAYA 2FPPA 4FB5A 1NPYA 3NT5A 4LRSB 1E3JA 2C2XA 4RF4A 2NWQA 3TOXA 1DJNA 3INTA 2WE8A 1IY8A 1NQOA 3GUYA 5JC8A 5KVCA 4HV4A 2DFDA 1NHGA 3DZBA 4D79A 2ZJ0A 4CLRA 1KETA 5IDYA 4DLAA 2GERA 4Z0PA 3ZHBA 1FJHA 1KYQA 2X6TA 5GZ6A 5AYVA 1KIFA 2NVUA 4NHEA 1M76A 4BNWA 3DMYA 1VKNA 1QP8A 2EWMA 2Q1UA 3QVTA 4LCJA 4DL9A 3L07A 1X1EA 2PZLA 1IE3A 5TGDA 5ILOA 1LI4A 4XD2A 4PLGA 3ETEA 1ZKMA 4FFNA 3JD3A 1Z82A 4YR9A 3TQHA 1V8BA 4LSMA 4XQ9A 1NXQA 3LC2O 3GOHA 2H9IA 2X8LA 1Y8RA 1K0UA 2D5CA 4IDCA 1T1SA 3RBZA 5JNLA 4BS9A 4WOKA 3U4CA 4FGWA 4BGEA 5L7WA 3WYEA 2PFGA 4ALIA 1EUZA 4N5NA 2VTDA 3AUAA 4PCVA 4OL9A 2NM0A 3IMFA 3FNHA 4WLUA 3FSRA 2I66A 5CDYA 2OO5A 4EUHA 1RYDA 2JFGA 2YHIA 3D3WA 3JD0A 3SEFA 4PG8A 1KEWA 4QECA 5JBIA 1QXSA 3I52A 4PRLA 1OI7A 1T2AA 2Y0EA 2WD7A 2O3RA 2QYTA 2VZ9A 3RBVA 1ZCJA 3VVBA 3FCOA 1JDJA 3WGYA 2QRLA 3ZV3A 1XKQA 4PLZA 4U0JA 1PQPA 2JHFA 4J7UA 1MX3A 1DC4A 4UEKA 1KVSA 1JKIA 2I6TA 4L4RA 1XU9A 3NTRA 2O23A 4PVDA 3DONA 3IDSA 3PWKA 4IIVA 5C7IO 2PWZA 1FDWA
chains in the Genus database with same CATH superfamily
3DTVB 1CIPA 1XU4A 5CFPA 1XA4A 2LW7A 5LLTA 2QAGB 3R6LA 1XELA 1MJGM 5ICSA 3AEUB 1TI7A 2VP4A 5HCUA 3MELA 1IUPA 2ETXA 1EDOA 2VPZA 3CX3A 3EIOA 3GD5A 3HM2A 4ZTBA 2C07A 2CC2A 3ZV7A 4AUKA 3AB8A 1O97D 1C4XA 1H0KA 1U5CA 1D2EA 5EHQA 3TAHA 4BE7B 4EMUA 1MG5A 6LDHA 1MDFA 2QMUA 1V71A 2CLKB 2OY0A 4MVJI 4Q39A 5E2AA 4NYJR 5DBFA 4IHJB 4BV3A 1Y3BE 1ZWKA 2E1RA 3EB9A 1IPHA 3I28A 4JBXA 1HL7A 4WOBA 2OHGA 2FX3A 4R0NA 4DANA 1JJFA 5CYOA 5J4VA 4GMGA 2BV3A 2OAQ1 4HZIA 3W8DA 1G8KA 2XQVA 3TB4A 3LBNA 5K3AA 1W35A 3ENKA 4MULA 2A57A 4MAFA 2QJTA 1SBIA 5EG5A 3TZQA 4OG2A 2VTBB 4LOJA 2O2ZA 5BSTA 1C3XA 1LDGA 2EL9A 4NSNA 5IJZA 2I6GA 4MHOA 1FTQA 1GNTA 5JNSA 2E87A 4GYKA 2HCJB 3VPAA 5B58C 3P9IA 5IPFA 3H65A 2QUIA 4BLRA 1D6JA 4DXHA 3CLTC 4KXWA 2WVAA 1DBVO 4ND8B 3I8OA 7ADHA 2O0LA 3PYXA 2WWRA 3Q6IA 1R27A 1HPLA 1W75A 3FZYA 4RKWA 5CB4B 3AIIA 4H3HB 1QIMA 4XVQA 2RGRA 4OHPA 4E03A 2BKEA 2A30A 3M6VA 2GA8A 1T4MA 5CK4A 4EW6A 3ZGZA 3ZWWA 2YNMC 2FPOA 3FKQA 2BL4A 4CLXA 5A4FS 3LFUA 2W6JA 2X15A 1WY7A 3O4IA 5H1YA 2C9ZA 2G82A 2XB9A 3K0FB 2ORWA 4KKVA 3S2IA 4E2WA 3TL2A 3KHKA 1EEHA 4FHDA 5JTUA 3RC2A 3ZIAD 3U7JA 3LE8A 4O2AB 4UQLA 4IFBA 1TD1A 3FDIA 2IZ1A 1NN5A 3FFAA 4TT3D 5H3LA 3HSKA 5L3SB 1DTWA 1UBJS 4NYIR 4DE5A 2BAGA 1N78A 3Q1KA 3REOA 2YKGA 2I1VB 1BH2A 4ZO9A 3W04A 1ZI6A 1UZNA 3ILHA 5KREA 4B4VA 2X23A 3DCNA 3DZJA 4KR0A 4CQMB 3FOEC 4JI0B 4IL5A 4B73A 3ZQJA 2NMVA 3CVUA 4IEFB 3CF4G 3Q7PA 4MUMA 3T3GA 1U1DA 4A03A 4C5CA 3PHHA 2Q4EA 3DUFB 4OAOA 2IHUA 1WZEA 3OUUA 3CISA 4L9AA 2G28A 4NBTA 4F2GA 1QKKA 2Z98A 4FHZA 3MCZA 2BI7A 5EXXA 2MSCB 1RI5A 1T36B 3LC1O 3JVIA 4FHEA 3EEYA 4OYRA 4TTTS 4UAJA 4NK5A 1UDXA 3LX5A 5LFAA 2AZMA 3NTLA 1HFWA 4PLTA 1X42A 3ZKWA 2EFHB 2I54A 1LPBB 1QG6A 5DOVA 3QW2A 1Y7IA 3F9IA 5ER6A 2JLVA 4E5DA 1U90A 5D3KA 2XW6A 2GA9A 4FYXA 5GJWC 5C4MA 1YQTA 1WUYA 3QUSA 5B1HA 3IBSA 1VDZA 4G0QA 5ALPA 3K1AA 2V1UA 1BEUB 2YBEA 5D3MA 1ZQ9A 3FKSD 2BHNA 4CG0A 5TRTA 4I5IA 3WBJA 1N5IA 3C70A 3RAFC 3EDQA 5LP6F 1LBEA 5JLJA 3FWZA 4TYYA 1CZOA 1Z5PA 3LQ2A 1P5FA 5LYJB 5FNVA 1Q12A 2V0CA 4F1KA 1ZINA 3ZHQA 2PAFA 2OBFA 4MOWA 1AF7A 3TL6A 1XN4A 3TTUA 2Q46A 3GMDA 3NAGA 4HEHA 5D5HA 1XXHE 2O2YA 4IIJF 1XMVA 5LB2A 3SSNA 1U3WA 2BC9A 5KSZA 3KZXA 2VJKA 3N70A 4LWQA 3W3AD 3OC0A 4Y6GB 3KTFA 2ZJAA 2ZJYA 3V6MA 4FYIA 2V3VA 5AI0A 1GDDA 4EKDA 2RDMA 2CT8A 2GHTA 3VO1A 4A82A 5I01A 3U6KA 1LV8A 1BQEA 2WJZB 5NULA 2HMSA 4IGAA 3KUXA 1KK0A 3AGPA 1NVVR 1T0HB 2RMKA 3NIDB 1OH8A 4XIYA 1VP3A 3MMZA 4C30A 4ZDIA 1H5UA 3IPCA 3C87A 4ZVSA 4BQSA 3HI4A 2I4MA 3D6TB 3OFSA 2IUYA 4LOAA 1NF3A 3PNVA 4QQKA 1ZNWA 4TXMA 4KQWA 1ZK0A 3MFYA 2HA2A 4PZUA 4FGUA 1CUSA 4IHJF 2AN1A 4WCFA 2WKSA 1ZHFA 2RH9B 4FDVA 1WSAA 1VRCA 4A36A 4OBBA 2ODPA 4GX1A 1PBTA 4AJNA 1P1JA 4OAPA 2GCOB 3KUKA 1FNSA 3GT7A 4HB2A 4QEDA 5EMLA 3AYXB 3FLAA 5FYDA 2ENWA 1W93A 1KJNA 1SUFA 3ZIUA 3K6SA 4BLPA 2DE0X 2JCGA 1F8UA 3PCXA 2YMMA 2XA2A 4L2IB 4W99A 1GEEA 4EKNB 1KY3A 4QQ8A 3EDYA 2FCRA 3OU2A 1TK3A 3WDSA 4BFCA 4P5DA 4J4BA 4X00A 2G36A 1ZAKA 3VKVA 3ZHTA 1YJBA 1T1EA 4V3BA 3RLIA 4B82A 5CYFA 3UK2A 5CHEA 5F1OA 5KPJA 3H4VA 3UGKA 1ZZGA 4PLYA 4CLHA 5CVUA 5FI0B 2R8OA 4J03A 1VPDA 4IVQA 1E66A 2W42A 4YT2A 1NL3A 4DMUB 1P1IA 3AY6A 4NFHA 1CUGA 1YIDA 4OQMA 1WCXA 2W6IA 3LY8A 1XZPA 3G89A 1DXYA 1QRAA 2VXCA 1T1GA 3PFNA 4D8XA 3KJHA 3AOEA 4MV1A 2GN6A 1FS4A 3BRWA 2OBXA 3MRTA 4FD2A 2IS1A 4OJYA 3S8YA 3PFHA 4OMDA 2MSDB 5AW1A 3L9WA 4L6IA 2AMVA 1JIVA 2QJWA 1FRVA 1Z8HA 2JZCA 3KQPA 4OXRA 1KEVA 5H82A 3TYXA 2BFWA 1A5TA 2GNPA 4URXR 4LJ6A 1IRIA 4DJEC 4Z0TA 1LUAA 1I32A 2C9MA 1US8A 2PBFA 2ZUCA 4EWLA 2AB0A 2CLCX 4D1YA 5JRZA 5K3EA 1N5RA 2R1ZA 2G88A 1K97A 3VH3A 1EESA 4ZOBA 3KDPA 5AKXA 1VLVA 3L0SA 4MIYA 1VQ1A 2O2IA 1GILA 3FFWA 2CXPA 3CLUD 5CRIA 5EIHA 3JYLA 5BQXA 3K8YA 5GM2A 4WZAE 2D6FA 4FHFA 5CDFE 4KAJA 3L8MA 4J8PA 2Y0PA 1SFRA 1TRHA 2IF2A 2JKYA 3L7MA 3MEQA 2GKOA 2XTJA 4MAMA 3CEPB 1TZKA 3B13B 1S96A 1SY7A 1JI0A 1E1YA 2CHQA 3LK6A 1HE5A 4HDSA 2O2SA 4K81B 4YMIA 1ZN7A 4ZQGA 2QV7A 3VR6D 1V5WA 2QD2A 4MQLA 4R2HA 5AKHA 1H65A 4PG4A 3EA0A 1EGQA 1ORRA 5DN6A 4RTSA 2ZB3A 4L3VA 5AOCA 1UWVA 2JGDB 1P5ZB 1PR9A 2OORC 3EARA 5CCXA 4RU1A 3QH4A 3NH9A 1I9CA 3E0QA 3F3YA 3L1IA 1U4SA 3UUFA 3LPDA 3P9NA 4O4JA 5B1YA 4YCLA 4TVBA 4NZMA 5FHRA 5LYJF 3BTOA 3T7EA 4H7HA 4KUEA 1UMKA 3HEBA 3I6YA 4B0OA 4NV0A 4MVJH 4YLEA 3WQHA 2HJWA 2OUKA 3K6KA 4AKHA 4DYVA 1XCBA 4X54A 3ER8A 2HDOA 1Z5ZA 2JKZA 2AOTB 3KKQA 5LKAA 4PLHA 1Z0FA 1HSZA 1Z39A 1GTG1 2N0SA 4ESVA 3IMCA 5DMHA 2GEUA 1SKBA 4DQXA 2CB9A 3V4VB 4B3BA 2O1EA 5FWYA 4RIHA 3SDZA 1IY0A 3O8BA 4NFLA 4UHDA 4F5ZA 1T6ZA 1DHTA 5KDDA 4AYTA 5DRTA 4N3GA 4TZ0A 3REQA 1XFAA 5JFGA 1GDHA 4R71A 1G20B 1NW9B 4A0RA 3ONNA 3SWWA 3SF0A 2WPDA 5CFQA 1OAOC 4U8HA 2JGKA 5FKJA 1RDFA 3AVVA 3E05A 3ZG6A 1Z6XA 1J90A 1TYDE 2EKZA 4G0OA 3K9WA 4MW4A 4HRVA 4CM5A 1Y9EA 3HR8A 3CKLA 2OWEA 2YV4A 1A04A 2A0KA 2EIHA 4QSHA 4YWJA 3VNSA 4RFVA 3M4XA 4YP1A 2XODA 4URHA 1P6QA 4G1MB 4GKBA 3P2EA 2NGRA 3ZCSA 5DXAA 4F2WA 3EZ7A 2Q5JA 3KQUA 3TD6A 3USZA 3HB7A 3NC4A 1Q21A 3TQRA 4HPJB 3DW1X 3QUAA 4E46A 4R9NA 5ENDA 3IHLA 3A1CA 4E22A 1XVLA 1NI4B 3AFGA 1M2OB 2FMHA 4XRRA 4AZ0A 1RR6A 3RK0A 4JL5A 1GNLA 1BWQA 4F21A 1XHLA 3UJ7A 2I34A 5DYGA 1XDZA 1OYOA 2XEXA 3FI9A 3V1LA 5JUWA 2BF4A 4DQDA 1ONNA 2ID8A 1C1DB 3C6BA 5B2EA 4LKRA 1DT5A 4G1VA 2DETA 4BY9E 4BFTA 1RTKA 2QQGA 2R66A 3EH2A 4XIJA 3VR4H 4L5JA 5D87A 4LZNA 5CCEA 1GAJA 2QW1A 2V54A 5AJYA 4YRFA 5CB6A 5IZCC 1GPLA 4YJ3B 3ZW9A 2HGZA 2R48A 1BH6A 1XZCA 4R2XA 4RDCA 3VTZA 4OGFA 1Y8ZA 3ZDCA 4U6QA 2ARKA 4YO8A 4A8HA 5K1ZA 1E3TA 1NRIA 3GGSA 5BP7A 2CLHB 1N3YA 2O3SA 3AG6A 1OW3B 3GN2A 1ODIA 2QVCA 2WWGA 3HCOA 3KHSA 3O75A 4MKXA 5EE0A 4MMZB 1QH8A 4ZYWA 1OZ0A 1C8BA 3K1ZA 2C5SA 3SKYA 5C5EA 2AOWA 3H04A 2IDMA 1CUXA 4HXFB 2O7VA 5T4HA 4HAVA 4TS4A 4WY5A 2OO5C 3ZW8A 2XZOA 4E1AA 2PGOA 3T95A 2GVNA 4UTOA 2IYZA 2G4LA 2N9UA 2QY6A 5KNBD 5AT1A 4NONA 1UZUA 1OZGA 1VE9A 1FVFA 5T64A 2FFRA 2VN8A 2ZYVX 2UYYA 2O3TA 4QATA 3N8KA 2C4HA 4M0UA 3BGOS 3NJRA 4MKIA 5CVCA 5JS8A 2AJ8A 2NUPB 3K8OE 4PLVA 3MOIA 3IJ5A 4RK4A 2FTKE 4RSHA 2GOYA 1V7ZA 2V6IA 2Q7DA 3GBVA 1BDBA 2JFWA 1XXLA 4X1KB 1KDTA 1M2FA 2R2GA 4FR5A 3RAGA 4AP9A 4PHTA 4QSMA 4CT4B 3A9CA 5EIEA 4U2BA 3TD2A 4Q4DA 4QASA 2YJGA 1IN8A 5AW7A 2Q9CA 1MB3A 2H6EA 5T5QA 2MSKA 2VDPB 2XXJA 1ZK3A 1Y5NA 3LWBA 4HXEB 2GPNA 3HZZA 4QU9A 3ZX5A 5JSFA 1GZVA 4QJIA 4M38A 4X8HA 4DNFA 5CEEA 3O03A 1JXQA 3DO6A 1PYDA 2IYTA 4BNJA 1YE8A 5DBGA 2A9JA 3KOWA 4K46A 4X60A 1JQDA 4MW0A 1NWHA 4F2DA 1GLGA 2IYNA 1V3QE 4KQXA 3LUAA 3OQOA 1T4BA 4PTYA 4BO6A 2XCQA 2A4KA 2B8WA 5DM2A 5JZBA 4RXMA 4EUNA 2NYUA 2QM8A 4E3WA 1ORDA 1ZXLA 4IP0A 5MFZA 3N7AA 3PYMA 4B3TB 3KU1A 2QL7A 4MKGA 3AETA 2XE4A 1KZ6A 2Y05A 2VJMA 3HH8A 3QTLA 4TKUB 3MSCA 3G59A 1QFJA 1M6HA 1TC1A 1FX0B 3C3WA 4QO8A 3NIBA 1T6YA 4YRJA 4GX0A 1QHSA 4R31A 4EHFA 4ABTA 3OLCX 4O25A 2B6NA 2Q0QA 2JLAA 2KW5A 3AUJB 2GPWA 3CJTA 4EVQA 5A4AA 2VI5A 1DBIA 1D4ZA 4MPJA 2HJVA 2IHTA 3SX4A 4RIIA 3BCHA 5FP0A 1G291 4FYVA 4NY1A 4MIKA 4GPIB 5PGMA 1ZRHA 2PMEA 3GHYA 2JJYA 5HFNA 3T3EA 4IWXA 2PO5A 4J2TA 4QHTA 2R60A 3S2YA 4FCCA 4KLAA 1C7EA 4DQ0A 4Q4AA 2YMLA 1XZGA 4IDFA 3P19A 1E18A 3G0IA 2XCLA 3VR3A 5A0TA 1ISIA 4I55A 1HMYA 4N0DA 1P4GA 5CA1A 3G9TA 2WTBA 3KL2A 4HH0A 4A2WA 421PA 2VHWA 1KE1A 1KJIA 1NJ2A 3KTOA 4AZ3A 4ZOLA 5IHXA 4GL2A 4QRHA 5L6MB 1AS2A 2YWDA 3A14A 1VBKA 5KYVA 4BVBA 3DNMA 4QL3A 121PA 3RKSA 5IYZA 5KNDD 1CEEA 3DA8A 1CZHA 3GBSA 5SY9A 4CKCA 2FZ5A 1SK9A 4O4IF 1A7JA 4PZ0A 3VZSA 4XKJA 3LPMA 4GNRA 3ZHXA 1TM5E 1XTVA 4YAUA 4PWYA 1K7EB 1B8OA 1TEHA 3U4DA 4QBHA 1JJAA 2P2NA 4NYMQ 5EE3A 4ABYA 2AN5A 3O7MA 4B7ZA 4I3HA 3VJKA 1PFVA 2AXEA 2G9QA 4JBIA 2Z1NA 2OVFA 1KMNA 1UDBA 2QE7D 2W11A 3ELWA 3P2YA 4OA5A 3TOCA 1JBEA 5BN3B 5HOQA 1AUVA 3GR6A 4RF3A 4YDRA 2VHZA 1B3BA 2C1XA 1K66A 1WPQA 2I3BA 2ZUUA 1JZTA 2O5EA 1SNYA 4YJ3F 2WTUA 1L4NA 4G5SA 4ZYVA 4OMUA 3ECAA 3HVKA 2E5LB 3CTPA 4JI1B 5D6OA 4YQEA 1THMA 3M2PA 2YMQA 5FTWA 2C4TA 3PRHA 3FI0A 4ARBA 4I7EA 3TMKA 5EJ9A 3EJWA 3KB6A 5KTTA 2YC4C 3QVGB 2QN2A 4OKNA 4OUDA 3FBGA 4KX5A 5CB4F 5IJ0B 3GO4A 1XBTA 3WSWA 4ONEA 4I5DA 3OLWA 4LZWA 4RY2A 4B2YA 3GAZA 1ZMTA 2BEVA 4WRRA 4UARA 1I6MA 1GP2A 3ILVA 4UHKA 1BHO1 1Z5NA 4S1NA 5DULA 3UVEA 2D4AA 4H7PA 2HLPA 2RHTA 2QRZA 5U4QA 2VP6A 5KO2A 3SQOA 1B6RA 3BWMA 1GGEA 4GVPA 5JDIA 3H1FA 2KSQA 4W5JA 1EXDA 3F7TA 2J6IA 4RHUA 4PVCA 3BXZA 4OGKA 1TT7A 2HHLA 3DDNA 2V4UA 4J4HA 3TAUA 3RRYA 2W2MA 4IINA 5C1OA 1CS0A 1M1UA 3NVAA 3TVDA 3S5JA 5K01A 4OOEA 1UBSB 1UADA 3GP5A 3H83A 1H4SA 4J9UE 3GDFA 2WMYA 4O4LF 5DBHX 4B3FX 1XAJA 3M81A 3SXUB 5LOVB 1TCUA 4D3XA 3GNTA 1LQ2A 1GUZA 3M6XA 2QYHA 3R2JA 4ZHQB 1GAQA 2GEKA 3RSQA 4IJMA 3PVCA 2WD7B 4G5HA 3HKBB 4Q7EA 1U0LA 2HFJA 3GFSA 4AUEA 2YH2A 4D9EA 2BBTA 4QGBA 1T25A 3BE4A 3O8OA 3V80A 1D0SA 1TQ4A 3H86A 4Q34A 3E3MA 3OEED 1RRCA 2J9XB 2VCYA 4MHTA 1HZZC 2X0EA 1DCFA 3AH8A 1Y6ZA 3MPUA 3MXTA 3S44A 3LOQA 2WKQA 4AULA 3L77A 3Q8MA 1ABFA 4P7KA 1IN5A 1OZFA 3HCBA 3STYA 1I1OA 2ZPTX 1E4EA 5TVKA 1XVVA 2CLIB 1N2XA 1XPJA 3NR2A 5J4YA 1UJMA 3L4JA 1KPIA 1KORA 2CFIA 2Z9BA 4F3TA 1NDUA 1BAPA 4JOBA 5LQUA 5HRAA 2WB4A 2FPRA 4TN1A 4KFTA 4RDHA 1ZDMA 1XNQB 4AMUA 3M89A 1K5HA 2SBTA 4QAQA 4RE5A 3DL0A 2MOKA 1QTQA 1P44A 3NBYC 1H94A 1F38A 1RMTA 2K7ZA 3H05A 3A31A 4ZOEA 3UUGA 5B5SA 5L3QA 4ZVLA 3CXUA 3WMXA 3M4YA 2YICA 2W2QA 1AHNA 3M5WA 3NYIA 1UF9A 5B3LA 1ZJ6A 4LA4A 1Q7BA 1QV9A 2HJHA 4GGOA 1XHEA 4LZOA 2NUTA 1HE1C 1FVXA 3WLFA 2IHVA 3OBIA 5A5VA 4GPBA 2A88A 1X2EA 1LX6A 2CJXA 1NKTA 1QBGA 1W9HA 2QNBA 2RG7A 5K45A 1NV9A 1WL8A 2BMFA 2WJ6A 4CR8A 3OE7D 1ODSA 2NPFA 1W2WB 3I58A 2LUOA 3MAAC 2IP4A 3DZ8A 2HSGA 3TE7A 4QVGA 3G85A 1DIBA 3EC2A 4GU5A 4J94A 3WOVA 4KNYA 4JAVC 4GGPA 4JC4A 1WDTA 4TTQA 4YEDA 4Z1MA 4CMBA 1WB9A 4PLFA 3LY5A 3BK1A 3VSBA 2ERXA 4RHFA 3BXHA 1G7CA 4C4PA 1BN6A 1SJ9A 4PBTA 2CNOA 1U2PA 2X7HA 1XYVA 2P2SA 5BPFA 2WP8J 2QP9X 2XUAA 2XZPA 1SZCA 2WJAA 1Q0ZA 2D0PB 3OQIA 3KEFA 4Q47A 5SZHB 1E89A 2C2BA 1SMKA 4RJTA 3B1WA 3DMTC 4GQAA 4CM9D 4OLAA 1FNCA 1U2RA 1ZM4A 1UT5A 3MTDA 3VZBA 2F43A 3PGA1 5ADVA 2WC1A 4G9GA 4PYNA 1XG5A 4P3PA 1NMEA 2FFBA 2QDXA 4I6JA 4Y1RB 1A9PA 4LY3A 2DPXA 3G5AA 1N2IA 2HSEA 2PL3A 4RANA 1G42A 4EK9A 2D00A 3LXMA 5A5GA 1C8LA 1ZUIA 1ADCA 1ZD1A 2BFBB 2VLBA 3FMIA 3SBOA 1DTWB 2VUTA 2Z95A 4UEQA 2FE4A 4MVJA 4QLOA 2OP0A 2JBWA 3I8XA 2PS9A 2YJ5A 5E6SB 2JLSA 1OLSA 2O48X 3DD1A 4LXUA 3U7RA 1U7TA 2CGEA 5LA6B 4DIFA 1I1NA 1T2NA 2PVCA 3R44A 2GESA 4NG4A 3SPXA 2EKLA 2V9PA 3H1GA 5FFMA 3UMBA 1W0JA 3PX3A 4QGFA 4XWTA 4IQ4A 2EGHA 1NVKA 1RAEA 3SLRA 2ET6A 3HKEB 4WINA 4ZT3A 1E2KA 1YIOA 2GJKA 3EGVA 3Q2IA 3KUDA 4MWZA 1FP1D 1II8B 3T15A 4Q93A 3V3TA 2J9RA 5E2IA 4AMVA 1WXEA 5IK2A 1M0TA 2KBFA 4FONA 2ZAIA 1J7JA 3HVIA 4F6CA 5JV5A 4MPPA 2Q1YA 3BB1A 2FX5A 3MWJA 4QXQA 1JHAA 3SJAA 4HDQB 5LOVF 2RK4A 3PA6A 3W5VA 1CRWG 1J42A 4GWGA 1Y8CA 2B37A 4B32A 4D9NA 2VZEA 2Y1WA 3FD8A 1BEEA 1L8OA 3IKVA 4GM0A 4TSFD 4P8RA 2DBRA 2NSYA 3UXEA 4EELA 1TEZA 3ITKA 4UBOA 5U1PA 2NQ8A 3N6VA 4YDSA 4FZRA 2H1LA 1SBQA 4I9FA 5D3MB 5DGXA 5CLHA 1NF2A 2D59A 4H7IA 3RS9A 3UNXA 1AN0A 2BHSA 1GHTA 4TV9A 5FTMA 2BGJA 2E0IA 4MV0A 3PQ7A 4C0JA 4HJRA 1QDLB 2XD4A 4YMWA 1I3KA 3TZCA 2WWYA 3EXHB 4HTFA 3EUEA 3F6SA 5FNVB 2W9XA 3T0IA 4IF4A 2PUTA 4FMCF 5E9AA 4MA4A 3KPJA 1ZO8A 4GZ6A 4V0KA 1HLGA 2IYFA 2LCIA 1SD2A 3Q0EA 4IFTA 1E64A 3VV2A 3PNQA 4KJXA 2B9VA 2IV2X 3BMQB 1ISGA 3AUSA 2UZIR 2VH5R 1O9GA 3TUZC 3LIPA 4L0QA 4MV5A 1LW7A 3W9YA 1LNSA 2GM5A 3U80A 4B6EA 4N0MA 1PGNA 5LL6P 3WLLA 3THXA 3WGIA 2JBHA 5D8DA 2VFAA 4RHYA 2B4QA 3AKEA 4NBVA 1YMVA 3L7KA 2B4KA 1BU8A 4UXHA 5B1EA 5CPBA 2GN9A 2OECA 4BO1A 1QRDA 2NU7A 4WBNB 3QGMA 2XKBA 2AFHE 3JQDA 3JZAA 2FSUA 4PGMA 1YZUA 4E15A 3TFWA 3RSOA 4HLNA 1TU3A 4YFVA 5H83A 2ECOA 3PB3A 1O6ZA 3VU9A 1Z2DA 4RXUA 2R7MA 3QOFA 4JI5B 4AM8A 2XRZA 1ZMOA 4RELA 3WZ2A 2YYSA 3WLRA 1QO0D 3NG1A 3OZBA 2PM8A 2HJGA 5E9QA 1FPQA 3IAM1 3QPBA 4OATA 4HQLA 3QXCA 3T1VA 3NW9A 2GPSA 5IP5A 2B25A 4C7KA 3QKTA 4QPPA 1XEFA 2WNHA 1LB1B 3C4JA 4ND1A 3HNOA 1ZLYA 5FBLB 1FYWA 3K6SB 1C0IA 3U61B 3SXJA 1S2DA 4UNIA 1Y1QA 3DMRA 2MSLA 3H5AA 4YMSA 2UYQA 3SZLA 3JD4A 3OWXA 1T91A 3HA5A 2OK7A 4UMVA 2H31A 1QVRA 3EOAI 1O58A 2PXCA 2VAVA 5G02A 4UCQA 4MJ7A 3K6JA 1JYEA 3GX1A 4TYNA 1H9CA 5DOZA 1IM8A 1AKVA 1WW3A 4B40A 9GPBA 3SBDA 1WULS 1CDZA 4DCOA 2NZJA 1PNVA 1QJ4A 1PZGA 1UAGA 3EF3A 3EY9A 3GDWA 4FILA 4K86A 4P5EA 3LXRA 5DM60 5F3RA 1JA9A 5JSQA 5CPFA 1OKKA 1KZ7B 3G8BA 2NUAA 4MO9A 2FU5C 1J99A 1RZRD 4G0WA 1YQEA 1E2UA 1J39A 4H0NA 4YASA 2YV2A 4JQZA 3DM9B 3RU3A 3KWMA 3CJQA 1KH3A 2JS7A 1F5SA 2LCFA 4C6TA 1ABEA 3G2PA 2VCEA 3MAGA 3PDUA 3ZW7A 1QHEA 2DCMA 1B1AA 1WKBA 2XMQA 1XWIA 4FGJA 4JLVA 4FE7A 3U0VA 3HRKA 1CD5A 3BZUA 3KEQA 1NOIA 2I7XA 2UZ0A 4WW0A 5EJ5A 3INRA 3ZQ6A 3MWYW 5DU2A 4F06A 4I8DA 3ZWPA 4EI8A 1IRXA 1US8B 3VZQA 5KTKA 4YI5A 4NFSA 5K2MA 2H4FA 1NNSA 4UEOA 1D2CA 5CH3A 2M6KA 3WK5A 4RULA 4ZICA 3QJ5A 2O5CA 2V03A 2WILA 2WIKA 3KJNA 3HEAA 3FVWA 4UM9D 4JFAA 4UTVA 2OZKA 3TR5A 4OQNA 3QEMA 2Y4NA 2WHYA 4O1HA 4ED9A 3FETA 3H7AA 1Q20A 5BXYA 2AEMA 2FI1A 5DCUA 3R75A 4H31A 4JS0A 1BKDR 2C5BA 4BAGA 3COPA 4HDSB 2CJWA 3HCCA 4X0EA 3WWYA 4C0AC 4UZEA 4YRIA 4NCBA 4A7PA 3I2FA 1KSHA 3CGGA 3OIGA 5E3IA 1JTEA 1YRLA 3IT3A 3KXIA 3UJ8A 2BHLA 1N6IA 4LV8B 5CX1A 3QE9Y 2F8TA 2QA5A 2QMQA 5DP1A 1AE1A 4AXBA 2OYSA 4ACAA 3RI3A 4ITVA 1N2SA 2IYYA 3OJEA 4IGIA 2CMGA 2R86A 5DI9A 1R88A 4KQ9A 2E48A 1FJ2A 2QWXA 3GEEA 3C3AA 1VG0B 4HDCA 3T41A 4C06A 1YNOA 1PR3A 3HCAA 4IUYA 3QVXA 4WDRA 5FLXA 1LTHR 3QFRA 5AW4A 2OCBA 3GK3A 1NMQA 3D5EA 4HH3C 5I5EA 1X7ZA 1NXWA 3QU4A 3WKEA 5D3QA 4EEKA 1MBZA 5I4IA 3KNZA 1NM5A 2PIAA 3TXXA 5FWYB 2C92A 3FYUA 3M2TA 4KODA 4GYYA 1WMBA 1WOYA 3WL7A 1YRWA 3OEWA 1U63A 3NHAA 4MKRA 1SC1A 1ZVKA 3LBHA 3A4NA 3IQHX 4R81A 3BMOB 4WK2B 4ZC1A 4YRPA 1MAHA 3BMNB 3FNFA 3NNNA 2FGJA 4K6CA 1BROA 2F7SA 5DN9A 3V4ZA 2JVKA 1GTL1 1CHNA 3RCBA 7REQA 1F2UA 1KTVA 3ADOA 5KVQA 3HXQA 3DOIA 1JWBB 2ZDQA 2QVXX 3HEMA 1GUYA 1L4YA 1COWA 3MILA 4TMXA 1ECJA 5IM4A 4I1IA 1VCNA 2G04A 2Z1MA 4FVTA 1XMIA 2NV0A 1OLOA 1G3RA 3H5TA 5KX5A 3I9V1 1PX0A 2XYVA 4RQAA 4AG3A 2AFIA 4ZQCB 1G21E 1YE5A 5JISA 1FUYB 4F1JA 2IOFK 1G4UR 2AYXA 2XLCA 4AZ0B 1KMQA 2XGOA 3KOMA 4RY0A 3ZQ4A 3K4QA 4EVSA 2IS4A 1YZQA 1QDEA 1Y3HA 2VUHB 3ZH2A 3UB2A 5A4JA 3I92A 3RC9A 3K71B 2H7XA 3WYCA 1FSZA 4AL4A 2DC1A 3A9SA 4L0DA 5EMJA 1ZMRA 3PDJA 3S2SA 1AK1A 1EFPA 2FUG1 4UMEA 1PS9A 1ITZA 4GXQA 3VFDA 2GTIA 3ZH9B 3ZHVA 4HL6A 4UJ3A 2PE5A 1N6RA 1FNNA 4C2UA 4QNRA 3X1XA 1XJQA 2G8LA 4GX5A 1YASA 4BMYA 3W9UA 4V1CB 3MBOA 3E53A 4JLKA 2QGZA 3AF2A 3EQ9A 3ORHA 3QX3A 2X0KA 4L4XA 4FEGA 4HGZA 3CRRA 4M1MA 2P27A 1SEVA 3G0CA 2P3SA 3L8ZA 2IYOA 3UA4A 2XWQA 4AICA 3QYFA 1RAFA 4LG1A 1QH8B 3QI7A 2YCBA 1HOXA 3WFIA 5JMPA 3M6LA 4R6WA 1E1NA 2RI6A 2PD4A 3K9QO 3EZLA 3PUKA 5CFMA 4CEHA 2VDLB 1VFNA 2V5AA 4EHAA 2G3YA 4H3KB 2P79A 3I32A 1Z0UA 4DMHA 1B2RA 3O1JC 3Q2KA 1VMEA 5TXGA 1MP0A 1RI4A 3LY7A 4NBWA 1ZK1A 1O94A 4PC2A 4RLFA 3SIPA 4J0FA 2VHQA 3FHOA 2EFYA 2GBGA 4F56A 5A7FA 3GWGA 4O8CA 3W3ZB 4BEWA 4D46A 2A9FA 4C89A 3P7MA 5IX8A 3NFRA 4N65A 2FWPA 3IP8A 1DZ3A 2DJ5A 4U4AA 2IJGX 2ZETA 3BXPA 1MAVA 4Z0NA 1O03A 3R9XA 4BB9A 5DK4A 3UYLA 3G23A 5JADA 2I1QA 3FUVA 4QBGB 1W5TA 4UHEA 3HC7A 3O1IC 3LI2A 3LKBA 3ULKA 4MINA 1E0AA 4O2RA 1IY2A 5AKGA 1QONA 2WMNB 3T1TA 1DLJA 3EASA 4KN9S 4FYYA 2P4UA 5EPOA 3FG9A 4CFZA 3PNMA 2F17A 1XVIA 4RYDA 1WQ1R 2VPTA 1U3CA 4Q3LA 4O4JF 3ZUPA 4DEYA 3FPGA 2ZRFA 4G0XA 3UMGA 2NSJA 2YWEA 3OQBA 2WOOA 4HAWA 4ATNA 2LP4Y 1Z34A 4I0WB 4K6GA 4DY6A 3I9MA 4KKXB 5BT8A 2G72A 4NMMA 3W6OA 2AYYA 1BYIA 4F72A 2ODBA 3NWEA 5A4KA 4OKIA 4A5OA 4EI7A 3G5UA 2JD2A 5JNVA 4W82A 4OL0A 3WNCA 3BORA 2VJMB 1NUHA 1YT5A 5JAIA 1SIOA 4S3MA 3CZ5A 1YUBA 2FWRA 3OQPA 2QZSA 3KB1A 4DVGA 2VEDA 4A8JA 5DT2A 3GVHA 3RTDA 4AT1A 2YNMA 3H75A 1ESEA 4IVPA 2B8TA 3AJDA 4W4TA 2W2TA 3BSSA 3GYBA 5FQNA 5CLFA 3E9EA 5J2TA 1ECGA 4HBGA 1DUVG 4AJ1A 2ZYIA 3BL8A 4X7BA 1G60A 2JI4A 2DJIA 4MP8A 4MVXA 1B6GA 2LGJA 1NXTA 2GN0A 1PFKA 1KOFA 1U2EA 2GD1O 2ZBFA 5F2EA 5BVGA 2B8NA 4Q4AB 2GD6A 1CQJA 1SXPA 4XR4A 3TW8A 1TLTA 4GBJA 4IGFA 4I55B 2Z4SA 1Y3FE 2Y1XA 5C31A 5FBQB 3ZYCA 3DFIA 4LRQA 4JH0A 2UZ1B 4BU1A 1YONA 4ARVA 5IYZB 1AJEA 3GELA 4KTVE 2BPOA 3A9VA 1H0RA 4TLDA 2ATIA 4GBGA 4CKCB 4O4HB 2ZPUA 1KO8A 4LJRA 3S68A 4PCLA 3T7JA 3ERCA 3U1VA 1C14A 2A7QA 2PUJA 3KZNA 4RZIA 1K08A 3CCCA 3TBHA 2K5UA 3P0JA 5L3RA 4P53A 3ZLBA 1UPFA 3CIOA 4DLRA 4P35A 4LYJA 2QN1A 1X8JA 1QZZA 2O8DA 2O5VA 1YZFA 3LUGA 3QPDA 5LMCA 4XOIA 1GQYA 3HNRA 3T9FA 4RY8A 5F1KA 3SHVA 4CMCA 4DA0A 4ILKA 3UPUA 3ROMA 3LUPA 3AHJA 1TUBA 1JHXA 1PR1A 1Z5VA 3E03A 4M53A 1V9LA 3A2KA 1G8AA 1AN9A 1K7FB 3B5JA 2CBXA 1IG3A 2V7BA 3G82C 4OUDB 4BO8A 3FPSA 5BWMA 2O7QA 4HAUA 5KVAA 5I4BA 3K05A 4LHXA 5BUZA 4D0LB 4Z51A 2BEVB 5EJFA 4FJ2A 5EPUA 1T3HA 2J7PD 4KAXA 3BGDA 3D1VA 1O5OA 1HDRA 1C4WA 3EDOA 4HUQA 5JR3A 4BUJA 3I9KA 1XRRA 1RJ9B 2A6PA 5TJ9A 3CE6A 4DV1B 2Q5HA 3H4TA 2OP1A 5BW4A 1NWCA 3IDQA 2JARA 5DSTA 4MQBA 3UHOA 2F48A 2PMBA 1U8CB 1XTBA 4TRJA 4ENWA 1WNFA 1FYVA 2FOIA 1TTHA 1G19A 3BAZA 5IULC 1W48A 1IBKB 3G2HA 3QEJA 4YDHB 1LDEA 3PT9A 3L04A 3A9WA 3HJCA 3OCWA 2WVHA 1IMJA 3HRHA 4JB2A 2JJ2D 5C9ZA 1EX1A 1HBJA 2EHJA 3H0CA 3UC5A 1GUBA 3U7IA 3GYGA 3C3EA 1K7XB 2XUKA 5BUQA 1VIAA 3RRJA 1TM7E 1D2GA 5EE5B 1GA4A 3U1BA 4BWVA 2XQKA 2P0YA 4J2HA 2PSJA 1IUOA 3O2JA 3V97A 3O8OB 1O6GA 2DUMA 2FWBA 1GPJA 3FOFC 1NFFA 3WBBA 3KEMA 4GBMA 4RETA 4MGHA 1NUUA 3SNKA 1MEOA 3ANNA 3S2EA 2BGWA 1Z0AA 5SY4A 2MU1A 5IU6A 1O4VA 1E4EB 2FKAA 1LK5A 3PUIA 3U13A 1QQTA 3Q0TA 1YA6A 3Q87B 4RNCA 4DLZA 5HIIA 2CHEA 3P2MA 4JBWA 1MX1A 2IVFA 1PV2A 3IUMA 1OXBB 4D6YA 2HK7A 2Z8YM 2XRMA 3DXYA 3H4MA 3WOHA 5I4KA 2W6QA 1EQ2A 2H4YA 2YXBA 1R3UA 3WGVA 3R5XA 2RBGA 1AURA 2Z83A 3HYNA 3RUDA 1STOA 3HZOA 5L3QB 3NBQA 2FAXA 5I5GA 4H1UA 1LDBA 3N2LA 1YQWA 1PU2A 4O2LA 4LSGA 5D3ZA 1D1PA 2Z3WA 2EKPA 3N59A 4QXOA 2JAOA 4YUWA 1O08A 2QU7A 1BX3A 3HSSA 3KKPA 3TW0A 3ET4A 3EXG1 4DN6A 4I55F 5CA1F 2MSWA 1A4UA 4WPGA 2BTEA 4INOA 1LZKA 3BEDA 4UEJA 1EX6A 3RTEA 1L7EA 1NATA 4ZOLF 4JDUA 1P0FA 3C5WP 3TCKA 4GOXA 3AUKA 4MSUA 1GLVA 4JR1A 3KTAA 5DRYA 5IYZF 1T1JA 1DOAA 1S8FA 2J7KA 3EAFA 4EFKA 1YJCA 4FXPA 5EKTA 2XF2A 2Z3VA 4LECA 1NLZA 1EAMA 1P0QA 4M99A 4BCCA 3BB4A 3EBOA 5IAGA 3EX7C 1PQ4A 2IYAA 1MV8A 5COBA 3JAWA 4D99A 3NDJA 1Q15A 4MUJA 3QF4A 3AEXA 5AKZA 3TSWA 4K9OA 2ZWAA 3ER9A 3IVRA 1AMOA 1OBFO 3B7PA 2HA5A 2F1RA 2VS1A 4X71A 4CIAA 4ZYZA 2QMZA 1PGJA 4OB8A 2XXAA 2X9GA 4I3FA 4N48A 1DMSA 2GYVA 2AXPA 3EGWA 1DKPA 2GO7A 2KX7A 2ID4A 4C21A 2RGAA 5BV7A 4QU8A 4DA7A 1NXOA 2AN9A 3SYNA 4E5KA 3PP8A 2ODQA 2WM3A 4QGSA 4BTLA 1QV6A 4AF7A 2H0RA 4GBED 4C0KA 1G5TA 2HLDA 1NQXA 1OLXB 4OHCA 3TK1A 4YXFA 1LLCA 2ZYGA 2ENUA 3DKIA 1P2FA 4LYAA 1J7KA 3IJPA 2CNDA 3IUJA 3NP9A 2PKQP 2GMWA 4NV3A 2R2AA 3G2QA 5AK6A 4CG1A 2VYVA 3R3JA 4KVGA 1WPGA 2EQBA 5HZMA 3F47A 3UOAB 3RJZA 5GY7A 1YVRA 4I2NA 4TZTA 3LSYA 1KK1A 1P81A 2M6LA 2PJZA 4FBGA 4AJIA 4EHKA 4C0LA 3TL3A 3OIWA 4CT0A 1CC1S 3K92A 1QORA 2CZGA 1YC2A 4DILA 5MN6A 4R2LA 2Q4RA 4F6RA 1FC0A 2IF0A 5JD5A 2A14A 3P27A 1QS0B 1Q16A 4V3CA 1HE3A 1IBLB 3ZR4B 3E9ZA 1OAOA 4LK2A 3SAJA 4DUYB 1L3IA 2XT9A 1NJ1A 1YDGA 1Z13A 3ZX4A 4DT1B 4HNVA 4ZK6A 4JR0A 1J8QA 2I2WA 3WGQA 3C2QA 2IQIA 1U65A 3QIAA 4RMJA 2WNSA 3PL5A 4OAQA 4CKEA 4E1BA 1OU4A 4M7OA 1XZHA 2VOEA 4KYIB 1ODJA 1CV2A 2FUKA 2QR5A 4X5OA 5FAKA 1AGPA 5JMTA 3FPJA 1I0ZA 2E55A 3JALA 4I1OA 4LF6B 1JWAB 1ZMBA 2VRCA 1RXWA 4PX2A 4A23A 4HTFB 3OT4A 3A6KA 4B09A 4XM2A 4YRZA 4KSCA 1KI4A 1EFHA 1X9GA 2HNAA 4E30A 4CEJA 1HOTA 1ND6A 3VR0A 1VFPA 2PNJA 3I45A 1R6BX 4LHWA 5SZKB 2UVQA 3UV3A 1E2FA 5IN4A 3LBYA 1NKVA 3KSBC 4BXOA 1PO7A 3RSLA 4UCXA 1C81A 2XKJE 2YQ4A