5TRDA

Structure of rbkr (riboflavin kinase) from thermoplasma acidophilum determined in complex with ctp and its cognate dna operator
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
219
Chain Sequence
b'DQYYRAIKKIKEAAEASNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKRGQILNITEKGLDVLYTEFADLSRILAIKNNVVITGTVTSGMGEGRYYVARKQYIIQFQEKLGIIPYLGTLNIKVDQASLPELRKIRGFRGIHIEGFKTEDRTFGSVKAFPAKIQNIPCFVIMPERTVYTDVIEIISDKYLREEINLHDGDRVSVEVYTEGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Riboflavin kinase
publication title Structure of RbkR (Riboflavin Kinase) from Thermoplasma acidophilum determined in complex with CTP and its cognate DNA operator
rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase/dna
total genus 70
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2016-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5trdA01
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5trdA02
1O7FA 4ENJA 3IKVA 4IRIA 2ZMEB 5FLXZ 1ZAOA 1TQPA 3RTRA 3IL2A 1Q9SA 1HBXG 1SMTA 2K27A 5FGMA 4UZEA 4GXOA 3Q9SA 1R1TA 3MWMA 4BH9A 3HYIA 4Z2YA 4EQQA 2F2EA 4EM2A 4L9NA 3SFZA 2IP2A 1P4XA 2PQ8A 4CZZA 4WXHA 5DYMA 2CWEA 3GYHX 4F7ZA 3BP8A 1FSHA 1L3LA 1TW3A 1R36A 3OV8A 3C7JA 1XSXA 1U78A 2VBWA 1Y0UA 3LSTA 2ETHA 1J7KA 2EV5A 4KIBA 4O5VA 2VE9A 2FOKA 3LQRA 4QLCU 4N9HA 3KEOA 1LEBA 4N0BA 3WODF 4IPAA 3N97A 1IUYA 5E1XA 1KU9A 3QU3A 2I1LA 3K1PA 4L9VA 1TNTA 3GUDA 2QQAA 2XAGA 1MDMB 1TTYA 1P4AA 4RAYA 2PN6A 3LQQA 4XLNF 2XROA 4A12A 4P9FA 3Q9VA 5LHIA 2RC4A 3HOTA 1RI7A 3F72A 4OU0A 2Z3YA 4U7BA 5FLXK 4I0BA 3R0JA 5TJJA 1FWZA 2K4JA 1WI9A 1SD5A 3T8RA 2FQ3A 4ENKA 1R00A 5A89A 2BE5F 4FT8A 2XAHA 3VOEA 5D4RA 5DD4A 2E1CA 3EUHA 3PQKA 3TOAA 5LGTA 2PBIA 5DCMA 3RJPA 3B73A 2GXGA 2A6EF 1WQ2A 4YG2F 1FBUA 1CGPA 4M71A 1WRJA 3C18A 2A69F 2WC2A 4HAMA 3BJOA 2O61A 4N9IA 2V9VA 3I64A 2DK5A 1S8NA 5IT3A 2P5LC 1SFEA 3P9CA 2BYVE 1UB9A 3F8NA 2GA2A 1XCVA 1L0OC 1XCBA 3ISPA 3R60A 2G9WA 5FB2A 1Z6TA 2NS0A 4HX7A 4QWQA 3J80Z 1UHMA 1SAXA 5H20A 1MKMA 4MEXF 4OIOF 4L9JA 1CF7B 2P6SA 3JSOA 3M7GA 2IT0A 5LHHA 2VN2A 1ZGAA 3I59B 4O6JA 3V8KA 4EM1A 2XVCA 4LLNA 3T0YA 4BHCA 3CTAA 1KU7A 1YW7A 3GW2A 5JFRA 1XGOA 3GEZA 3DXJF 4HDVA 1XN7A 5DUIA 1G3WA 1D8JA 3V7SA 1Z7UA 3KETA 2H94A 5D6FA 2Q8KA 3ECOA 2Q0OA 4L18B 3GXOA 4KDPA 2YX4A 3L09A 3DKWA 5H6QA 2HKOA 3HSRA 4EJVA 5HLGA 3FXQA 4R79A 2NNYA 1IXCA 5CVVA 4EMSA 4EV0A 4EVIA 4G94A 1O7LA 1ZLKA 3V7CA 5IT9K 2G7HA 1HKQA 3LA2A 4G7ZF 1ZYRF 2M8EA 2XAFA 5DDGA 3LA7A 2DU9A 3P9KA 2PEXA 1LDDA 4YFKF 1XSVA 3EDPA 1V4RA 2IA0A 2DTRA 4Q47A 1IAWA 2VXZA 3J80K 2QBYA 4KYWA 1P2FA 3CUQB 4OMZA 4H0EA 2NRAC 3KLOA 2A07F 2P8TA 2HKXA 4EM0B 1TW2A 3QAHA 3BPXA 3FMQA 3JAMZ 2XRNA 2JT1A 5HDGA 1YW9A 3EQLF 1Z91A 2OAZA 4DNCA 2QUFA 2OZUA 3WGHA 2HS5A 1K79A 1BI0A 1LVAA 1EH8A 1D8KA 5FFXA 1SFUA 3U9GA 4M9ZA 1YLFA 1IZ1A 2UWMA 1K78A 4HV6A 4M9XA 5DEQA 3C3WA 4BXUA 4BYYA 2KIFA 2VOOA 4I7HA 3S2WA 5LGUA 2H09A 2EWNA 2RKHA 5DUKA 5D5WB 2HTJA 1JE8A 1U2WA 3DV8A 4UV9A 4A0XA 3WTUC 1B9NA 4M6YA 2GWRA 4WXDA 2VBTA 2MH9A 4PGHA 1R1VA 2QENA 2F5EA 2UZKA 2O03A 3V8LA 3E6MA 1IN8A 1YIOA 4I09A 1IXRC 2OYNA 5K1YA 4RB3C 1J5YA 3BZ6A 2EA2A 4GYGA 4G7OF 1MZBA 1USTA 3KE2A 1IN6A 2VBXA 1FX7A 2EFWA 2CFXA 2DLLA 3SHFA 4RGRA 3GLXA 3HRTA 2D45A 1SFXA 1HW5A 2UXNA 4YIFA 1ZRDA 4HYEA 3JTGA 2P3MA 4BNCA 1UFMA 2YU3A 2ZJ2A 1I6XA 4HOBA 2EJRA 3I58A 2DO7A 1UHWA 2RQPA 1HKTA 4L0YB 3G3ZA 4CXFA 1XGSA 4IHTA 1YTYA 1ZHFA 5CLSA 3IHUA 2FF4A 2KKOA 2PI0A 2D1HA 5CYVA 4AIJA 1XB4A 1XMAA 3FMRA 2MLKA 3VEPA 2PLYA 3E5XA 3COAC 4EJUA 5DCFA 1RUNA 1E2XA 2VBVA 4M6XA 4MHGA 1X3UA 4LG0A 3ROUA 4OIQF 2A5YB 2ZO4A 3RYRA 3K0LA 5E18F 4ZYEA 4IF4A 5E1WA 3CO6C 4OIPF 5CJ9A 5BPIA 1YW8A 1R5GA 4AWXB 3TKYA 2VBYA 3WTVC 3T1BA 4HF0A 1FYMA 5CVIA 2G7UA 2AS5F 1SD7A 4U0VA 2FSWA 1D5VA 4NQWA 4U0WA 4HLYA 3R6SA 1QZZA 3P7NA 5AONA 4WX9A 1C0WA 2VC1A 4LK1F 3QPTA 1ON2A 5J8CA 1T6XA 3V8JA 2P7VB 3EYIA 2UXXA 2ACJA 1TBXA 1FSEA 3F8MA 3FXUA 1BIBA 2V1UA 3NQOA 3E5UA 4R1HA 3CO7C 1KGSA 1H0MA 5E17F 4XSXF 2EFOA 2VC0A 3GVAA 2PJPA 1SMYF 3VB2A 2ADUA 4OOIA 2M1BA 4KMUX 1U5TB 5L3BA 2R7FA 3QPHA 4KN4X 3K69A 2F5CA 2OQRA 4A2UA 4A6EA 4PZJA 2PG4A 1J59A 3KP6A 1JHHA 2F5DA 2XV4S 2ZFWA 3ZMZA 1Z6RA 1QGPA 4KIGA 4I0AA 4I2OA 1I1SA 2X0LA 2RVCA 4M72A 4XSZF 1B4AA 3F23A 3K1NA 2QVOA 4KIFA 2L3DA 1T38A 4RAZA 4YFXF 3TO9A 1F5TA 3F22A 3DPLC 3E6CC 1H9TA 5L3GA 3SXYA 4HX4A 2MBFA 1OMIA 2W25A 1T39A 5E1ZB 5HS8A 5J8FA 4P55A 2L54A 1IRGA 4A6DA 1R7JA 4ZYHA 3BJ6A 4FHTA 1FPQA 5CVRA 1MJAA 2BEOA 4RB1A 2ZMEA 3JW4A 3M1EA 4BQAA 2CG4A 3BY6A 1KYWA 4IHSA 1IN4A 3R0AA 1ZGJA 4FX0A 2O6GE 2H6BA 4IRGA 1I1GA 4OINF 3FMSA 1U6GA 1LDJA 3L9FA 3WGIA 3CDHA 3LAPA 3FM3A 4HQEA 1W7PB 1N06A 4LMYA 4WWCA 3P9IA 1BI3A 2CGPA 3E3VA 2R3SA 1BC8C 4EJTA 1I27A 5IT9Z 3MZYA 5J6XA 5ERIA 2HR3A 2ZBKA 1EH6A 3IKTA 1S6LA 3FZVA 1FOKA 3RKYA 4E70A 2GZWA 4L0ZB 2FNAA 2LF7A 3IRRA 3GFIA 1HSJA 2IA1A 3PFIA 5LGNA 3M8EA 1NHAA 5KVRA 3O2PE 3K2ZA 5A2QZ 4G6DA 4LK0F 1YS6A 2NNNA 4XLPF 2A68F 2IVMA 3HRMA 3FXRA 1ZRCA 1G3TA 1ZN2A 1MDMA 4M9SA 2FU4A 3TGNA 1KQ8A 3MFKA 5ILUA 2HGCA 4MTDA 3K9TA 2RV8A 2HTSA 2Z33A 4AIKA 2Y48A 2DAOA 4MGRA 3E5QA 5D8KB 1SD4A 2CSOA 2BGCA 3V7RA 4KUMA 3OOPA 1NB9A 5BOXA 2HQNA 2IJLA 3IWZA 3KZYA 1AWCA 5L3CA 3GFJA 4EJWA 3BDDA 2OD5A 3NEUA 4UVBA 3I53A 1KQ9A 2ZNYA 1OKRA 3V4GA 1P6RA 1S3JA 1KA8A 3PQJA 3HSFA 2YPRA 1BIAA 4MQVA 1S7AA 2VBUA 4IXAA 1JHFA 1IN5A 3WTZA 1YFHA 4G6QA 4BHPA 3U1DA 4HDUA 1XDSA 4G9YA 4LFUA 5D8LB 4MQ9F 2VT3A 3HRSA 1OYIA 2K86A 4U88A 5A2QK 1IRFA 2STTA 5EEHA 2XUBA 5FO5A 2PMUA 3RKXA 4KICA 1JGSA 2DW4A 1QZYA 1CF7A 3GO5A 5D5VB 1FBQA 3QP5A 3F21A 3QU6A 3T5XA 1KQ0A 2TDXA 2LNBA 1HW2A 1NB0A 2Z9OA 1BI1A 3ECHA 4UVAA 3ZN1A 3I59A 4A5MA 4DQ2A 2B0LA 4XRFA 5DD8A 5HS7A 2M5WA 1XMKA 2OU2A 5CVUA 2JZYA 3T8TA 1OR7A 2HOEA 3H3ZA 3M8FA 1TLHB 5HOOA 1O3TA 5BPDA 4AIHA 1KYZA 3ZP5A 3ZMTA 2P4WA 2OA4A 4ZZLA 3GFLA 2YR2A 3RDIA 4ETSA 1K6OA 2IPQX 2QQ9A 2HEOA 2O8XA 3CUQC 3H3UA 2VBSA 1AOYA 5BS6A 3R4KA 1FYKA 1I5ZA 2J5PA 3KZZA 2Q2EA 5ICGA 3WTXC 2A6HF 1ZH5A 4LB6B 4OIRF 1ZREA 4L5IA 3IWFA 4RB0A 2COMA 5BQTA 2FMLA 3RYPA 2Z5UA 5LEKA 2XGXA 3CUQA 2EFPA 4LLLA 2JRTA 1V3FA 1GHCA 2VBZA 3CJNA 3RPUA 4U0YA 1LQ1A 2DFIA 2CYYA 4WF2A 3QP6A 1J2XA 3ZQ7A 3WU0A 3QRFF 2L01A 4LD5A 4ZZDA 2QZ8A 4AVPA 2A61A 1FNNA 4PDKA 3KEQA 1F4KA 2Y0MA 2ISYA 4A5NA 2KRFA 3KCCA 2HWVA 2XAQA 3ULQB 2V79A 2M45A 4LLGF 1DDNA 1FT9A 4UV8A 3D5LA 1Z1DA 4KA4A 4PCQA 5A8AA 2M30A 3GX4X 2K02A 1YS7A 2LDUA 1FC3A 2EA4A 3WG9A 2DBBA 4UZFA 3JSPA 2P5VA 2DQRA 3KP7A 3TO6A 1ONVA 4NB5A 2P6TA 5FD5A 3E6BA 1YG2A 4KMFA 2FBKA 1N05A 4EJOA 4ASNA 2DI3A 1F9NA 2C6YA 1LDKB 2KIUA 3GWZA 2CQKA 1HXDA 3HHGA 3KP4A 2L4AA 1MGTA 4HV5A 3I54A 5ED4A 3ZMUA 3J7AO 4S04A 1ZLJA 5ILVA 3FM5A 1JXSA 4KN7X 3KFWX 1ZG3A 2ZNZA 2VONA 3ZPLA 1MJ9A 1PP7U 1RIOH 3LWFA 3ZUGA 4CGZA 1QPMA 3BPVA 6PAXA 3GFMA 4ZYGA 5HLIA 4ESBA 2VE8A 2EB7A 4ZH4F 2HQRA 1J9IA 3I5UA 4EGZA 2IW5A 1J75A 4K2EA 1G6NA 2OBPA 4KNYA 3GF2A 3MZHA 2LKPA 2NAZA 1QNTA 3WGGA 4P9UA 2MC3A 2XHKA 4CHUA 2RGVA 1IN7A 2DT5A 1FLIA 2WV0A 4A0ZA 2QM3A 2CW0F 2FEZA 2VOPA 1W7PD 2RN7A 2FBHA 1XD7A 1UCRA 3QOPA 3J81Z 2XIGA 2RDPA 3KP3A 1FZPB 1FY7A 1B59A 3RI4A 5FFZA 1E17A 4WK8F 4B8XA 1TQIA 3F6OA 2XKOA 1O3RA 2FNPA 4Y15A 2YSRA 2ESHA 4IRHA 1ULYA 1XSDA 1U3EM 4HW0A 2XAJA 2KJBA 1QO0D 3DP7A 1N08A 4HBLA 1MRZA 2OZ6A 2K4BA 1FP2A 1HSTA 1XGMA 1LEAA 2L4MA 4IVNA 2QYOA 3DEUA 4EGYA 2GAUA 3HIFA 4ZYDA 1U5TC 5DCMB 1LB2A 3I71A 4A0YA 3B02A 4RGUA 3TQNA 1DUXC 1Z9CA 3JTHA 3DPTA 3BJAA 2HFHA 1LJ9A 2STWA 4CDGA 2E7XA 2VODA 2HYFA 3BROA 4GYIA 1BC7C 1B6AA 3RPQA 2HDCA 4RGXA 4P5OA 1O3SA 2AXLA 2F5FA 2VT2A 5LHGA 2GA1A 3ZMVA 5F64A 2JPBA 2DK8A 3WE3A 1OYWA 4CO8A 1GXPA 1WWXA 1YYVA 5ICFA 1P92A 5FO0A 1IXSB 3WTSC 3EETA 1T6YA 3U2RA 3FF5A 4D0PA 3L00A 1U5TA 3CLOA 3AAFA 3Q5FA 3E97A 2FA5A 2X4HA 1EH7A 3J81K 1T6SA 3F8BA 3FHZA 2V1DA 5JHUA 2EV6A 1F1ZA 2PMHA 1BBYA 3DQVC 2ZCWA 1XDUA 5JR3A 3O6BB 1YO5C 2O3FA 1G3SA 2X0KA 1OYYA 5BMZA 1KU3A 2ZKZA 2FXAA 2QQBA 3C1DA 4JQFA 3F3XA 4Q48A 5TRDA 1GXQA 1QQIA 4UUVA 3H92A 4S05A 4HF1A 3WTTC 4GCVA 1P4MA 1RNLA 1WSUA 3ERED 4IJAA 5E8IA 2GIVA 2KJCA 3ZMSA 4UVCA 1ZG5A 4NHJA 3VODA 4B09A 4HLXA 2DPUA 3CUOA 3LFKA 5LEJA 1D3YA 3W6KB 5HVQC 1Q1HA 3HHHA 5HS9A 3TOBA 1PDNC 3SZTA 4OMYA 1TNSA 5ICEA 1MJBA 2H6CA 2YX7A 1ZG1A 4MNUA 3L2CA 1XGNA 2QBYB 2MLGA 1DPUA 4O3MA 3W6JB 1YQAA 3MQ0A 5A88A 1HKSA 2ISZA 3M9AA 4I98B 2R7DA 2EK5A 1W7PA 3IRQA 2HYGD 3OP1A 4FX4A 5F6FA 1MD0A 2ELHA 3F8FA 4RGSA 3F6VA 1PUEE 1T6ZA 3DF8A 2P7CB 3HRUA 3MAJA 2A3SA 4L9TA 5CVJA 1K78B 2V1XA 5AIQA 5FO1A 5E20A 4U7DA 5JVTA 2JSCA 4AD9A 2LF8A 4GO1A 5FNZA 4HZFA 2L02A 3LAJA 5E8GA 3BNWA 4CYDA 2K7LA 3K1MA 1QBJA 1J0RA 3ZN0A 1PP8F 2EFQA 2WTEA 4I02A 4LGWA 5K5QA 1Z05A 4UHTA 5D5UB 1P4WA 2J5OA 1VTNC 4Y13A 4ON0A 1W4MA 3RKWA 4HF2A 2HZTA 1USSA 1H9GA 2LSOA 4M74A 1STZA 3LA3A 3VFZA 3TO7A 5H6RA 3WTYC 3D0SA 3HUGA 1R58A 3N4MA 1IW7F 4I01A 4BAYA 1HW1A 1U8RA 2QWWA 1O3QA 4LJZF 3FWEA 3SQNA 3TDUC 5ICCA 1ZARA 2E1NA 2XASA 2FRHA 4KT5C 4HA8A 4LB5A 1TQMA 4PGGA 3MEXA 2QLZA 1W5SA 3KP2A 1OPCA 5AIPA 2BV6A 1DPRA 1FYLA 1HQCA 2KIMA 3WU1B 4WCGA 4TV7A 2FE3A 1N07A 3ABTA 2XKPA 1DP7P 3WE2A 4GGGA 1ZRFA 2CO5A 4ESJA 2IRFG 4R8HA 3ELKA 1O57A 2RNJA 1R23A 4Y17A 3TDZC 2E7WA 2V6CA 1K7AA 1T2KA 5LRSA 2DQLA 3I4PA 1BI2A 1B9MA 3O3KA 3HSEA 2H27A 5LBQA 1R22A 1R5HA 1B1BA 4LG0B 3NRVA 4Q4ZF 2O0YA 3RIRA 1T98A 5HDNA 2GXBA 5L3EA 3BOQA 1BN5A 5JI6A 4YIIA 3BWGA 3I0TA 3E6DA 3G73A 4RB2C 4RS8A 4G7HF 2ZXJA 2WWYA 3JAMK 4M73A 1FBSA 3KP5A 2EFNA 2W84A 5FD6A 5K5OA 2P5KA 2MH2A 5HLHA 2MD5A 4ESFA 1KU2A 5D5XB 4G8XA 3FX3A 2W24A 4ENMA 3WTWC 2ESNA 2EV0A 4WXCA 2DPDA 1GVJA 2JTVA 5HDKA 3R61A 1EV7A 5L3DA 4CICA 4Q5SF 2BBYA 1ON1A 1REPC 1S7OA 2Y75A 2GQQA 1ODDA 3DFGA 2JPCA 3HTUA 2FBIA 4MTEA 2D2WA 1A04A 1T0FA 1S4MA 4KFCA 3EYYA 5K5RA 1BOAA 1RZ4A 2W85A 5KK1A 1G4DA 5EEGA 3HTSB 4HX8A 5DV5A 1IF1A 4JBAA 1WKMA 1BJAA 1W5TA 1RUOA 2M87A 4UNOA 3MCZA 5LRRA 5LLQA 5F1RA 1S29A 5D6EA 3SZPA 1SD6A 3GZ5A 3ZMDA 4HQMA 1BM9A 3KLNA 4BHBA 3HOSA 4UXNA 4MEYF 1G3YA 2W57A 4ENNA 3IC7A 3L7WA 2FMYA 4YFNF 3REOA 2MA3A 2Z99A 4JK1X 5D4SA 5L3FA 3GZ6A 4XBFA 2PFBA 4L5JA 2D1VA 4P96A 3ABUA 1R1UA 5ILSA 3F8CA 2IA2A 2NYXA 1LNWA 2OQGA 1FP1D 3ML6A
chains in the Genus database with same CATH superfamily
3G1MA 1HDPA 1O7FA 2IGMA 4ENJA 3IKVA 4IRIA 2AQEA 3CB4A 4P9SA 5HZAA 2ZMEB 1HZEA 2QGUA 5BSYA 4B3AA 3MVPA 4R71A 1OJLA 5FLXZ 1ZAOA 2XGDA 4A93J 4X1EA 3PA1A 2N8GA 1TQPA 4B44A 3RTRA 3IL2A 1CNFA 1Q9SA 1HBXG 1SMTA 2K27A 5FGMA 5J40A 4UZEA 4GXOA 5FKOA 4F91B 5TR9A 3Q9SA 3CF5F 1Y0YA 1R1TA 3KX2A 3OE7A 2NOGA 3MWMA 2IBDA 4YXWA 2WA0A 3CZ6A 2KDOA 2DOAA 4BH9A 3HYIA 4Z2YA 2HDWA 1O4XA 2HVSA 4OPSA 4ITVA 3BTIA 1MBKA 2DA1A 4EQQA 5C4JJ 2F2EA 3AFHA 2LYCA 5J1YA 4EM2A 2EIKH 4L9NA 3SFZA 5H59A 1VQNB 2IP2A 1P4XA 3D1NI 5IYRA 1Y6IA 2LRDA 2PQ8A 4CZZA 5EDNA 1VF7A 4IHYA 2HDNB 1YJNI 4WXHA 5DYMA 2CWEA 3GYHX 4F7ZA 3BP8A 2YUSA 1FSHA 1L3LA 4TMWA 1DQUA 1TW3A 1VQMI 1R36A 4BDZA 3OV8A 1JKRC 3C7JA 5IYWA 1XSXA 1U78A 1IO2A 3AGPA 2VBWA 3F0CA 1Y0UA 1E43A 2DOGA 4X7FA 5GPAA 3LSTA 2XF6A 2GK7A 4BY7J 4TMZA 2ETHA 5IYCJ 4BJ5C 2JSPA 1J7KA 2EV5A 4KIBA 4O5VA 3HXLA 2VE9A 4Z4UA 5TY0A 2KDZA 3B82A 3FK6A 3DEWA 3CESA 4DQKA 2ZXWH 1FNCA 2FOKA 3LQRA 1EF4A 4QLCU 3WNBA 4P3YA 2DFFA 4N9HA 5EZHA 4PC3A 3KEOA 1RPWA 4N0BA 1MMSA 3WODF 2OTJI 4IPAA 1LEBA 1PVEA 3N97A 2LY2A 2F5VA 3DCFA 1D1CA 1VF9A 3K4BA 1A35A 1IUYA 5JBQA 2VKHA 5E1XA 3CJRB 5HLTA 3ABKH 1OB2A 1SFOJ 2BM1A 1KU9A 2QQ8A 3QU3A 3SJZA 4XONA 2I1LA 3K1PA 4L9VA 3A8IA 2DJIA 3EUHC 1TNTA 4RAGA 3GUDA 2QQAA 3PSIA 3CCJI 1W36D 1E3ZA 2XAGA 3K70D 3CCQI 1MDMB 3SDBA 1XC5A 1TTYA 1P4AA 4RAYA 2GQFA 2PN6A 4A3KJ 2OC6A 3LQQA 1FOWA 1E3PA 2PX9A 4XLNF 2XROA 1SVOA 4A12A 2BMWA 2CQQA 3QPSA 4P9FA 3Q9VA 3LSHA 2HU9A 5J1UA 2RC4A 2BW3B 5LHIA 5B1AH 3HOTA 3I4NJ 3A8KA 1RI7A 4FETA 1V0EA 3F72A 4OU0A 2Z3YA 4U7BA 5FLXK 5E3OA 3CP8A 1IG7A 2R7OA 1E63A 1ETKA 3CCEB 4I0BA 2I10A 2X3UA 3S1RJ 3TL4X 1TWGJ 3R0JA 5TJJA 1YJWI 1FWZA 2CUEA 2CW7A 1Y1VJ 2K4JA 1WI9A 1SD5A 3T8RA 5GV7A 1YX3A 5IP9J 1EFTA 1YOVB 2FQ3A 3AG2H 1BR4A 4P1WA 4ENKA 1GAWA 1R00A 4E7IA 3M4OJ 1A5JA 5A89A 4J00A 2BE5F 4FT8A 4IHVA 3U2QA 2QCOA 2XAHA 1ZUNB 4JYKA 1VQ4I 2Z16A 5DM7F 3VOEA 5D4RA 2HOTA 5DD4A 2E1CA 3EUHA 1OCRH 3MKZA 3PQKA 3TOAA 5LGTA 1GV2A 2QDXA 4E7LA 5M5WJ 3ABMH 2PBIA 3SJMA 1GR1A 4IL6C 5GAGJ 5DCMA 3RJPA 3B73A 2GXGA 3R6KA 1VQKB 2A6EF 2E5NA 1JKPC 1WQ2A 2L9RA 4YG2F 1FBUA 1CGPA 4M71A 1WRJA 1KK1A 3C18A 3U6BA 3OAAA 2A69F 2WC2A 3E1SA 2XF5A 3BTLA 4HAMA 3OW2B 3BJOA 1YLOA 2VYQA 4YALA 2O61A 4N9IA 2V9VA 3I64A 2DK5A 1S8NA 5IT3A 3BCBA 2ZXIA 2P5LC 1SFEA 1BW5A 1WJDA 1K83J 3P9CA 2BYVE 1UB9A 4HE5A 3F8NA 2GA2A 3KZIC 3AVTA 1XCVA 2FX3A 1L0OC 1B23P 4C2MJ 1XCBA 3ISPA 3R60A 4GRIA 2G9WA 5FB2A 3OYLA 1Z6TA 2NS0A 4HX7A 4CYCB 4QWQA 3J80Z 1UHMA 3LSRA 1SAXA 5H20A 2BY1A 2EBIA 1MKMA 2IS6A 4MEXF 4OIOF 4L9JA 2YWFA 1CF7B 1RKTA 1NRKA 5KHDA 1LE8A 1QHGA 3H9NA 2P6SA 3JSOA 2QSFX 3PO2J 3AG4H 1I18A 3M7GA 2R7VA 1UMKA 3T56B 4RM0A 2IT0A 2HNHA 3D5RC 4HSTA 5GADJ 1QVGB 2Q6KA 1VQ5B 2V9KA 5LHHA 2VN2A 1GVHA 1Q82D 1ZGAA 3I59B 1IRZA 1F20A 2QSHX 4ZGQB 2NOJB 3DTEA 4O6JA 3V8KA 1FMVA 2KQRA 2DODA 1OCZH 4YELA 4EM1A 2XVCA 1HC8A 1LPQA 4LLNA 3CMEI 2XDVA 3T0YA 3GTLJ 4BHCA 3CTAA 2R5YA 1KU7A 1YW7A 2VKVA 4ZDLA 4W97A 3ZQCA 3N05A 1R4MB 2OCCH 3GW2A 3K6GA 5JFRA 3OL4A 1TVCA 1XGOA 3GEZA 3DXJF 2R7QA 1ETWA 4XLFA 3W2EA 1HLVA 3BG6A 2JUGA 1VQ6I 4AF6A 4HDVA 1XN7A 1E1QA 2Y9ZA 5DUIA 1D8TA 4PC1A 1G3WA 5AN9A 1D8JA 3Q3SA 4ASUA 4C0SA 1Q81D 3V7SA 4FWTA 1Z7UA 2MD0A 2H94A 3KETA 5D6FA 1OGIA 2ZBVA 2Q8KA 4LBVA 3P27A 3ECOA 2Q0OA 4L18B 3OZWA 3DPUA 1JT6A 4G1BA 3GXOA 4ACBA 3W3CA 4AC0A 1Y8RB 4KDPA 2YX4A 3L09A 3DKWA 4XKCA 5H6QA 2V7WA 2HKOA 2JA6J 1H85A 3CMAB 3H35A 3HSRA 4EJVA 5HLGA 3FXQA 4R79A 2NNYA 1IXCA 2LKSA 4YAOA 1VQ7B 2DCUA 1MH3A 2ICWG 2X85A 3DTIA 2O7OA 5CVVA 2DMUA 4EMSA 2OBSA 1PJ7A 2LMDA 2L7MP 1QUEA 4EV0A 4EVIA 1B8IB 2V4DA 4UB6C 3WG7H 4E6KG 2M0CA 4X7EA 4G94A 1YE9A 2F6CA 1O7LA 2K5CA 4D7NA 1ZLKA 3V7CA 3AL0B 1MBGA 1TWFJ 5IT9K 4AYBN 3NWSA 1JNYA 2W6JA 2L0KA 3BR3A 2NVQJ 2G7HA 1HKQA 2KVOA 4HG2A 3LA2A 3ABLH 4G7ZF 1ZYRF 2XGJA 2M8EA 1WHUA 1ZR4A 2XAFA 1W0JA 5DDGA 2X6YA 3LA7A 3S32A 2DU9A 2LBFB 1F60A 3KEWA 2WZNA 1FIAA 3P9KA 1JA1A 3OJXA 5M5XJ 1KONA 4DNRB 2PEXA 5HKKA 1UD2A 1LDDA 1KJZA 1QPIA 4YFKF 2HZDA 2LD5A 3ONYA 1XSVA 4PJJA 3FXOA 3EDPA 3M1CA 4AYBA 4IZZA 4RPBA 3PNVA 4ZCMA 3ZZTA 2O8KA 1ETYA 3CC4I 1QG0A 1V4RA 2EPFA 2IA0A 2EIMH 1MBJA 2DTRA 3A1YA 4JX5A 2F4IA 3E1YE 4Q47A 3CC2B 1IAWA 4P2NA 2VXZA 1ZK8A 3J80K 3HOXJ 3CLQA 1GT0C 2PJRB 1TLLA 2QBYA 1GAQA 4KYWA 1P2FA 3CUQB 4M3BA 1OCPA 2KFDA 4OMZA 3S16J 4H0EA 2OBTA 4LC0A 5KW9A 3A01A 3M3YJ 4PJLA 4A3IJ 2NRAC 4FQGA 3KLOA 2A07F 3G1LA 4OPVA 1QFZA 2MC4A 2P8TA 4XN0A 4I6ZA 2HKXA 4EM0B 3HOZJ 1N0UA 3K2AA 1TW2A 4BY1J 3QAHA 3BPXA 5FIUA 3FMQA 5DSZA 1VNDA 2LC2A 3JAMZ 2D3NA 1SAUA 3H0GJ 2XRNA 1IUFA 2JT1A 5HDGA 1YW9A 3EQLF 1Z91A 2VQGA 2OAZA 4DNCA 2QUFA 1GV5A 2OZUA 1D1NA 3WGHA 2HS5A 4C3JJ 1K79A 3W5HA 1BI0A 2KHMA 2NV4A 3BY1A 3QOEA 1B2RA 4KJZA 1LVAA 2CV0A 1EH8A 1D8KA 1IC8A 5FFXA 5IP6A 1SFUA 5E6TA 3U9GA 2GIZA 4M9ZA 1YLFA 5KAFC 4UB8C 1W0UA 3A0BC 1IZ1A 2UWMA 3IAS2 3VDXA 1K78A 4HV6A 1AHDP 1POGA 2I5UA 2V7UA 4M9XA 4X7CA 3I56B 5DEQA 4A3CJ 3T53B 3C3WA 4DIQA 2LP0A 1K4SA 4BXUA 4BEHB 4BYYA 1ORKA 2M9HA 3DEEA 4UZUA 2KIFA 2VOOA 3H9GA 4I7HA 2K9SA 3S2WA 5LGUA 2H09A 3ZC3A 2EWNA 4DYQA 1P7JA 2RKHA 5DUKA 5D5WB 3OYFA 2OUMA 1TWCJ 2HTJA 1JE8A 4CSWA 4M6VA 4DYRA 3S15J 4P26A 1U2WA 3DV8A 4UV9A 4A0XA 2LY9A 2DDBA 3WTUC 1B9NA 4M6YA 3J7YJ 1FDRA 2GWRA 4WXDA 2VBTA 1S72I 4A3DJ 4X8IA 3ZBTA 2GLOA 1KZHA 2MH9A 2MFZA 3VSLA 4AF7A 1JTYA 3DKYA 2V31A 1WOOA 4PGHA 4Z4RA 4RMNA 1D1AA 1R1VA 2QENA 3BG7A 4TSFA 2BF4A 1Y0RA 2F5EA 2UZKA 3CCUB 2O03A 4ZTJA 4OOVA 5THXA 2M4KA 3V8LA 3X2QH 2CU7A 3QE2A 3E6MA 2R7ZJ 4B3FX 1ERDA 1XS9A 1IN8A 1YIOA 4I09A 5F0CA 2NVYJ 1IXRC 3HZJA 2OYNA 2EFGA 3PUNA 1UD4A 3AVUA 5K1YA 4RB3C 4BDYA 2C78A 4XRSG 2VNHA 1J5YA 5E3MA 1WOSA 3BZ6A 2VIXA 4XOTA 3TW6A 2LLKA 2EA2A 3B6CA 1LFBA 4GYGA 4PK4A 4G7OF 2A5WA 2XRLA 1MZBA 2X6OA 1USTA 3K4JA 5E79C 3Q0WA 3KE2A 3CC7I 2DDAA 1XFOA 1IN6A 1JJ8C 4XMYA 4JX4A 2JJ1A 2VBXA 2ZTGA 1FX7A 2EFWA 2CFXA 4ABZA 5FKKA 2DLLA 2VQLA 3SHFA 1GDTA 4RGRA 1BA5A 1KQSB 2HXIA 2W00A 2L7FP 2L9NA 1A31A 1WSRA 2NPFA 3GLXA 2NS8A 1AKHA 3I3LA 1YJ9I 3GTOJ 3K4NA 1HOMA 1ETVA 2VI6A 1EA3A 3HRTA 5J1RA 1OCOH 5CQEA 2D45A 1SFXA 1HW5A 1PJRA 4Z4TA 1XB2A 3VYRB 5BSXA 2DMNA 2UXNA 1NJID 1WPKA 2DJNA 3GCMA 5FROA 4YIFA 2JN6A 3JRHA 4B3XA 4RLFA 1WPCA 1WVRA 4X05A 3W2GA 1IDYA 1K9MD 1WOPA 3OYKA 2QF7A 2Q6OA 3ZQLA 1Z0XA 1N78A 2LR8A 1YJNB 4HIZA 1ZRDA 4HYEA 3JTGA 2P3MA 3HBLA 1F36A 9ANTA 4BNCA 1UFMA 4KKTA 2VJ5A 5J4VA 3QPLA 3HAGA 2XSDC 1VQMB 4Y33A 2YU3A 3JQRA 2ZJ2A 3PUBA 4IQ4A 4Y4RA 1I6XA 2XGEA 2EJRA 4HOBA 5F1JA 3PUMA 4DBQA 3I58A 1OQYA 4ZGNB 1X1PA 2JA7J 2DO7A 3ZGKA 1UHWA 2RQPA 1HKTA 1NTCA 3SYTA 4L0YB 3AVXA 3DBRB 3G3ZA 3LMMA 3G4SI 4CXFA 1XGSA 4IHTA 3GBGA 2M4GA 4B1RA 4IEJA 1YTYA 1BJKA 1ZHFA 1GO2A 5CLSA 3IHUA 2FF4A 4U9UA 1HA3A 2KKOA 2PI0A 2V6EA 1K8AD 4DQLA 4FN5A 1VQ8I 3SEQA 2PMZN 4M2LA 1QVTA 2KLOA 3JRIA 2D1HA 5EYRA 1R49A 3CJTB 3IH3A 2OTJB 5CYVA 3JRAA 4AIJA 1XB4A 1XMAA 3FMRA 3QFTA 2MLKA 3VEPA 4P6VF 2PLYA 3E5XA 4WZTA 2Y31A 3COAC 4EJUA 2LREA 1PUFA 5DCFA 3VNVA 1RUNA 4IOCF 1E2XA 2ELKA 5K7ZA 2VBVA 1RC9A 1MNDA 4M6XA 4MHGA 1X3UA 3FJOA 4LG0A 3ROUA 2ZZQA 1MNEA 4OIQF 2A5YB 2ZO4A 5JHFA 3GIRA 3FXMA 2FD5A 1RRJA 2KP6A 2V7FA 3RYRA 3K0LA 2PMZA 5M3FJ 3CCJB 1RESA 5E18F 4ZYEA 3CCQB 4IF4A 3HOVJ 5E1WA 3CO6C 2UV1A 4OIPF 3VYUB 2KL4A 5CJ9A 1QUFA 5BPIA 4FCYA 1N25A 3EUKL 1YW8A 1R5GA 2BHZA 3TKYA 4AWXB 1QGYA 2VBYA 3WTVC 3T1BA 4ANJA 4C2TA 2OTLI 3IAM2 3W5UA 4M3EA 4HF0A 5GP9A 1FYMA 4A3JJ 5CVIA 1I3AA 4MIMA 2G7UA 2AS5F 4ZV4A 3QYFA 1SD7A 4ZJZA 4U0VA 4A3MJ 3K4KA 1DU6A 4XLCA 2FSWA 5J4YA 2QEXI 3ASRA 1RR8C 1YJWB 1D5VA 3GZNB 1M90D 4NQWA 4U0WA 4RDUA 4HLYA 3QWLA 3R6SA 1QZZA 5FKNA 3AVYA 1DG1G 3HL2A 4K1XA 3P7NA 5AONA 4WX9A 3OZVA 1TL8A 2ZFUA 1C0WA 3IUOA 2VC1A 3BQYA 1VQ4B 3K4LA 1MMGA 4LK1F 4LBYA 4AIDA 4Y3OA 1COWA 4RLZA 5KSWB 4QFMA 2M7BA 3DLLF 3BTJA 4KISA 1F43A 3CQZJ 3QPTA 3RQIA 1VHEA 1ON2A 5J8CA 1T6XA 4HEA2 3V8JA 2P7VB 3EYIA 2UXXA 1UJ8A 2ACJA 3K4MA 2EINH 4Z4VA 1TBXA 2ECBA 2VL8A 4XR6A 1FSEA 1JA0A 2HDDA 3F8MA 3FXUA 1BIBA 2V1UA 2GJPA 1W87A 3NQOA 1ETQA 3E5UA 2AQFA 3UNGC 3LSMA 4R1HA 1KGSA 1OISA 3CO7C 1D0XA 1H0MA 5E17F 3IH2A 2R7WA 2WADA 4D5CA 1G7TA 4G5GA 1MIJA 4XSXF 2XB5A 3JR9A 2B9SA 3OYHA 3KYCB 1QA6A 2DY1A 5EMNA 3QSYA 2EFOA 2VC0A 3GVAA 2PJPA 1SMYF 3VB2A 2ADUA 2DA5A 1FNDA 4KITB 4PGOA 4NC6A 4OOIA 4BXXJ 2M1BA 3KIOA 3OYAA 4KMUX 1KTVA 3QFRA 1XX5A 1I50J 1YRNA 3DWLE 4RD1A 1IRXA 1U5TB 5L3BA 2R7FA 4CUGA 3OYMA 3QPHA 4KN4X 4RD3A 3K69A 3W2AA 2F5CA 2OQRA 4A2UA 4A6EA 4PZJA 1WJFA 2Z1DA 2PG4A 4F3QA 3MKWB 2M2EA 1J59A 3KP6A 4XKBA 1JHHA 2F5DA 2XV4S 2ZFWA 2VLAA 3ZMZA 1VJSA 2BGJA 1Z6RA 1E3HA 4DW6A 1QGPA 4KIGA 4I0AA 4EEFG 4I2OA 1I1SA 2X0LA 2JJ2A 1WU8A 2RVCA 4M72A 2CK3A 4XSZF 1B4AA 1WI3A 1CQTA 1B72A 3F23A 1JT0A 2V7TA 3K1NA 4P6YA 4PJNA 3A0HC 4E7HA 2QVOA 1Y39A 3ASPA 4KIFA 2L3DA 1T38A 4RAZA 2OCEA 4YFXF 3TO9A 4UUSA 4ZTFA 2CV1A 2CF4A 3CMEB 1F5TA 2JRMA 3F22A 3LSPA 3DPLC 3E6CC 4BE1A 1H9TA 5L3GA 4ZDPA 4E7ZA 3SXYA 2O9LA 2DFHA 4HX4A 2MBFA 4IQJA 3RQ4A 1OMIA 2DERA 1VQ6B 3CDLA 2BVNA 1JTXA 2CUFA 1R5NA 2JA5J 1AA7A 2W25A 1T39A 3Q0VA 3PSFA 3CCRI 1JJ2B 5E1ZB 5HS8A 1FEXA 3BC8A 5J8FA 4P55A 1GVDA 2Y69H 2VNKA 3FPPA 2Z6BD 2L54A 4DZJA 1IRGA 4A6DA 1R7JA 2K9MA 3BJ6A 4ZYHA 1KMHA 3B78A 1PJ6A 1LVKA 4XRSA 2OBRA 3AGQA 4FHTA 1R5OA 1EXMA 1FPQA 1WDTA 3UR3C 2CMPA 2F48A 3LNNA 1CQXA 3DTKA 5CVRA 2ZJQF 1MJAA 2BEOA 2LH9A 1OLTA 2ZMEA 3OR1C 4RB1A 1QFYA 3JW4A 3M1EA 2G0EA 3HGGA 1BR2A 4EATA 4WZLA 5EGOB 4BQAA 4XLAA 2CG4A 2DEUA 2YWGA 3BY6A 1KYWA 4IHSA 1WORA 5FLVA 2K85A 1IN4A 2Z2SB 4IOAF 3R0AA 2XPVA 2XPWA 1ZGJA 3HG9A 2LTPA 5F0FA 4FX0A 3RY8A 1JUSA 1IHMA 1X58A 2L9SA 2O6GE 3S14J 2H6BA 2R7XA 1LE8B 2WJVA 2W1OA 3BQZA 2ZTNA 1YX2A 4IRGA 1I1GA 4KKUA 1TWHJ 2M3AA 3BT9A 3ZPNA 4OINF 2WYRA 3FMSA 1U6GA 1LDJA 2L7ZA 4BQNA 3L9FA 4LG3A 4QPQA 1FIPA 3WGIA 2R6HA 3CC4B 4IHXA 3CDHA 3LAPA 1YI2I 1K61A 1KC8D 4Z4WA 3BLYA 3FM3A 4QHYA 3OIPA 3A02A 4HQEA 1W7PB 3IV5A 5LD2C 1H88C 4B4DA 1N06A 4LMYA 4WWCA 3TBIA 2R5YB 3JRGA 4C3IJ 2GJRA 3P9IA 1BI3A 2CGPA 4Y7NJ 3TP0A 3E3VA 2EZLA 5DM6F 4X0CA 2R3SA 3L1PA 5IY5H 4E7KA 1JB9A 1BC8C 3GQBA 1DGWY 4EJTA 2J7KA 1I27A 2OJED 3ZQGA 3S8PA 5IT9Z 3MZYA 2I8DA 1YIJI 5J6XA 2W4SA 5EF6A 2DTZA 2JA8J 5ERIA 2HR3A 3GTGJ 4A3BJ 2ZBKA 1EH6A 1UHSA 3IKTA 1S6LA 3FZVA 4LITA 3RKYA 1FOKA 1DP3A 3O8HA 4E70A 2WSSA 3GVKA 3CRZA 4DJAA 2GZWA 2VJ4A 4L0ZB 2FNAA 3FXKA 2LF7A 3IRRA 3GFIA 2M7AA 1HSJA 2IA1A 3PFIA 3MKYB 3CCSI 3A35A 5LGNA 3M8EA 1FX0A 5BNGA 1NH3A 2FVGA 4M3FA 1NHAA 5KVRA 1X1BA 3KPHA 3O2PE 1G8XA 3K2ZA 1QFJA 5A2QZ 1ACIA 1VQLI 4G6DA 4LK0F 4N4OB 3RPUD 3LSKA 1YS6A 2NNNA 3DBLB 4XLPF 2A68F 2EZIA 1FMWA 2IVMA 3CW2A 3HRMA 3Q39A 3FXRA 2E5ZA 3ZZUA 3OY9A 1QZEA 1TT0A 1ZRCA 4U87A 1G3TA 3PUFA 1ZN2A 2LVSA 3VSKA 3PJRA 4C43A 1P9QC 1SANA 4DBRA 1MDMA 3C2HA 3JU4A 4M9SA 2FU4A 4V2GA 3TGNA 5DTDA 1KQ8A 3OMYA 2E1OA 3MFKA 1OHHA 4MYTA 1KRHA 2NVXJ 5ILUA 2Q6LA 2HGCA 4MTDA 1K28D 3K9TA 2OK7A 2DA6A 2BW3A 3U21A 2ZJRF 4OP7A 2RV8A 4D1QA 2HTSA 2Z33A 4AIKA 2Y48A 1QX4A 3VYSB 2DAOA 2LY1A 4B43A 3G6EI 1AIPA 4MGRA 2D74A 4RJLA 2BVMA 1W0TA 3E5QA 5D8KB 1BLIA 5FKMA 3HOUJ 1SD4A 1QU3A 1S72B 2CSOA 2BGCA 2L5QA 3V7RA 4KUMA 2VPRA 2R7RA 3OOPA 3HUGB 2QA4I 3H94A 1NB9A 5F04A 2H8WA 5BOXA 2HQNA 2IJLA 3IWZA 2EIXA 2HLDA 4N3GA 1G7CA 3ZIAA 3KZYA 2IEKA 1AWCA 4MFDA 2XNJA 3BH4A 2HMAA 2EIJH 1V54H 5L3CA 3GFJA 2DA4A 3BR2A 4X06A 1JI8A 1WJEA 4EJWA 1X2MA 5GPCA 3BDDA 1XE1A 3OJWA 2OD5A 3NEUA 4Y52J 1MMDA 4UVBA 4CCOA 1NG7A 3I53A 4HNUA 3JRCA 3MHPA 3VO2A 1KQ9A 2ZNYA 3W2FA 1OKRA 4XOPA 3V4GA 1P6RA 1S3JA 4P22A 4RDKA 1A6QA 1D5YA 1GLNA 4TKOB 2LZJA 2XGCA 4P1VA 2DYIA 1KA8A 2W7NA 5GAEJ 3PQJA 5FKLA 3HSFA 2YPRA 1V5FA 2H8RA 3CC7B 4NC7A 1BIAA 4V2FA 3ASQA 4MQVA 4QSHA 4XNFA 1S7AA 2X53S 1RQPA 1QVFB 3OS0A 2R7TA 2VBUA 4IXAA 1JHFA 1IN5A 3WTZA 1YFHA 1XQBA 4G6QA 4C30A 4BHPA 3MKLA 3OS1A 1W36C 4RDLA 3U1DA 4HDUA 1XDSA 2RREA 1OR7C 3K70C 2M5SA 2ZZGA 4G9YA 1YJ9B 3A8JA 3H1CA 4YRVA 4LFUA 3OOUA 4MQ9F 5D8LB 2VT3A 1Y0NA 5IOZA 1UG0A 4ZDOA 3FXLA 2X8KA 2WV1A 4G6TB 3HRSA 1OYIA 2ID3A 3OYNA 2K86A 3S1NJ 4CYCA 4U88A 1IRFA 5A2QK 2VZLA 3JQQA 2STTA 1X4OA 5EEHA 2XUBA 5FO5A 2PMUA 1M1EB 3RKXA 4KICA 1JGSA 1BL0A 2DW4A 2XPUA 1QZYA 1CF7A 3GO5A 1GJRA 5D5VB 1VQOI 1APLC 1FBQA 3QP5A 3F21A 3QU6A 2JN9A 1SC7A 3T5XA 1KQ0A 1BX0A 1BX1A 2TDXA 2LNBA 1HW2A 1NB0A 2NVUB 1UG2A 1BI1A 2MABA 3ECHA 4UVAA 3ZN1A 3I59A 4A5MA 2GOMA 2Z9OA 1Q7YD 5H2FC 1JGGA 5DS0A 3ZQHA 2HXOA 3U6KA 4ROXA 4DQ2A 2B0LA 2GM4A 3G4SB 3W2VA 4XRFA 5DD8A 5HS7A 1Z7LA 2M5WA 1XMKA 1SKQA 2E1MB 2OU2A 4OAZA 5CVUA 2IAIA 2JZYA 3T8TA 1OR7A 2HOEA 3S2HJ 1R5ID 3FISA 3H3ZA 3M8FA 1TLHB 3HJEA 5HOOA 4QV2A 2UUZA 1VQ8B 4BGDA 4WZEA 1ENHA 1O3TA 3CF2A 4AVZA 3ZBUA 3QQAA 3G05A 2BY0A 3ASOH 2ZBUA 2IXSA 2NVTJ 4BBRJ 3BCAA 5BPDA 3EPZA 3FK7A 4AIHA 1IJEA 1KYZA 1MBHA 2IS2A 3DU6A 2F4MB 3SZGA 3FDYA 3ZP5A 2E19A 1W5CC 3ZMTA 2C5HA 1LFPA 4RA2A 2P4WA 4LIUA 2OA4A 4ZZLA 5F08A 1VQPI 3GFLA 2YR2A 3RDIA 4ETSA 1XPXA 2IPQX 2QQ9A 1K6OA 3BR6A 2VJIA 2HEOA 2E1BA 4XLHA 2O8XA 1JUMA 3CUQC 4QTRA 3CMYA 3S17J 2X9DA 3H3UA 1FOYA 1IJWC 2VBSA 1AOYA 2LFBA 1EKEA 5BS6A 3JQPA 3R4KA 3K4CA 1FYKA 3BCFA 1B8IA 2Y2ZA 4BXFA 2CW5A 2VASA 4PSWA 3V42A 3MMPA 1E64A 1I5ZA 2OTLB 2J5PA 4XN3A 2BSAA 3GVLA 4Z4ZA 3KZZA 4JX6A 3K7AJ 3CJQB 4NC8A 3HM5A 2Q2EA 4E4HA 2M0MA 4XM3A 4CH7A 5K7HA 5ICGA 4MFEA 3WTXC 1NG6A 2A6HF 4NBQA 4CCLA 1HVXA 1ZH5A 2QEXB 4LB6B 2BHYA 2FJ1A 4A69C 4OWRB 4OIRF 1ZREA 4L5IA 3IWFA 2R93J 2Q6IA 4F93B 4RB0A 4BBSJ 1ZQ3P 2COMA 4M1KA 2ZXHA 1RQRA 4IHWA 5BQTA 2WAQA 3CCLI 1WH7A 2FMLA 2FX0A 3OL3A 4LBZA 5L46A 2K40A 4II3A 2MG4A 3RYPA 3U1KA 4HE6A 1BOBA 2JJ7A 3GTQJ 2Z5UA 4IO9F 3G71I 3ZOBA 5GTIC 2R5ZA 2E2IJ 2PJRA 5LEKA 2XGXA 3CUQA 2EFPA 5EG0B 4LLLA 2JRTA 1W0KA 1V3FA 2AHQA 1GHCA 2VBZA 3CJNA 3PL8A 3RPUA 4I76A 4YAFA 1BQEA 2IGNA 2DMQA 4BUPA 4U0YA 1LQ1A 2DFIA 2CYYA 4WF2A 2IGKA 3QP6A 4WQMA 4XICA 1J2XA 3PNTA 4AU7A 2ME6A 2BV3A 4BACA 5CDFA 3FBIB 1SKYB 2CRGA 3ERMA 2K9QA 3WU0A 3ZQ7A 3QRFF 2L01A 2XZOA 4LD5A 4ZZDA 2CBXA 2QZ8A 2XOKA 2V26A 4AVPA 2A61A 3D5SC 3PIPF 4RD0A 3WNDA 3FBNB 1V5VA 5JLXA 2ZB9A 2YWEA 1FNNA 4PDKA 4A3FJ 3KEQA 4B47A 3ES9A 1Y1WJ 1F4KA 2Y0MA 2W82A 2ISYA 1T56A 4A5NA 2KRFA 2TCTA 3KCCA 2HWVA 1AU7A 5FJ8J 2XAQA 2A6TA 2BGIA 2DETA 3ULQB 2HOSA 1SVLA 3PENA 3WU2C 3MZ8A 1ETOA 2V79A 4RD6A 1XTAA 3DKXA 2WZPP 2M45A 4BL0B 1VLOA 4LLGF 1DDNA 1FT9A 4UV8A 4BE0A 2KPMA 3D5LA 4NCNA 1Z1DA 3PM1A 4OAYA 1VZ0A 3C2BA 1K4TA 1Z67A 2E2JJ 4BEHA 3S93A 4D9JA 4DZPA 3BY2A 4KA4A 3OEHA 2OV7A 4PCQA 1YHQI 3VWBA 5A8AA 2M30A 2HQ5A 3H36A 3GX4X 3SEJA 1TZLA 3AG1H 2DA2A 1YS7A 2JVHA 2K02A 2LDUA 1FC3A 5B5EC 1X1CA 3KYDB 2JIZA 2EA4A 2ZITA 3WG9A 4LOCA 2DBBA 1FTZA 4UZFA 3JSPA 1SFKA 2P5VA 3SKBA 2DQRA 3HPGA 1LUJB 1PJ5A 5TGTA 4GQNA 1X3ZB 3KP7A 3TO6A 1ONVA 1IJFA 4NB5A 3GVJA 3WXMA 5HODA 2P6TA 5M3MJ 2EZKA 3VR6A 5FD5A 4OOSA 3SDGA 3E6BA 2KISA 3P5JA 1YG2A 4KMFA 2FBKA 2AHOA 1N05A 4WZKA 2A05A 2K9LA 4BU2A 4EJOA 4ASNA 1HA8A 1WCMJ 2DI3A 1X1AA 3Q3AA 5FLMJ 1WJBA 4IW3B 1ETXA 1T33A 3CCRB 1F9NA 1S5LC 5K7FA 1QHHD 3RZDJ 2C6YA 1LDKB 2CUZA 2KIUA 3GWZA 2CQKA 3K10A 2IS1A 5C4XJ 1X1DA 1HXDA 3HHGA 3KP4A 2DA7A 3J81k 4XRMA 2L4AA 1MGTA 3P26A 2R4GA 3CCVI 2QE7A 4HV5A 3I54A 5ED4A 1EP3B 4PUSA 4AM3A 3ZMUA 4NDLA 3J7AO 2K3FA 3OEEA 2BVLA 4S04A 1ZLJA 3OIOA 3Q0UA 5ILVA 5GAHJ 5LFAA 3FM5A 4XORA 2XSJC 1SM4A 2V4JC 1MSEC 1UD8A 1EP1B 1JXSA 4KN7X 4F7DA 3BG9A 3KFWX 3BG5A 1E1RA 3GSIA 1FNBA 4NUBA 3IH4A 3M07A 2R7UA 4X6AJ 4IKFA 2C2WA 1ZG3A 2ZNZA 2VONA 3ZPLA 3H3VK 1U0JA 2MYSA 1UMQA 1MJ9A 3OFNA 1PP7U 3MD2A 1MW7A 2X6XA 5F4MA 1FNMA 2QTLA 1RIOH 3LWFA 3ONUA 3OYIA 3J7AY 2QKMB 3CPXA 3FPKA 3ZUGA 3VNUA 3B8HA 4CGZA 2R92J 2F1LA 3QODA 1QPMA 2LOOA 3BPVA 3GFMA 6PAXA 3ASTA 1OB0A 4MLOA 4M0LA 2NXNB 3E0JB 1AMOA 2B63J 3CXCB 1YI2B 4ZYGA 3I55I 4XD7A 1E79A 5HLIA 4ESBA 2AXTC 2VE8A 2EB7A 4ZH4F 3O8GA 3CCYA 2E2HJ 3LQ6A 2HQRA 1A36A 1TTTA 1G7SA 1J9IA 5E3NA 3I5UA 3FIWA 4EGZA 3A1PA 2MSYA 1BW6A 2IW5A 4G7WA 1JKOC 1J75A 3CCMI 4K2EA 3IP4B 1G6NA 2OBPA 2XNCA 3DU5A 4KNYA 1BR1A 3Q6QA 3GF2A 1YIJB 3MZHA 1OCCH 2LKPA 5IYDJ 2NAZA 4MO7A 1QNTA 1RETA 3WGGA 2F4OB 4YHBA 2CQNA 2DN0A 4P9UA 1BMFA 1H8EA 1MH4A 1MSFC 2MC3A 3DDYA 3LO8A 2WY8Q 2XHKA 4CHUA 2RGVA 5CQGA 3OOCA 4PABA 1IN7A 2BY2A 2DT5A 1FLIA 2WV0A 4A0ZA 2X1EA 3CCSB 2QM3A 2PLFA 2ZL5A 2CW0F 2B7EA 2FEZA 3PNYA 2WBMA 4RAFA 5IP7J 1W7PD 2RN7A 2FBHA 4AUXA 1ITYA 4DNTB 1XD7A 3TMOA 1UCRA 1VQLB 3QOPA 2D9RA 1NK3P 1R71A 4QVJA 3J81Z 1WJAA 4PFPA 3BZKA 2XIGA 3BTCA 2RDPA 2XB0X 3A2KA 3KP3A 3LOCA 1FZPB 3GTJJ 2QTZA 5IYPA 5CPRB 2VQCA 2FOWA 4HSRA 1V0FA 2HCJB 1FY7A 1R4NB 3E20A 3SJPA 1ELOA 1B59A 3RI4A 5FFZA 3MN2A 1RKWA 1E17A 2HQAA 4B8XA 4WK8F 1OB5A 4II2A 3BC9A 1TQIA 3F6OA 1HCRA 2XKOA 4XKVA 1O3RA 2HPMA 2RAEA 2FNPA 2JA2A 4Y15A 3HC7A 2HVQA 4QVAA 2YSRA 2ESHA 2KZGA 1FRQA 3GTPJ 4IRHA 3A03A 1ULYA 2K3PA 1WP6A 1XSDA 3CMMA 2BPOA 1U3EM 1Z3YA 3NARA 1JKQC 2WJYA 3SLNA 4HW0A 2XAJA 2KJBA 2KT0A 1QO0D 2ZMEC 3L2RA 3G6EB 3OS2A 4V19K 4DYCA 3DP7A 1N08A 2MW8A 2VNJA 4HBLA 1MRZA 2BN4A 3JCUC 2OZ6A 3NAUA 4J19A 4P3IA 3WY9A 3LVBA 2K4BA 3EUAA 2QA4B 5FL7A 2L2OA 1FP2A 1TC3C 1HSTA 3CD6I 4I99C 1WJ5A 1EFRA 3WNCA 1VLYA 1VI0A 1XGMA 1YITI 1LEAA 2L4MA 4IVNA 1T5EA 2QYOA 3DEUA 2XNDA 4EGYA 4ZYAA 2M34A 2GAUA 3HIFA 3V76A 4ZYDA 3JRFA 1U5TC 2BY3A 5DCMB 3BZCA 4FTHA 3Q38A 1LB2A 1TT5B 3I71A 3OYDA 4A0YA 2WR8A 4RDJA 3B02A 4RGUA 5JLWA 3TQNA 1D0ZA 1DUXC 3AKZA 1Z9CA 2XEXA 4YAWA 3ZRGA 3JTHA 2C4TA 3DPTA 2QN6A 3WHBA 3I4MJ 3PFYA 3BJAA 2HFHA 1LJ9A 3B6AA 2STWA 2IS4A 4YEJA 4CDGA 1ZGWA 2E7XA 1UAAA 2VOPA 4H9GA 3FHNA 2VODA 1ZM2A 1EWYA 1IV8A 2Y0SN 2LG4A 4TMVA 2HYFA 3BROA 4GYIA 1BC7C 1B6AA 5TV2A 3RPQA 4B48A 4RGXA 2HDCA 4P5OA 1O3SA 1H8HA 1MABA 2AXLA 2F5FA 2VT2A 5LHGA 2BM0A 2GA1A 2DOFA 3ML6A 2JPBA 5F64A 3ZMVA 2R7SA 2DK8A 2JWTA 3BG3A 1A6IA 3WE3A 1OYWA 1HDDC 4QIWN 4CO8A 1GXPA 1WWXA 2JMWA 2VXDA 1G2HA 1YYVA 5ICFA 2BZTA 3BCDA 1P92A 5FO0A 1IXSB 2Y0SA 3S3OA 1NDHA 3WTSC 2DMPA 1HF0A 2E35A 3EETA 1T6YA 3LSIA 3U2RA 1Y8QB 2ECCA 2K9NA 3FF5A 3L00A 4D0PA 1U5TA 3CLOA 5CKTA 5EEAA 4OPOA 3NWTA 3AAFA 3H9JA 3Q5FA 2DT6A 1I39A 3E97A 3OSFA 2FA5A 2CFOA 2X4HA 4JP0A 3RZOJ 3H5NA 1EH7A 2NS7A 3J81K 3WBKA 4JMQA 2TRTA 1T6SA 1Z77A 3F8BA 3FHZA 4LBWA 2V1DA 3CDIA 3NE5B 5JHUA 2EV6A 1SEUA 1NK2P 3OIQA 1VQOB 2D3LA 1F1ZA 2PMHA 4Z4YA 4H4KC 1SVMA 1BBYA 3DQVC 5J3LA 2ZCWA 3ISXA 3T51B 1XDUA 2DT7B 5JR3A 4FASD 5FRMA 3O6BB 2VB6A 2O3FA 1YO5C 1G3SA 2X0KA 2QMUA 2EILH 1DDGA 1EJ9A 2PMDA 1OYYA 1X4PA 1KU3A 1Z21A 2Y30A 2FXAA 2ZKZA 4M3GA 5KCMA 5BMZA 1VQ9I 4GFBA 1V5GA 4ZCLA 2R0QC 3RKQA 1ZM3A 2QQBA 3C1DA 1IV6A 4JQFA 3VO1A 1P7IA 3F3XA 3L2WA 4Q48A 2YWHA 3OZUA 1QQIA 1GXQA 5TRDA 4UUVA 1NBMA 2V9PA 3I1FA 2H1LA 5C44J 2WY7Q 3E7LA 3H92A 2KMUA 4S05A 4HF1A 2E71A 3QYEA 3WTTC 1JJ6C 4BE2A 4GCVA 3WBJA 2X1CA 5M5YJ 2R9VA 1H8AC 1FTTA 3A3GA 3G1OA 2CS3A 1P4MA 1RNLA 1WSUA 2D5VA 2B7BA 4C2UA 2PIAA 1JUPA 3ERED 4IJAA 3DLAA 4CCNA 4KT6A 1S9HA 1H42A 2X48A 5E8IA 3HGYA 2E34A 2GIVA 2HI3A 1MMAA 4F92B 2KJCA 4BQOA 4G6IA 3ZMSA 4UVCA 4J0QA 1ZG5A 4NHJA 3VODA 1LFUP 1VQPB 3ESWB 4B09A 4QPOA 4HLXA 2DPUA 1U9NA 5B66C 4CCKA 3CUOA 4XQFA 4XL9A 3LFKA 4BJTA 5DN6A 2QKLB 5LEJA 1D3YA 3W6KB 5HVQC 2RNGA 1I6HJ 5EGOA 1I7PA 1Q1HA 1U2RA 2VJJA 4BJ6C 5GTHC 3HHHA 5HS9A 3TOBA 1PDNC 5TISC 4P25A 1X2NA 3SZTA 4OMYA 1TNSA 1IGNA 1QGAA 5ICEA 2BXYA 1VQNI 2Y9YA 3W6VA 1MJBA 4FXUA 2H6CA 3HB9A 4XIDA 2YX7A 5E3LA 2WB1N 3J7ZI 1ZG1A 4MNUA 1Z3XA 2F4NA 3L2CA 4A3GJ 3SEZA 3L2UA 1XGNA 4CA0A 2QBYB 4B4CA 4OOXA 3LL7A 2MLGA 2E1RA 1DPUA 2JUCA 5IK2A 2W48A 4O3MA 3W6JB 4D7MA 1YQAA 3JREA 1V55H 3LSGA 2COBA 3A01B 2C4UA 1MBEA 3MQ0A 5A88A 3CCLB 1HKSA 2ISZA 3M9AA 4I98B 4RLQA 2R7DA 3G71B 1TWAJ 2L7KA 2EK5A 3SFIA 1W7PA 3IRQA 2HYGD 2WB1A 3OP1A 2HVRA 3Q6RA 2DCEA 2BOLA 4LIVA 4FX4A 3AG3H 1IDZA 5F6FA 2EZHA 3HKZN 1MD0A 4PC7A 2ELHA 3F8FA 3GMEA 2E60A 3W5VA 4CQJA 4RGSA 3F6VA 1PUEE 4PSXA 1T6ZA 4PJMA 4RD4A 2VPLA 5B1BH 3DF8A 4IX7A 1TUIA 3SLDA 2X51A 2P7CB 3HRUA 3GTMJ 4Z6YA 2IGOA 3HEFA 3MAJA 2V7XA 2A3SA 3M8JA 3OYBA 2CNDA 4L9TA 1UD3A 1R6RA 2ZSIB 2EQRA 5CVJA 2E36A 1K78B 2V1XA 3HKZA 1EFCA 2QGGA 5AIQA 2C77A 3LFUA 5FO1A 2WAFA 3H9QA 5E20A 4U7DA 4MYUA 5JVTA 2JSCA 4AD9A 2LF8A 4GO1A 2DMTA 4BS9A 5FNZA 4HZFA 4G12A 3RSNA 2XC7A 3OYCA 4Y7CA 2L02A 3W2HA 3LAJA 4FE4A 5E8GA 4D5FA 3HOYJ 2F43A 3BNWA 2C5BA 1OCTC 1WSVA 1D0YA 4DOZA 4CYDA 2K7LA 3K1MA 1QBJA 3GLLA 3L2QA 1J0RA 2JVGA 2OF7A 3ZN0A 5JVGF 1PP8F 2EFQA 2WTEA 2Q2EB 4I02A 2ELJA 4LGWA 1Z05A 5K5QA 3CCEI 3S3NA 1ZR2A 1YHQB 4UHTA 4C9YA 1D1BA 5D5UB 1P4WA 2Q1ZB 1W1WE 2J5OA 1CNEA 4PC6A 3OYJA 1VTNC 1WJCA 2ZSHB 2GPJA 4Y13A 1S0UA 4ON0A 1ZTRA 1W4MA 3RKWA 1VHOA 5J35A 4HF2A 4C3HJ 2HZTA 2FUG2 3WYAA 1USSA 4PAAA 3AL0C 1H9GA 2HYJA 4JOMA 2KRCA 2LSOA 4M74A 1STZA 4GDFA 3LA3A 3VFZA 3TO7A 1ZELA 2R5ZB 1TP4A 5H6RA 1XG1A 3D0SA 3WTYC 3L2VA 3HUGA 1R58A 3N4MA 1IW7F 4I01A 2VNIA 4BAYA 1HW1A 1U8RA 2QWWA 1O3QA 1G7RA 2L9VA 2P0WA 4LJZF 1Q86D 3FWEA 1J09A 2OK8A 2ZZEA 2VKEA 1I3QJ 1VQKI 3SQNA 1Q1VA 4E7SA 5F4JA 3V7AA 2W6IA 3TDUC 5ICCA 1R5BA 2P81A 1ZARA 2E1NA 1YX5A 1FRNA 2XASA 2FRHA 4KT5C 4HA8A 4DGWB 3HPHA 4LB5A 4YAUA 4KKSA 1TQMA 5IYNA 3ZQIA 1ZM9A 3CPWB 4PGGA 3MEXA 3CCVB 2QLZA 1W5SA 4CCJA 4RCZA 2OPTA 3KP2A 1OPCA 1WFXA 4RM3A 3ASSA 3HOWJ 3FXJA 5AIPA 1AKHB 2RQQA 4EH1A 2BV6A 4DK1A 1K6YA 1KK2A 2B5OA 4G7XA 1UELB 5HNHA 4DK0A 1DPRA 4FE7A 1EFUA 1FYLA 1HQCA 3FKJA 1U8BA 1H89C 2KIMA 2E1MC 2WAQN 1V5EA 3WU1B 4WCGA 3VPRA 1WZ2A 4TV7A 1X3WB 2FE3A 3BR5A 5F27A 1N07A 2GJKA 3ABTA 3FKSA 2XKPA 2AO9A 2LBFA 1DP7P 3TEDA 3OYGA 3D26A 4BQQA 4RD2A 3WE2A 1N0VC 1VFCA 4J01A 4M4SA 4GGGA 2CQXA 1ZRFA 2CO5A 1VQ5I 4ESJA 2LKXA 2IRFG 5F0HA 3OKXA 2H1KA 4FK8A 4S0HB 3ZR8X 1MMNA 2GREA 2X6WA 1KZLA 3LNQA 3I55B 4R8HA 4Q7JB 1KD1D 2X1DA 3PIOF 2ZL7A 3ELKA 3RCOA 1O57A 3TP3A 2RNJA 1I8DA 1MBFA 1W34A 1WTHD 1R23A 4TN1A 5F4OA 4Y17A 5EZGA 3JRBA 4RBOA 1IB0A 3CCMB 3TDZC 1OFCX 2E7WA 1E0EA 2DOEA 2V6CA 4M3DA 2LK2A 4B3GA 2CH0A 1PKVA 3BR0A 4N3NA 5IYQA 1K7AA 1T2KA 5LRSA 2DQLA 3I4PA 5KNLA 1W9XA 4NBSA 1BI2A 1B9MA 3O3KA 4A3EJ 3HSEA 1T8IA 1PUFB 3PA2A 2H27A 2EH3A 3WHCA 1OGJA 2WAEA 5LBQA 3OR2C 1R22A 1R5HA 1G59A 4QUZA 1B1BA 1J9ZA 1KK0A 4LG0B 3KEYA 3NRVA 2O0YA 3LSJA 3RIRA 4Q4ZF 1T98A 5HDNA 4HRIA 2GXBA 2DIEA 3QFSA 3CMAI 3DBHB 1VQ7I 5L3EA 3OYEA 4PC2A 4UY8I 3BOQA 1BN5A 3W2IA 1A8PA 5JI6A 2DYSH 1R9TJ 4YIIA 3BWGA 3UKGA 4Z1MA 1UD5A 4RPDA 1DGRM 3I0TA 5DS9A 3E6DA 2DA3A 5FA6A 3ZCOA 3G73A 3S2DJ 3HDDA 5FRNA 4TT3A 4RB2C 4RS8A 2GOXB 3H0DA 3OSGA 4G7HF 2ZXJA 2GK6A 2V1NA 1N77A 2WWYA 2KZVA 3JAMK 1X19A 2KIQA 4M73A 1FBSA 2DFEA 3KP5A 3S1QJ 2EFNA 2W84A 5FD6A 1FJLA 4TMXA 5B6IA 1QH0A 2FQ4A 5K5OA 2RC5A 3OPOA 5EJCA 4TMTA 5HZBA 2P5KA 1T95A 5IOYA 4NQWB 5GV8A 3MCAA 4RCYA 1T0FC 3C2GA 2MH2A 3H5RA 2QSGX 2RC6A 5HLHA 5IYBJ 3LQEA 5HNFA 4UAJA 2MD5A 2V7VA 2DYRH 3W2WA 4ESFA 2GXAA 1KU2A 1DARA 2ZJPF 5D5XB 1KK3A 1QVUA 4G8XA 3FX3A 2CRVA 1FOXA 1E62A 1N75A 3CC2I 4ACAA 1UD6A 2JK3A 4Y9RA 3CD6B 3R6JA 2W24A 4ZCIA 4ENMA 3WTWC 2ESNA 2EV0A 2VQHA 4WXCA 2DPDA 4P12A 1YITB 1GVJA 2JTVA 3I9V2 5HDKA 4Y9UA 3R61A 2CUJA 1EV7A 5L3DA 4CICA 2CJJA 3ZXSA 5J47A 3AVVA 2XAUA 4XLEA 2GBYA 1E3XA 3KYLA 3ZQFA 1D2EA 4AC9A 4Q5SF 2BBYA 3MMYB 1ON1A 1REPC 1S7OA 2YS9A 2Y75A 4PFOA 2HOAA 1LKXA 1DU0A 2GQQA 2CC2A 1ODDA 3AVWA 1U9OA 3DFGA 5EG0A 1UZCA 5HXBA 3G2BA 2JPCA 2B7CA 4NNJA 3A3BA 1T08B 3HTUA 4X0GA 5C3EJ 2FBIA 4MTEA 1EP2B 2ZZFA 4HNVA 1ZKGA 2D2WA 2WPDA 1K73D 1A04A 1T0FA 1S4MA 4FISA 2V7QA 2DXIA 4KFCA 3EYYA 5K5RA 4HNTA 1BOAA 1RZ4A 2W85A 5KK1A 1G4DA 5EEGA 1YRNB 3HTSB 3QFCA 5IPAA 4HX8A 4L5EA 5DV5A 1IF1A 1WGXA 3ONQA 1RR7A 1WKMA 4JBAA 1QGZA 1BJAA 2CW8A 4ZC3A 1W5TA 4W1UA 1MNMC 1BPLA 3OW7A 1RUOA 2M87A 4UUTA 1ZM4A 5LMZA 4UNOA 2YU9J 3ZZ0A 4BPRA 3MCZA 3I56I 5LRRA 4F55A 5LLQA 5F1RA 1N8RD 2ME0A 3FKIJ 2BXZA 1DDIA 1M1KD 2XZPA 2VUMJ 1S29A 2KRHA 5D6EA 5KAIC 3SZPA 3F9KA 4N4NB 4WWVA 1SD6A 1Y56A 3GZ5A 1B72B 4YIRX 1W35A 4BKXA 3ZMDA 4HQMA 5H5JA 4E7JA 4PJ0C 4XK4A 1BM9A 3KLNA 2ID6A 4BHBA 2CQ7A 4CCMA 4CZCA 4UXNA 4MEYF 3HOSA 4A3LJ 3BQJA 1G3YA 2W57A 2F1MA 4ENNA 3KL9A 3CP2A 1S7EA 3OWTA 3VYTB 3IC7A 1GUUA 3L7WA 3PVDA 4UUSB 4RM2A 4Z4SA 3TW7A 4X7DA 2FMYA 4YFNF 3BR1A 3REOA 1VQ9B 1XMXA 2MA3A 3GTKJ 3PO3J 1BJZA 1PYVA 1WH5A 3S3MA 2CV2A 3A4CA 2Z99A 1QRYA 4XKWA 4G1VA 4JK1X 3CCUI 2HPIA 5D4SA 1W2BB 5L3FA 3GZ6A 4XBFA 4F52A 5J3OA 2PFBA 4HPQA 2PE3A 4L5JA 2D1VA 2MGQA 4P96A 2JQ7A 3ABUA 1R1UA 2O5RA 5B3SH 3QYBA 2JDIA 2ZL6A 3H5AA 4X07A 2XF7A 2XZLA 1E3OC 2M8GX 3VMFA 5ILSA 4L8JA 3F8CA 3ZQQA 2IA2A 2NYXA 2ZC2A 3WQZA 1LNWA 2OQGA 1FP1D 3JRDA 4M53A 4E0FA 3S1MJ 3ASNH 2VKDA
chains in the Genus database with same CATH topology
1O7FA 4ENJA 3IKVA 4IRIA 2ZMEB 5FLXZ 1ZAOA 1TQPA 3RTRA 3IL2A 1Q9SA 1HBXG 1SMTA 2K27A 5FGMA 4UZEA 4GXOA 3Q9SA 1R1TA 3MWMA 4BH9A 3HYIA 4Z2YA 4EQQA 2F2EA 4EM2A 4L9NA 3SFZA 2IP2A 1P4XA 2PQ8A 4CZZA 4WXHA 5DYMA 2CWEA 3GYHX 4F7ZA 3BP8A 1FSHA 1L3LA 1TW3A 1R36A 3OV8A 3C7JA 1XSXA 1U78A 2VBWA 1Y0UA 3LSTA 2ETHA 1J7KA 2EV5A 4KIBA 4O5VA 2VE9A 2FOKA 3LQRA 4QLCU 4N9HA 3KEOA 1LEBA 4N0BA 3WODF 4IPAA 3N97A 1IUYA 5E1XA 1KU9A 3QU3A 2I1LA 3K1PA 4L9VA 1TNTA 3GUDA 2QQAA 2XAGA 1MDMB 1TTYA 1P4AA 4RAYA 2PN6A 3LQQA 4XLNF 2XROA 4A12A 4P9FA 3Q9VA 5LHIA 2RC4A 3HOTA 1RI7A 3F72A 4OU0A 2Z3YA 4U7BA 5FLXK 4I0BA 3R0JA 5TJJA 1FWZA 2K4JA 1WI9A 1SD5A 3T8RA 2FQ3A 4ENKA 1R00A 5A89A 2BE5F 4FT8A 2XAHA 3VOEA 5D4RA 5DD4A 2E1CA 3EUHA 3PQKA 3TOAA 5LGTA 2PBIA 5DCMA 3RJPA 3B73A 2GXGA 2A6EF 1WQ2A 4YG2F 1FBUA 1CGPA 4M71A 1WRJA 3C18A 2A69F 2WC2A 4HAMA 3BJOA 2O61A 4N9IA 2V9VA 3I64A 2DK5A 1S8NA 5IT3A 2P5LC 1SFEA 3P9CA 2BYVE 1UB9A 3F8NA 2GA2A 1XCVA 1L0OC 1XCBA 3ISPA 3R60A 2G9WA 5FB2A 1Z6TA 2NS0A 4HX7A 4QWQA 3J80Z 1UHMA 1SAXA 5H20A 1MKMA 4MEXF 4OIOF 4L9JA 1CF7B 2P6SA 3JSOA 3M7GA 2IT0A 5LHHA 2VN2A 1ZGAA 3I59B 4O6JA 3V8KA 4EM1A 2XVCA 4LLNA 3T0YA 4BHCA 3CTAA 1KU7A 1YW7A 3GW2A 5JFRA 1XGOA 3GEZA 3DXJF 4HDVA 1XN7A 5DUIA 1G3WA 1D8JA 3V7SA 1Z7UA 3KETA 2H94A 5D6FA 2Q8KA 3ECOA 2Q0OA 4L18B 3GXOA 4KDPA 2YX4A 3L09A 3DKWA 5H6QA 2HKOA 3HSRA 4EJVA 5HLGA 3FXQA 4R79A 2NNYA 1IXCA 5CVVA 4EMSA 4EV0A 4EVIA 4G94A 1O7LA 1ZLKA 3V7CA 5IT9K 2G7HA 1HKQA 3LA2A 4G7ZF 1ZYRF 2M8EA 2XAFA 5DDGA 3LA7A 2DU9A 3P9KA 2PEXA 1LDDA 4YFKF 1XSVA 3EDPA 1V4RA 2IA0A 2DTRA 4Q47A 1IAWA 2VXZA 3J80K 2QBYA 4KYWA 1P2FA 3CUQB 4OMZA 4H0EA 2NRAC 3KLOA 2A07F 2P8TA 2HKXA 4EM0B 1TW2A 3QAHA 3BPXA 3FMQA 3JAMZ 2XRNA 2JT1A 5HDGA 1YW9A 3EQLF 1Z91A 2OAZA 4DNCA 2QUFA 2OZUA 3WGHA 2HS5A 1K79A 1BI0A 1LVAA 1EH8A 1D8KA 5FFXA 1SFUA 3U9GA 4M9ZA 1YLFA 1IZ1A 2UWMA 1K78A 4HV6A 4M9XA 5DEQA 3C3WA 4BXUA 4BYYA 2KIFA 2VOOA 4I7HA 3S2WA 5LGUA 2H09A 2EWNA 2RKHA 5DUKA 5D5WB 2HTJA 1JE8A 1U2WA 3DV8A 4UV9A 4A0XA 3WTUC 1B9NA 4M6YA 2GWRA 4WXDA 2VBTA 2MH9A 4PGHA 1R1VA 2QENA 2F5EA 2UZKA 2O03A 3V8LA 3E6MA 1IN8A 1YIOA 4I09A 1IXRC 2OYNA 5K1YA 4RB3C 1J5YA 3BZ6A 2EA2A 4GYGA 4G7OF 1MZBA 1USTA 3KE2A 1IN6A 2VBXA 1FX7A 2EFWA 2CFXA 2DLLA 3SHFA 4RGRA 3GLXA 3HRTA 2D45A 1SFXA 1HW5A 2UXNA 4YIFA 1ZRDA 4HYEA 3JTGA 2P3MA 4BNCA 1UFMA 2YU3A 2ZJ2A 1I6XA 4HOBA 2EJRA 3I58A 2DO7A 1UHWA 2RQPA 1HKTA 4L0YB 3G3ZA 4CXFA 1XGSA 4IHTA 1YTYA 1ZHFA 5CLSA 3IHUA 2FF4A 2KKOA 2PI0A 2D1HA 5CYVA 4AIJA 1XB4A 1XMAA 3FMRA 2MLKA 3VEPA 2PLYA 3E5XA 3COAC 4EJUA 5DCFA 1RUNA 1E2XA 2VBVA 4M6XA 4MHGA 1X3UA 4LG0A 3ROUA 4OIQF 2A5YB 2ZO4A 3RYRA 3K0LA 5E18F 4ZYEA 4IF4A 5E1WA 3CO6C 4OIPF 5CJ9A 5BPIA 1YW8A 1R5GA 4AWXB 3TKYA 2VBYA 3WTVC 3T1BA 4HF0A 1FYMA 5CVIA 2G7UA 2AS5F 1SD7A 4U0VA 2FSWA 1D5VA 4NQWA 4U0WA 4HLYA 3R6SA 1QZZA 3P7NA 5AONA 4WX9A 1C0WA 2VC1A 4LK1F 3QPTA 1ON2A 5J8CA 1T6XA 3V8JA 2P7VB 3EYIA 2UXXA 2ACJA 1TBXA 1FSEA 3F8MA 3FXUA 1BIBA 2V1UA 3NQOA 3E5UA 4R1HA 3CO7C 1KGSA 1H0MA 5E17F 4XSXF 2EFOA 2VC0A 3GVAA 2PJPA 1SMYF 3VB2A 2ADUA 4OOIA 2M1BA 4KMUX 1U5TB 5L3BA 2R7FA 3QPHA 4KN4X 3K69A 2F5CA 2OQRA 4A2UA 4A6EA 4PZJA 2PG4A 1J59A 3KP6A 1JHHA 2F5DA 2XV4S 2ZFWA 3ZMZA 1Z6RA 1QGPA 4KIGA 4I0AA 4I2OA 1I1SA 2X0LA 2RVCA 4M72A 4XSZF 1B4AA 3F23A 3K1NA 2QVOA 4KIFA 2L3DA 1T38A 4RAZA 4YFXF 3TO9A 1F5TA 3F22A 3DPLC 3E6CC 1H9TA 5L3GA 3SXYA 4HX4A 2MBFA 1OMIA 2W25A 1T39A 5E1ZB 5HS8A 5J8FA 4P55A 2L54A 1IRGA 4A6DA 1R7JA 4ZYHA 3BJ6A 4FHTA 1FPQA 5CVRA 1MJAA 2BEOA 4RB1A 2ZMEA 3JW4A 3M1EA 4BQAA 2CG4A 3BY6A 1KYWA 4IHSA 1IN4A 3R0AA 1ZGJA 4FX0A 2O6GE 2H6BA 4IRGA 1I1GA 4OINF 3FMSA 1U6GA 1LDJA 3L9FA 3WGIA 3CDHA 3LAPA 3FM3A 4HQEA 1W7PB 1N06A 4LMYA 4WWCA 3P9IA 1BI3A 2CGPA 3E3VA 2R3SA 1BC8C 4EJTA 1I27A 5IT9Z 3MZYA 5J6XA 5ERIA 2HR3A 2ZBKA 1EH6A 3IKTA 1S6LA 3FZVA 1FOKA 3RKYA 4E70A 2GZWA 4L0ZB 2FNAA 2LF7A 3IRRA 3GFIA 1HSJA 2IA1A 3PFIA 5LGNA 3M8EA 1NHAA 5KVRA 3O2PE 3K2ZA 5A2QZ 4G6DA 4LK0F 1YS6A 2NNNA 4XLPF 2A68F 2IVMA 3HRMA 3FXRA 1ZRCA 1G3TA 1ZN2A 1MDMA 4M9SA 2FU4A 3TGNA 1KQ8A 3MFKA 5ILUA 2HGCA 4MTDA 3K9TA 2RV8A 2HTSA 2Z33A 4AIKA 2Y48A 2DAOA 4MGRA 3E5QA 5D8KB 1SD4A 2CSOA 2BGCA 3V7RA 4KUMA 3OOPA 1NB9A 5BOXA 2HQNA 2IJLA 3IWZA 3KZYA 1AWCA 5L3CA 3GFJA 4EJWA 3BDDA 2OD5A 3NEUA 4UVBA 3I53A 1KQ9A 2ZNYA 1OKRA 3V4GA 1P6RA 1S3JA 1KA8A 3PQJA 3HSFA 2YPRA 1BIAA 4MQVA 1S7AA 2VBUA 4IXAA 1JHFA 1IN5A 3WTZA 1YFHA 4G6QA 4BHPA 3U1DA 4HDUA 1XDSA 4G9YA 4LFUA 5D8LB 4MQ9F 2VT3A 3HRSA 1OYIA 2K86A 4U88A 5A2QK 1IRFA 2STTA 5EEHA 2XUBA 5FO5A 2PMUA 3RKXA 4KICA 1JGSA 2DW4A 1QZYA 1CF7A 3GO5A 5D5VB 1FBQA 3QP5A 3F21A 3QU6A 3T5XA 1KQ0A 2TDXA 2LNBA 1HW2A 1NB0A 2Z9OA 1BI1A 3ECHA 4UVAA 3ZN1A 3I59A 4A5MA 4DQ2A 2B0LA 4XRFA 5DD8A 5HS7A 2M5WA 1XMKA 2OU2A 5CVUA 2JZYA 3T8TA 1OR7A 2HOEA 3H3ZA 3M8FA 1TLHB 5HOOA 1O3TA 5BPDA 4AIHA 1KYZA 3ZP5A 3ZMTA 2P4WA 2OA4A 4ZZLA 3GFLA 2YR2A 3RDIA 4ETSA 1K6OA 2IPQX 2QQ9A 2HEOA 2O8XA 3CUQC 3H3UA 2VBSA 1AOYA 5BS6A 3R4KA 1FYKA 1I5ZA 2J5PA 3KZZA 2Q2EA 5ICGA 3WTXC 2A6HF 1ZH5A 4LB6B 4OIRF 1ZREA 4L5IA 3IWFA 4RB0A 2COMA 5BQTA 2FMLA 3RYPA 2Z5UA 5LEKA 2XGXA 3CUQA 2EFPA 4LLLA 2JRTA 1V3FA 1GHCA 2VBZA 3CJNA 3RPUA 4U0YA 1LQ1A 2DFIA 2CYYA 4WF2A 3QP6A 1J2XA 3ZQ7A 3WU0A 3QRFF 2L01A 4LD5A 4ZZDA 2QZ8A 4AVPA 2A61A 1FNNA 4PDKA 3KEQA 1F4KA 2Y0MA 2ISYA 4A5NA 2KRFA 3KCCA 2HWVA 2XAQA 3ULQB 2V79A 2M45A 4LLGF 1DDNA 1FT9A 4UV8A 3D5LA 1Z1DA 4KA4A 4PCQA 5A8AA 2M30A 3GX4X 2K02A 1YS7A 2LDUA 1FC3A 2EA4A 3WG9A 2DBBA 4UZFA 3JSPA 2P5VA 2DQRA 3KP7A 3TO6A 1ONVA 4NB5A 2P6TA 5FD5A 3E6BA 1YG2A 4KMFA 2FBKA 1N05A 4EJOA 4ASNA 2DI3A 1F9NA 2C6YA 1LDKB 2KIUA 3GWZA 2CQKA 1HXDA 3HHGA 3KP4A 2L4AA 1MGTA 4HV5A 3I54A 5ED4A 3ZMUA 3J7AO 4S04A 1ZLJA 5ILVA 3FM5A 1JXSA 4KN7X 3KFWX 1ZG3A 2ZNZA 2VONA 3ZPLA 1MJ9A 1PP7U 1RIOH 3LWFA 3ZUGA 4CGZA 1QPMA 3BPVA 6PAXA 3GFMA 4ZYGA 5HLIA 4ESBA 2VE8A 2EB7A 4ZH4F 2HQRA 1J9IA 3I5UA 4EGZA 2IW5A 1J75A 4K2EA 1G6NA 2OBPA 4KNYA 3GF2A 3MZHA 2LKPA 2NAZA 1QNTA 3WGGA 4P9UA 2MC3A 2XHKA 4CHUA 2RGVA 1IN7A 2DT5A 1FLIA 2WV0A 4A0ZA 2QM3A 2CW0F 2FEZA 2VOPA 1W7PD 2RN7A 2FBHA 1XD7A 1UCRA 3QOPA 3J81Z 2XIGA 2RDPA 3KP3A 1FZPB 1FY7A 1B59A 3RI4A 5FFZA 1E17A 4WK8F 4B8XA 1TQIA 3F6OA 2XKOA 1O3RA 2FNPA 4Y15A 2YSRA 2ESHA 4IRHA 1ULYA 1XSDA 1U3EM 4HW0A 2XAJA 2KJBA 1QO0D 3DP7A 1N08A 4HBLA 1MRZA 2OZ6A 2K4BA 1FP2A 1HSTA 1XGMA 1LEAA 2L4MA 4IVNA 2QYOA 3DEUA 4EGYA 2GAUA 3HIFA 4ZYDA 1U5TC 5DCMB 1LB2A 3I71A 4A0YA 3B02A 4RGUA 3TQNA 1DUXC 1Z9CA 3JTHA 3DPTA 3BJAA 2HFHA 1LJ9A 2STWA 4CDGA 2E7XA 2VODA 2HYFA 3BROA 4GYIA 1BC7C 1B6AA 3RPQA 2HDCA 4RGXA 4P5OA 1O3SA 2AXLA 2F5FA 2VT2A 5LHGA 2GA1A 3ZMVA 5F64A 2JPBA 2DK8A 3WE3A 1OYWA 4CO8A 1GXPA 1WWXA 1YYVA 5ICFA 1P92A 5FO0A 1IXSB 3WTSC 3EETA 1T6YA 3U2RA 3FF5A 4D0PA 3L00A 1U5TA 3CLOA 3AAFA 3Q5FA 3E97A 2FA5A 2X4HA 1EH7A 3J81K 1T6SA 3F8BA 3FHZA 2V1DA 5JHUA 2EV6A 1F1ZA 2PMHA 1BBYA 3DQVC 2ZCWA 1XDUA 5JR3A 3O6BB 1YO5C 2O3FA 1G3SA 2X0KA 1OYYA 5BMZA 1KU3A 2ZKZA 2FXAA 2QQBA 3C1DA 4JQFA 3F3XA