5TQVA

Crystal structure of nadp-dependent carbonyl reductase from burkholderia multivorans
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
225
structure length
225
Chain Sequence
MKTVLIVGASRGLGREFVRQYQRDGWNVIATARDDASLAALRALGAHAHALDITQPEQIAALGWKLDGERLDVAVVVSGVYGPRTEGVETIASDDFDTVMHTNVRGPMQLLPILLPLVEDARGVLAVVSSRMGSISEATGTTGWLYRASKAALNDVLRIASLQTRHAACISLHPGWVRTDMGGAQAALDPATSVTGMRRVIAEAGADVSQSNGRFFQYDGVELSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH-dependent carbonyl reductase
publication title Crystal structure of NADP-dependent carbonyl reductase from Burkholderia multivorans
rcsb
source organism Burkholderia multivorans (strain atcc 17616 / 249)
molecule tags Oxidoreductase
total genus 87
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2016-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tqvA00
2FPPA 4JX8A 2AQ8A 2HK7A 3EYWA 4TRNA 1R12A 1NAIA 4J9VA 5G0VA 1WZEA 3I9LA 3COSA 4EITA 4GVLA 3FF4A 3QE3A 2OUIA 4DQXA 3FD8A 1ZH8A 3RUCA 1K6XA 4TROA 4YXFA 3HDHA 3RC7A 3UOGA 4XYGA 2QRJA 5KNLA 3KUXA 3PHIA 4FS3A 1R0LA 4QECA 1NYTA 1S7CA 3C7AA 3HFSA 2W2KA 4DMLA 4YWJA 2FPGA 2J5RA 4BS9A 1QSGA 1EQUA 4BKUA 3ETEA 2J3HA 2QX7A 4H16A 4UVGA 4J1QA 4KMSA 5H83A 3WFJA 1ZUD1 2Z95A 1U2DA 2O3UA 4S3MA 2ZTUA 4IGEA 2AE1A 3V2HA 3UXYA 1PGQA 3AUUA 1AUPA 5T67A 1EDOA 1FJHA 4JBHA 2V6MA 2AA3A 4HFMA 4RVGA 3AM5A 2BKAA 5JE8A 4TRJA 2CVZA 4WNCA 1EUDA 2BH9A 2ZJ0A 2X0JA 3PHHA 1XCBA 4R3WA 5ES3A 4U6SA 1E1LA 2DQ4A 3BMOB 3K2BA 4B3IA 2X1HA 3FWZA 1PIWA 3H9JA 3LQFA 5LC1A 3AI2A 1I10A 1L7DA 4IY1A 3U09A 4W7IA 1E3EA 4BKOA 3ASUA 1VM6A 3R6DA 4FIZA 3PPIA 3D4NA 4J7XA 2WEKA 4BV8A 1SEPA 3KYDA 1JKFA 4UULA 2HAEA 2CVOA 1T2EA 1GZ3A 3OF2A 4G81A 3Q9NA 5GZ3A 3U49A 5ADHA 4EI2A 1R4MA 1E0DA 4M1QA 4UVDA 3MZ0A 5JDIC 1D8AA 4ZQEA 4WLOA 4GLOA 3WICA 1WPQA 2EGHA 3JQAB 4I5GA 3ZV5A 1IE3A 1YVEI 4DLBA 1LUAA 1IYZA 2VOJA 2Y93A 1F8FA 1X7HA 3AU9A 4DPLA 2ZB8A 2OGUA 1EBUA 1U4OA 4QO7A 2ZKLA 1O95A 5I8WA 3PLRA 1E7YA 4AJPA 4F6CA 1LSSA 2VRBA 4FJ2A 4YRAA 2VTDA 5F1KA 3A06A 1C1DA 2O4UX 4F46A 3H7AA 1R0KA 4PN3A 3L0DA 4URFA 4GBJA 2J5QA 3GN1A 4M87A 1DIAA 4UUMA 1EEHA 1E5LA 4TQGA 4PG5A 3VH2A 1I32A 1D4FA 4CM1A 4MVJM 3JYOA 2Y67A 4WGGA 3IC5A 5JMPA 1KVSA 2DUWA 2HRBA 2FSVA 4A2CA 3WQSB 4IS2A 4FC7A 2DBZA 3DL2A 4ZA2A 3RBXA 3Q2KA 1XG5A 4DA9A 5I7SA 3PJGA 3LDHA 4CR8A 3KO8A 2GSDA 3WOHA 2PGJA 4PZDA 5G0UA 2OL4A 5EINA 1F06A 2E4AA 3HZZA 1WDKA 2NU9A 1E3SA 3MOIA 1CETA 2BMAA 3WMWA 4PZEA 2VHYA 1A71A 2W98A 1YONA 1BW9B 4HP8A 2FR8A 4J3FA 4O63O 1ISIA 5AOVA 3U4HA 1YRLA 4CLRB 4J9UE 5L95A 4ND2A 3VPSA 5IJZA 3MWEB 5GZ1A 3HNPA 4E12A 2CDBA 1QYDA 4N5LA 3QRWA 2UYYA 4XD2A 2WJPA 2C2XA 1E7QA 4OYRA 2Q2QA 3KSDO 4II2A 1DIHA 3TZKA 3KVOA 1LI4A 4Q39A 2QRLA 4NPCA 4EJMA 1IUKA 4BNIA 1ZK0A 2I66A 3I83A 2NSDA 1Y5RA 4R4JA 1ZKMA 2DTDA 4CMHA 2AXQA 2O48X 2BLLA 3E03A 1WAMA 3OM9A 1YL6A 1DRWA 3ETGA 4INAA 2WYUA 2VTEA 5IFLA 1LLQA 2D5CA 2I99A 3TDKA 1HDGO 1R66A 4YJDA 5L4SA 1GY8A 2DPGA 1NBOA 1YB5A 4UVEA 3LF1A 1B16A 3WIDA 1LQUA 3Q1LA 2WMDA 3QV1A 4RVFA 2VUTA 4CMIA 5CPBA 1ZZEA 3GGGA 2Y0EA 4RVHA 4BGUA 1R0SA 4GMFA 3QY9A 3AFMA 1C0IA 3A4VA 1JVSA 5JAMA 3JSAA 5DULA 3ZU5A 1Y8RA 3DTTA 4JN6B 5JPIA 3GN2A 2UV8A 4DXHA 3UFXA 2VRCD 3KTDA 3DZJA 3FHLA 4NFYA 1U5AA 4Y6PA 4EJ0A 1F17A 3RFTA 5ITVA 1JA9A 3JQFA 4GVXA 1GV0A 1BXZA 2DBRA 2VN8A 4ALLA 4PZCA 3T4EA 8ADHA 1SNYA 4OSPA 3ZCXA 3CTMA 1E77A 5F21A 4B7UA 3AI1A 4RPHA 4XA8A 5IAAA 4R16A 4H15A 3S2IA 2A4KA 3RC2A 3PZRA 3QQPA 4BKPA 2Z1MA 5A4DA 2Y1GA 1B0AA 5EPOA 4OXYA 4EUEA 3IOYA 1NVTA 1Z73A 3EGOA 3PHJA 5G4KA 1DPGA 4JP2A 1E7SA 4IJUA 4CLEA 3RC1A 3G17A 3IMFA 4OSOA 5A5EA 3GK3A 5GMOA 2YDXA 4BNVA 2YUTA 5KKCA 1ZJYA 2JHGA 2EXXA 4XB1A 2GZ2A 1Z7BA 4N7RA 5L7YA 4NK5A 4XGNA 1NTOA 4IJVA 5BR7A 3CPSA 5HA5A 5TT1A 1F14A 1VI2A 5IDXA 4EJ6A 3VPFA 3D64A 4DMMA 1PJCA 2NWQA 1JN0A 2VHZA 1K6JA 2YV3A 1YOVB 4CL8A 3PQFA 5TGDA 1Z6ZA 3DHYA 3DBRA 4O6VA 1C1XA 1NQTA 1EUCA 1KBZA 4DC0A 1TXGA 4Q3DA 1RKXA 1FDTA 1T2AA 1UXHA 4GGPA 2DPHA 3I9OA 4HWKA 3MJVA 3GQVA 4LRSB 4MVJD 5CEFA 2VNSA 3IJRA 4KUHA 3LVFO 3EDMA 1W4ZA 5DOZA 1LQTA 1VL8A 2CDAA 1DSSG 1MUUA 1R37A 4CM8B 1D7OA 1WMAA 3N58A 3WG9A 3WYEA 1YGYA 3GAZA 3HN7A 4WLVA 3PQEA 5BNIA 3RKUA 1BDBA 2BF7A 3OETA 1LLCA 2PWZA 4J90A 1Z45A 4FR5A 4PG7A 5HM8A 4U7WA 3TOXA 2BI8A 4BO1A 2O50A 1ZIDA 4ZVVA 4XR4A 1RYEA 4J2OA 2I5PO 1GZ6A 1X0VA 3BTUA 3DTYA 3S55A 2PR2A 1GD1O 2O2YA 1TEHA 1SCUA 3JQDA 3ASVA 1D1TA 2GASA 4E30A 3D1LA 2ZCUA 2C29D 4YACA 3L4SO 1HYGA 2FZEA 2O3RA 3TF5A 3DB2A 1O0SA 2PA3A 2HMVA 1I5RA 4OH1A 5LCXA 3WR5A 4Q3AA 1J4AA 4BQRA 1ZCJA 2ZYAA 3RC9A 4R5HA 5IDQA 2ZB4A 4CMCA 1L7EA 1OFGA 1T2FA 3N74A 1QG6A 3ZWPA 1RM4A 4CMBA 5TLSA 2QZZA 2QHXA 4J4HA 1O6ZA 3T4XA 5IN4A 1NFFA 2DAPA 4PLCA 4E33A 2G5CA 4HY3A 3GUCA 4ZQHA 5IDYA 5T6BA 4DIFA 3K5PA 1ZK1A 4OHUA 1E3LA 4M54A 5CEEA 3JQ8A 2QIOA 4AFNA 1BXGB 3GT0A 1A27A 1PQUA 1XWFA 2AQKA 2IEDA 1PU2A 4FW8A 4B4UA 3M1LA 4D79A 4NBWA 1V8BA 2P9EA 2O4CA 1I2ZA 1HE4A 2RHRA 3JQ7A 1UXGA 4FFOA 3IAHA 3BTSA 1XDWA 1ZVMA 4KTVE 3DMTC 3DZIA 4WECA 1UZNA 2Q46A 3ORFA 1U9JA 1DB3A 2GRAA 3IL2A 2HCTA 3OIDA 2CY0A 3FRJA 3UUWA 3AOGA 3E9QA 3ONEA 3GVXA 4U8GA 1V3TA 2B35A 3QWBA 4XYMA 3DOCA 3PGXA 4ZICA 5JC8A 5TT0A 1HE3A 2RAFA 3V1TC 3ZWBA 3GR6A 2TMDA 5EQFA 3X2EA 3FR7A 2W90A 2YV2A 4AVYA 4OKIA 3CIFA 1IPFA 2AW5A 3ANLA 3GHYA 5T64A 4YJHA 4LN1A 1Y5MA 4J4BA 2WDZA 1GU7A 2YY7A 4HADA 3VC7A 3I3OA 4E31A 4BO6A 4YJGB 2V65A 1KVRA 4R1UA 3KBOA 1JW9B 1Q7CA 2R00C 4N18A 4OGWA 4JGBA 3TZHA 3WGTA 5JAZA 2IXBA 1KEUA 2J6IA 3IUPA 1SC6A 2E82A 2VRCA 1JAYA 4CV0A 4MVJE 1N92A 4RZIA 3V1YA 5DCUA 4BO2A 4YTEA 4BNLA 2ZIZA 1IL0A 3K73O 4J1SA 4PLVA 4WUVA 1FMCA 2BFMA 2V7PA 4JJFA 4LK3A 2B37A 4ALMA 4QSMA 4JP3A 5ICMA 3AW9A 4B4OA 1CEQA 3KXDA 2BFOA 4J6FA 3S8MA 4UUOA 5L51A 3BMQA 1I3KA 3OMLA 3CMCO 5JYDA 3QVTA 2WWRA 3GFGA 2O3QA 1LRLA 3KHUA 1I3MA 1LNQA 4Z0TA 3BMCA 5JYEA 3JQAD 4PLWA 3IUSA 2C82A 3ZGYA 3O26A 3PJDA 3CZMA 1N8KA 3KEQA 4MJLA 4BHTA 1PSDA 3WQRA 1WMBA 3CSDA 4WASA 2B4TO 3NUGA 3STHA 4IDFA 4QUKA 3VTZA 4DC1A 1GEEA 4FPXA 2AMFA 1I3LA 1GL3A 1GUZA 4I5EA 3NDJA 3AWDA 3DONA 2RIRA 1LDYA 2AEJA 4KP7A 4XQEA 4Z9XA 1B26A 2EKPA 4G5HA 1LDEA 4GX2A 5JLAA 5KIAA 1ULSA 3I9MA 2NU7A 2YFHA 3D0OA 1ZJZA 3E82A 3L77A 4Q3EA 5DNAA 3UKOA 1ISMA 1LSJA 1FDSA 3L6EA 4CM4B 2O7SA 3LC2O 4NR0A 4B8WA 5KKAA 1Y9EA 4MVJA 3OQ6A 2H9IA 4UREA 1LEHA 4YR9A 4I5FA 1Y6JA 1DDOA 1GUYA 4IZHA 2ZCVA 1T4BA 1Q1NA 3GG9A 3INRA 3PFWO 3LC1O 3GEMA 3K9QO 2OXIA 2BI7A 4BMSA 1RM3A 1EUZA 5AQ1A 2BGLA 4N54A 3RJ9A 1LRJA 4LVCA 5U4QA 4JNKA 1GQ2A 5AVOA 1PZFA 4W9NC 2Y0DA 4R3NA 1DXYA 3TL3A 1NHWA 2G82A 2B36A 1LDNA 4IJWA 3GF4A 1P1RA 1V9LA 4IINA 3NJ4A 3F4LA 1A4IA 3JD2A 3WJAA 5COQA 5TQVA 2NU6A 3GAFA 2Y99A 1NWHA 3WS7A 3TOZA 1T1SA 2FR0A 3D3WB 1JWAB 4YB8A 4YJFA 5JAQA 4GPD1 1E3WA 4OL9A 2ZB3A 3RD5A 2Q1UA 4RL6A 1NP3A 1YB4A 3ONFA 2VHWA 4XYBA 5TC4A 4BNNA 2NVUB 4CV3A 2W8ZA 2H1SA 4Q3BA 3WMXA 4BGEA 2WE7A 2IDZA 3L4BC 1FF9A 3NEPX 1HSOA 3U4CA 5L45A 2EW8A 5TRTA 1W73A 4AICA 3E8XA 1VJ1A 2CUKA 2DBVO 1X7DA 1H6AA 1I24A 3C85A 1R4NB 4G2NA 3JV7A 2PKQP 2FWMX 4RVDA 2WD7B 3KOUA 5C7IO 3MJCA 2Y66A 2ZK7A 4RDIA 4XIJA 4CV1A 3F46A 1BSVA 2YHIA 2O23A 3AM3A 1E1NA 2RH4A 5FFFA 1KY4A 1TT5A 4BO4A 1Y81A 4Z6KA 3OIFA 4Y6SA 3ZI0A 5DF1A 2VZ0A 4I9NA 3GVPA 4EDFA 4HNGA 3WLEA 9LDBA 2GLXA 3WBBA 4AL4A 3H4VA 3OA0A 4LSMA 3U4DA 2HK8A 3RQSA 3GOHA 5C37A 5TJ9A 4XQ9A 3DXFA 4L76A 1VE9A 2FSSA 3PWZA 3JYPA 3GGPA 3GH3A 4LSWA 3AUAA 4D0RA 3LT4A 3G79A 1YS4A 2VUSA 1ADFA 1PS9A 1ENOA 1FXSA 2JCVA 4MIEA 4WCFB 5T8KC 1I2BA 4Q3CA 3SLGA 5EL0A 1PJ2A 4D0SA 2YDYA 3GPIA 4BNJA 1NVMB 4XGKA 2VWGA 4BNYA 5B12A 3HHPA 3I4CA 5LDHA 3AUSA 5HRUA 1XGKA 1QV6A 1YL7A 2XF8A 1KEWA 3ZWXA 4Z3DA 5I8ZA 3MTJA 2AQHA 3ETDA 3QVXA 3DBLB 1BGVA 1UJMA 1P74A 5DDIP 3ANNA 1DRUA 1GYPA 1GADO 1U3WA 2DU8A 4BO3A 1QYWA 2VT2A 5KJFA 3ZHZA 5J23A 1J5PA 3ZHBA 1HE5A 2JAPA 4DPMA 3H9QA 4IXWA 1YE3A 4CQLB 3BMOA 4MKRA 4TRRA 1DJQA 4E5NA 4RF2A 1VL0A 4JXKA 1R16A 2PGDA 3L4BA 1UXJA 1EE2A 4O1MA 2IZ0A 4YQYA 4R5MA 5T57A 5G0WA 2Y0CA 4FN4A 1E3JA 1MXFA 2GDZA 3ROKA 3VKVA 4OAQA 4CM6A 1ORRA 1ZSNA 3GZNB 1NQOA 3NT5A 4YT8A 4KWIA 1NAHA 1T24A 2EEZA 3CMMA 1NQAO 3JQAA 1ENZA 4O59O 2X22A 1XU9A 1L1FA 4B79A 2NV6A 4DYDA 5JY1A 1PQWA 1GCUA 1DEHA 6ADHA 3PQDA 2C54A 5U9CA 4NH4A 3UVEA 4KQWA 3TZQA 3UICA 1WXDA 2XAAA 5FI5A 2AEFA 2V6GA 4BOYA 3PIDA 3CZRA 2HRZA 1H6BA 4IZIA 4AG3A 5ILGA 3VVCA 4DQUA 3UGKA 1SOVA 4LRTB 5T8KA 2XPCA 2CF6A 2PTGA 2EV9A 4N5NA 1I30A 3D5TA 5IZ4A 2V6BA 4MP6A 2X0RA 5F3RA 3QW2A 4ROSA 3NTQA 2PK3A 3V2GA 3FNHA 1PGPA 3H3JA 5IF3A 1IY8A 3GVCA 2ILTA 4YEDA 4I1IA 2BELA 2GN4A 1M76A 3UH1A 1FDWA 3K6JA 1N5DA 3GPDG 3B1FA 3FN4A 1WP4A 3H9EO 4AJ1A 2P5YA 2DFDA 3F1KA 2Q49A 1BDMA 3OQ1A 5HTOA 1GFSA 4GMGA 3OJLA 3WSVA 5DP2A 5JDCC 1IOLA 1E1MA 4RPKA 1P9LA 4GWGA 1BRMA 1KC1A 3A1NA 5TNXA 9LDTA 4HX5A 1OC2A 1LDGA 4P22A 1PZHA 1BW9A 1CYDA 1KETA 2HJRA 3DZKA 4NHEA 4K1LA 4WPGA 4CLRA 5TIIA 2C7VA 1PZEA 1ZK3A 2X6TA 3JQFC 4NMHA 4RF3A 1UP4A 4ZRMA 3DDNA 4RJTA 3DOJA 1GDHA 1U5CA 2JCYA 5DCWA 2YW9A 1U3VA 3QWIA 1JWBB 4W6ZA 1UZMA 3GVHA 5TS3A 4I9UA 4C4OA 4E2ZA 1P77A 1EK6A 3MOGA 2JHFA 3ENNA 3QVOA 4W99A 1MXHA 3ZWOA 4B4WA 3I6IA 4CPDA 3CKYA 3JQBC 1SMKA 1ML3A 2X9NA 4J91A 1E6WA 3PGJA 3HFGA 2P5UA 4OQZA 1K3TA 3AK4A 1X14A 1YJQA 1JLLA 3RUIA 1PS0A 4H7PA 3P2OA 3TQHA 4CV2A 5BSFA 2NTVA 1U3TA 3DFUA 4JBIA 1NPDA 4D43A 4FC6A 2IRWA 3WNVA 1KVQA 5KCZA 3GMSA 1HTBA 1ZNQO 2JD2A 3PZBA 4K9DA 1NFRA 3ONDA 2NTJA 1P0CA 3HG7A 1Q0QA 4PLHA 3ADOA 2XXBA 1A9ZA 4C7JA 3BAZA 3PDUA 2FMUA 2VZ9A 1JKJA 3GRKA 3I9NA 3NYWA 4YT4A 1UDAA 2OBNA 1XKQA 4R1NA 5BNFA 4RGBA 3Q0EA 1O9BA 4MVJH 1PL6A 3NTOA 4GSKA 4XQGA 1YXMA 1MLDA 1C0PA 4IJKA 1XYGA 2OZPA 3VZSA 4L74A 4HKTA 4QQRA 4RCVA 5A06A 4DWVA 5KTKA 2CD9A 1PL8A 4P8RA 3WTBA 5JDCA 3KETA 4M8SA 3ROQA 2EW2A 3VH1A 5A1TA 2NACA 1PR9A 4CM3A 4XYLA 3JCZA 4NFSA 4B3JA 5A9RA 2I3AA 1GEGA 4JCOA 4BNMA 3LLSA 1Z7EA 1N1GA 3WGYA 2XOXA 3DBVO 4PCVA 3FWNA 1MV8A 5A3JA 1NPYA 1PJLA 5C7LO 1HRDA 4GL4A 1E7RA 4UEJA 4OKNA 3WWYA 4NBRA 4AJIA 4JJIA 4PIVA 4XR9A 3H2ZA 1NVGA 2G17A 5AYVA 4CL3A 1K6IA 5L7WA 2A92A 2GN9A 1ZMOA 4JBGA 1XEAA 3F47A 3JQBA 3ZWVA 3H8VA 4MO2A 5COAA 5BSGA 1C0KA 1LC3A 2VUUA 3KYBA 1YOVA 4PFJA 3U9LA 2Y1DA 3SC6A 5BT9A 2GR9A 2VOEA 2UUOA 1QRRA 2D2IA 4XQCA 1B7GO 2QW8A 1GV1A 2O2SA 4LCJA 1DHTA 3O4RA 1LDBA 4ALIA 3AU8A 1DAOA 2NQ8A 3TFQA 2VZ8A 1DFIA 4FCCA 4HUJA 5L4NA 3GDFA 4A10A 1HT0A 3SLKA 1NR1A 1C3VA 3C1TA 4XRGA 1FDUA 3K2EA 4J7CA 4IIUA 3DAFA 1X1TA 1VJ0A 5AXDA 3IIEA 4YAJA 4CM8A 2C59A 3AY3A 3NV9A 1Q0LA 3TL2A 3OEWA 1PGNA 1PJSA 3PP8A 4Q9NA 4DIBA 1EK5A 3WGIA 1NFQA 1NWCA 1N7GA 4OM8A 3BMNB 4NJMB 1ADGA 3JYLA 4OOFA 3P7MA 3OECA 4PLGA 3R1IA 4XKJA 3SBOA 1VKOA 3K96A 1ZMTA 4ND5A 1QORA 3E18A 3WQQA 3ANMA 1WNTA 3DQPA 3ROPA 5COBA 5A04A 1PGOA 3GHHA 1LSUA 3SC4A 4AJHA 4FOSA 2OOSA 1PR3A 3CXRA 5IXSA 4KUEA 4MOWA 4AJ4A 3DR3A 3WDSA 4XEHA 2OORA 3VPHA 1H5QA 4M49A 5GY7A 5I7EA 1CQIA 1LTHR 3FCOA 4WLUA 3DBHB 1RPNA 3SJ7A 2P9CA 1AXEA 3ENKA 2CSUA 4AJEA 1ZXBA 1NNUA 1ENPA 2FY8A 4NU6A 2R2GA 3IKVA 1W8DA 2IZZA 1ID1A 4IDEA 1BMDA 1ONNA 5A5FA 2CF5A 2ZQZA 4CM9D 5JBIA 3WGOA 1YBVA 3CH6A 4CLHA 1IZ9A 4DPKA 3BHMA 4OJNA 4WOJA 5IG2A 4Y98A 4Z3KA 5CDSA 1EFKA 5L4LA 4P4GA 2DLDA 3Q2IA 5ER9A 3QSGA 3EMKA 4FFPA 3OBBA 4CLOB 1C0LA 4L0QA 2VHVA 3JQGB 4IPTA 4PVDA 1HL3A 5KWEA 2C5EA 4BGVA 1T25A 4EEZA 2P4QA 2ZYGA 1FK8A 5IZCA 1HYEA 4GQAA 4QX6A 3O9ZA 1XLTA 2RH8A 5KJ6A 2JFFA 4M86A 1BXGA 3ITDA 3IDSA 4D44A 1H93A 1VKNA 2JKVA 4R54A 3C1OA 4MIYA 1IHXA 2WM3A 3L6OO 4CUZA 2GERA 1ISFA 3SVTA 1VC2A 1GZ4A 1P1FA 1U28A 4IM7A 4RF5A 1YDWA 2JFGA 1P1IA 4Y9DA 4BVAA 3KV3O 1BTOA 4GAEA 3FNFA 5EQDA 4E32A 3W8EA 5F1PA 2I67A 3TZCA 4BO7A 4GH5A 2CDCA 2A9FA 1F0YA 3UHAA 4DGSA 3FTPA 4CLXA 5KVSA 4PLFA 5ER6A 3D3EA 3HN2A 1A9YA 5HBRA 1PEDA 4ND4A 2PNFA 2OMEA 3FPCA 4UUPA 2JD0A 3ZNNA 4R9RA 4DQVA 4MINA 5I9MA 1K2WA 2D3TA 2Q50A 3I5MA 3Q11A 1U7HA 4IQ8A 2X0IA 2P9GA 3OP4A 4Z9YA 4XRRA 3TFOA 1RM0A 2B4RO 1NXQA 3E1KA 4NBVA 5EERA 3EZLA 3T7CA 1BHSA 4KTTE 1Y8QB 3L9WA 4B4VA 1NX6A 3NAQA 2VWQA 2EERA 3O38A 4BKQA 4E5KA 3CEAA 3R0IA 4JK3A 1E7MA 4WEOA 5JO0A 3C24A 4M55A 1ZSVA 1EZ4A 4PRKA 1HYHA 4YJGA 1E7WA 4YAEA 3DAPA 3G49A 3V2UA 3WB9A 3RCBA 4CR7A 1P33A 3ZV6A 1U7TA 1VL6A 1UH5A 3KB6A 2OO5A 2BD0A 3BTOA 4UVIA 2LDBA 2D4AA 4PLTA 4IQ0A 2H6EA 7ADHA 3TPCA 4A7PA 4E2XA 3EUWA 4RZHA 3JYNA 4ZJUA 1BVRA 2NTNA 1Q7BA 2I3GA 2WSBA 4DREA 1SEVA 4RVSA 1HLPA 3KZVA 3D4PA 1MB4A 3PWKA 4LISA 4IQGA 1CDOA 3K8ZA 4KDFA 3VZRA 3PHGA 2BHLA 4KUGA 3FTNA 2ZB7A 3KYCB 4AJ2A 5F5LA 2H5LA 3E9MA 4DUPA 4R68A 1XR3A 4U6QA 1QMGA 4FOOA 1VJTA 1LLDA 3EVTA 3WGZA 3NJ8A 3RROA 2EP5A 3EY4A 3G1TA 4U0KA 4KWHA 1ISGA 1E6EA 4YT5A 5BSEA 3FI9A 3FNGA 1CWUA 3Q3CA 2PD4A 1G0NA 3ROMA 2HUNA 2ZJ1A 2Y05A 2DFVA 2POQX 1QYCA 1YDEA 1ZK2A 3WXBA 2CMDA 4BNGA 3QVWA 1N2SA 2I9PA 2A35A 3GLQA 3W6UA 2CZCA 3QWHA 3FR8A 1IB6A 1XQ1A 3GEDA 3OH8A 1GAEO 3W8FA 4CM4A 1DO8A 3DZBA 1H9AA 1ISHA 1M6WA 2NQTA 2BFAA 1QP8A 1B14A 5A9SB 3LSYA 2LDXA 2JD1A 5U1PA 4K6CA 5C3MA 4A26A 5DP1A 4A27A 2Z1NA 3IQDB 4BB6A 3ZWAA 2C5AA 4I9HA 3PDJA 3UCEA 1FDVA 1DC6A 1MFZA 3GEGA 3TRIA 1Y7TA 4XCVA 3RKRA 3AY6A 2FPIA 2JCXA 1GQYA 3QWAA 4RO0A 2PD6A 1QV7A 1LX6A 1PWXA 5EN4A 2JL1A 4FSHA 2PFGA 4WJZA 4ALJA 3HUDA 1B15A 4WCFC 5JC1A 4R1SA 1J0XO 3RBVA 2JAHA 2X9GA 5JCXA 1EQ2A 3UAGA 3G1UA 4GI2A 3UN1A 3RUHA 5G0SA 1I2CA 2YHUA 4ZGWA 3O03A 4YT2A 3JTMA 4D3SA 3ZWNA 4I8XA 4EYEA 5B37A 1PJTA 3EHEA 4WLEA 4BNWA 3ZU4A 3D3WA 1AE1A 3BYZA 2QYSA 3PHLA 3V5NA 4GKVA 1V3UA 4RV9A 1P44A 2PH3A 4BNUA 1YH3A 1M6HA 3H9GA 4JQCA 3WGGA 1VLLA 2A94A 3JYQA 2PZJA 4CM9A 1YWGO 2NVUA 1SB9A 5CDUA 1YBAA 3HADA 4M89A 3R3SA 5K0ZA 4K6FA 1XU7A 3S2EA 1X1EA 2D8AA 4OMUA 3HJAA 3O8QB 5A3VA 4EUFA 4L75A 1O8CA 3W4KA 3DC2A 1DC3A 3NGXA 3MJTA 3A14A 1R4NA 4HBGA 5KOIA 1JKIA 4ESOA 3HB5X 2EJVA 3RWBA 4XWYA 3HDYA 4ID9A 4TWRA 1X0XA 4FDAA 1RM5A 2PZLA 2WD7A 4TRMA 2AHRA 1DIGA 3PXXA 4E5MA 3L6DA 3RAJA 2BFPA 3D5QA 1ARZA 3H9UA 1W6UA 1Y9AA 3EZYA 3E48A 2FHSA 1WDMA 1P45A 1X13A 3QVSA 2BGKA 3QWFA 3DHNA 3JD1A 1CJCA 1LU9A 1OAAA 1A72A 4L9RA 3F3SA 1NASA 4BNHA 4RORA 3LT0A 3E5RA 3GG2A 1XSEA 1UXIA 3OJOA 1ADCA 3K31A 1LBEA 3H3FA 1PS8A 3F5QA 4EBFA 1P1KA 3HSKA 5DOVA 1NQ5A 5K9ZA 4BNTA 3HQ4O 2E48A 2HMUA 4FJ0A 4WCFA 2H63A 1E6UA 3OJ0A 2OBYA 2RHCA 2X5KO 4FQ8A 4DTIA 2GN8A 4IMRA 4MKZA 4DLLA 1B3RA 3LU1A 5JSFA 1JTVA 2I6TA 4NFHA 3IJPA 2RBEA 3I9JA 4FFRA 1NPTO 4ZN6A 4WEQA 1MC5A 4FJ1A 1DFGA 3QJ5A 3ZNPA 4IDDA 4UEKA 4CLDA 1AXGA 3RIHA 4D45A 3JD3A 2ZYDA 2BGMA 4UUNA 4Z0PA 4AJNA 3IKTA 3ZN2A 1QR6A 3DBLA 4QO8A 5GZ6A 2ZTLA 5ENVA 4TZTA 3SXPA 1UAYA 4A5OA 3ZW9A 3KSUA 4CMGA 5CDGA 3GA0A 4WLFA 1OMOA 2RCYA 3BHIA 3VHRA 3MWDB 2EIHA 3KM0A 2HMTA 2Y1EA 1IZ0A 1MX3A 1H2HA 3TN7A 2NM0A 4XX0A 3SJUA 4CQLA 6LDHA 5K6AC 1PJ4A 1SOWA 1G1AA 5JCJD 3I4FA 2YYYA 1EFLA 4JIGA 2Q3EA 3ST7A 4HV4A 3U0BA 3DO5A 4W82A 1V0JA 5G0TA 2DUUA 3DFZA 1UUFA 4YA6A 4EZBA 1A5ZA 2B0JA 4XIYA 4TKMA 3WBFA 2OP1A 2X5JO 5DCYA 1P1HA 5CAEA 3GZNA 5B4TA 3DZGA 3ZU2A 3C8MA 2HO5A 3RJ5A 3IS3A 3W6ZA 1ZBQA 1ULUA 1DLIA 3F6YA 5CDYA 1U4SA 4IS3A 1CQJA 3EW7A 3BHJA 4CQMB 4L73A 1GYRA 1P3DA 3K92A 2FP4A 2QRKA 3NDIA 3PYXA 1A4UA 1KS9A 2JJYA 4IDBA 3DEYX 3FPLA 1I01A 1WLYA 3RFXA 3ICPA 1N9GB 3CUKA 1PX0A 1DOHA 1TLTA 1XELA 4BMNA 3KEOA 4J49A 4E21A 1PJQA 2AE2A 4RPGA 3E5MA 4QT0A 4Y8VA 5MGBA 1HSZA 1O89A 1D3AA 5F1OA 1Z74A 4I08A 4NBTA 5JO9A 2O3SA 3EC7A 3ZV3A 4GGOA 2SCUA 4O5OA 2GCGA 3FNEA 4RLSA 4YCAA 8LDHA 2Y68A 4KQXA 3NKLA 2DTXA 3RASA 2IEBA 2VWPA 2G76A 4AJJA 4ILKA 3OEYA 3JQCA 4P38A 2PD3A 1JAXA 1GQQA 5A02A 2Q1TA 1AHIA 3EAGA 3W4IA 1U8FO 3OJFA 4GKBA 1R15A 2J5KA 4MVJG 5IN5A 4F6LA 3BTVA 1ZK4A 2HSDA 3INTA 3ZH2A 2X58A 3DZHA 4MVJP 3WYBA 3RU7A 1HZZA 2EG9A 2J3JA 1X7GA 2W2KB 4BO0A 4BNKA 4OIMA 1KIFA 3V1UA 5B4UA 4II3A 3RUFA 3PYLA 3PWSA 3IP3A 1IULA 5HS6A 2QQ5A 2EKLA 3JD4A 3NT2A 3TSCA 5K6AA 3INGA 3C7CB 4BO9A 2QYTA 2B5VA 4ZQGA 4BMVA 3AOEC 1UZLA 2TMGA 1DAPA 1NR7A 5KJ1A 4KZPA 3VVBA 4PLZA 2GN6A 3SX2A 2E49A 2PH5A 1CERA 5CHEA 1HDOA 3VZPA 5FYDA 2Q1WA 1K0UA 3E6AA 3I1JA 3L07A 4NG5A 2PV7A 3I52A 2F1KA 3HDQA 1ZEMA 2GZ3A 4RQTA 2NU8A 1YQGA 3ADPA 1JU9A 4BQPA 2YZ7A 1KVUA 2EGGA 3JQ9C 3KYDB 5JW6A 2P2SA 3BA1A 3W1VA 2B83A 1ZSYA 5L53A 1PTJA 3PI7A 5EESA 2CFCA 4IIVA 5JAIA 4F3YA 3ZWMA 1HZJA 2HK9A 1PZGA 1R4MB 4QXMA 3PRJA 1IPEA 4ONEA 5FEUA 2WTBA 2Y1FA 1ZO8A 1JQBA 4PVCA 4E6PA 1V3VA 4E5PA 5IXYA 4CR6A 4ZU3A 1DJNA 1U2GA 2UDPA 2WYVA 3H65A 1Y1PA 4J4TA 4W4TA 1OOEA 3MJSA 3TZ6A 2X0NA 2J3KA 3QP9A 3JQEA 1I0ZA 4YAKA 1LSOA 4BIIA 3GMDA 1EVIA 3VOSA 4IXTA 4GLLA 1ZXLA 1JVBA 1D1SA 4HFNA 1C1DB 1YQXA 3OFSA 2HKIA 2Z5LA 5AXAA 3B1JA 3IP1A 1SO8A 4J7UA 3ZNOA 2O7QA 4I5DA 5DBFA 3UF0A 2AG8A 2IYOA 5L3ZA 1DHRA 1HXHA 1H6DA 2ZATA 3GUYA 3KSZO 2X9VA 4FBGA 2FRDA 1QYXA 4HFJA 3S2FA 5L9AA 1B8VA 4LMRA 1H0KA 1ZFNA 2Q4EA 3GGOA 2HJSA 1K5HA 5G2OA 1G6KA 3WFIA 1WWKA 3M2PA 3AOEA 3GY0A 3WIEA 2VCYA 3QIVA 1TVEA 1T2CA 3ZNQA 3VKUA 2CNBA 1E92A 3LF2A 4NJOA 4MVJI 1E1KA 5EIOA 3FBGA 5ENDA 5EJ2A 3M1AA 4E3ZA 2HQ1A 4PRLA 5KVQA 1P31A 3UCFA 1WZIA 1J49A 2D59A 5JDIA 2C2YA 1OZAA 4WCDA 2GGSA 3HWRA 4OO3A 5THKA 1MG5A 5CPFA 5CFZA 1VSUA 3AUTA 3BZUA 5BSHA 2HU2A 2WD8A 1EBFA 2DT5A 4WE3A 4ITUA 2AEMA 1DLJA 4YRDA 3JQ9A 4GX5A 3W4JA 2GF2A 3T7EA 4BNZA 3A9WA 5JCJA 3DHEA 1UDCA 3OIGA 1WDLA 2VYVD 4ZHSA 1DC5A 5JMWA 1G0OA 2OP0A 3RSHA 1P1JA 3ICCA 3PYMA 1WVGA 4GWKA 1O94A 4L8VA 3H6KA 5G4LA 1ONPA 3PVZA 4TMFA 4PGFA 3V8BA 4BNFA 1ZEJA 2IYPA 4K28A 5IZCC 5BNTA 1F12A 1LC0A 3K30A 3BMNA 4NZ9A 4NJMA 1EE9A 1MG0A 1EVYA 4FGWA 4CJXA 4CMIB 3WGHA 3H5NA 5TJHA 3OJEA 4DIOA 2F00A 2V6FA 1DRVA 4ZQFA 1NM5A 2B4QA 4RLHA 3OHSX 4CMKA 4P4LA 5H82A 5H81A 1H94A 2NLOA 1SZJG 2B69A 4PLYA 2W4QA 5I9LA 3VDQA 1Y8RB 4ALNA 2EHDA 4UVHA 5CDTA 3G0OA 3PJEA 1MC4A 3DBHA 3MJ4A 2GNAA 3A28A 3M2TA 2NVWA 3AM4A 1OI7A 1QXSA 1YL5A 4A73A 3WSWA 2X86A 1GCOA 2W2LD 3ZHYA 5HS4A 3DAGA 3UW3A 3WNQA 3ZU3A 3F4BA 4MDHA 4NK4A 2J3IA 3CE6A 1GR0A 4B8ZA 2JFHA 1BG6A 4BO8A 4Y67A 3KLPX 3ULKA 3DZFA 4MVJF 4FFLA 4J0FA 2NUAA 1GPDG 4CLOA 4D3DA 3JQGA 3ON5A 2NNLD 3Q6IA 2P91A 3PIIA 3B6ZA 1S6YA 4QTZA 4XYEA 3WWZA 1YB1A 3BXXA 5G4KB 5KVVA 1AN9A 2VYND 2X7HA 1CIVA 1DBVO 3BIOA 4IBOA 1PJ3A 5I9NA 1SB8A 2Y1OA 4GSLA 3GFBA 4R1TA 2UUPA 4TSKA 5ILOA 3N7UA 3X2FA 3NDRA 4CMAA 4D3FA 1TI7A 3ZW8A 4XDZA 1M75A 3Q9UA 1X15A 4Z9FA 1HLDA 1TA4A 1VRWA 1CRWG 2D1YA 4F45A 1HF3A 1YO6A 2DBQA 1A7AA 4TKLA 2O3JA 1LLUA 3AI3A 5CP8A 4DLAA 1Z82A 2PGLA 4AJKA 1BXKA 1B3BA 4YDRA 3B20A 3NT4A 5TF4A 1XHLA 3DBRB 4OXKA 1C1XB 2XXJA 4QFCA 1LJ8A 1TT7A 5T5QA 4PG8A 3RFVA 4YRBA 5JS6A 2ET6A 1SAYA 2E6UX 1ISJA 2QG4A 3TJRA 4L4RA 3PLNA 3P5SA 5JNLA 2D5AA 4J1TA 1T1RA 1MA0A 1AGNA 1P0FA 2VQ3A 4IMPA 5A05A 4ZRNA 4Z0HO 5F5NA 3LT2A 3B1KA 2PY6A 4CUKA 1Z75A 1Y8QA 1YKFA 4WOKA 1SPXA 4J43A 1U1IA 1HDZA 4CM5A 4E13A 2EKQA 3B70A 4XDYA 4BL5A 2YQ4A 3DWFA 1PL7A 4A03A 5A03A 5FWNA 3RUAA 2QZ9A 4E0BA 4FFMA 4RVUA 2CVQA 1KC3A 4BB5A 4CUJA 3S1LA 1XQ6A 2C20A 2ZQYA 3ZHXA 4CMJA 2WYWA 4XB2A 4N5MA 1HE2A 4OQYA 4RPLA 4Y6RA 1RYDA 3DOOA 2X8LA 4LMPA 4RQUA 1H2BA 4DYVA 2UVDA 5DBIA 1GPJA 3U3XA 2Q1SA 5HWSA 3GNTA 4YYZA 1ADBA 3C3XA 1GTMA 1Q0HA 1GYQA 3I9KA 4RPJA 2EP7A 3AY7A 3JQ6A 1HKUA 1H9BA 3GZ4A 1RWBA 1UP6A 2YQ5A 3KYCA 1KEPA 4J2HA 4HXYA 1HDYA 3VDRA 2GUGA 4LGVA 5DT9A 5EMHA 3U4IA 4L4SA 1GUFA 4B7CA 4CQMD 5CG1A 3SEFA 2R6JA 3ZDFA 4NU5A 5TX7A 1HDCA 1M2WA 2B5WA 3KRTA 2PLAA 3VH4A 4WLNA 3JQ8B 4J0EA 4LCEA 4EEXA 2Q99A 2IE0A 2PZKA 2EJWA 1HDRA 3RU9A 3AJRA 5JY6A 4XJSA 5TSDA 1E3IA 5LDGA 1HDXA 3QA9A 3LT1A 1M67A 3F1LA 2DTEA 3JQ7B 3RUEA 4DBVO 4U5QA 4PG6A 3ABIA 2Q2VA 1ZW1A 2VYVA 2IXAA 1BWSA 2G1UA 5AXBA 5CG2A 4E5YA 1PJBA 1XA0A 3U5TA 3D7LA 3RVDA 3F9IA 5A9SA 2HMSA 2C7GA 4P4NA 4AJLA 1E5QA 1CF2O 3GDOA 4YPOA 1PWZA 5FI3A 1YBMA 2E37A 3ZZNA 4E2WA 3WJ7A 4BKRA 2DVMA 4IDGA 2YJZA 1VSVA 5AXCA 3H2SA 1LDMA 1UP7A 1UDBA 4UAGA 3CINA 1K89A 3PEFA 1F8GA 1O5IA 2GYYA 2VNAA 4ND1A 4WNIA 3F5SA 1V35A 2YFQA 3LYLA 4C7KA 4NNJA 4FGSA 1KY5A 2GO1A 4AJOA 4QFDA 4EUHA 4XGIA 2OFPA 1NHGA 3VPGA 1KOLA 3P2YA 4YJHB 2ZTMA 3GC6A 4R69A 4A0SA 3VH3A 2X4GA 5L7TA 1KERA 4R41A 3PK0A 3W8DA 1I8TA 3LK7A 1T4DA 2J8ZA 4TZKA 4BV9A 1J6UA 3HB4X 4H3VA 1B2LA 1V6AA 4HFRA 1UAGA 4FFNA 1TB4A 4XZ3A 4ZD6A 1JDJA 4MP8A 1ENYA 1I3NA 4D7AA 4O0LA 1AHHA 1ONOA 2GPTA 3I23A 2W2LA 3HE3A 1IHYA 4MPDA 1KEVA 2HDHA 3JD0A 2PZMA 4NIMA 1YQDA 4ALKA 1HWYA 3LLVA 4DVJA 1QLHA 4NBUA 3DMTA 5C7OO 4IUYA 3RI3A 2FN7A 1LXCA 3PTZA 4CODB 1DC4A 5KVCA 3E9NA 3NGLA 3BMQB 4JROA 3GRPA 3NRCA 3M6IA 4Q3NA 2OHXA 2FZWA 4YAIA 1M66A 3O8QA 4NQZA 4BO5A 1MFPA 2Y1CA 4IDAA 3BMCB 4B7XA 5CEJA 2VYNA 3OA2A 4HNHA 4DBZA 4MKXA 4KOAA 2IZ1A 2I65A 1Q7GA 2Q2WA 3AFNA 4G65A 3PJFA 1U8XX 4DL9A 2C0CA 4UEOA 1PQPA 4PG4A 4R9SA 3WGQA 4FB5A 3QLJA 3RUDA 3OSUA 2Q4BA 3U62A 1VPDA 4PLPA 4OXNA 4D42A 1N1EA 5IDWA 1MP0A 3NX4A 2VWHA 1DIRA 1UR5A 3QHAA 4RF4A 3H5AA 2HMWA 4D41A 4IDCA 2YV1A 2PKQO 3ZV4A 2R00A 4CMEC 1EVJA 1W0CA 3GNSA 4OOEA 1QYVA 2P4HX 4R51A 3H5RA 4TVOA 3HDJA 3ZWCA 1B8PA 2GZ1A 3C7DB 3WLFA 1WW8A 4R01A 3MCVA 4WKGA 1HETA 3UCXA 5FF9A 2ZTVA 1T2DA 5DBGA 4YBZA 4RDHA 2C07A 4BNXA 4YQZA 4CM7A 4E2YA 3ITKA 3VTFA 2I76A 4W7HA 1B8UA 4D46A 5ICSA 2HLPA 1EDZA 2AG5A 3NTRA 3LZ6A 4MP3A 2FOIA 2G0TA 1UXKA 1DFHA 1MGOA 1EVZA 1U3UA 4MIOA 2BRUA 4GX0A 5MDHA 5C5IA 4K26A 1T26A 1Q2XA 3GDGA 3MTGA 1BVUA 4EGFA 4J16A 2AQIA 1YJ8A 5ITWA 2X23A 1R6DA 3D4OA 3TWOA 2X5OA 4WK6A 5I7VA 1C14A 5A9TA 4X54A 3DMYA 1OBFO 2DC1A 2DKNA 4GX1A 3WX0A 5KJCA 4YJFB 3PFFA 3GNQA 2O3TA 1E3WB 1QLJA 1KYQA 3FBTA 1I36A 1A7KA 5KJEA 3TNLA 1N7HA 3MEQA 3S2GA 1KVTA 1SBYA 5THQA 2DM6A 5DZSA 4LVUA 3VZQA 5L40A 3ZWYA 3P19A 2VT3A 2FR1A 5BQFA 3MJEA 3WYCA 2VHXA 4U0JA 3EK2A 3GVIA 4FD3A 4IGFA 2NVBA 3C1AA 3VPXA 1LRKA 2UAGA 3L9XA 4J1NA 1XIVA 3LC7O 4ND3A 4XJTA 4E4YA 1PGJA 4YVFA 2D0IA 4KDEA 1H6CA 3I6QA 2P68A 4LW8A 5B4VA 3VAZA 1LA2A 4S1VA 4JJGA 4CQMA 2EF1A 1EMDA 3R3JA 4B3HA 4YAGA 2WE8A 2PKRA 4BGIA 3G3EA 4QEDA 4EW6A 4NDNE 1DIBA 4ZQBA 7MDHA 1OC4A 2IODA 5I7FA 4NI5A 4L4XA 1N9GA 3FSRA 4CMEA 3KLMX 3OQBA 2YHIB 1HEUA 2NADA 4JLWA 4W9NA 4DRYA 5JFOA 2EWMA 1RJWA 1TT5B 5DN9A 1I33A 3ZWWA 3WTCA 2GD1O 3EVNA 2Q45A 3RBZA 3OICA 5JXWA 4TVBA 1QKIA 5B1YA 4BUCA
chains in the Genus database with same CATH superfamily
2FPPA 2QVZX 2JH8A 1EE1A 1RAGA 3EYWA 4U00A 4TTSA 1DRJA 4R1QA 1LLFA 2B7LA 2V4ZA 3L8FA 5G0VA 1QQTA 3GLGA 3NEJA 2JASA 4WNAA 4A6XA 2EX1A 3COSA 4EITA 3EMVA 5CLHA 5CRIA 5KKNB 2OUIA 3FDFA 1RD4A 3HDHA 3RC7A 5HOQA 3VTKA 3I2HA 1H8HA 4KYUA 4DSZA 2KQUA 1S8AA 5FOUA 1BAPA 1DEOA 3LHFA 4J29A 2HHJA 2H3HA 1WMEA 3OKFA 2W2KA 2WD9A 4LIPD 2QA5A 4LQLA 4KR0A 2FPGA 2VJQA 4MUNA 4P1ZA 5HF8A 1USGA 3HUFA 5AW8A 1TL7C 4NG4A 2BTEA 2P5TB 2PJDA 3ETEA 1X3SA 4BKUA 2QX7A 4G0QA 5TPWB 1AMUA 1YI0A 3O4FA 5CH8A 5HMMA 2WLSA 3M6UA 1GQFA 4S3MA 4IGEA 3Q8KA 5LP6B 3NIBA 2HT6A 4B71A 1PGQA 1JNYA 3L5KA 4X3OA 1KQNA 2C4NA 5DM60 1M8GA 1XPOA 4Z4EA 1FJHA 2ROQA 4RVGA 4WY8A 1E5TA 4KHPB 4HWRA 5JS8A 1IRIA 1DV2A 2CVZA 1EUDA 2Z83A 2ZJ0A 1G38A 2XX3A 4GSYA 2X0JA 3PHHA 4ZHQB 4R3WA 5TQ2A 1JA0A 1USVA 1GSIA 1E1LA 2DQ4A 1Q1ZA 2NXJA 3K0EA 4MKFA 3TLAA 3V00A 1Y1TA 2X1HA 4LXXA 3UK0A 1PIWA 3WLLA 1GZDA 2H1LA 1R2QA 1XTKA 2A9OA 5A6VA 5BV0A 4R1MA 4GBMA 2YV5A 3ASUA 1G5HA 3MJHA 4LXUA 4O4LB 1OQAA 1C50A 3SVZA 3H9CA 3BJMA 3PPIA 1IM5A 3TD9A 4P82A 1RC0A 5FTWA 2C5SA 2V3CC 1UBSB 5DHRA 2H0QA 3ZCPA 5C8YA 1PN3A 1JDZA 2IGBA 3EZ6A 3V4PB 1VG0B 2ICAA 2HAEA 3OEHD 4MA4A 1EM6A 3V9AA 1GZ3A 2YZMA 4HYEA 4IDPA 1JIUA 4L22A 5ALZA 2HDNB 3Q9NA 1PBTA 1IY2A 1QCZA 5EZYA 3NUQA 1OTHA 2O1XA 5FLYA 3U49A 2O2GA 3G7UA 1MABA 2GJAA 3MZ0A 1D8AA 3Q7EA 3R77A 1TKAA 4HTAA 3WICA 1QH0A 5HF5A 1KJQA 2EGHA 3EHDA 4I5GA 1WR8A 1IE3A 1Z6XA 1FS6A 2JAUA 3IQGX 4DLBA 1LUAA 1S9DA 2PQMA 2XGOA 2ZRKA 3EZ2A 5HCUA 1UBKS 4QYMA 4DPLA 3JWHA 2C88A 2DR3A 2HBYA 3D9QX 2UZ1A 3I58A 2ZKLA 4HAUA 4MW1A 4QM6A 3FFTA 1DJPA 4AJPA 1Z6QA 1LSSA 3SEAA 2VRBA 3GRUA 1QIDA 1JEJA 1HURA 5TQ0A 5F1KA 5HQ3A 4QOEA 3H7AA 1TF7A 1XL1A 5A7GA 3MTAA 1YHNA 2OCAA 1VMEA 1YDMA 4IFBA 4URFA 3D6HA 1JYEA 1GARA 4IX1A 1K06A 4GBJA 1KS2A 3GN1A 4Q37A 1ZL0A 1UMCA 3JATB 4DT1A 2AF3C 3FKSA 2Q1XA 3HB7A 4UUMA 4BJ1A 4PAWA 4TYNA 4PG5A 4ZVNA 1JHMA 1WRBA 2XGSA 3IP6A 1I32A 3GLHB 1SG6A 5I7RA 2QUAA 4PSDA 2C7RA 4YAWA 4BV2A 2PUEA 1E4YA 1MKYA 4KO2S 3IC5A 2OHGA 4RJLA 3UHFA 4AQDA 3PEVA 3F9CA 4IS2A 3FWHA 2DBZA 4DNFA 4DR4B 2JVIA 4GH5A 3NOVA 5ALYA 3LBFA 3AYZB 2CNWA 5AUPB 3PFKA 2P40A 3HHEA 3PJGA 3R3XA 3KO8A 3HXPA 4L02A 4QGBA 5AM0A 1EINA 4G4IA 1BKSB 2XI4A 4Q9LA 3I2GA 4EA8A 4V1CB 4BZZA 1OLOA 4GP9A 4Q15A 4DADA 3GFSA 3SM3A 1YRAA 3WV4A 1N2JA 3GFTA 1WDKA 3WMWA 4L7QA 5JYDA 5F76A 3KKZA 4D96A 2BUCA 3TRHA 2QLBA 3EQ6A 3HJCA 4QBTA 1L7BA 1VPLA 1XA4A 1P4HA 2VSNA 3CF4A 1T1EA 3H1AA 2H11A 5AOVA 1KO1A 1GTG1 1YRLA 1QRTA 3W77A 4HAYA 4ND2A 1GOTA 1V11A 1SOUA 2MSLA 4BP8A 4YRBA 4P4SB 5GZ1A 3W78A 4E12A 4H7FA 2CDBA 4BQQA 2V7TA 4U2CA 3G1WA 2UYYA 4L4YA 4BE4A 4F2HA 2IDMA 5HFJA 4ZVPA 1REQB 2C2XA 3GLVA 3IQIX 4OYRA 2I62A 3TZKA 1P9OA 4HTFB 1ESNA 3B2QA 2ODWA 2HO4A 3AGPA 4BNIA 4DSTA 2I66A 3R5XA 4JKIA 4R4JA 3NBYC 2R7LA 3NHLA 5EMKA 2HU8A 3OQOA 1XYYA 4F1WA 2SNIE 1RKUA 1W4RA 3E03A 4MYHA 1SZDA 1DDIA 1WAMA 1F3OA 1YL6A 2XNDD 3DT6A 3ZDZB 2WYUA 2VTEA 5JSKA 3GLTA 2OV2A 1NQVA 4YH1A 2I99A 3GRCA 3G2KA 4GOXA 4HAVA 2FXIA 4MV6A 5CJ2A 1GL9B 2W7TA 1GY8A 3TDKA 5C1DA 1EWRA 1LQUA 2IE8A 3SN6A 5BR1A 2PRSA 1RI4A 1JT9A 2LZ0A 2D2EA 2RI0A 5D5QA 5FBWB 5B1HA 2PYZA 2Y0EA 4RVHA 4GMFA 1TYZA 4LJ8A 2V9PA 1DG3A 4NARA 3NB0A 4LQ4A 2G4LA 3QEAZ 1VPEA 1W94A 2O8VA 3A4VA 1JVSA 3AP2A 3MUNA 2XWPA 4IZ6A 1CW2B 1F0NA 1BHQ1 4QYXA 5DULA 3VR3A 2GXAA 2XF2A 1NSYA 3ZU5A 5A2QA 3HRKA 4TMZA 5CVVA 1PLJA 1YJBA 1YQEA 2EARA 1H05A 3VBCA 2LE0A 5JPDA 1APBA 4LFBB 2WPNA 2CLIB 3HV2A 3FVQA 3KTDA 1KKMA 3FHLA 2HM7A 3PD7A 2NO0A 1MO5A 3D02A 3HA5A 4V0LA 4WAUA 3RFTA 1NVWQ 4MQEA 3RAFC 4D0NA 3KT3A 2XIJA 3ER8A 3FCUB 2HWWA 5B7GA 5AVTA 5A3SA 4BWGA 1QH1B 2HJGA 3NWBA 3EWAA 4OSPA 1RAAA 1FYEA 3TLYA 5A5DA 2PL3A 1K92A 4B7UA 5HX7A 4J1TC 2D1QA 2REXB 5G40A 5IAAA 4R16A 3TGLA 3EXHC 5AKJA 3DW3X 2B4KA 4HAXA 3MXTA 4XSHA 3ZWKA 5HXAA 3E7XA 5IHPA 3QQPA 1XZBA 3E4DA 4BKPA 4BQEA 2Z1MA 5A4DA 2Y1GA 2GBIA 3NLLA 2R7MA 4WKNA 2VPPA 3D7KA 4JJ8A 3BF8A 4EUEA 1PYOA 1Y4DE 3NHWA 5BYKA 1NVTA 3PHJA 2I55A 3WYAA 1DPGA 4JP2A 3G13A 1A7UA 3RC1A 4J3JA 4EGJA 1H0HA 1PNTA 3JRWA 3G17A 4QVGA 1WS6A 2IQIA 2F1HA 3AHCA 3GK3A 4BNVA 5A5EA 5A5GA 1L7OA 3PUIA 2GZDA 4MQFB 5KYWA 2JHGA 2EXXA 1KZ4A 3R7WA 4D9FA 4MI9A 2ZWPA 1KP3A 5IYZB 4HQKA 3DKPA 3L8DA 4LNUB 5JSZA 2AOXA 4HDCA 1DKMA 1NXPA 4IJVA 5HA5A 5TT1A 5BR7A 1NY6A 5IDXA 1PJCA 2FEAA 2NWQA 3D8RA 1JIVA 1K6JA 1K5PA 4MV5A 5AKLA 5ICFA 3FGZA 3GBSA 3L46A 1P2SA 4ZVMA 5TGDA 3DHYA 1L5RA 2YWXA 4RHEA 5M7EA 1C1XA 1KBZA 4GZLA 3S1AB 2PS9A 3NYIA 3X1KA 1OBOA 3RS0A 5I47A 2G8LA 1M7HA 1MPTA 1UZUA 1Z5ZA 2CJWB 2Z4RA 1LPPA 3TLGB 1FDTA 1VYHA 1MNAA 3EW9A 3I9OA 4HWKA 2VUHB 3MJVA 4LRSB 2D0PB 3IJRA 3M0EA 3QPAA 1KJNA 4KUHA 2C9MA 3BHNA 5FXMA 1VL8A 5AW7A 1AKEA 2CDAA 3C45A 3ZDBA 4BQFA 5JD5A 2XXAB 2IBMA 1V5IA 1MUUA 1FQOA 1EGHA 5BWOA 1PK7A 3W3AD 3ZS8A 4F5EA 4QUHA 3QH4A 1UKCA 5JSZB 3QE4A 4I55B 4US2R 1EJBA 1B6TA 4BV3A 3RKUA 1QF7A 2FOXA 4NZZA 1R4AA 2XVMA 1E3TA 3CSSA 1Z45A 2J6BA 3CR8A 4J90A 4PG7A 2H1IA 2JIDA 4XM0A 2BI8A 3UNXA 4BO1A 1JSLA 1RYHA 3QVMA 1ZIDA 1G8SA 1QONA 4XR4A 3H4IA 4JD5A 1RYEA 4PZPA 1DGQA 2C1XA 1MZPA 1X0VA 3E1GA 3BTUA 1DKUA 4C20A 1G3RA 4RS3A 3Q7SA 3ZWDA 5JJ5A 3S55A 4DEYA 2IUTA 1IB0A 5GQSA 3L2OB 4NZPA 4R2KA 3T7IA 1D6SA 1SCUA 1DO0A 3TXAA 4D4JA 4Q1DA 2Q4TA 1XRLA 1A9QA 3MILA 2WHXA 4RXUA 4BWFB 2AOVA 3BZBA 3ECAA 3AF6A 2C94A 4YACA 3PUYA 3QY0A 2P62A 3KVYA 3JAKA 1O0SA 1OBHA 1RW4A 2PA3A 4LBZA 3KVNA 4A8TA 5CCDA 4NE9A 5SZJA 4EUNA 4XWTA 2QQFA 2QWXA 5HMLA 2IPNA 3ZOKA 4BECA 1Z88A 1LWOA 4Q3AA 5LLTA 5IASA 3S6JA 4GZ5A 1X9HA 2VTBA 4IGKA 1QTQA 2CLHB 4Q4JA 4IWNA 4KU4A 2GQ0A 5CW2A 4O4JA 1ZMXA 2IUFA 3E22B 4DM7A 1RJDA 2GEKA 2INGX 3N74A 4CMBA 3FX2A 2QZZA 1YVDA 3OMXA 2VDQB 1E32A 2ZPUA 4PV7A 4J4HA 1O6ZA 2WJ3A 2CE2X 4DCGA 2WNHA 4E33A 4UXJA 2H7XA 5LZ9A 5EQJB 1JJAA 3ZY4A 4ZQHA 5IDYA 4PC2A 5T6BA 4DIFA 2ECOA 3OPVA 4LJ7A 2AWNA 4JLUA 3RYHB 1GG2A 1A2QA 1E3LA 3OAAA 3SLRA 3H2BA 2JFVA 2QIOA 4QOHA 2EL7A 4AFNA 2WJWA 1HOXA 3TD2A 1L3IA 3AZOA 1T0JB 4MUIA 1XWFA 1Q83A 1E2QA 3RODA 4AP5A 4FW8A 2C2OA 1VI6A 2CHFA 1XV5A 2YVLA 2JK0A 5ALJA 3VZDA 2ID9A 3VC3A 2OK8A 2FMFA 2PRYA 1B8OA 3D6NB 4KRFA 4I2VA 1SXGA 2O4CA 2PM8A 3E8MA 2F9FA 2RHRA 1D09A 4XJXA 4GXQA 4DG5A 3OZSA 1JR3A 1I7DA 1PR4A 3OX2A 1E2KA 1ZVMA 5DBOA 2C4UA 4MCHA 2GA9A 3DZIA 4H1HA 1P3JA 3N6XA 1IN8A 1G8PA 2Y0BA 2Q46A 3G8CA 4D9MA 4F7WA 3RB8A 4QULA 3B7WA 4QEKA 4PC1A 1T3HA 2FFBA 2NX2A 4B0PA 5CA1A 2QSYA 2X41A 3GUUA 3IL2A 1G20E 3AVXA 3N7TA 4MZXA 3AHEA 1XB2A 2CLMB 1XDZA 1VBMA 1AK9A 1LBIA 2PX4A 3FRJA 3ONEA 3NVAA 3L4EA 1FPQA 1ND6A 1UBJS 4DUGA 4WBNB 5LP6F 3LK6A 3QWBA 4AN4A 3OT4A 1ZW6A 5FHQA 1PTKA 5BOSA 1DOAA 1FFXA 2FA9A 3EVCA 4XYMA 3VNSA 2MYUA 2D13A 3FFWA 3UA3A 2XHZA 1WCV1 4FLMA 1HE3A 5TT0A 3V1TC 4OATA 3GR6A 5IRCD 4CIDA 4BLUA 3IR5A 2I4MA 2VA8A 1GFWA 4LJ5A 4MTLA 1FYFA 3BN3A 3U3DA 2YV2A 3U13A 2XOKA 2E4WA 3N3AC 3CIFA 4OKIA 2EKBA 1JHPA 1DBRA 3NHKA 3NIWA 2QTTA 3KX2A 1Y5MA 4J4BA 2WDZA 4PM4A 3SHTA 1L5WA 3KR2A 2HFJA 5G3ZA 3VC7A 5B57C 3FSGA 4H6VA 3D2LA 4XE5A 2W2QA 4YROA 2L42A 4WOCA 1JW9B 2PSDA 2VNJA 1AA9A 1Q7CA 1UK9A 3FYCA 1NR5A 3M9LA 5F23A 1OWLA 4E3WA 1DX9A 4XD7A 5F7XA 1JHXA 4C22A 3W5BA 5A0VA 5IS2A 1E1QD 1BS1A 4C0LA 4RZIA 4BO2A 2HPAA 3GPBA 4YTEA 5DH9A 3I8OA 3O8BA 4KC0A 1F2TB 4YMWA 4OJKA 1R00A 1ACJA 1FMCA 3RRXA 1XTZA 3K9CA 5CITA 1D2GA 2O6LA 4YXWA 1A2OA 1FSZA 3FVRA 4JP3A 4MV7A 4NE2A 2X76A 3MTBA 2OZLA 3I42A 3KXDA 2ZDGA 4TXHA 4Q9IA 2FUEA 4X3PA 4B48A 1NMYA 2BFOA 4LZLA 5DM2A 4W5RA 3Q72A 5EC8A 3F74A 1K3FA 4IIXA 1E2DA 2GPYA 1KZ7B 2WWFA 4TMWA 1L7AA 5DTJA 4UM9D 1Z25A 3CMCO 5H3CA 3FG9A 2WWRA 4U2EA 2NPOA 1H1LA 1NOKA 2VAMA 2YW2A 1LRLA 5ARBA 5F2NA 3KHUA 4Q00A 1LNQA 1GPLA 4HRAA 5BXQC 3BMCA 3A0RB 2C3PA 2MOKA 4H0FA 2JCSA 3JQAD 4PLWA 1J7KA 1SHZA 5LYYA 1Q74A 1VKHA 4BRUA 3KAQA 2FE4A 4RPIA 3ZGYA 1CVLA 1P7WA 1COWA 1AUOA 1L8XA 3IOBA 3OOWA 4MJLA 1RFGE 2OFWA 5JEEA 5K0EA 4Z4CA 1KWKA 4MS1B 4WASA 1S2OA 5DGDA 5DXAA 3EVZA 1QTNA 4C2BA 3A1WA 3NDPA 4IMJB 5EWMA 5IBQA 4QUKA 3I8XA 1GEEA 3KPJA 4FPXA 5I7UA 3VJMA 1CV2A 1I3LA 4LYDA 2FQ1A 4YP9A 1H5NA 4X8MA 3ZVNA 1LK0A 1LDYA 3NP7A 1VKJA 2C99A 4KP7A 4XQEA 4Z9XA 4DAOA 1WD7A 1B26A 4DRXB 4Q3EA 3E82A 2EU8A 2O2ZA 1ZC3A 1ZJZA 2OD9A 3QJGA 1NRXA 2C3OA 1VE3A 4I1VA 3TDMA 1J09A 3V1MA 1QBGA 3JALB 3BKXA 4WACA 4F91B 5F3DA 1BDIA 2YMMA 4ZPJA 5KKAA 1U0EA 4C3OB 2QVLA 1G2PA 3GAAA 1B6RA 3AONB 1K97A 2XYRA 3KELA 3LUBA 3OQ6A 4HDNB 5BV7A 2C7BA 5JJLA 1D2MA 4FFVA 4REQA 3R5JA 1Q92A 3OD5A 3KIPA 4IZHA 3RK1A 1Q14A 3PFWO 4HWTA 3G0CA 4Z4GA 4YQEA 1G3QA 1WKBA 3GEMA 3MERA 4BMSA 4KYTA 4DHEA 3OE4A 3RRZA 3JWEA 5AQ1A 3RYCB 1GJRA 3BD8A 3NFRA 2WA2A 2GESA 1ADJA 1LRJA 1V48A 5U4QA 3BXHA 3NC1C 4JNKA 2GBPA 4K6HA 1W2HA 3DL7A 5TEVA 3TE7A 2F62A 3FPFA 4U2BA 4Z1MD 1PZFA 5KC9A 2B5OA 1Y3AA 3LRPA 3TIFA 4CEIB 2HWKA 4L0CA 1D04A 5FADA 5LQJA 2X13A 1H2EA 5ISMA 1QV9A 3M5PA 1ODTC 1OHHA 1MTZA 2DR0A 1L4FA 2IOHA 2ZIUB 3GF4A 1V9LA 3RHSA 5JAOA 3AR7A 1A4IA 3F4LA 4LZNA 4MUBA 2R4UA 4ZIRB 3HCCA 4ZOLF 4D8TA 4K8RB 1A9TA 1MX1A 2X7JA 3EF3A 3KJHA 1ZD2P 1RRFA 3QMWA 5EXPA 3TSAA 1ZM4A 2QJWA 2Y6VA 5K1ZA 5IM4A 1XJ0A 1OLUA 1RYBA 1UM8A 3LW7A 3OM8A 2HLHA 4FDVA 2H1RA 2HSZA 3KHSA 5HIAA 1RAIA 4OL9A 2ZB3A 3SICE 3DXXA 4M9XA 4I1PA 2GDJA 3L5OA 1YULA 3E15A 4DCUA 5CDFA 4XWKA 5KHLB 1XC7A 2Q1UA 3HKBA 3N2LA 4B3CA 4YUZA 4UCWA 5DTEA 2VHTA 5KPJA 3TW0A 1A8UA 3AHGA 4Q3BA 3SJCA 2RAVA 2AN9A 3R6GA 4A9AA 4I6JA 4CG0A 4KIFA 2IDZA 5L8VA 4WIAA 1XTRA 1HSOA 1T6YA 2IJGX 2D1TA 5E3HA 2IPMA 5TRTA 4HLQB 4AICA 2IYTA 3K6SA 5CX4A 1BJTA 1QUFA 3DSRA 3C85A 1DE0A 1R4NB 4LDAA 1AQ6A 1T9HA 2J41A 4MGHA 4G0WA 1FMLA 1T5OA 2OC4A 4QBGB 4PS1A 4WN3A 4RVDA 4X5OA 1DJLA 3PGLA 2FEXA 2ZK7A 4OJQA 2IY7A 3S29A 4RDIA 3WZLA 4D97A 3K71B 5CB0A 2PUAA 1MVLA 4ZCIA 5F77A 5LYJF 2RG7A 2CC2A 4BO4A 2H18A 4BVJA 5CFQA 3KKMA 3NXKA 2A0YA 2YV4A 2P79A 2VQ6A 1HNWB 3GUHA 2JDIA 2EYQA 4QQ8A 4V0MA 3IVGA 4I9NA 3IEKA 5ALNA 4AY5A 3HA7A 4HNGA 4BEJA 4EDFA 4UTXA 3VHXA 1W2GA 3LZDA 3O82A 3TSOA 3TXXA 2ATVA 4MGYR 3E3AA 3WBBA 1RDFA 3D7MA 3E70C 2QVGA 3GPLA 1GGKA 1SKYB 2BW0A 2HK8A 2DULA 2H7CA 4NU0A 5C37A 4AQ7A 5K2MA 1VE9A 3MD9A 4ND8B 4DJAA 3GH3A 2QD1A 2OGTA 3AUAA 3LT4A 1ADFA 1PS9A 3AEQB 3AERB 1DKQA 2JCVA 5DX8A 4WCFB 5K99A 5CFNA 1RKQA 3HBMA 1I2DA 2J7PA 2ZT6A 2KI5A 1YZ3A 3EXEB 1NMXA 4KNWA 1NJ6A 4EKNB 2I3BA 2YDYA 1MTOA 1C9MA 3CLVA 3EZXA 1UFOA 4IG9A 2BHTA 2VWGA 5IYZF 5CBPA 4YNBA 5B12A 1ZVJA 4RCYA 3EG5A 1GGNA 3QFTA 4OV6B 4PSKA 1QV6A 1U8CB 3ILHA 4Y0VA 1ESZA 4O3MA 1O95C 3BQNB 3H1GA 4LF7B 1KY2A 1AS3A 2H29A 1LGYA 2I4NA 2J3EA 4D9KA 3DE0X 2W8BA 3C3KA 4NXNB 3ANNA 1DRUA 2GZMA 1S2NA 1J2RA 3AR8A 3CZPA 3H05A 3SDSA 4BO3A 2QTVB 3E4CA 4X94A 2Z57A 2VT2A 4PG8A 4M4SA 4MYUA 2FWJA 3PENA 2K87A 4X20A 3REFA 1J5PA 1EFPB 3ZHBA 5J23A 4MSUA 1PFQA 4UUAA 4DPMA 1MMFB 3MGGA 1RPAA 3I53A 1KI6B 3AESA 4IQFA 4UDYX 3I32A 1E4EA 3EC2A 2QL9A 1Y89A 3G2OA 4E5NA 2CXUA 3L4BA 2PGDA 4A6PA 1JXMA 2V5AA 1FLVA 2X0DA 3CZ9A 5EJ6A 4I55F 4Z5XA 5C51B 3DLBA 1A9RA 1ESMA 2H7YA 3MBKA 3W7BA 2ZAGA 4LEIA 5E4JA 4P08A 5G0WA 3IIIA 1AB6A 1IBLB 4O29A 2PUCA 2HCFA 1E3JA 1MXFA 2GDZA 2NO9A 5EHXA 3ZTYA 4H7IA 1KYTA 1Y9DA 1OF1A 1JI3A 5C5DA 4AG5A 4QRDA 3GZNB 4XI9A 3NT5A 4YT8A 3S28A 3ZBQA 3KSBC 2YJTD 5L3SA 2KX7A 3AR9A 3KLBA 1P1BA 2H48A 1P5ZB 2PANA 3CA8A 5LQRA 1NQAO 5EFZA 3ZIAD 4JOQA 1CQJB 2GEVA 3OT1B 4PYKA 2YWGA 5ESXA 4DYDA 1II8B 2NN3C 5D5PA 5K8UA 2FR8C 3FIJA 4F2PA 3PQDA 3PFNA 2PS3A 4N3AA 2WVHA 1VA4A 4JOBA 1JB9A 4RZ2A 4Q7LA 3MGCA 5AWFC 1AXRA 3MGKA 4WESA 4EYSA 3UICA 4BP1A 1WXDA 1CDDA 4HDMA 1JG3A 1QR2A 1J0AA 1IH8A 1WSAA 4CN8A 3KXLA 3KJNA 4MZDA 3PIDA 2HRZA 4B9AA 2FEKA 5EZQA 1QCDA 1FVFA 4KB5A 5IXJA 1SKQA 2RGBA 4TUYB 2XLBA 2J9ZB 4PIMA 3WLSA 3OKPA 3P0FA 4AG3A 4H17A 2R8BA 4D3YA 2HNKA 5T8KA 1ZOIA 1AF4A 5LQMA 1AIPA 2HA2A 2EV9A 5FBKA 5BN1A 2MINB 2VATA 3IHWA 3IOEA 3MXOA 4QOJA 3X3HA 2V6BA 1V7CA 4K86A 3WDKA 1M54A 1RAFA 2F4VB 1K8RA 3QW2A 2PXAA 2BEKA 3C6MA 2XODA 2IZ6A 3NTQA 5IF3A 1NF8A 3GVCA 4DRZA 1FP7A 3V1LA 4YUWA 4I1IA 3WY9A 4CKZA 2BE7A 2BR3A 3OFVA 2GN4A 3UJ6A 3I30X 1ULTA 3UMSA 5HE9A 4NULA 2P5YA 3ACBA 3TLBA 4CU2A 3IUEA 3PEEA 1AZLA 2CNOA 4JU9A 3UMYA 1FOEB 1P19A 3RWMB 1I94B 3C6BA 4P3PA 3T5GA 3OQ1A 5HTOA 4H4DA 2IK8A 3D4IA 1YUBA 4PPYA 5EI5A 1OH6A 4IHJA 2PGOA 2CBZA 2A1UA 9ATCA 4Q4CA 4W5NA 1P60A 2GM9A 1BRMA 1KC1A 3A1NA 4CKWA 2QROA 4TWIA 4AIRA 4ON9A 3N8NA 4GM0A 5JPCA 3F67A 3M8KA 1V2GA 1XD2A 2OM2A 4HDSB 1CZLA 2OCXA 3BGDA 1V8PA 4NHEA 4WPGA 3CLKA 4NE7A 5D3MB 1N33B 1ZK3A 2X6TA 3JQFC 4HYQA 4RF3A 3E7DA 4ZVSA 3UAXA 2UYCA 3MWEA 5DLPA 2GYVA 1GDHA 5CB8A 1IQRA 4EJSA 4HLDA 1A77A 1LPSA 4J0CA 5ALKA 1WF6A 2PXHA 2CLSA 3P0IA 1JWBB 1TO2E 2WHPA 1LVGA 3OX3A 2E89A 3PC8A 4X0EA 2F1OA 2JHFA 2RBGA 4W99A 3PTAA 1A4RA 2JI4A 5JXHA 1S3SA 3SOPA 1NXSA 3CKYA 3JQBC 2Q27A 4UE3S 3X44A 1E6WA 1J1IA 1QDLB 2VDWB 3PGJA 5BVGB 2JH9A 3RS5A 3EAFA 3OE7D 5BSUA 3OCJA 1J39A 1K3TA 1KYXA 2GBLA 1JLLA 4FNOA 4WK0B 4Z7QB 3F3MA 3RUIA 1PS0A 1UKYA 2CXSA 4H7PA 1WXIA 2BISA 2QG9A 4P32A 3VTAA 4U3JB 5ESWA 5BSFA 2NTVA 3DFUA 5E6RA 3H2HA 4KPUA 1P80A 4Y18A 5E8JA 5E1MA 5HPYB 4DKJA 5K20A 1HTBA 2JD2A 2VPTA 3KZXA 1SVMA 1EWKA 4MUEA 3ONDA 2NTJA 3HG7A 3LWDA 3QHPA 2I29A 4L2IB 5BMOA 2XXBA 1NQXA 2IYEA 5CMLA 2QR5A 2W6NA 3HK2A 1Z0ZA 4YRIA 3PDUA 3OEEA 4U39A 4YCLA 3U3KA 4BVFA 2OBNA 3BL8A 1ML4A 5AM2A 1X7XB 4RGBA 5DI9A 3Q0EA 1G4UR 2A33A 1MVNA 4MVJH 4V39A 2Q3DA 1DQRA 3DCNA 1PL6A 3NTOA 3T38A 4GSKA 1HX7A 4JI0B 1JHRA 3AF0A 4WCVA 1XYGA 4XSGA 1LS6A 3VZSA 3IA2A 1YBFA 221PA 1RBYA 1W59A 4YALA 4RCVA 4JGGA 5A06A 1XTUA 1PUJA 4LG1A 2RJOA 5B2FA 2R1TB 2IXFA 2OB1A 3Q6MA 4HAWA 1CR4A 3WTBA 2KLHA 3M3DA 1RADA 4B5KA 4RTLA 1R0ZA 3HGMA 1V11B 1YIOA 2GI4A 2QTHA 3DEAA 3WLKX 1SUEA 4L85A 1NBWB 4LPSA 3JCZA 5IMSA 3H4MA 4I1OA 2EDCA 3QVGB 3B3FA 4I1RA 4UBLA 1CUYA 1GEGA 3PTLA 3UMRA 1N1GA 1PEKE 3EDYA 3M4NA 5DNVA 3DBVO 3WGUA 1KJYA 3FWNA 2W6JA 1PG5A 3QF7A 3FUXA 3C98A 4DR1B 4UBJA 1XALA 3F5DA 1QIJA 1MO2A 2EQBA 3L0OA 1QWOA 2HWUA 3EGIA 4OKNA 4UEJA 5BW8A 5CB4A 4EDHA 1UAAA 4PIVA 4TWAA 1BMQA 1I0IA 2PSFA 1S0UA 1K6IA 3CGWA 5L7WA 2GN9A 1WG8A 4JBGA 3ZWVA 1U0HC 4F04A 1C0KA 1W49A 3PJRA 3WDMA 1W4AA 3F49S 3KQHA 1Q22A 3IVXA 5BT9A 1R88A 5KTMA 4GOMD 2B9VA 2UUOA 1JAZA 3RYFB 1QRRA 2I2DA 2D2IA 4IG4A 1B7GO 1ZA2A 1GV1A 1GPWB 1NI3A 3L7BA 3NORA 4LCJA 5DYWA 3TUZC 1I1QB 1LDBA 1NT2A 2VL7A 1TYEB 3D8TA 2NGRA 3LQKA 4UCFA 5EIWA 3FLEA 3N2GA 5U4XA 2WY2D 2DUJA 3I8SA 4KMRA 1FDUA 4J7CA 3VXKA 3PFGA 1X1TA 4LKOA 4BLWA 4PN7A 2FX2A 2EJTA 2XB6A 3AY3A 5G53C 2DECA 1Q0LA 2X9QA 1DBSA 1WSWA 3Q15C 1CUIA 1NWCA 1N7GA 1XVIA 4OM8A 3TE6A 4OOFA 3I05A 3C87A 3P7MA 1L7PA 3R1IA 1W30A 4P0QB 3RM3A 1ZMTA 5FUYA 4WCFA 3H11A 3HYRA 3ROPA 5COBA 2DX7A 4C3UA 1Y1SA 1JFRA 4AJHA 1GT91 4FOSA 1H1DA 4MMYB 2HA3A 1GPYA 3RTEA 5IXSA 4KUEA 4OXIA 4ETNA 2DYKA 3QUAA 4M0MA 1SXJB 1LTHR 3FCOA 4R2HA 1RPNA 3SJ7A 1QRAA 3ENKA 4A8JB 1ENPA 1YAHA 1P4GA 2FY8A 1IU9A 1JEQA 2JJ8A 3IKVA 3PPVA 5B55A 1ILEA 3PGKA 1FU7A 3KWJA 3LX8A 2IZZA 4Z51A 1A9XA 5BSTA 1ID1A 4LXGA 1BMDA 1W93A 5FQOA 2ANBA 1O54A 1USKA 4XFDA 4CM9D 5GTDA 2AD1A 3L93A 1EVLA 3BSSA 5CVUA 4B46A 4CLHA 5ADUS 4LDJA 4OJNA 1Y4AE 4KPGA 1BCRA 5CDSA 2NZVG 2WSMA 3GGCA 4ADSG 3WAGA 3GGDA 3EMKA 3VSEA 1YA4A 1CIJA 3CWZA 3IPYA 2VTVA 4CLOB 4MHTA 3IUNA 4PVDA 5KWEA 2FW1A 4G1CA 3K4PA 5I9BA 3COYA 2GRUA 4BGVA 2LIVA 4FYXA 3PSAA 2YCLA 1ZRHA 2A6PA 3JR3A 2CVPA 5EJFA 4D8UA 4ZK6A 1HT2E 1QG0A 5AI0A 2HU5A 3FMIA 4TL6A 5JEDA 2LKDA 1PG0A 2GRJA 1C4WA 1IRXA 1Z07A 1Z7WA 5EZ6B 3TLMA 2QUJA 4R54A 1SRQA 4MIYA 2KB0A 4M36A 5M34A 5ICCA 4DW8A 1I2AA 4CUZA 2GERA 3SVTA 1DKLA 2RBKA 1VJ5A 1P1FA 2O6HA 1FTNA 2FWIA 4JX9A 5BY2A 3AUKA 3F4KA 2JIBA 2JFGA 2IYLD 4XPZA 4Y9DA 3ZE0B 5D87A 5D1HA 6YASA 1F8XA 2BTQB 3IBGA 3FNFA 3DAYA 1YZGA 3CZAA 5F1PA 1UC5B 3AINA 3FOZA 2A9FA 2UVPB 5KTPA 3ECCA 4CCYB 4DGSA 3VRHA 4DABA 5HYVA 4CLXA 5ER6A 4OP1A 1XBTA 4JFAA 1YR2A 1I6LA 2WC1A 3FPCA 3LIIA 2J6CA 2MYPA 4IGAA 1RFLA 2ZJ5A 2YHAA 2FEMA 2O2HA 3CZ4A 3IYLW 4R9RA 4DQVA 2QW0X 5BWMA 4DR5B 2D3TA 1SG9A 2GWRA 3Q11A 1GQSA 3PFIA 4XXHA 3VVMA 4IQ8A 3THOA 3OP4A 2WIFA 3LLUA 1PKXA 2FVXA 4TKVB 2QPTA 5CNIA 4M9QA 1OZFA 3KFVA 5J4VA 3NAQA 2VWQA 2NW6A 4MNTA 4QUDA 5J5AA 5EXSA 3K0FB 2WTUA 2B1QA 3CEAA 3EXIB 4JK3A 1X7WB 2AK3A 3KK0A 3KQMA 4ZI2A 2NXWA 1J8VA 2ISCA 3WBJA 4O2BB 4J0KA 3DAPA 3G49A 4OBXA 1ZIOA 2A84A 3RCBA 3RF6A 3V8RA 1YR8A 3VPDA 3DDHA 1F7VA 4LYEA 5JV5A 1P2GA 2N1BA 3BTOA 3O93A 4HF7A 2OQRA 3ZKWB 4PLTA 1ADYA 3LKVA 3O95A 5BW5A 4A7PA 2IYYA 4GI1A 4BJ6A 3TRKA 2PGXA 3OZDA 4RZHA 5DGCA 1EP2B 4R31A 1RLMA 4KOEC 4ZJUA 5JNTA 1UPFA 3T5PA 3OHMA 2P6RA 1AK1A 1Q7BA 2I3GA 3ONNA 4QD3A 4B85A 4B2PA 1IDOA 4LOJA 4DREA 5AVYA 3FA2A 4DDTA 1OX6A 1M3SA 2IX3A 3PWKA 5F5XA 4LISA 1UQUA 3VGJA 3K8ZA 1TVMA 1BOOA 3VZRA 2BKLA 4LI3X 1TIKA 2HWYA 5FUVA 4XTCS 1FRZA 2GH1A 3FTNA 1NZDA 1MZVA 3Q9LA 2WIDA 3S2YA 4B3BA 2B78A 3NO4A 4ZTUB 2BY4A 4UBKA 4DUPA 1T5SA 4N6NA 1JDBC 3WGZA 4ENWA 2Z9CA 1G5RA 4D82A 2I3ZA 3IQXA 3RROA 4BMPB 4EX7A 2BEWB 3G1TA 4GLFA 4WXYB 3E3NA 3DLAA 4TT3A 1JECA 3NVKI 1TW3A 4N0PA 1X8XA 3SBDA 5JNSA 1G7RA 4UNPA 1Y42X 1OAOA 1AS0A 3HJBA 4IEEA 2Y1XA 4Y30A 2Y05A 2B82A 1BNCA 1W44A 5EPEA 4LHSA 5FWAA 3EF1A 3NBMA 5JD6A 4GECA 4D92A 2P35A 1Z4QA 1CE8B 1N2SA 2UUCB 2XQIA 4OUDB 2J0QA 2A35A 3W6UA 2CZCA 4P3NA 3FZGA 2P9JA 3QWHA 3ZHCA 2VP9A 2KS6A 1XQ1A 1R5BA 3AKCA 3GEDA 3OH8A 4LSGA 1Z5GA 2CLKB 3CX3A 3AUFA 4DLWA 3KKOA 3PUXA 4UQOA 4WA7A 1SA0A 4KSBA 4CM4A 2J0VA 4HH3C 4ER3A 1CY4A 1DO8A 3AG6A 4F86A 5KYTA 4IF6A 1U8ZA 1XTTA 1UT6A 1XJCA 1ISHA 1Z4MA 2OG2A 3G2LA 3IAAA 4M1OA 3WNZA 5C4IA 4MEBA 1EXDA 5C3MA 3MCTA 2G36A 4K6CA 5K0JA 2B0CA 1ABFA 4ZV7A 5CXXA 4MPRA 4URXR 4BB6A 3HBFA 3MD0A 2WJYA 3RVOA 1NN1A 3V7NA 5AJXA 4CNQA 1UPUA 1OTXA 5TVKA 5C8YF 1DNPA 1Y3FE 2QN8A 1T9KA 3AY6A 3OESA 2FPIA 4RO0A 3DGFC 3EIEA 3LFHA 1C2TA 1DTWA 2GVDC 3LBHA 2QT9A 1R3UA 3B3AA 5ALEA 2YJ5A 1M7GA 3A4NA 4WCFC 3TZEA 1UBHS 3ZYCA 1WD5A 3L6CA 2AMYA 1EQ2A 4NOKA 5AOAA 3G1UA 2VJKA 4UHJA 4EF5A 1HT3A 1P0QA 1GL6A 2FPLA 2PUWA 3P9YA 4ZGWA 5JNVA 4D9HA 4DB2A 4MYRA 3JTMA 4KXQA 2AJDA 2FK8A 2OEPA 2RAPA 2WF6A 3BRCA 4I8XA 2G5TA 3EHEA 1L4NA 3P0JA 1P3Y1 1FIUA 4RC9A 1AE1A 3BYZA 2QYSA 3ZBUA 2IYNA 3ITEA 4ERXA 1OWNA 1VIVA 1DIOB 3SHFA 2PH3A 3K70C 3IPCA 2P9YA 2P0AA 2LNDA 4HD8A 4C0HA 3RSFA 2FWBA 1YH3A 4BNUA 1M6HA 1P6QA 2V54A 3H9GA 3WGGA 4W1RA 3I0NA 1P73A 1VLLA 2J4FA 3TUJC 3VX4A 4YRJA 1TJ4A 2VP6A 1GNTA 3ORYA 2CMFA 4KQJA 2IITA 4HUTA 3A10A 5CYPA 3T7TA 1ZDMA 4XVCA 2NVUA 3NC4A 3ACDA 3FRHA 4BNDB 4C87A 2DZDA 4F5WA 1R9GA 4LZZA 3AM1A 1CRPA 4KV9A 3KZOA 1UC8A 5K0ZA 3L41A 4EHHA 1Q17A 5LMNB 1X1EA 3MG9A 4OMUA 2FX5A 1WZNA 4Y3UA 2MYTA 1T8PA 4V02A 4EUFA 1FUIA 2VCHA 2JJMA 3ETNA 3KWLA 1O8CA 4DV4B 3UT5B 1FW6A 3MJTA 1QOPB 5KI6A 1BKYA 4PHGA 1RYZA 3HB5X 2Z56A 3RWBA 3EPJA 3SMQA 5BURA 3DP7A 2WF8A 4K3UA 1X0XA 2H16A 1VMAA 4N40A 2PZLA 3EEFA 3I6BA 2WD7A 4EGSA 3THWB 2AHRA 3MT9A 1TECE 3UJDA 1PZNA 3NWOA 3PXXA 4FZ5A 4LHZA 1U7DA 2N47A 3H9UA 4EB8A 2X19A 2HDOA 1W6UA 1Y9AA 2VT7A 3E48A 1XEWY 4KFTA 1WDMA 1QGAA 2I78A 3SKXA 4EB3A 2WT8A 3QVSA 1N2XA 4KBGA 3IVMA 1LU9A 1OAAA 2AG6A 1L5MA 2XA1A 1G6HA 5KYYB 3GLIA 1U31A 2QT0A 5LZ8A 2R5FA 2E18A 4PBTA 2IPOA 3LGXA 1CSEE 3OZFA 4EBFA 2KBFA 4MHOA 1SVLA 4M76B 2H1FA 4NCBA 4MKIA 4A1FA 1SK9A 1RWMA 3HQ4O 2HMUA 4YLGA 4ZI3A 2GD6A 3ZH9B 2JAOA 2OQIA 1E6UA 4DTIA 1BCSB 1UFKA 3LU1A 3MT0A 4FHFA 3V6MA 1JTVA 3GEBA 4A0HA 4PQYA 3SZUA 1KFCB 3HYTA 2Q3LA 4MW7A 2AZMA 4RW0A 4YMTA 3O8OA 3UJ7A 4FJ1A 2YTZA 4N41A 4N4AA 2PMFA 2NQ2C 5KWJA 4CLDA 1QHSA 4JL5A 4QWMA 4EFNA 2V7QD 3JD3A 5I01A 1M1UA 2NXNA 3C3DA 4PAMA 3PEUA 4PR0A 1NYLA 1MDFA 4UUNA 3TKAA 2IPAB 4AJNA 2RJNA 4AKEA 4KEAA 2A14A 2NUPA 4NKRA 4YJ3A 4Q9JA 5ENVA 4M22A 2JPDA