5TRDA

Structure of rbkr (riboflavin kinase) from thermoplasma acidophilum determined in complex with ctp and its cognate dna operator
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
219
Chain Sequence
DQYYRAIKKIKEAAEASNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKRGQILNITEKGLDVLYTEFADLSRILAIKNNVVITGTVTSGMGEGRYYVARKQYIIQFQEKLGIIPYLGTLNIKVDQASLPELRKIRGFRGIHIEGFKTEDRTFGSVKAFPAKIQNIPCFVIMPERTVYTDVIEIISDKYLREEINLHDGDRVSVEVYTEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of RbkR (Riboflavin Kinase) from Thermoplasma acidophilum determined in complex with CTP and its cognate DNA operator
rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase/dna
molecule keywords Riboflavin kinase
total genus 70
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2016-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5trdA01
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5trdA02
2IPQX 2VBWA 1WSUA 5DD4A 2EFQA 2E1NA 4FX0A 3OP1A 3H3UA 1O57A 1ZREA 2GAUA 1REPC 2JSCA 3REOA 4YIFA 5IT3A 3CUQA 5JFRA 2EFPA 2QLZA 4WXHA 1WRJA 1WWXA 2ZXJA 3FZVA 3BJOA 1LEBA 2CW0F 5DV5A 3RTRA 4UVBA 1IF1A 1FSEA 2UXNA 4ZYDA 2JRTA 4KUMA 2XKPA 2FOKA 4FX4A 3ABTA 2HOEA 2ZCWA 3E6BA 5K1YA 1O7FA 2M5WA 1N05A 2DK8A 2BEOA 5DCFA 2W84A 3HSEA 2F5FA 3R60A 4Y17A 4CZZA 4JK1X 4KT5C 1LB2A 3V8KA 2HR3A 3GO5A 5ERIA 3ECOA 3ZMZA 2LNBA 4YIIA 4LG0B 5DDGA 2NS0A 3CUQC 4MHGA 1W7PB 1FYLA 1U78A 2ADUA 1OYYA 2P6TA 4G6QA 4G7OF 3I71A 3U9GA 3T8TA 1I1GA 1HKQA 4UVCA 3M1EA 1BBYA 5CVVA 2RQPA 1DP7P 4EQQA 2V6CA 2BGCA 4O6JA 2LF7A 2QBYA 4XLNF 3WTVC 1SAXA 2V1DA 3GX4X 3WTSC 2HFHA 4ASNA 4EJVA 3IRQA 5H6RA 4LD5A 3DXJF 1E2XA 1MDMA 3IWZA 3KP5A 1P92A 3G73A 5ICFA 1OMIA 3F8BA 1IW7F 4ZYGA 2C6YA 2VBTA 1BI2A 4OMYA 4IRIA 3R4KA 2WC2A 3WTXC 1UHWA 2F5EA 1R23A 4YFXF 1FX7A 2HWVA 2XAFA 3GWZA 3V7SA 3Q9VA 4KMUX 4AIJA 4L0YB 4HQEA 3KFWX 2QZ8A 3WTWC 2OQRA 2OA4A 3AAFA 5ICEA 3QOPA 1MDMB 3PFIA 3RDIA 1HSJA 4G94A 4CYDA 4Q47A 2COMA 3K9TA 2OU2A 5L3DA 4ZZLA 3HSFA 4UV9A 3WGIA 1XGSA 2IA1A 2QQBA 4KN4X 2DK5A 1IXCA 2FA5A 3K1MA 4AIKA 2VC0A 4PZJA 4S05A 2BYVE 2ELHA 3V7CA 1XMKA 3ZP5A 1ZG5A 3RPQA 4KFCA 4K2EA 2KJBA 4L9NA 2GZWA 1EV7A 4XSZF 1Z6RA 2RN7A 2W25A 5BMZA 2ISYA 3I53A 2GIVA 1N06A 3HHGA 1TLHB 3WODF 2KRFA 1VTNC 3MFKA 4AIHA 1T0FA 3V7RA 1LDKB 4WXCA 3CDHA 2EJRA 1Q9SA 4LK1F 2CO5A 4B8XA 1ZH5A 3HTUA 5CVUA 4L0ZB 5J8FA 5L3FA 3BPXA 2L02A 4U0WA 1IRFA 1YQAA 1BJAA 3GFJA 1CGPA 4KIFA 2ISZA 3TDUC 1KQ9A 2OYNA 2XVCA 1F9NA 1ZGAA 5TRDA 4AWXB 4A6EA 2MLKA 4HX4A 1T39A 1OR7A 4XRFA 2ZNYA 5BQTA 4NHJA 4LK0F 1G3SA 2RC4A 5J8CA 1MGTA 1XCBA 3KP3A 1Z7UA 1FT9A 3F23A 4HX7A 4R8HA 2XGXA 4L5JA 4HDUA 1F5TA 5D6FA 5FGMA 4I98B 2VN2A 2XUBA 3R0JA 1BI0A 3OOPA 2M8EA 5CVJA 4EJWA 4ESJA 2XROA 3GZ5A 3BJAA 4GO1A 4ZYHA 2DI3A 4OIOF 1RI7A 1FBSA 5DEQA 4HF2A 3RKYA 3ZMUA 1SFEA 1KYZA 4EJUA 4RS8A 2YSRA 3GFMA 3FMRA 1FBUA 1Y0UA 5K5RA 5ILVA 3C3WA 1K78A 1MKMA 4ENNA 5DUIA 5EEHA 2H6CA 1CF7A 4N9HA 3DKWA 2P7CB 5LRRA 1T6SA 5F64A 2R7DA 4G6DA 3F72A 4QWQA 2X0KA 4A5NA 1IXSB 4P96A 1P2FA 3BNWA 4HV6A 1Z1DA 1D5VA 4F7ZA 3T5XA 3C18A 3E5XA 1U8RA 5HDKA 4U7BA 3O2PE 3E6MA 5CVRA 2RNJA 2RGVA 3JW4A 5HDNA 2Y75A 5E20A 1LDJA 1LVAA 3HIFA 1MD0A 2B0LA 5A88A 2L01A 4N0BA 1Z91A 3ZMTA 2WV0A 2EV0A 3QU3A 2PBIA 2ZKZA 4U7DA 3C1DA 1TQIA 3J7AO 2EB7A 4OMZA 1RIOH 1XSDA 2MH2A 5FNZA 2QBYB 1YW9A 2Z33A 3RI4A 2IP2A 1BM9A 1I27A 2DQLA 4HX8A 1BC8C 1K7AA 2FQ3A 1IRGA 3SZTA 3CJNA 2HDCA 4EV0A 1R1VA 2XRNA 3M8EA 4WK8F 1XSXA 3MAJA 1HQCA 2KIMA 2VBXA 3VOEA 3J80Z 2CFXA 5L3BA 2IA0A 1D8KA 2K4BA 2V79A 3LAPA 1W4MA 1TW2A 3SFZA 3DPLC 3KETA 3ROUA 2P5LC 1KGSA 2DFIA 2Z5UA 1U6GA 4M9SA 1E17A 1AOYA 3O6BB 4WCGA 2HYFA 1J5YA 5FO0A 5DUKA 2EFOA 2IW5A 3E6DA 2YU3A 1KU2A 2KIUA 1ZG1A 3P9KA 2D45A 4BNCA 4IRGA 4IJAA 2P5KA 3F8NA 1HKTA 2H6BA 3K2ZA 3FX3A 1MRZA 1Z9CA 2DU9A 1I5ZA 1XDUA 1N07A 5E1WA 2OD5A 4JQFA 2DW4A 3VB2A 3F8FA 2UXXA 3N97A 3IKTA 2M87A 1UB9A 1XGMA 2ZJ2A 3J81Z 5LGTA 3R61A 3B02A 1B9MA 4EGZA 1PP8F 3KP4A 2FU4A 5D8LB 2ESHA 3I0TA 3J81K 4U0YA 4DQ2A 3VFZA 4UUVA 5D5XB 5DCMA 2PN6A 1S7OA 2F5CA 4HA8A 1SFXA 4HYEA 2OZ6A 2A68F 1ZHFA 2MH9A 1YFHA 3ZUGA 2STWA 3CO7C 1KU7A 3HOTA 1GVJA 2I1LA 4RB3C 4UNOA 5JVTA 3ISPA 4LG0A 3GW2A 4BHCA 5AIQA 4UHTA 3K1NA 2MBFA 1PUEE 4KN7X 4BXUA 1P4AA 2JPBA 1V4RA 2PQ8A 1H0MA 3PQJA 2A61A 1UHMA 2Q8KA 2EA2A 3PQKA 1TTYA 2H09A 4I7HA 3LA3A 1IN6A 4L9JA 3I64A 1ZN2A 1KQ0A 3KEQA 2VODA 1LNWA 5L3GA 4BYYA 2ETHA 3T1BA 4ETSA 3ZN1A 5L3EA 5E17F 3LSTA 2EWNA 2HQRA 3IL2A 2Q0OA 3I5UA 4RAZA 1S29A 1QGPA 4B09A 1XMAA 5D5VB 2ZFWA 2Z9OA 4AVPA 4ESFA 2Z99A 5E8GA 2HKOA 3CTAA 1Z6TA 4I02A 5F6FA 2WWYA 2GA2A 2NYXA 2ACJA 5CLSA 4A6DA 5TJJA 3ELKA 4KIGA 1WQ2A 1TW3A 4MQVA 4I09A 4A5MA 4CGZA 2O6GE 3RPUA 5HS9A 1T38A 4HOBA 3GZ6A 4A0YA 4PCQA 2FSWA 2KKOA 4I0BA 5K5OA 4ENJA 3DQVC 1RZ4A 1XGOA 1EH8A 5KK1A 2Z3YA 5A8AA 2F5DA 2Q2EA 3IC7A 3IKVA 4Y15A 3SZPA 3F8MA 3F6OA 1USTA 1R58A 1XSVA 4JBAA 1BN5A 1FZPB 5HOOA 3MZHA 1TNSA 4WWCA 3TKYA 3JAMZ 3RYRA 4M6XA 1R1TA 2LF8A 2PMHA 2YX4A 3ULQB 3KLNA 2QUFA 4UV8A 2K4JA 4IXAA 5CVIA 2Y48A 4M71A 5A89A 4M9XA 1IZ1A 3LFKA 2FMLA 2ZBKA 2O3FA 5LEJA 5EEGA 3ZMVA 1J9IA 1BOAA 1L0OC 3GYHX 3K69A 3FMQA 1NB9A 5DYMA 4P55A 2VT3A 4CO8A 2DTRA 2VE8A 2HGCA 2A5YB 3WU0A 1BC7C 1FOKA 1SD5A 5F1RA 3KEOA 1B59A 3NRVA 3ZPLA 2A6HF 3V8LA 2O0YA 5E1XA 3GXOA 2VE9A 4XSXF 4UXNA 3EUHA 3Q5FA 3ABUA 1HXDA 2ZMEB 4UZFA 2IRFG 3LQQA 3M9AA 1K78B 1AWCA 4LFUA 1HW2A 3KE2A 2GQQA 4BHBA 5L3CA 3BP8A 5HS8A 1XGNA 3KCCA 4Q48A 3GUDA 2DAOA 4HW0A 1P4XA 5D4SA 1EH7A 3I58A 4Q4ZF 4GYGA 2FNPA 3EDPA 3P9IA 4LMYA 1O7LA 5HDGA 2A69F 3E97A 2W24A 3U2RA 3ERED 4WX9A 1N08A 1QZZA 1SD6A 4RGXA 2CYYA 2L4AA 3O3KA 4Y13A 5KVRA 2LSOA 1BI3A 1YG2A 2KIFA 1YYVA 2XAHA 2DBBA 4UVAA 3ZMSA 1J0RA 4HLXA 3W6KB 2ZNZA 3NQOA 3TOBA 2HQNA 2K7LA 2OAZA 3EYYA 2FEZA 2V9VA 4KDPA 5FD6A 4GGGA 2FBKA 4BQAA 3E5UA 4RGRA 2VC1A 4MTDA 4M6YA 4FT8A 3C7JA 2BV6A 1W7PD 1L3LA 1FYKA 5J6XA 2VXZA 3I59A 4ENMA 2UZKA 2CSOA 4I2OA 1V3FA 1G6NA 3I4PA 2PG4A 4A12A 4HBLA 2VBUA 1ULYA 5IT9K 3R0AA 2VBZA 3VEPA 4U88A 1KQ8A 3I54A 1IN7A 4UZEA 5BOXA 3ZMDA 2XASA 1T6ZA 5IT9Z 1ONVA 2PFBA 4G7HF 3P9CA 4RB0A 1FY7A 4O3MA 1IN8A 4GYIA 4AD9A 5DCMB 2TDXA 5FLXZ 1RUNA 3DF8A 1RUOA 3KP7A 4IPAA 2H94A 3HYIA 4G8XA 4M72A 1YS6A 2AS5F 1C0WA 3W6JB 2VBVA 1MZBA 4M9ZA 2NNNA 2HKXA 3EQLF 1YS7A 1LQ1A 2D1HA 5D8KB 5LRSA 3GVAA 4EVIA 4CICA 1S7AA 3F6VA 1O3QA 2GXGA 2G7UA 5FO5A 3E3VA 4FHTA 2QWWA 3GFLA 2W57A 3K1PA 2YPRA 3BY6A 5LHHA 1TNTA 4HAMA 1T6XA 4TV7A 1OPCA 2HS5A 2XHKA 4IVNA 1QQIA 3QPHA 2IT0A 3FXUA 1W7PA 4EGYA 1DDNA 1U3EM 3FM3A 1W5TA 4M74A 2EFWA 4G7ZF 4XBFA 5LHGA 3QP6A 1PDNC 5A2QK 3TDZC 5FFZA 1F1ZA 4OOIA 3L09A 3MQ0A 3WTUC 3IRRA 2IVMA 1PP7U 3FXRA 4NQWA 3L00A 2VT2A 4YG2F 1GHCA 2DPDA 4EM1A 2GXBA 1FNNA 1S3JA 2BE5F 1YW8A 2AXLA 1XD7A 3SXYA 4YFNF 2IJLA 2F2EA 4KMFA 4WF2A 1JE8A 3WG9A 4L18B 4RB2C 1YTYA 1Z05A 1W5SA 3SHFA 2XAGA 3KZYA 4IHTA 4ZH4F 1ZRFA 4LLGF 3GF2A 3RIRA 1D3YA 3MEXA 3LAJA 2HTJA 2RDPA 2PI0A 1YIOA 1FWZA 4DNCA 4MEXF 4BH9A 4RB1A 2FF4A 1K6OA 2ESNA 4RGSA 5FD5A 4ENKA 1CF7B 1IXRC 4LLNA 5E1ZB 3KP6A 5H6QA 5D4RA 1YW7A 4QLCU 3FF5A 1FLIA 4ZYEA 5JHUA 3B73A 3MZYA 3LWFA 4O5VA 2NNYA 2H27A 4IRHA 3FM5A 1OKRA 5LGNA 1MJ9A 1TQPA 2CQKA 1JHFA 1Q1HA 3JSOA 4WXDA 1U5TB 1IN5A 5JI6A 3WTYC 4Z2YA 3ECHA 1QO0D 3EETA 1R00A 2QYOA 1FP2A 3VODA 1K79A 1P4MA 3WE2A 3F3XA 2V1XA 2FNAA 3QAHA 1IUYA 3BDDA 4I0AA 2E7WA 5D6EA 2CWEA 3BOQA 3MWMA 3GEZA 3WTTC 2PJPA 3JTHA 2O8XA 4BHPA 4IF4A 1GXQA 4PGGA 2GA1A 1TQMA 2EV5A 1XN7A 4MTEA 2PMUA 2RV8A 3H3ZA 3COAC 4EJOA 4E70A 1IN4A 4LB6B 5FB2A 3GFIA 2J5OA 3BPVA 1SD4A 1FPQA 2OQGA 1HKSA 2M1BA 3TOAA 1BIBA 1USSA 2NAZA 3H92A 4NB5A 1P4WA 3QU6A 4L9VA 3D5LA 4S04A 2P3MA 4YFKF 1FSHA 4G9YA 2FE3A 3OV8A 4R1HA 3HRUA 3HRSA 1QNTA 3EYIA 3BJ6A 4HDVA 2HZTA 2QENA 2CG4A 4HF0A 3M8FA 1RNLA 5FFXA 1U5TA 1U2WA 2E1CA 3HTSB 3E6CC 1ZARA 4P5OA 1H9TA 2ZMEA 1KU9A 2K27A 3CLOA 3HSRA 2YR2A 2DO7A 2J5PA 2VOOA 3TQNA 4OU0A 5E8IA 1ZLKA 5HLGA 1R7JA 5DD8A 5D5UB 2DT5A 3F21A 2NRAC 1G3WA 4OIRF 2RVCA 4KNYA 4HV5A 3R6SA 3U1DA 2X4HA 1HBXG 5LEKA 2MLGA 1F4KA 2VONA 1HW1A 1XB4A 2EV6A 3ZQ7A 1HW5A 5ILUA 2K86A 2M45A 1D8JA 2MA3A 3I59B 2V1UA 2GWRA 4PDKA 4EJTA 2L3DA 1P6RA 5CYVA 1G4DA 2LKPA 3QP5A 1BI1A 3CUQB 3V4GA 4P9UA 1JGSA 5FLXK 3L9FA 3WU1B 4LJZF 3MCZA 2M30A 5D5WB 3FMSA 3RKWA 2E7XA 3ZN0A 4OIQF 4M73A 3Q9SA 4OINF 3LA2A 3F22A 1X3UA 2EFNA 3T8RA 3HUGA 3FHZA 3FWEA 1B4AA 2JPCA 2XV4S 2P8TA 1I6XA 4IHSA 2FXAA 2XAQA 3JAMK 3TO7A 1R5GA 3WTZA 5ICCA 1ZGJA 1R5HA 1NB0A 3DFGA 1QPMA 3BZ6A 2O61A 5K5QA 3SQNA 5E18F 4R79A 4U0VA 1OYIA 4A0ZA 1O3SA 1R1UA 2FBHA 2X0LA 1UCRA 1ZRDA 4I01A 2A07F 4A0XA 1ZYRF 4XLPF 1FYMA 1DUXC 1I1SA 3WGGA 3J80K 3KP2A 2R7FA 3RKXA 5HLHA 3HOSA 2PEXA 5BPIA 3GLXA 2WTEA 4KICA 4GCVA 1O3TA 4ESBA 3L7WA 2XIGA 3L2CA 5JR3A 2OBPA 2D1VA 4KYWA 1GXPA 4H0EA 1S8NA 2L54A 4L9TA 2QM3A 3BROA 2Y0MA 3DPTA 3JTGA 2HEOA 1TBXA 6PAXA 1J2XA 3G3ZA 1B1BA 1WKMA 3IWFA 4L5IA 2PLYA 2VBYA 5LLQA 1FC3A 1B9NA 4LB5A 3WE3A 4BAYA 1SMYF 1ODDA 3KZZA 2G9WA 3E5QA 1BIAA 2MC3A 1JXSA 1J7KA 3LQRA 1SMTA 5A2QZ 2DPUA 1T98A 4CXFA 2EK5A 1R22A 2G7HA 1NHAA 2A3SA 2EA4A 5FO1A 3F8CA 5CJ9A 1LJ9A 2FRHA 4RAYA 1ZLJA 5BPDA 2VBSA 3QRFF 2A6EF 5H20A 2O03A 1T6YA 5ED4A 1STZA 3V8JA 1FP1D 3M7GA 1LEAA 5AONA 1WI9A 1H9GA 1LDDA 2FBIA 4Q5SF 5ILSA 3DEUA 1G3YA 1ZRCA 3CUOA 3DP7A 1ZG3A 1XDSA 2UWMA 2D2WA 5ICGA 4CDGA 3CO6C 1HSTA 1J75A 2CGPA 1OYWA 1U5TC 3QPTA 4MEYF 4HF1A 2HTSA 2JTVA 5HLIA 3LA7A 1QBJA 1A04A 1YO5C 2L4MA 4HQMA 3JSPA 1UFMA 5BS6A 2FMYA 1KA8A 3N4MA 1MJAA 3RJPA 3HHHA 1JHHA 4MNUA 2P7VB 2QQ9A 2STTA 2JZYA 4A2UA 1S4MA 1KU3A 5LBQA 3HRTA 2OZUA 4EM0B 1MJBA 1ON2A 2KJCA 1XCVA 1O3RA 5HVQC 5LHIA 1ZAOA 1YLFA 3RYPA 4PGHA 4EM2A 2DLLA 4CHUA 1IAWA 3T0YA 2MD5A 3TGNA 2YX7A 2BBYA 1G3TA 2P4WA 1ON1A 3FXQA 1R36A 1B6AA 2ZO4A 1DPUA 1SFUA 3IHUA 4ZZDA 3KLOA 1QZYA 1J59A 2HYGD 4HLYA 4ON0A 2XKOA 2W85A 2LDUA 4OIPF 4LGWA 3S2WA 2XAJA 3BWGA 3DV8A 3NEUA 5AIPA 4EMSA 1KYWA 3ML6A 1SD7A 2DQRA 2JT1A 1S6LA 1FBQA 2P5VA 4D0PA 4N9IA 4RGUA 4MQ9F 2IA2A 4LLLA 2K02A 3K0LA 3WGHA 4KA4A 2QQAA 3TO9A 4HZFA 3P7NA 5HS7A 2RKHA 4KIBA 2R3SA 1EH6A 3TO6A 4P9FA 2P6SA 2QVOA 5LGUA 2VOPA 4GXOA 4MGRA 1T2KA 1DPRA 3HRMA 3D0SA
chains in the Genus database with same CATH superfamily
2IPQX 2VBWA 1D0ZA 2GREA 2IGNA 2G0EA 1WSUA 1JB9A 4D9JA 5DD4A 5E3OA 1B23P 2HVQA 2CC2A 2EFQA 2E1NA 4DGWB 5J4YA 1WOOA 2VYQA 4FX0A 4XRMA 3OP1A 2BY0A 1O57A 3H3UA 4C3HJ 1ZREA 3MKZA 2NOGA 2GAUA 4KT6A 1REPC 1COWA 2JSCA 4AVZA 3REOA 4YIFA 5IT3A 3JCUC 3CUQA 2DA6A 2GJPA 2VNIA 3JRDA 3VMFA 1XQBA 3PVDA 5JFRA 2EFPA 2QLZA 4WXHA 4DBRA 2XGJA 5FKOA 1WRJA 1WWXA 2ZXJA 3FZVA 3BJOA 4JYKA 2DEUA 2DTZA 1LEBA 2CW0F 1I18A 4XORA 1VF9A 2DJIA 3AGPA 1T33A 1WCMJ 5DV5A 3RTRA 2BMWA 4UVBA 1IF1A 5IP9J 1FSEA 1V5GA 2UXNA 1D1AA 4Z4VA 4ZYDA 2JRTA 2UUZA 3LQ6A 2COBA 4KUMA 2Q1ZB 2XKPA 2FOKA 3MMYB 4FX4A 3ABTA 5KSWB 2HOEA 2ZCWA 1ETWA 2H1KA 1ZELA 3E6BA 1O7FA 3SEZA 5K1YA 3OYLA 1W0TA 1UD5A 2M5WA 2QCOA 1W9XA 4CCJA 4E7ZA 3FIWA 3PNTA 1N05A 2DK8A 2BEOA 4XKCA 5DCFA 5IYDJ 4OP7A 2W84A 3HSEA 4MFEA 3JU4A 2EZHA 2X85A 4YHBA 3MMPA 3OSFA 3GTJJ 4RCYA 2F5FA 3R60A 1AU7A 4Y17A 5LD2C 4CZZA 4JK1X 1VJSA 4RLZA 4KT5C 2R9VA 4BS9A 2R93J 3BLYA 2X3UA 3FISA 4XLAA 4LG3A 4KJZA 3CMAI 1LB2A 1ZKGA 3V8KA 4C3JJ 1W0JA 4KISA 2HR3A 2JA7J 3GO5A 5ERIA 3ECOA 5CKTA 3RY8A 2HDWA 5FROA 3ZMZA 2LNBA 4YIIA 4RDUA 4LG0B 2DMQA 3SEQA 4K1XA 5DDGA 2XZOA 3CLQA 3SJMA 1V5VA 2NS0A 2RC6A 3DEEA 2BVLA 2LY2A 3G05A 3CUQC 4MHGA 3CC7I 1W7PB 1FYLA 1U78A 2ADUA 3OMYA 2KZVA 2M7AA 3BTLA 1VF7A 1JUMA 1Z67A 1OYYA 1Z7LA 1R4MB 2P6TA 4ZTJA 4N3GA 4C30A 4G6QA 4G7OF 3I71A 1V0FA 3U9GA 3T8TA 1I1GA 3GVLA 2M2EA 1YE9A 1HKQA 3OYAA 4XIDA 2HZDA 4UVCA 3M1EA 3B82A 1BBYA 1PUFB 2W1OA 1ZGWA 1S9HA 5CVVA 2RQPA 1DP7P 4CYCB 4EQQA 4QFMA 2K5CA 3J7AY 2V6CA 1QZEA 1HCRA 2X6XA 2QGGA 4C43A 4XRSG 2BGCA 1TUIA 4PSWA 2HCJB 2DA2A 4O6JA 1AKHA 2LF7A 3FBIB 3NWTA 1D0XA 5K7ZA 1V5EA 2FX3A 2QBYA 2QKLB 4CCKA 4XLNF 4DNRB 3WTVC 4F93B 1SAXA 2V1DA 3GX4X 1FRNA 3WTSC 3TL4X 3VYRB 3OYIA 3Q0UA 1MNEA 3CF2A 4FCYA 2LY1A 2HFHA 4ASNA 4EJVA 3IRQA 5H6RA 1TT5B 2WAQA 2BXYA 4LD5A 1XC5A 3DXJF 3CJQB 1E2XA 2W00A 3H5AA 3VPRA 1YIJI 1MDMA 3IWZA 3KP5A 3BY2A 1P92A 1PKVA 2EZIA 1BX0A 3G73A 1HLVA 2Z6BD 5ICFA 3ONYA 2PE3A 1OMIA 4BE1A 1FNCA 2WJYA 3F8BA 1IW7F 3BZCA 3B8HA 4BE2A 3H1CA 3DBRB 4CQJA 4ZYGA 3ZBUA 2C6YA 2VBTA 1BI2A 1LUJB 2CMPA 3ZQGA 4OMYA 3QSYA 3CMYA 4QPOA 4IRIA 3R4KA 2WC2A 3WTXC 2PIAA 4RAFA 3L1PA 3LSIA 1UHWA 5EF6A 2F5EA 1R23A 4YFXF 3ZQFA 1FX7A 2HWVA 3M07A 4C2TA 4HE6A 2XAFA 1IRXA 1Z3YA 4S0HB 4B48A 4CZCA 5HNFA 3GWZA 1QA6A 2XNJA 3W2VA 1T95A 3V7SA 1YITI 3Q9VA 4KMUX 4AIJA 1DQUA 2VL8A 4L0YB 4HQEA 3KFWX 5EG0A 2QZ8A 4IHYA 3WTWC 2OQRA 1FIPA 2OA4A 3G6EB 2AXTC 3LVBA 3AAFA 2KIQA 5ICEA 3QOPA 1MDMB 1ORKA 2QSGX 4BEHA 3T53B 2V4JC 3CZ6A 4LIUA 1ZTRA 2JN6A 3PFIA 4TN1A 3RDIA 2XC7A 1HSJA 4G94A 4CYDA 4Q47A 2VNKA 2COMA 3K9TA 3AFHA 2JUGA 4LBYA 2XF6A 2V7TA 2OU2A 5L3DA 4ZZLA 4M0LA 3HSFA 4UV9A 2RC5A 3WGIA 3CCUI 1XGSA 4HRIA 2ECBA 1JTYA 4II3A 2IA1A 2QQBA 4KN4X 2VI6A 2DK5A 1IXCA 3K4NA 1HDPA 2H1LA 4DZPA 1N77A 2FA5A 4FN5A 3K1MA 4AIKA 4OOSA 5EG0B 3D26A 5F27A 1EP2B 2X48A 2VC0A 1BR2A 1ZR4A 4X6AJ 4PZJA 4BBRJ 2R5YA 2QEXB 4S05A 1BX1A 1ZM3A 3K4JA 4CCNA 1RC9A 5H59A 2BYVE 5FJ8J 2ELHA 3HPGA 1K83J 2P81A 3A0HC 3KYDB 3V7CA 2V7UA 1ITYA 1XMKA 3ZP5A 1ZG5A 2HLDA 1K61A 1F36A 2E5NA 3RPQA 4RBOA 4KFCA 4K2EA 2Q6LA 2HU9A 2BN4A 5HZAA 4LITA 2KJBA 2DIEA 4L9NA 4Y52J 2GZWA 1EV7A 3RZDJ 1HF0A 4WWVA 4XSZF 1Z6RA 4BQQA 2EILH 4WZLA 2RN7A 4X7CA 2W25A 4E7JA 5BMZA 2ISYA 2L7FP 3I53A 3OJXA 2DA1A 1XTAA 2GIVA 2K9NA 1N06A 3HHGA 1TLHB 3WODF 2KRFA 1GR1A 1W2BB 3E1YE 4ASUA 1VTNC 2BY2A 1Y0NA 3MFKA 1IDZA 3JQRA 4AIHA 3CP8A 4ACBA 3OS1A 2CQ7A 1T0FA 3V7RA 1A5JA 1R71A 1LDKB 4WXCA 1W1WE 5F4OA 2CFOA 4B44A 3GBGA 3CDHA 1VQMI 2EJRA 1Q9SA 4LK1F 3GQBA 2CO5A 4B8XA 1ZH5A 5M3MJ 3HTUA 3Q0VA 5CVUA 4PABA 1TTTA 4P1VA 4Y4RA 4L0ZB 4P6YA 5J8FA 5L3FA 2D74A 3ES9A 1TL8A 2DY1A 3BPXA 2L02A 4U0WA 1IRFA 1YQAA 1BJAA 3GFJA 1CGPA 2X1CA 2XAUA 4KIFA 3OYDA 2ISZA 2LOOA 2H8WA 3TDUC 1QFZA 1Y1VJ 1KQ9A 2OYNA 1KJZA 3K4LA 1GUUA 2IAIA 2ELJA 4RM2A 2XVCA 4A69C 3K70C 1F9NA 1KK2A 2K3PA 1ZGAA 3QQAA 2HDNB 5TRDA 4AWXB 4OWRB 4M6VA 4A6EA 4PUSA 2MLKA 1FOYA 4HX4A 1T39A 3OYHA 1OR7A 4XRFA 3BG7A 3OIQA 2FX0A 2ZNYA 5BQTA 4NHJA 3AVTA 4LK0F 1G3SA 2RC4A 2C5BA 5J8CA 5F1JA 4D1QA 1IC8A 2R7UA 1GJRA 3NARA 3ZQIA 1MGTA 3MKLA 1XCBA 2MW8A 3F9KA 1Y39A 4P25A 3LOCA 4B4CA 3OYFA 2BOLA 3U2QA 2ZXWH 3ZC3A 3KP3A 3CCMB 1OGJA 1N0UA 2VIXA 4MYTA 4G7XA 3K10A 1Z7UA 2GM4A 1G59A 3SDBA 1VQ6B 1KQSB 3PSFA 2OBSA 2CS3A 1FT9A 2MC4A 1XS9A 2GK6A 3F23A 4HX7A 1JUPA 3D5RC 2XGXA 4L5JA 4R8HA 3CCSI 4HDUA 1KK3A 3CF5F 1F5TA 2BGIA 5D6FA 4JP0A 5FGMA 1WOSA 3P27A 4I98B 3HPHA 4F55A 1O4XA 2LK2A 2HQAA 2VN2A 2XUBA 3HDDA 1QG0A 2MD0A 4A3DJ 4F91B 5C4XJ 5HXBA 3R0JA 2VPRA 4NUBA 4YAFA 4I6ZA 3VO2A 1BI0A 3OOPA 2M8EA 3ZCOA 4G1VA 3GIRA 5CVJA 4DQKA 1ETXA 1YJNB 4EJWA 4ESJA 4DQLA 1XX5A 2XROA 2NVYJ 3GZ5A 3K70D 3BJAA 4GO1A 4ZYHA 1OJLA 2DI3A 1FEXA 1LE8B 3O8GA 4WZTA 4OIOF 3BQYA 1E79A 1RQRA 1MSEC 5IYBJ 5KW9A 1RI7A 4PC6A 1FBSA 4QVJA 3ASSA 5DEQA 1WP6A 3U6BA 4HF2A 3RKYA 2ZJQF 3ZMUA 2OK8A 1SFEA 2E1BA 2ZJPF 4BGDA 3K7AJ 1SVLA 1BJZA 1KYZA 4EJUA 9ANTA 1TVCA 4RS8A 2YSRA 3GFMA 3QYBA 2ZBVA 3FMRA 5EJCA 2OC6A 2LVSA 3KYLA 1FBUA 1Y0UA 5K5RA 4LBVA 1A8PA 4BU2A 1IV8A 5ILVA 3C3WA 3DLAA 5DM6F 1K78A 3I4MJ 2W6IA 3FKIJ 3S17J 1Y1WJ 1MKMA 3PO2J 4Z4ZA 2E1RA 2X6OA 4YAWA 4ENNA 2D5VA 5DUIA 5EEHA 2H6CA 1CF7A 4IQ4A 3CC2B 5K7FA 4N9HA 3DKWA 2CV0A 1KK1A 3PIPF 4U9UA 1YJNI 2R7SA 1Z0XA 2JN9A 2OBRA 2WY7Q 1UD6A 1OFCX 1OCRH 2NS7A 4F3QA 4ANJA 2QMUA 2P7CB 4Z4RA 4M3GA 2D9RA 5LRRA 1IV6A 1T6SA 4XKBA 1JA1A 2JIZA 5F64A 4ZGQB 2R7DA 4EEFG 2OTJI 5LMZA 2AO9A 2M4GA 4G6DA 3A01A 2DODA 2BM1A 3F72A 4QWQA 1LFPA 2X0KA 2B9SA 1TWCJ 4A5NA 2GOMA 1QVUA 2VKDA 3HB9A 3VNVA 3WY9A 3CCLB 1GVDA 4RLFA 4HNVA 5DS9A 1TZLA 1IXSB 4I76A 4G5GA 3K4CA 4PJ0C 4P96A 1P2FA 3BNWA 2YWFA 4X8IA 4HV6A 4C3IJ 1Z1DA 1D5VA 4F7ZA 3T5XA 4PC2A 1OLTA 3C18A 5J47A 2KDOA 3E5XA 3E7LA 1U8RA 5HDKA 2W48A 4U7BA 3CCVI 1JNYA 1PYVA 3O2PE 3OWTA 4AYBA 3MCAA 3E6MA 4IEJA 5CVRA 1MSFC 3U21A 1VQOB 2RNJA 2RGVA 3JW4A 2LG4A 4CCMA 5HDNA 2DOFA 2Y75A 3G6EI 1NDHA 2V7QA 5E20A 4U87A 1LDJA 3HIFA 1LVAA 4R71A 1MD0A 2B0LA 1WORA 5A88A 2L01A 5J1UA 4N0BA 1WJBA 3CCMI 2AQEA 1Z91A 1QPIA 1P7IA 1SANA 2DA7A 2EIXA 2WV0A 3ZMTA 4L5EA 3CB4A 4L8JA 2EV0A 3QU3A 2PBIA 3HZJA 1NH3A 3S16J 2YU9J 3A3BA 3H94A 1MW7A 2ZKZA 1KC8D 4FISA 4C2MJ 4U7DA 3WNBA 4IX7A 2VJIA 3C1DA 1TQIA 2AHQA 2WBMA 3J7AO 2EB7A 4OMZA 2CUFA 5FIUA 3FBNB 1RIOH 2MSYA 2KRHA 3OKXA 4N3NA 1XSDA 2MH2A 3OFNA 3JRGA 5FNZA 3CCSB 4NNJA 1YW9A 2Z33A 2QBYB 4IZZA 3RI4A 5IOZA 3SZGA 2PJRA 2IP2A 1BM9A 1S5LC 3MN2A 3OS2A 4F7DA 1I27A 4V2FA 4KKUA 2DQLA 4HX8A 2F4OB 3VDXA 1K7AA 2FQ3A 1BC8C 2XGDA 3SZTA 1IRGA 2BSAA 3CJNA 4AIDA 5IK2A 2HDCA 2HXIA 2OCCH 4XN0A 4EV0A 2MYSA 1R1VA 3OYEA 2XRNA 4M53A 4NDLA 2LR8A 3CMMA 3OW7A 1OB5A 1SVMA 2W4SA 3M8EA 2X1EA 4WK8F 4OOXA 4OOVA 1XSXA 2F4MB 4C2UA 3CCRB 1E62A 3MAJA 3LSHA 2OTLB 1HQCA 2HI3A 4ZGNB 3QE2A 2KIMA 3S3NA 5EMNA 2VBXA 3VOEA 3J80Z 4RDKA 3CCYA 4FXUA 4BE0A 1I39A 2CFXA 3BR2A 5L3BA 1H89C 2C5HA 2IA0A 4MO7A 1D8KA 3H36A 2PJRB 2L7MP 2K4BA 2V79A 2WSSA 3HUGB 4YAOA 3LAPA 1I3QJ 1W4MA 4G6TB 1V0EA 1U9NA 1TW2A 3SFZA 3DPLC 2DMNA 3HGYA 1KZLA 3G71B 2BXZA 3KETA 4P2NA 4Z4TA 3ROUA 3BCFA 4UUSA 2P5LC 1KGSA 5JVGF 2NXNB 4Y33A 2OBTA 2JWTA 3ERMA 2DFIA 2Z5UA 1U6GA 4M9SA 1WOPA 1E17A 3H35A 1AOYA 3O6BB 1VQ4B 1OGIA 2LKXA 4WCGA 2A6TA 2HYFA 1J5YA 5FO0A 2M0MA 5DUKA 3FPPA 2EFOA 2ELKA 3GSIA 1ETQA 2IW5A 3IUOA 3E6DA 3BR3A 1MMGA 1KU2A 2YU3A 5EYRA 1VQ8B 4XKVA 2KIUA 3U6KA 1ZG1A 3P9KA 3IH2A 2D45A 1VNDA 2MGQA 4IRGA 4BNCA 5DM7F 4RD3A 4IJAA 4OPVA 2P5KA 3F8NA 5DS0A 1KZHA 1EJ9A 1HKTA 2H6BA 3K2ZA 1RQPA 4X07A 4ZC3A 1IB0A 3Q3AA 4CA0A 1J09A 5GPCA 3FX3A 5KNLA 3CW2A 1MRZA 2CUJA 1Z9CA 2DU9A 2WB1N 5C44J 3NAUA 4E7SA 3NE5B 1KD1D 1I5ZA 1XDUA 2DA3A 4XMYA 2R7OA 5E1WA 5KAFC 3JRCA 2OD5A 1N07A 4JQFA 1X4OA 2DW4A 1F43A 2E35A 3F8FA 4X1EA 3VB2A 2UXXA 1MBKA 3N97A 3IKTA 2ZL7A 5HZBA 1X1AA 2M87A 1UB9A 4HSRA 1Z21A 1LKXA 5EZGA 1XGMA 2ZJ2A 4W97A 3J81Z 3GZNB 5LGTA 2GJKA 3FJOA 3R61A 1M1KD 4J01A 3B02A 4MLOA 1B9MA 1VQPI 2JA8J 1UMKA 3PA1A 5FKKA 4OAZA 4EGZA 2DFEA 3QFCA 1PP8F 1IJFA 1JT0A 3KP4A 1YRNB 2FU4A 5D8LB 2ESHA 4MFDA 3P26A 1E64A 5IPAA 1B8IB 3I0TA 3J81K 4XQFA 4FETA 1D0YA 4U0YA 4CCLA 4X7EA 4DQ2A 3VFZA 3CMEI 4UUTA 3W5UA 2M3AA 3MKYB 2R7RA 5D5XB 1R4NB 4UUVA 3KYCB 4LOCA 1A36A 1Y8QB 5DCMA 5E3LA 5B1BH 5M5WJ 2PN6A 4P3IA 1S7OA 2YWEA 2WADA 4RD2A 5IY5H 2F5CA 4HA8A 1SFXA 2Y9ZA 2KHMA 3A1YA 4HYEA 2BVMA 3BR5A 4HIZA 3RSNA 2OZ6A 1DU6A 3EUKL 4RPBA 2ZSIB 2A68F 4M3DA 1ZHFA 2MH9A 4Y3OA 5HKKA 1YFHA 4RA2A 4BXFA 4A3MJ 2VQCA 3ZUGA 2STWA 4J0QA 1VQ9B 2L9SA 4IL6C 3CO7C 2PMDA 3KL9A 4CCOA 1KU7A 4XOTA 5F0CA 3HOTA 1GVJA 2M8GX 1GO2A 3I1FA 2I1LA 2DYRH 4RB3C 4UNOA 1U2RA 3H3VK 5JVTA 4X7DA 3ISPA 4LG0A 3Q6RA 3GW2A 4BHCA 3DDYA 5AIQA 4BBSJ 4XR6A 4NQWB 4UHTA 1SKYB 2V26A 3K1NA 2MBFA 1PUEE 1TWAJ 3FKJA 4KN7X 3ZZUA 4BXUA 1P4AA 2JPBA 2F1MA 3UNGC 3PNVA 1TP4A 3HAGA 2Q2EB 1WH5A 3CC2I 1V4RA 3Q6QA 1KONA 2PQ8A 1H0MA 3PQJA 3E1SA 2A61A 1UHMA 4IOAF 2Q8KA 3ABKH 1JJ2B 2EA2A 1NG7A 3PQKA 3VWBA 3PFYA 3BH4A 1TTYA 2H09A 4I7HA 3LA3A 1IN6A 2WZNA 4L9JA 3QFSA 3I64A 3GTKJ 1ZN2A 3S8PA 1KQ0A 1WJEA 4IOCF 3KEQA 3WHCA 2M4KA 2VODA 4LBWA 3TMOA 1LNWA 5L3GA 4BYYA 2ETHA 2M34A 1WH7A 3T1BA 1CNEA 1IUFA 4WQMA 5J35A 5E79C 4ETSA 3ZN1A 3K6GA 5L3EA 2GOXB 5E17F 4I99C 2XGCA 3OSGA 3LSTA 2EWNA 2HQRA 3IL2A 1W0KA 2KLOA 4TT3A 4ZCIA 5C3EJ 1MNMC 2Q0OA 3I5UA 4BKXA 2R7WA 4RAZA 1S29A 1QGPA 3TW7A 1VLYA 4B09A 1XMAA 4BY7J 5D5VB 3CCJI 2ZFWA 3SDGA 5HNHA 2Z9OA 4AVPA 4ESFA 2ZITA 2Z99A 1GT0C 5E8GA 2HKOA 4XLEA 3CTAA 1Z6TA 4I02A 4M3EA 3H5RA 5F6FA 5KAIC 4AC9A 4HE5A 2WWYA 3VSKA 1QU3A 2GA2A 1PJ5A 2CK3A 1SAUA 5GPAA 2R5ZB 2NYXA 2ACJA 2ZL6A 1BPLA 5CLSA 4A6DA 5TJJA 3ELKA 4KIGA 1WQ2A 1TW3A 2KRCA 4I09A 4MQVA 1OCOH 4A5MA 4GDFA 4CGZA 2X53S 1PJ6A 1D8TA 2LC2A 2GJRA 2IBDA 2O6GE 4XD7A 3BG5A 3RPUA 1X58A 2XGEA 5HS9A 3AVVA 1XFOA 1SKQA 4A3FJ 2MFZA 5IOYA 1T38A 1I6HJ 2FQ4A 1FNMA 2UV1A 5GTHC 4HOBA 3GZ6A 4LC0A 3SJPA 1MMAA 4A0YA 1V54H 2BW3B 4PCQA 3DKYA 2DJNA 4GRIA 4E7HA 2IS6A 4Z4YA 3OOUA 2FSWA 1YX2A 1VQ7I 2B7CA 2KKOA 4I0BA 4W1UA 5K5OA 3JQQA 4ENJA 2GLOA 4YXWA 1AMOA 3KZIC 1Y6IA 4EATA 3OEHA 4FE7A 1WPCA 4FWTA 2R7XA 1QVTA 2CW5A 1T0FC 3I55B 2HOAA 3DQVC 1RZ4A 1EXMA 1XGOA 3C2GA 1BR1A 1EH8A 1VFCA 1Y8RB 5KK1A 2Z3YA 4HSTA 3K4MA 1FTZA 5A8AA 4F92B 2ZZGA 3LSRA 4J00A 3RPUD 2F5DA 3W2EA 1MMNA 2Q2EA 4Z1MA 3IC7A 3IKVA 4KITB 4Y15A 1Q1VA 3BR6A 2K40A 3H5NA 3BG3A 5C4JJ 1YJ9I 3SZPA 2ZTGA 3F8MA 3DCFA 1QX4A 3CQZJ 5KCMA 3F6OA 1USTA 2JA6J 2OK7A 1R58A 1XSVA 1UELB 4JBAA 1BN5A 1FZPB 5HOOA 3MZHA 1X3ZB 3OYKA 1TNSA 4AUXA 4WWCA 3S2HJ 1RKWA 3TKYA 2M0CA 3JAMZ 1VQMB 1ACIA 3RYRA 1CNFA 3VO1A 2HPMA 5GTIC 5IYQA 4M6XA 1R1TA 1WHUA 2LF8A 2PMHA 2YX4A 1NK3P 3ULQB 3KLNA 1WTHD 5GADJ 3EUHC 2QUFA 4UV8A 2DFHA 3HG9A 4D7MA 1BMFA 2ZBUA 2RREA 2K4JA 1WU8A 1RR7A 2VKEA 3W2WA 3E0JB 4IXAA 5CVIA 2F1LA 2Y48A 4M71A 2QQ8A 4M1KA 2NPFA 4RM3A 5K7HA 5A89A 1W36D 1E3HA 2FD5A 1WJ5A 2K9SA 3K2AA 4M9XA 2IS2A 1IZ1A 5TR9A 1M90D 2YS9A 2V7FA 4BUPA 2Y2ZA 4EH1A 3LFKA 4X0GA 2VKHA 3L2QA 2FMLA 2ZBKA 2O7OA 3MD2A 3CCUB 2O3FA 1NJID 5B3SH 1U9OA 3LL7A 2DMUA 4N4NB 4P1WA 5EEGA 5BNGA 5LEJA 1SM4A 2AHOA 2JDIA 1QVFB 4PGOA 3ZMVA 1J9IA 1BOAA 5BSXA 1L0OC 3FK6A 3GYHX 3K69A 3FMQA 3LSMA 1EKEA 3DTEA 1VQ5B 1EP3B 1NB9A 3CCVB 5DYMA 3HL2A 4V19K 2QDXA 4P55A 3PENA 1VQ6I 5CQEA 2VT3A 3UR3C 4CO8A 3L2UA 2DFFA 2DTRA 2VE8A 2LKSA 3CD6I 2IGKA 4UB6C 2HGCA 2A5YB 3FHNA 3CPXA 4E7LA 2CUEA 2ZXIA 3WU0A 1BC7C 2WAQN 1FRQA 1SVOA 1FOKA 4LIVA 3IV5A 2VUMJ 1SD5A 4A3BJ 3OIPA 5F1RA 5B66C 3G2BA 5J4VA 2JVGA 3KEOA 2ZL5A 1LVKA 1B59A 2VXDA 2R7QA 3NRVA 2DCUA 5E6TA 3ZPLA 1IDYA 2A6HF 2O0YA 3V8LA 3JQPA 5E1XA 3GXOA 2VE9A 4XSXF 4UXNA 3EUHA 3Q5FA 3HOWJ 5FL7A 2YWHA 2O9LA 2EBIA 2VQGA 3ABUA 1HXDA 2ZMEB 5IYWA 4UZFA 2IRFG 4YAUA 4TMZA 1H8HA 3VSLA 3LQQA 4XM3A 1A6QA 3PNYA 2ZJRF 3ZZTA 1QGAA 2CQNA 1JKRC 3CCRI 3M9AA 1K78B 1Y0YA 3ISXA 5AN9A 1EA3A 1X1BA 1AWCA 3FXMA 4H9GA 2CU7A 2I5UA 1XG1A 4XKWA 5TISC 3CCQI 2KDZA 4BY1J 1NBMA 4LFUA 1HW2A 3KE2A 3AVYA 2WJVA 2E1OA 1EFUA 1SC7A 2EIKH 2GQQA 4ZDPA 4BHBA 5L3CA 2B7BA 3BP8A 5HS8A 1UJ8A 1XGNA 3V7AA 3KCCA 2DOAA 4Q48A 3GUDA 3FXJA 2DAOA 2E34A 4PJMA 3OYJA 4HW0A 4RLQA 1P4XA 4YELA 3ABMH 4JMQA 5D4SA 4IHVA 1JJ6C 4YIRX 1EH7A 1JTXA 2KT0A 2VB6A 4ROXA 3I58A 4Q4ZF 4XNFA 3DEWA 4GYGA 1JKQC 2FNPA 3EDPA 3P9IA 5IYPA 3H0GJ 4LMYA 3I56B 1O7LA 3FPKA 4UY8I 5HDGA 2A69F 3E97A 4Z4SA 1VZ0A 5EEAA 2W24A 4BJ6C 1LE8A 2BHZA 2KQRA 2HQ5A 3E20A 2R0QC 4XICA 1VQNB 3U2RA 1BOBA 3ERED 2FJ1A 3JRFA 1DDGA 3WBJA 4XL9A 4WX9A 2BY3A 1N08A 2Y69H 1QZZA 1S72B 3B6AA 1IGNA 1SD6A 1VQLI 1H8EA 3R6JA 4RGXA 1JJ8C 3Q3SA 5FLMJ 3SJZA 1AIPA 1WGXA 3S32A 3DU6A 1H42A 1VLOA 2CYYA 2L4AA 5HLTA 1KRHA 4IW3B 4ZCMA 3HOUJ 3O3KA 4Y13A 5J1YA 3WNCA 5KVRA 2LSOA 1KMHA 1BI3A 1YG2A 1D1CA 2ZXHA 1ETYA 2KIFA 2K3FA 1YYVA 2XAHA 3HC7A 3KEYA 5IYCJ 3AKZA 3VR6A 2DBBA 4UVAA 3ZMSA 1J0RA 4HLXA 3WG7H 2E60A 3CP2A 3W6KB 3S15J 2W82A 3ASNH 1W0UA 4OAYA 4QHYA 3QFRA 4P26A 2BF4A 5FKNA 2ZNZA 3NQOA 3GTMJ 3TOBA 2VQLA 1IJEA 1IO2A 1IRZA 3Q38A 1LFBA 3CC4B 2HQNA 2MABA 3OR2C 2K7LA 2OAZA 2GPJA 1Y56A 3PUNA 3EYYA 2FEZA 2V9VA 4KDPA 5FD6A 4QPQA 1TWFJ 2BPOA 4GGGA 2OTJB 1U0JA 2FBKA 3G4SI 4AYBN 5E3MA 2ZZEA 4BQAA 1VQLB 3GTPJ 3E5UA 2OV7A 4RGRA 2CJJA 2VC1A 2DMTA 3ASOH 4MTDA 4IO9F 1QVGB 3X2QH 4M6YA 1E3OC 4FT8A 5FA6A 5H5JA 3C7JA 3SLDA 2BV6A 2JQ7A 2R6HA 2XF7A 4X05A 3G1OA 3CCJB 1YJWB 2XF5A 4D5CA 3J7ZI 3ASTA 1I50J 4RD4A 1W7PD 1L3LA 1FYKA 1V5FA 2AQFA 3TP3A 4QSHA 5J6XA 3LNQA 3JRIA 3WU2C 2VXZA 3I59A 3JRAA 4ENMA 2UZKA 2CSOA 3SFIA 1V3FA 1X4PA 2R4GA 4I2OA 1RKTA 1F20A 1F60A 4B4DA 4N4OB 3S3OA 2M5SA 1G6NA 3I4PA 1VQ5I 3OYNA 2PG4A 4A12A 1EFTA 1HZEA 4TKOB 4HNTA 3GVKA 1NRKA 1GAWA 3U1KA 1J9ZA 2LMDA 4HBLA 4ZYAA 2O8KA 2VBUA 2JJ1A 5GV7A 1SFKA 2BGJA 1ULYA 5IT9K 3R0AA 2VBZA 2WY8Q 3VEPA 3W5VA 3CD6B 4IHWA 2QTZA 4U88A 1VHEA 1KQ8A 3CXCB 5H2FC 2HMAA 2ID3A 3I54A 4M4SA 1IN7A 1ETKA 3A8KA 4UZEA 5BOXA 3ZMDA 4ZDOA 2ZFUA 3BC8A 5BSYA 2XASA 1YRNA 3OJWA 1D2EA 1T6ZA 3BQZA 1X1PA 5IT9Z 1ONVA 2XPVA 3WHBA 2PFBA 4G7HF 2HVSA 3P9CA 4XLFA 4B47A 2QE7A 1MBFA 1FY7A 4RB0A 2I8DA 2K9QA 1X1CA 2QA4I 4O3MA 1IN8A 3OL4A 4GYIA 3DTIA 4AD9A 5DCMB 4FASD 2C77A 1TWHJ 3BCBA 3QYFA 2TDXA 5FLXZ 2OTLI 1GLNA 1OB0A 3HKZA 1K6YA 3QODA 1RUNA 3PJRA 2HOTA 3DF8A 1RUOA 3KP7A 5EZHA 4IPAA 1MIJA 2DT6A 3WYAA 2Q6KA 2H94A 3HYIA 4G8XA 4M72A 1YS6A 1QUEA 4ZDLA 2JK3A 2AS5F 1C0WA 1BA5A 4TMWA 3W6JB 1W36C 2VBVA 1OQYA 1VQ7B 3A35A 1MZBA 4M9ZA 1G2HA 3G71I 2ZZQA 2NNNA 2Z16A 3A02A 1MNDA 2HKXA 1X3WB 3LSGA 2H8RA 3EQLF 1YS7A 1BLIA 4PC7A 2Y30A 2XPWA 2R5ZA 5IYNA 1YJ9B 1LQ1A 4A3KJ 2D1HA 2DT7B 5D8KB 4E4HA 5LRSA 3GVAA 4EVIA 1HDDC 4CICA 4BXXJ 4RD0A 1S7AA 3F6VA 3MZ8A 2GXGA 2G7UA 1O3QA 4G12A 5FO5A 2P0WA 5J3LA 2YWGA 2DN0A 2XEXA 2CQXA 3E3VA 2C4TA 4FHTA 2QWWA 3GFLA 3DBHB 3CRZA 2W57A 4YRVA 4IKFA 3ZZ0A 2EH3A 1FMWA 3K1PA 4DOZA 2LTPA 4IQJA 1WJCA 3DWLE 2YPRA 3BY6A 5LHHA 1TNTA 4HAMA 3AVXA 1IHMA 1T6XA 4GQNA 4P9SA 4TV7A 2LY9A 1OPCA 2XZLA 2HS5A 2XHKA 5F4JA 4IVNA 2R5YB 3AL0C 1QQIA 3MVPA 4XN3A 3QPHA 2IT0A 4RM0A 1VI0A 3FXUA 3OYGA 1JKOC 3OOCA 5JLXA 2Q6OA 2ZTNA 1W7PA 4DIQA 1FTTA 4EGYA 1A31A 1DDNA 5THXA 1U3EM 2L5QA 3W2HA 2IGMA 3FM3A 5LFAA 1W5TA 4M74A 2HDDA 1E3PA 4RD1A 2EFWA 4G7ZF 3OW2B 4XBFA 5LHGA 1EP1B 3L2RA 1P9QC 1YHQB 4BACA 1H85A 3QP6A 1PDNC 5A2QK 2M7BA 3C2HA 2VZLA 3TDZC 5FFZA 1F1ZA 3L09A 4OOIA 4AC0A 1I3AA 4PJJA 2V6EA 4LBZA 3MQ0A 2NVUB 3IH3A 3S3MA 3WTUC 3QFTA 2EIMH 2RQQA 3IRRA 2IVMA 3ASPA 4ITVA 3JRHA 1PP7U 3OYBA 4BEHB 1D1BA 1K4TA 3DBLB 3FXRA 2CW7A 1I8DA 3HJEA 4NQWA 1QH0A 3L00A 4G1BA 2K85A 3VYTB 1R49A 2VT2A 3SYTA 4YG2F 3OIOA 1KTVA 1T08B 3BTIA 1GHCA 2KISA 2DPDA 4EM1A 2GXBA 1MBEA 4TMVA 1FNNA 1S3JA 1YIJB 2XB5A 5DSZA 4BJTA 1A35A 5F4MA 2M9HA 2BE5F 1YW8A 2AXLA 1XD7A 3BTJA 3SXYA 3ZQQA 2IJLA 3AG1H 4YFNF 2E2HJ 2F2EA 4KMFA 3RZOJ 5TV2A 4WF2A 1JE8A 3WG9A 2DA4A 4L18B 5CQGA 4JOMA 4RB2C 1WVRA 1YTYA 1UHSA 4FK8A 1IJWC 1ETOA 2F4IA 1SEUA 1Z05A 1W5SA 3SHFA 1R5NA 2XAGA 1YX3A 3KZYA 3W5HA 3BR1A 3GLLA 2L2OA 1ZM9A 4IHTA 1OCZH 5JHFA 3QWLA 1A6IA 3N05A 2GQFA 3MHPA 4ZH4F 1E1RA 3UKGA 1ZRFA 4LLGF 3GF2A 3RIRA 1D3YA 3MEXA 3LAJA 4P12A 4JX4A 2HTJA 2RDPA 2KL4A 1OCPA 3AG3H 1R5OA 4PFOA 3MKWB 3S14J 2PI0A 4TMXA 1YIOA 3DTKA 3HGGA 1FWZA 5J40A 3HOXJ 1UMQA 4FQGA 1GV2A 4DNCA 3S1QJ 3LNNA 1E3XA 2V9PA 2LYCA 1N25A 2QEXI 3GVJA 3OZWA 3G1MA 4MEXF 1NG6A 4BH9A 4RB1A 2L0KA 4ZV4A 2FF4A 2ESNA 1K6OA 1MBHA 4RGSA 1YHQI 5FD5A 4ENKA 1UG2A 1CF7B 1IXRC 2E71A 4LLNA 5E1ZB 3HKZN 3KP6A 3ZOBA 5H6QA 5D4RA 4KKTA 2W7NA 1E3ZA 1YW7A 4QLCU 3FF5A 1FLIA 4ZYEA 3M8JA 5JHUA 3OYMA 3B73A 2HOSA 4A3IJ 2VJJA 1BQEA 3MZYA 2BV3A 2OJED 3LWFA 1E0EA 1K73D 4RPDA 2E1MC 4O5VA 1PVEA 3ZQHA 3V76A 3AVWA 1OCTC 2DERA 3CMEB 2NNYA 1GV5A 2H27A 1MABA 1VHOA 2OPTA 2DYIA 4IRHA 1B2RA 3Q39A 3FXLA 3FM5A 1WSRA 2GXAA 1FNBA 1OKRA 1N78A 1ZUNB 5TGTA 2X51A 3GTOJ 5LGNA 1MJ9A 3A0BC 1TQPA 1FMVA 1D1NA 2EPFA 4QUZA 1LPQA 2CQKA 1JHFA 1RR8C 1Q1HA 3JSOA 3OEEA 1EFRA 4WXDA 1RETA 2ME0A 1U5TB 2ZZFA 3G4SB 1IN5A 5JI6A 3OY9A 3WTYC 2LRDA 4Z2YA 3ECHA 1QO0D 4BQNA 3EETA 1R00A 2QYOA 1FP2A 3ABLH 3VODA 4J19A 1YX5A 3WE2A 3F3XA 1K79A 1P4MA 4F52A 1FIAA 4A93J 2V1XA 1BL0A 4BQOA 4A3GJ 2FNAA 1WPKA 1VQ4I 3OPOA 2WPDA 2DOGA 1QHHD 3LSPA 3QAHA 1IUYA 1DARA 3BDDA 4I0AA 3OL3A 4AM3A 2E7WA 5D6EA 1WSVA 3PUMA 2OUMA 2CWEA 1U8BA 1OCCH 4XLCA 4D7NA 3PIOF 3BOQA 1MBJA 3MWMA 1VQPB 3GEZA 4A3CJ 3WTTC 5M5XJ 2KFDA 4AF6A 4JX6A 5DN6A 3C2BA 2PJPA 2TCTA 1ETVA 3JTHA 1VQOI 2R7VA 1Q81D 4RAGA 2XZPA 2O8XA 4BHPA 3CDLA 4XOPA 4IF4A 4FTHA 2PX9A 1GXQA 4PGGA 1GDTA 1T8IA 2GA1A 2B63J 1TQMA 2EV5A 1OISA 3SLNA 1DG1G 2DXIA 1SFOJ 1XN7A 3ZRGA 4MTEA 2PMUA 3W3CA 2E1MB 1CQTA 3H0DA 2RV8A 3H3ZA 4D5FA 3OR1C 1ELOA 4RDJA 4E0FA 1BR4A 4PK4A 3COAC 1QHGA 4EJOA 3A01B 2BW3A 4E70A 3A8JA 3EPZA 1IN4A 4LB6B 4NBQA 3BG6A 4Y9RA 2C4UA 1Q86D 2NVTJ 5FB2A 3GFIA 1NTCA 1X2MA 2J5OA 3BPVA 2D3LA 3CCEB 4RMNA 1SD4A 5IP7J 1OHHA 1FPQA 2OQGA 1HKSA 3HEFA 2B7EA 4DZJA 2F4NA 2M1BA 3TOAA 3GCMA 1BIBA 1USSA 2NAZA 3H92A 1S72I 4NB5A 1P4WA 3S93A 1W34A 1EFCA 5GV8A 3QU6A 3OE7A 3SKBA 1UD2A 4L9VA 5FRNA 3D5LA 4S04A 2NS8A 2P3MA 3LSJA 4YFKF 1FSHA 4G9YA 1RPWA 4X06A 2FE3A 3OV8A 2R7TA 4R1HA 1N8RD 1X2NA 3HRUA 3HRSA 1WJAA 2GK7A 1QNTA 3EYIA 3BJ6A 3HOYJ 4HDVA 2Y9YA 2NV4A 2KP6A 2ECCA 2QSFX 2HZTA 2QENA 1ZR2A 2CG4A 2NVXJ 2HPIA 4JX5A 2F5VA 3OZVA 3EUAA 3ZPNA 4HF0A 2GBYA 3M8FA 1RNLA 5FFXA 2WYRA 1U5TA 2VASA 1U2WA 3AG2H 2E1CA 1UAAA 1E1QA 5J3OA 3RQIA 3HBLA 3TP0A 4UAJA 3HTSB 3E6CC 2VNJA 1QGZA 1ZARA 4DYRA 5B5EC 2ICWG 4P5OA 1H9TA 2ZMEA 1KU9A 2K27A 3W2IA 3HSRA 3CLOA 2YR2A 2DO7A 2J5PA 3TBIA 1FOXA 2VOOA 5GAGJ 3TQNA 4CH7A 2R92J 4OU0A 1QGYA 3ZBTA 5E8IA 2WA0A 1ZLKA 1K9MD 2GIZA 4DBQA 1R7JA 5HLGA 5DD8A 3K4KA 5D5UB 2IS4A 1APLC 2DT5A 2CV2A 3F0CA 4V2GA 3A4CA 2DYSH 3BCAA 3ZIAA 5L46A 3F21A 1WZ2A 3WBKA 3RCOA 3V42A 2NRAC 1XE1A 2NVQJ 1G3WA 4OIRF 5FLVA 4BPRA 3ONQA 1E43A 2RVCA 4KNYA 4Y7CA 4HV5A 3R6SA 2C2WA 1XB2A 4P3YA 3W2AA 3T56B 3RQ4A 2WAEA 2J7KA 2BZTA 4XRSA 5IYRA 3U1DA 3PSIA 1YITB 2X4HA 3VYUB 2PMZA 5M5YJ 1HBXG 2LP0A 4BL0B 4X0CA 4G6IA 5LEKA 1JUSA 3CCLI 2L9NA 2MLGA 3QYEA 1F4KA 2VONA 2B5OA 3D5SC 3AG4H 1H88C 1HW1A 2VJ4A 4YEJA 1XB4A 2EV6A 3ZQ7A 2DOEA 2Y0SA 1HW5A 4A3JJ 5ILUA 2X9DA 2K86A 4B3XA 4A3LJ 2M45A 4DK1A 3LSKA 2MA3A 3I59B 2V1UA 3I4NJ 1D8JA 4ZTFA 4TMTA 2GWRA 4DJAA 4Z4WA 4PDKA 3PL8A 4EJTA 2L3DA 4CUGA 2EQRA 1P6RA 5CYVA 1G4DA 2LKPA 4NC7A 3QP5A 2Y0SN 3O8HA 1BI1A 3CUQB 3V4GA 3GTLJ 3T51B 3CDIA 4P9UA 2VNHA 1IG7A 3H9GA 1GVHA 2MG4A 3A1PA 2L7KA 4NCNA 1JGSA 1ZM4A 5FLXK 1DU0A 3A03A 3L9FA 3WU1B 4LJZF 3MCZA 2M30A 1POGA 2KVOA 5D5WB 3FMSA 3RKWA 4M2LA 2E7XA 3S1RJ 5F08A 3ZN0A 4OIQF 3GTQJ 2EIJH 4M73A 3Q9SA 4OINF 2TRTA 1BW6A 1GAQA 1R5BA 3LA2A 1T56A 2XDVA 1QFJA 3F22A 2O5RA 2IS1A 3I55I 1X3UA 1FX0A 2EFNA 3T8RA 4Y9UA 1R9TJ 3HUGA 3FHZA 3FWEA 1B4AA 2JPCA 3TEDA 2XV4S 4DK0A 1YOVB 2DCEA 2P8TA 2ZSHB 5JBQA 1I6XA 4IHSA 2FXAA 2XAQA 4XK4A 3LQEA 3JAMK 2W6JA 3CESA 3TO7A 1R5GA 3ZR8X 4UUSB 4TSFA 2XB0X 5CPRB 3WTZA 5ICCA 4BJ5C 1Q82D 5F04A 2QGUA 1ZGJA 2WB1A 4QTRA 1M1EB 2Y31A 4HG2A 1B8IA 3PM1A 1BW5A 3OZUA 1R5HA 1NB0A 5TY0A 1JT6A 2DA5A 3DFGA 1QPMA 1XPXA 3BZ6A 1CQXA 4P6VF 4PAAA 2RAEA 3FXKA 4B1RA 3SEJA 3FKSA 2HYJA 2O61A 5F0FA 1UZCA 5K5QA 2V31A 3SQNA 5E18F 5DTDA 5FRMA 2CBXA 3RKQA 3CC4I 3IH4A 2LREA 4R79A 4E7IA 1ZQ3P 2BVNA 4U0VA 1OYIA 3BR0A 4PSXA 4A0ZA 1O3SA 3J7YJ 5GAHJ 2ZMEC 1PJ7A 2LBFA 5GP9A 1R1UA 2FBHA 1FNDA 2X0LA 1UCRA 4KKSA 3DLLF 1DGRM 1ZRDA 4I01A 2A07F 4A0XA 1ZYRF 2KZGA 4XLPF 1FYMA 1DUXC 3BT9A 1I1SA 4RDLA 3WGGA 3J80K 1MMDA 3KP2A 2R7FA 3RKXA 5HLHA 3WNDA 1YI2B 3I56I 1X19A 1YLOA 3HOSA 2PEXA 2X6WA 4M3BA 5BPIA 3GLXA 2CNDA 1TWGJ 2I10A 1AKHB 3VYSB 2WTEA 2DETA 1JI8A 4KICA 4GCVA 4HEA2 1O3TA 3HOVJ 2X6YA 4ESBA 3L7WA 3PUBA 1JGGA 2EINH 2XIGA 3L2CA 1DGWY 2X8KA 4PC1A 2DMPA 3NWSA 3P5JA 5JR3A 2OBPA 5FKLA 1X1DA 4B43A 2K9MA 2D1VA 4X7FA 1AHDP 4KYWA 3L2VA 3WXMA 3ZQCA 3FK7A 5B6IA 2X1DA 1GXPA 4H0EA 1LFUP 3ONUA 1S8NA 2QF7A 2ZB9A 2XRLA 2XOKA 1QRYA 2L54A 4MIMA 2XSDC 1VQKB 2FUG2 4L9TA 2QM3A 3D1NI 2IXSA 3BROA 2Y0MA 3DPTA 2L7ZA 3JTGA 2E19A 2HEOA 1TBXA 6PAXA 4B3GA 1J2XA 3G3ZA 3CJRB 4CSWA 2QN6A 1DDIA 4WZEA 3ASQA 1B1BA 1Y0RA 1WKMA 3IWFA 2JUCA 4DW6A 2F6CA 2QA4B 1MBGA 3HOZJ 4L5IA 1XMXA 4Q7JB 1R5ID 2PLYA 2VBYA 3IAS2 3ZXSA 1Z77A 1VQNI 5LLQA 1VQKI 3LMMA 1FC3A 2PLFA 2XNDA 1MH4A 1B9NA 1WJDA 3PUFA 3HXLA 2ZC2A 5FKMA 4Z4UA 5F0HA 3WE3A 4BAYA 4HNUA 1TC3C 1SMYF 2E5ZA 4LB5A 2LD5A 3AL0B 3CMAB 1ODDA 2WAFA 3KZZA 2G9WA 3E5QA 1BIAA 4IHXA 1KK0A 2MC3A 3QPLA 4Y7NJ 1WFXA 3JREA 1JXSA 4C0SA 3DU5A 1G7TA 2FVGA 4DYCA 1J7KA 1UD3A 3LQRA 2CH0A 3JR9A 2WR8A 4XONA 1D5YA 1SMTA 5A2QZ 3BZKA 2DPUA 2LFBA 1QUFA 4Z6YA 3GMEA 1EF4A 1T98A 3CC7B 3PA2A 1H8AC 2V7WA 4CXFA 4NC8A 1R22A 2EK5A 5B1AH 4ZJZA 4B3FX 3S1NJ 1S7EA 4AU7A 4QVAA 2G7HA 1NHAA 2A3SA 4DNTB 2LBFB 3ASRA 2EA4A 5FO1A 3F8CA 1N75A 4OPOA 3B78A 2F43A 2WV1A 5CJ9A 1LJ9A 2FRHA 3KIOA 3M1CA 4RAYA 1ZLJA 4BDYA 2JJ7A 4GFBA 3CCQB 2ID6A 3H9QA 5BPDA 2N8GA 2VBSA 3QRFF 2A6EF 3H9NA 5H20A 2HXOA 3M3YJ 4AF7A 2O03A 1T6YA 2CRVA 4RJLA 5ED4A 4PC3A 2RNGA 2F48A 3KPHA 3OYCA 1FJLA 2BM0A 1G7CA 4MYUA 4BDZA 2LLKA 1STZA 2VJ5A 1FDRA 1OR7C 3V8JA 4WZKA 3BQJA 1ZK8A 1FP1D 3M7GA 1UD4A 1LEAA 5AONA 2XPUA 4UB8C 1WI9A 1H9GA 1LDDA 2FBIA 5KHDA 4Q5SF 5ILSA 3DEUA 1N0VC 1G3YA 1ZRCA 2BY1A 3CUOA 3DP7A 1ZG3A 1XDSA 2UWMA 3CPWB 4II2A 3LO8A 2D2WA 5ICGA 1G7SA 2XNCA 4CDGA 3CO6C 1HSTA 3BG9A 3IAM2 1J75A 2CGPA 1OYWA 2EZKA 1JA0A 3W2FA 2IGOA 2V1NA 1U5TC 2VLAA 3QPTA 2JA2A 2KMUA 2HVRA 3IP4B 4MEYF 1B72B 5J1RA 3ZGKA 4HF1A 3G1LA 1HA8A 2OCEA 2CW8A 2HTSA 2ME6A 5M3FJ 2JJ2A 4C9YA 2Z2SB 4B3AA 4G7WA 2JTVA 5HLIA 3LA7A 1QBJA 3W6VA 2QSHX 1S0UA 3H9JA 3S1MJ 2CV1A 1A04A 5HODA 2L4MA 1YO5C 1E63A 3BY1A 4OPSA 4HQMA 3JSPA 2V7XA 5JLWA 1UFMA 1W87A 5BS6A 2V4DA 3LFUA 2FMYA 1KA8A 3DPUA 3DKXA 3A3GA 3CJTB 1YI2I 1Z3XA 3N4MA 2PMZN 3S2DJ 1MJAA 3RJPA 3HHHA 1JKPC 1DP3A 1JHHA 1PJRA 1B72A 1UD8A 1ENHA 3HM5A 1W5CC 1NK2P 2P7VB 4MNUA 1HVXA 2QQ9A 3BTCA 2STTA 2JZYA 4A2UA 1K28D 1KU3A 1S4MA 2A05A 5LBQA 1T5EA 2JSPA 3HRTA 2OZUA 4EM0B 2WZPP 2D3NA 1AA7A 2VQHA 1FOWA 1MJBA 1ON2A 2KJCA 3I9V2 1XCVA 3I3LA 1O3RA 4ACAA 4RD6A 1K4SA 4ZCLA 5HVQC 5LHIA 1ZAOA 1YLFA 1W35A 3AGQA 3RYPA 1YJWI 2Q6IA 2QKMB 1P7JA 4PGHA 1I7PA 1K8AD 4FE4A 2BHYA 4EM2A 2DLLA 4XLHA 4CHUA 2EFGA 2V7VA 4UZUA 3KX2A 3B6CA 1OB2A 1IAWA 3T0YA 2MD5A 3TW6A 3TGNA 2JA5J 2YX7A 3BCDA 2BBYA 2XSJC 2DDBA 2JVHA 5E3NA 1VQ8I 3KEWA 4A3EJ 1G3TA 1TLLA 2P4WA 1ON1A 1G7RA 3FXQA 3ZQLA 1R36A 4DYQA 1B6AA 2ZO4A 1DPUA 3A8IA 1HA3A 1SFUA 1HC8A 3IHUA 2L9VA 2C78A 4ZZDA 2LH9A 2YUSA 4QV2A 3KLOA 1RESA 2QTLA 4P22A 2Z1DA 2EZLA 1QZYA 2HNHA 3L2WA 1G8XA 1J59A 4YALA 2HYGD 1V55H 2KPMA 4RCZA 2CUZA 1TT0A 2VKVA 4NC6A 3Q0WA 1HOMA 2VPLA 2NOJB 1R6RA 3A2KA 2DDAA 4M3FA 3GTGJ 3JRBA 4HLYA 4ON0A 2XKOA 4E6KG 1QFYA 4NBSA 2W85A 2LDUA 4OIPF 2E2JJ 4HPQA 4LGWA 1Q7YD 1MH3A 3ESWB 3S2WA 2XAJA 1UG0A 3BWGA 2OF7A 3DV8A 3QPSA 3NEUA 2L9RA 5AIPA 4EMSA 4PJLA 3R6KA 3AVUA 1WI3A 3W2GA 1KYWA 3WQZA 3ML6A 3VNUA 1SD7A 1ERDA 2DQRA 4PJNA 2JT1A 3FXOA 2CF4A 1S6LA 1FBQA 1WJFA 1RRJA 2P5VA 4D0PA 3PO3J 4N9IA 5EGOA 4RGUA 2LZJA 4MQ9F 2FOWA 2R7ZJ 2K9LA 2IA2A 3FDYA 3OAAA 4LLLA 4H4KC 2CRGA 1VQ9I 2IEKA 2K02A 1WDTA 2E2IJ 3BC9A 4E7KA 2CQQA 3K0LA 3WGHA 4KA4A 2QQAA 3QOEA 3TO9A 4PFPA 3OS0A 4HZFA 3P7NA 2JMWA 1BJKA 5HS7A 2RKHA 4QIWN 5GAEJ 3J81k 5EDNA 1ZM2A 1EWYA 2A5WA 5CDFA 4KIBA 2R3SA 1EH6A 3TO6A 3M4OJ 4ABZA 4P9FA 5IP6A 3CCEI 2P6SA 2QVOA 2V9KA 3K4BA 5LGUA 2JRMA 1PUFA 2VOPA 2E36A 4GXOA 4MGRA 1T2KA 1DPRA 5EGOB 1MMSA 4CYCA 3HRMA 3D0SA
chains in the Genus database with same CATH topology
2IPQX 2VBWA 1WSUA 5DD4A 2EFQA 2E1NA 4FX0A 3OP1A 3H3UA 1O57A 1ZREA 2GAUA 1REPC 2JSCA 3REOA 4YIFA 5IT3A 3CUQA 5JFRA 2EFPA 2QLZA 4WXHA 1WRJA 1WWXA 2ZXJA 3FZVA 3BJOA 1LEBA 2CW0F 5DV5A 3RTRA 4UVBA 1IF1A 1FSEA 2UXNA 4ZYDA 2JRTA 4KUMA 2XKPA 2FOKA 4FX4A 3ABTA 2HOEA 2ZCWA 3E6BA 5K1YA 1O7FA 2M5WA 1N05A 2DK8A 2BEOA 5DCFA 2W84A 3HSEA 2F5FA 3R60A 4Y17A 4CZZA 4JK1X 4KT5C 1LB2A 3V8KA 2HR3A 3GO5A 5ERIA 3ECOA 3ZMZA 2LNBA 4YIIA 4LG0B 5DDGA 2NS0A 3CUQC 4MHGA 1W7PB 1FYLA 1U78A 2ADUA 1OYYA 2P6TA 4G6QA 4G7OF 3I71A 3U9GA 3T8TA 1I1GA 1HKQA 4UVCA 3M1EA 1BBYA 5CVVA 2RQPA 1DP7P 4EQQA 2V6CA 2BGCA 4O6JA 2LF7A 2QBYA 4XLNF 3WTVC 1SAXA 2V1DA 3GX4X 3WTSC 2HFHA 4ASNA 4EJVA 3IRQA 5H6RA 4LD5A 3DXJF 1E2XA 1MDMA 3IWZA 3KP5A 1P92A 3G73A 5ICFA 1OMIA 3F8BA 1IW7F 4ZYGA 2C6YA 2VBTA 1BI2A 4OMYA 4IRIA 3R4KA 2WC2A 3WTXC 1UHWA 2F5EA 1R23A 4YFXF 1FX7A 2HWVA 2XAFA 3GWZA 3V7SA 3Q9VA 4KMUX 4AIJA 4L0YB 4HQEA 3KFWX 2QZ8A 3WTWC 2OQRA 2OA4A 3AAFA 5ICEA 3QOPA 1MDMB 3PFIA 3RDIA 1HSJA 4G94A 4CYDA 4Q47A 2COMA 3K9TA 2OU2A 5L3DA 4ZZLA 3HSFA 4UV9A 3WGIA 1XGSA 2IA1A 2QQBA 4KN4X 2DK5A 1IXCA 2FA5A 3K1MA 4AIKA 2VC0A 4PZJA 4S05A 2BYVE 2ELHA 3V7CA 1XMKA 3ZP5A 1ZG5A 3RPQA 4KFCA 4K2EA 2KJBA 4L9NA 2GZWA 1EV7A 4XSZF 1Z6RA 2RN7A 2W25A 5BMZA 2ISYA 3I53A 2GIVA 1N06A 3HHGA 1TLHB 3WODF 2KRFA 1VTNC 3MFKA 4AIHA 1T0FA 3V7RA 1LDKB 4WXCA 3CDHA 2EJRA 1Q9SA 4LK1F 2CO5A 4B8XA 1ZH5A 3HTUA 5CVUA 4L0ZB 5J8FA 5L3FA 3BPXA 2L02A 4U0WA 1IRFA 1YQAA 1BJAA 3GFJA 1CGPA 4KIFA 2ISZA 3TDUC 1KQ9A 2OYNA 2XVCA 1F9NA 1ZGAA 5TRDA 4AWXB 4A6EA 2MLKA 4HX4A 1T39A 1OR7A 4XRFA 2ZNYA 5BQTA 4NHJA 4LK0F 1G3SA 2RC4A 5J8CA 1MGTA 1XCBA 3KP3A 1Z7UA 1FT9A 3F23A 4HX7A 4R8HA 2XGXA 4L5JA 4HDUA 1F5TA 5D6FA 5FGMA 4I98B 2VN2A 2XUBA 3R0JA 1BI0A 3OOPA 2M8EA 5CVJA 4EJWA 4ESJA 2XROA 3GZ5A 3BJAA 4GO1A 4ZYHA 2DI3A 4OIOF 1RI7A 1FBSA 5DEQA 4HF2A 3RKYA 3ZMUA 1SFEA 1KYZA 4EJUA 4RS8A 2YSRA 3GFMA 3FMRA 1FBUA 1Y0UA 5K5RA 5ILVA 3C3WA 1K78A 1MKMA 4ENNA 5DUIA 5EEHA 2H6CA 1CF7A 4N9HA 3DKWA 2P7CB 5LRRA 1T6SA 5F64A 2R7DA 4G6DA 3F72A 4QWQA 2X0KA 4A5NA 1IXSB 4P96A 1P2FA 3BNWA 4HV6A 1Z1DA 1D5VA 4F7ZA 3T5XA 3C18A 3E5XA 1U8RA 5HDKA 4U7BA 3O2PE 3E6MA 5CVRA 2RNJA 2RGVA 3JW4A 5HDNA 2Y75A 5E20A 1LDJA 1LVAA 3HIFA 1MD0A 2B0LA 5A88A 2L01A 4N0BA 1Z91A 3ZMTA 2WV0A 2EV0A 3QU3A 2PBIA 2ZKZA 4U7DA 3C1DA 1TQIA 3J7AO 2EB7A 4OMZA 1RIOH 1XSDA 2MH2A 5FNZA 2QBYB 1YW9A 2Z33A 3RI4A 2IP2A 1BM9A 1I27A 2DQLA 4HX8A 1BC8C 1K7AA 2FQ3A 1IRGA 3SZTA 3CJNA 2HDCA 4EV0A 1R1VA 2XRNA 3M8EA 4WK8F 1XSXA 3MAJA 1HQCA 2KIMA 2VBXA 3VOEA 3J80Z 2CFXA 5L3BA 2IA0A 1D8KA 2K4BA 2V79A 3LAPA 1W4MA 1TW2A 3SFZA 3DPLC 3KETA 3ROUA 2P5LC 1KGSA 2DFIA 2Z5UA 1U6GA 4M9SA 1E17A 1AOYA 3O6BB 4WCGA 2HYFA 1J5YA 5FO0A 5DUKA 2EFOA 2IW5A 3E6DA 2YU3A 1KU2A 2KIUA 1ZG1A 3P9KA 2D45A 4BNCA 4IRGA 4IJAA 2P5KA 3F8NA 1HKTA 2H6BA 3K2ZA 3FX3A 1MRZA 1Z9CA 2DU9A 1I5ZA 1XDUA 1N07A 5E1WA 2OD5A 4JQFA 2DW4A 3VB2A 3F8FA 2UXXA 3N97A 3IKTA 2M87A 1UB9A 1XGMA 2ZJ2A 3J81Z 5LGTA 3R61A 3B02A 1B9MA 4EGZA 1PP8F 3KP4A 2FU4A 5D8LB 2ESHA 3I0TA 3J81K 4U0YA 4DQ2A 3VFZA 4UUVA 5D5XB 5DCMA 2PN6A 1S7OA 2F5CA 4HA8A 1SFXA 4HYEA 2OZ6A 2A68F 1ZHFA 2MH9A 1YFHA 3ZUGA 2STWA 3CO7C 1KU7A 3HOTA 1GVJA 2I1LA 4RB3C 4UNOA 5JVTA 3ISPA 4LG0A 3GW2A 4BHCA 5AIQA 4UHTA 3K1NA 2MBFA 1PUEE 4KN7X 4BXUA 1P4AA 2JPBA 1V4RA 2PQ8A 1H0MA 3PQJA 2A61A 1UHMA 2Q8KA 2EA2A 3PQKA 1TTYA 2H09A 4I7HA 3LA3A 1IN6A 4L9JA 3I64A 1ZN2A 1KQ0A 3KEQA 2VODA 1LNWA 5L3GA 4BYYA 2ETHA 3T1BA 4ETSA 3ZN1A 5L3EA 5E17F 3LSTA 2EWNA 2HQRA 3IL2A 2Q0OA 3I5UA 4RAZA 1S29A 1QGPA 4B09A 1XMAA 5D5VB 2ZFWA 2Z9OA 4AVPA 4ESFA 2Z99A 5E8GA 2HKOA 3CTAA 1Z6TA 4I02A 5F6FA 2WWYA 2GA2A 2NYXA 2ACJA 5CLSA 4A6DA 5TJJA 3ELKA 4KIGA 1WQ2A 1TW3A 4MQVA 4I09A 4A5MA 4CGZA 2O6GE 3RPUA 5HS9A 1T38A 4HOBA 3GZ6A 4A0YA 4PCQA 2FSWA 2KKOA 4I0BA 5K5OA 4ENJA 3DQVC 1RZ4A 1XGOA 1EH8A 5KK1A 2Z3YA 5A8AA 2F5DA 2Q2EA 3IC7A 3IKVA 4Y15A 3SZPA 3F8MA 3F6OA 1USTA 1R58A 1XSVA 4JBAA 1BN5A 1FZPB 5HOOA 3MZHA 1TNSA 4WWCA 3TKYA 3JAMZ 3RYRA 4M6XA 1R1TA 2LF8A 2PMHA 2YX4A 3ULQB 3KLNA 2QUFA 4UV8A 2K4JA 4IXAA 5CVIA 2Y48A 4M71A 5A89A 4M9XA 1IZ1A 3LFKA 2FMLA 2ZBKA 2O3FA 5LEJA 5EEGA 3ZMVA 1J9IA 1BOAA 1L0OC 3GYHX 3K69A 3FMQA 1NB9A 5DYMA 4P55A 2VT3A 4CO8A 2DTRA 2VE8A 2HGCA 2A5YB 3WU0A 1BC7C 1FOKA 1SD5A 5F1RA 3KEOA 1B59A 3NRVA 3ZPLA 2A6HF 3V8LA 2O0YA 5E1XA 3GXOA 2VE9A 4XSXF 4UXNA 3EUHA 3Q5FA 3ABUA 1HXDA 2ZMEB 4UZFA 2IRFG 3LQQA 3M9AA 1K78B 1AWCA 4LFUA 1HW2A 3KE2A 2GQQA 4BHBA 5L3CA 3BP8A 5HS8A 1XGNA 3KCCA 4Q48A 3GUDA 2DAOA 4HW0A 1P4XA 5D4SA 1EH7A 3I58A 4Q4ZF 4GYGA 2FNPA 3EDPA 3P9IA 4LMYA 1O7LA 5HDGA 2A69F 3E97A 2W24A 3U2RA 3ERED 4WX9A 1N08A 1QZZA 1SD6A 4RGXA 2CYYA 2L4AA 3O3KA 4Y13A 5KVRA 2LSOA 1BI3A 1YG2A 2KIFA 1YYVA 2XAHA 2DBBA 4UVAA 3ZMSA 1J0RA 4HLXA 3W6KB 2ZNZA 3NQOA 3TOBA 2HQNA 2K7LA 2OAZA 3EYYA 2FEZA 2V9VA 4KDPA 5FD6A 4GGGA 2FBKA 4BQAA 3E5UA 4RGRA 2VC1A 4MTDA 4M6YA 4FT8A 3C7JA 2BV6A 1W7PD 1L3LA 1FYKA 5J6XA 2VXZA 3I59A 4ENMA 2UZKA 2CSOA 4I2OA 1V3FA 1G6NA 3I4PA 2PG4A 4A12A 4HBLA 2VBUA 1ULYA 5IT9K 3R0AA 2VBZA 3VEPA 4U88A 1KQ8A 3I54A 1IN7A 4UZEA 5BOXA 3ZMDA 2XASA 1T6ZA 5IT9Z 1ONVA 2PFBA 4G7HF 3P9CA 4RB0A 1FY7A 4O3MA 1IN8A 4GYIA 4AD9A 5DCMB 2TDXA 5FLXZ 1RUNA 3DF8A 1RUOA 3KP7A 4IPAA 2H94A 3HYIA 4G8XA 4M72A 1YS6A 2AS5F 1C0WA 3W6JB 2VBVA 1MZBA 4M9ZA 2NNNA 2HKXA 3EQLF 1YS7A 1LQ1A 2D1HA 5D8KB 5LRSA 3GVAA 4EVIA 4CICA 1S7AA 3F6VA 1O3QA 2GXGA 2G7UA 5FO5A 3E3VA 4FHTA 2QWWA 3GFLA 2W57A 3K1PA 2YPRA 3BY6A 5LHHA 1TNTA 4HAMA 1T6XA 4TV7A 1OPCA 2HS5A 2XHKA 4IVNA 1QQIA 3QPHA 2IT0A 3FXUA 1W7PA 4EGYA 1DDNA 1U3EM 3FM3A 1W5TA 4M74A 2EFWA 4G7ZF 4XBFA 5LHGA 3QP6A 1PDNC 5A2QK 3TDZC 5FFZA 1F1ZA 4OOIA 3L09A 3MQ0A 3WTUC 3IRRA 2IVMA 1PP7U 3FXRA 4NQWA 3L00A 2VT2A 4YG2F 1GHCA 2DPDA 4EM1A 2GXBA 1FNNA 1S3JA 2BE5F 1YW8A 2AXLA 1XD7A 3SXYA 4YFNF 2IJLA 2F2EA 4KMFA 4WF2A 1JE8A 3WG9A 4L18B 4RB2C 1YTYA 1Z05A 1W5SA 3SHFA 2XAGA 3KZYA 4IHTA 4ZH4F 1ZRFA 4LLGF 3GF2A 3RIRA 1D3YA 3MEXA 3LAJA 2HTJA 2RDPA 2PI0A 1YIOA 1FWZA 4DNCA 4MEXF 4BH9A 4RB1A 2FF4A 1K6OA 2ESNA 4RGSA 5FD5A 4ENKA 1CF7B 1IXRC 4LLNA 5E1ZB 3KP6A 5H6QA 5D4RA 1YW7A 4QLCU 3FF5A 1FLIA 4ZYEA 5JHUA 3B73A 3MZYA 3LWFA 4O5VA 2NNYA 2H27A 4IRHA 3FM5A 1OKRA 5LGNA 1MJ9A 1TQPA 2CQKA 1JHFA 1Q1HA 3JSOA 4WXDA 1U5TB 1IN5A 5JI6A 3WTYC 4Z2YA 3ECHA 1QO0D 3EETA 1R00A 2QYOA 1FP2A 3VODA 1K79A 1P4MA 3WE2A 3F3XA 2V1XA 2FNAA 3QAHA 1IUYA 3BDDA 4I0AA 2E7WA 5D6EA 2CWEA 3BOQA 3MWMA 3GEZA 3WTTC 2PJPA 3JTHA 2O8XA 4BHPA 4IF4A 1GXQA 4PGGA 2GA1A 1TQMA 2EV5A 1XN7A 4MTEA 2PMUA 2RV8A 3H3ZA 3COAC 4EJOA 4E70A 1IN4A 4LB6B 5FB2A 3GFIA 2J5OA 3BPVA 1SD4A 1FPQA 2OQGA 1HKSA 2M1BA 3TOAA 1BIBA 1USSA 2NAZA 3H92A 4NB5A 1P4WA 3QU6A 4L9VA 3D5LA 4S04A 2P3MA 4YFKF 1FSHA 4G9YA 2FE3A 3OV8A 4R1HA 3HRUA 3HRSA 1QNTA 3EYIA 3BJ6A 4HDVA 2HZTA 2QENA 2CG4A 4HF0A 3M8FA 1RNLA 5FFXA 1U5TA 1U2WA 2E1CA 3HTSB 3E6CC 1ZARA 4P5OA 1H9TA 2ZMEA 1KU9A 2K27A 3CLOA 3HSRA 2YR2A 2DO7A 2J5PA 2VOOA 3TQNA 4OU0A 5E8IA 1ZLKA 5HLGA 1R7JA 5DD8A 5D5UB 2DT5A