5TRDA

Structure of rbkr (riboflavin kinase) from thermoplasma acidophilum determined in complex with ctp and its cognate dna operator
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
219
Chain Sequence
b'DQYYRAIKKIKEAAEASNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKRGQILNITEKGLDVLYTEFADLSRILAIKNNVVITGTVTSGMGEGRYYVARKQYIIQFQEKLGIIPYLGTLNIKVDQASLPELRKIRGFRGIHIEGFKTEDRTFGSVKAFPAKIQNIPCFVIMPERTVYTDVIEIISDKYLREEINLHDGDRVSVEVYTEGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Riboflavin kinase
molecule tags Transferase/dna
source organism Thermoplasma acidophilum
publication title Structure of RbkR (Riboflavin Kinase) from Thermoplasma acidophilum determined in complex with CTP and its cognate DNA operator
rcsb
total genus 70
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2016-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5trdA01
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5trdA02
1SFUA 1OR7A 3ZMTA 2HS5A 1RUOA 3MCZA 4MEYF 2FNPA 1L0OC 4HX8A 4LG0A 1UB9A 3PQKA 1WRJA 1BM9A 1FSEA 4BXUA 5LHHA 1XSDA 2JSCA 4I98B 3FM5A 5AIPA 2FNAA 2BE5F 5CVIA 1IAWA 1HW2A 2HR3A 5D8KB 3RPUA 3SFZA 3DF8A 4XRFA 3KETA 1J7KA 2XV4S 2COMA 1FP2A 2FBKA 2RV8A 2RKHA 5BPIA 5TRDA 3C3WA 1R5HA 2GA1A 2IT0A 2MA3A 3QPTA 1P92A 4GCVA 3K0LA 4KIBA 2VC0A 3I53A 5E18F 1W7PD 4G6DA 3V8LA 3FMSA 4OU0A 4BHPA 3WODF 2X0LA 4WXHA 2QZ8A 4PCQA 1YS7A 3CUQB 1HKSA 4EJOA 1H9GA 1RUNA 1S4MA 3GVAA 3TOBA 2DI3A 4KN7X 2VE8A 4LJZF 3GFMA 4OOIA 3F22A 3BZ6A 2AXLA 1FT9A 5KK1A 4M72A 3RJPA 3KEQA 4RAYA 5A89A 3PFIA 1GXQA 4Q5SF 3T8TA 4GYIA 5D5WB 1R1UA 1SD4A 2DU9A 2OAZA 2DLLA 2FRHA 1G4DA 2GA2A 2VBYA 3IC7A 3QP6A 5ICCA 1HW1A 2A61A 5E8GA 1ZRFA 4U0YA 3WGGA 2WV0A 4G7OF 5HS9A 4RGRA 2IJLA 2V6CA 2VOPA 1PUEE 2RN7A 4KIGA 3CDHA 1QBJA 5A88A 1IXSB 2DAOA 3HOTA 2WWYA 4G7ZF 3HIFA 2HYFA 1F5TA 1ZAOA 5CVJA 2P7VB 3KP4A 3N97A 4UNOA 2VC1A 4KN4X 5E20A 1TTYA 5LEJA 1FSHA 1BI1A 2P6TA 5DUIA 4LK1F 3AAFA 2WTEA 3I58A 4BYYA 1PP7U 3HSRA 4GXOA 1OKRA 1YYVA 3K2ZA 3LFKA 4GGGA 2VBSA 1F1ZA 1YO5C 3HRTA 1YTYA 2A69F 3C18A 1T39A 2F5CA 3E3VA 1BI2A 3EETA 3QU3A 1V3FA 2WC2A 3KE2A 3E97A 3V8JA 2PI0A 1OPCA 3FXRA 4MNUA 5DCFA 4ASNA 3DFGA 4L9JA 2ZFWA 5D8LB 3F8CA 1K78A 4O6JA 1WSUA 1T6SA 2VOOA 1LB2A 5BPDA 4Q48A 3ECOA 2AS5F 3DPLC 2HFHA 1KA8A 3KEOA 2K4JA 1H9TA 5JI6A 2BBYA 1QGPA 1LJ9A 2IA2A 3BROA 2EFWA 3IWZA 2MH2A 2KIFA 5AIQA 4HX4A 1KQ0A 1U5TC 3JW4A 3FM3A 3KZZA 5K1YA 3V4GA 2RDPA 2OQRA 4L5IA 2JZYA 2OYNA 1OMIA 4LMYA 4EJTA 1S7AA 2A68F 4MEXF 3J7AO 2K86A 1GXPA 3GF2A 4MTEA 5K5OA 3BJAA 1U5TA 2HYGD 3IL2A 3E6CC 3T8RA 2EFNA 2K4BA 2W84A 3RIRA 3BPXA 4MTDA 3R61A 1J0RA 3QRFF 1FLIA 3IKVA 5JVTA 3IKTA 2UZKA 1T2KA 1TQPA 4BHCA 1XMKA 1ZARA 2P5VA 4IPAA 2P5LC 1WKMA 4PGGA 2VT3A 1Z7UA 1IRFA 2IRFG 3E6MA 3JTHA 1UCRA 3GFIA 1LEBA 3F8FA 4MHGA 1RZ4A 5CVUA 4I02A 2JPBA 2JTVA 4ENJA 5FB2A 1KU3A 2MH9A 2BEOA 1OYWA 3FMQA 3ULQB 3IWFA 2D2WA 2LSOA 1BJAA 4MGRA 4L5JA 1D3YA 3VEPA 2HQNA 1IN4A 3GWZA 3F8MA 3WU1B 4HW0A 2YR2A 1YIOA 3ZMDA 3T0YA 1LNWA 2GZWA 4Y13A 2HQRA 1S3JA 5ED4A 3ZQ7A 2MLGA 3KCCA 3P9IA 1EV7A 4I2OA 1YG2A 3SQNA 3GZ5A 4M71A 2IP2A 5KVRA 5D6FA 1MZBA 3C1DA 2KJCA 5LHGA 4KA4A 3GZ6A 5L3CA 5F1RA 2I1LA 4EJWA 3BDDA 1K78B 4UV9A 1YW8A 5CYVA 2D1HA 3H3UA 1I1SA 2GQQA 1BIBA 3SXYA 3KZYA 3F8NA 3PQJA 1I27A 2FMYA 4BNCA 1BN5A 4I7HA 3V7RA 2O0YA 1NB9A 1ZRDA 2M30A 2P6SA 1QZYA 4HLYA 1VTNC 3KP6A 2A6HF 4ETSA 3V8KA 1ZG5A 4WXDA 5F6FA 1CF7A 4I09A 5HDNA 5BOXA 4L9VA 4HX7A 5F64A 4GO1A 4NHJA 3L2CA 3RKXA 2EV6A 3QOPA 4IHTA 2DQRA 3BP8A 3QPHA 3R0AA 1IZ1A 2L4MA 2EV5A 1T98A 1JHFA 2OU2A 4RB3C 2YSRA 1KQ9A 2D1VA 2EA2A 3BWGA 2BYVE 2YX4A 2Z3YA 4ZH4F 4O5VA 3HHGA 5D6EA 3QAHA 4R1HA 4ZYDA 4EJUA 2ZXJA 3VOEA 4KDPA 2STWA 1XSVA 1Z6RA 1SD6A 1N08A 2VODA 1J59A 3E5QA 4NB5A 3FXQA 2P3MA 3LSTA 4Q4ZF 1I5ZA 1S8NA 2GAUA 5ICEA 1W5TA 3GO5A 4I0BA 5HLHA 1ZN2A 2VN2A 4M9SA 1IW7F 2L4AA 3GXOA 3F6OA 1FBUA 3E6DA 4IXAA 3LQQA 1J9IA 4A6EA 2XIGA 2ZBKA 3KP5A 2X0KA 4ZZLA 2GXGA 2V79A 4RGSA 3HHHA 5CJ9A 4S04A 5ICFA 3TO6A 2F5DA 4N9HA 3M8FA 2RGVA 1GHCA 2V1DA 4O3MA 2QBYA 2OD5A 1KGSA 2F2EA 2EV0A 3ZUGA 5DEQA 3EDPA 3R0JA 3F21A 2Q2EA 2Z9OA 3ECHA 3BJOA 2R3SA 3WGHA 2XRNA 2R7FA 1B59A 1W4MA 5FO5A 5E1WA 2W57A 2Q0OA 1YQAA 1MDMA 1FNNA 5FFXA 5JHUA 5HS8A 1FWZA 4B8XA 2KRFA 3VODA 1IXCA 3IRQA 2XAQA 2VBZA 3JSPA 2HZTA 3G3ZA 2V1UA 2G9WA 1B6AA 3KP3A 1QPMA 5J8FA 4L0ZB 2E1CA 2GWRA 2XAHA 1ZHFA 3WTWC 1DPUA 5D4SA 3DEUA 1B9NA 1LVAA 2HTJA 2G7HA 4HDVA 3EYIA 1QQIA 2H27A 4FT8A 1SMYF 1X3UA 1DDNA 3RYPA 1KYZA 4KICA 4LG0B 5ILUA 5FFZA 2C6YA 5ERIA 3E5UA 1B9MA 2B0LA 1OYIA 2MLKA 2PG4A 2XVCA 5L3EA 1ZG1A 5DDGA 1FOKA 4YG2F 2XGXA 4UUVA 5HLGA 4H0EA 4WXCA 2CWEA 2PMHA 1FYLA 1MJAA 3WE3A 4AWXB 2DT5A 5IT9Z 4JBAA 2LF8A 2ZMEB 3I54A 4QLCU 2V1XA 4HYEA 4HQMA 3FWEA 4WWCA 2E7WA 3F8BA 2XHKA 3ERED 1BBYA 4U0WA 2F5FA 2A5YB 4UV8A 3FHZA 2DFIA 3OP1A 1IN6A 4NQWA 4U0VA 1QO0D 2ACJA 4G7HF 4UVBA 3TDUC 5FD6A 1P6RA 1MRZA 3WTUC 3ZMUA 4M6YA 2IA1A 3K1MA 1D8JA 5IT3A 1PP8F 4UZFA 3TOAA 2HOEA 3IRRA 1Q1HA 1HSJA 5HLIA 5HVQC 4KUMA 4LLNA 2MC3A 4RGXA 3LWFA 2OQGA 1IN7A 4IRHA 5J8CA 1U5TB 2OBPA 2ADUA 2ISYA 5LGTA 1IN8A 4OIOF 3COAC 5D4RA 5EEGA 3CUOA 1R36A 3ZMSA 3I59B 2MBFA 1RI7A 1Z91A 4WX9A 2OZ6A 3EUHA 4IF4A 4EVIA 1Y0UA 3HUGA 4Z2YA 5DD8A 1XCVA 3HSEA 1J2XA 3ZPLA 2BGCA 4EJVA 1O7LA 3M9AA 1IXRC 4S05A 2MD5A 4Y15A 1SD7A 4M73A 4HF0A 4Y17A 4AIHA 4HZFA 2Z99A 3JAMK 4WCGA 1R1TA 2UXXA 2EB7A 2FE3A 3NRVA 2EFPA 2QQ9A 4KT5C 5FLXK 1K6OA 2ZCWA 1DUXC 3H92A 3ML6A 3GFJA 5LGUA 5AONA 1TNTA 2EA4A 3DP7A 3E6BA 4MQ9F 2ESHA 2Z5UA 1XCBA 4FHTA 4HA8A 3REOA 1QZZA 3J80Z 5A2QK 1T38A 1ZG3A 1Z1DA 4EM1A 3O6BB 4ZZDA 1D8KA 3O3KA 4PZJA 3VFZA 4KFCA 2YU3A 2LDUA 1ONVA 3MZYA 2FXAA 2CO5A 3F23A 3KFWX 2DTRA 2R7DA 2ZMEA 4RS8A 4ESFA 2Y0MA 5H6RA 1BIAA 4WF2A 2X4HA 3ISPA 3I71A 1KU2A 1TW2A 1SMTA 3HTUA 3M7GA 4RGUA 3DXJF 3MEXA 1LQ1A 4LK0F 1MDMB 5K5RA 4A0YA 3V7CA 1G3SA 2EFOA 3CO6C 5LHIA 4ESJA 2VBWA 2CW0F 1FC3A 2HTSA 3WTTC 2GXBA 1V4RA 1HSTA 1R22A 3J81Z 4FX4A 2XKPA 3O2PE 3N4MA 2QWWA 4K2EA 4ENNA 2M1BA 2P5KA 4EGZA 2FSWA 1LEAA 3DPTA 1FZPB 3LA3A 2O03A 2XAGA 2VT2A 4P9UA 2CYYA 4HV6A 2QM3A 4LB6B 3WG9A 2FU4A 6PAXA 3BY6A 3D5LA 2UWMA 2O6GE 3Q9VA 3GW2A 3NQOA 4N9IA 5J6XA 1B1BA 3GFLA 3M8EA 4U7BA 2L02A 4U88A 4AIJA 1IUYA 1T0FA 4L18B 1XB4A 3GLXA 4OMYA 2Z33A 4I0AA 3LAPA 2JRTA 1Z6TA 2DPUA 2PJPA 1WI9A 4HOBA 4CO8A 2CFXA 1HKTA 4ENKA 2YPRA 3DQVC 1NHAA 1N05A 3WGIA 3CTAA 4MQVA 2VBVA 4XLPF 2NRAC 3HSFA 3ZMZA 1JXSA 3HRMA 2W24A 5BS6A 2BV6A 4CICA 1TNSA 3F6VA 2OA4A 3I64A 2NS0A 1CGPA 4M74A 2M45A 1TQIA 4LGWA 3V7SA 3RYRA 3P9KA 2H94A 1FYKA 1USTA 1ZGAA 1ZRCA 1P2FA 2EWNA 4CHUA 3GYHX 1XGSA 4A12A 2EFQA 2XAJA 2W85A 1O3TA 3U2RA 1XDUA 1FPQA 3VB2A 1BC7C 3TQNA 1HBXG 5LLQA 2CSOA 3MQ0A 3WU0A 3W6JB 1B4AA 3R6SA 1T6XA 2QBYB 2H6BA 5L3FA 1KU7A 4N0BA 1J5YA 2F5EA 3FZVA 3I59A 3K9TA 1JE8A 4G8XA 2QQBA 2XUBA 1U78A 3SZTA 3JAMZ 3ZP5A 1C0WA 2H09A 4HF2A 5D5XB 4HBLA 1RNLA 4A6DA 3ZN0A 2EK5A 5FO1A 1HKQA 3P9CA 2QQAA 3MFKA 4UVCA 4EGYA 1LDJA 2ZNZA 4UXNA 1PDNC 2JT1A 5LEKA 1YW9A 1JGSA 4CDGA 2Y75A 1N07A 5JR3A 2CGPA 5LGNA 4F7ZA 4IJAA 3QU6A 2DO7A 3MAJA 4BQAA 2ZNYA 5IT9K 2FBHA 3WTZA 4YFXF 5FO0A 2ETHA 4KMUX 5L3GA 5E1XA 2O8XA 1HQCA 1MGTA 1FP1D 1Z05A 2P4WA 1YFHA 3EQLF 3IHUA 3OOPA 1G3WA 2E1NA 3MZHA 3K1PA 1W5SA 3TKYA 4XBFA 4HV5A 2DK8A 4HQEA 3CLOA 5LRSA 1IRGA 3GUDA 4PGHA 2KIMA 5H6QA 1MKMA 3LA2A 1L3LA 3P7NA 1F4KA 3WTXC 2W25A 2QUFA 4RB0A 1Z9CA 1OYYA 3WTVC 5E17F 1TW3A 4A2UA 1U6GA 2DW4A 1XSXA 2M87A 5L3DA 4IRIA 4G9YA 1O7FA 2FBIA 5CVVA 4HLXA 3JTGA 1XGNA 1ON1A 4YIFA 4P55A 5HS7A 1EH7A 2EJRA 3C7JA 2UXNA 3WTYC 1XMAA 3SHFA 3D0SA 3LA7A 1NB0A 4AIKA 5ICGA 4ON0A 1O3SA 3RDIA 1G6NA 3I0TA 1H0MA 1GVJA 2ESNA 1F9NA 1RIOH 3S2WA 5ILVA 5DYMA 2IW5A 1O57A 1ZLKA 4UHTA 4LD5A 2QENA 1N06A 2RVCA 1SFXA 4WK8F 4DNCA 5CLSA 1LDDA 1SD5A 1MJ9A 3HRSA 4A5MA 4EM2A 2A6EF 4QWQA 4M6XA 2ZKZA 1U3EM 2VONA 4TV7A 4YFKF 2PLYA 1UHMA 2FMLA 1R5GA 1T6ZA 4ESBA 2M5WA 5ILSA 3HTSB 1AWCA 4G94A 3TO9A 4A0ZA 1G3YA 1FBSA 2J5PA 4OIPF 4BH9A 3GEZA 2Y48A 2L54A 3RKYA 4EQQA 1R58A 4OIRF 1HXDA 2M8EA 4HF1A 3RI4A 3KLOA 1BI3A 4RB2C 5CVRA 3L9FA 5DCMA 2NNNA 3BJ6A 3HYIA 2VBTA 5FGMA 1FYMA 1ZYRF 3T5XA 4YIIA 1ON2A 2P7CB 5DD4A 2A3SA 4XSXF 1YLFA 5DV5A 2A07F 1FBQA 4E70A 4FX0A 2E7XA 3WTSC 3ZMVA 1LDKB 4ZYGA 1O3QA 2KKOA 1E2XA 2ELHA 4U7DA 4EV0A 1UHWA 4DQ2A 1WQ2A 2O61A 1I6XA 4HDUA 3RKWA 4A0XA 3RTRA 2STTA 2PEXA 4YFNF 5L3BA 1REPC 1G3TA 1SFEA 3H3ZA 1DP7P 4EM0B 2Q8KA 3EYYA 4LFUA 3GX4X 1STZA 2O3FA 1QNTA 2H6CA 4ZYEA 2FA5A 1ZGJA 3FMRA 5E1ZB 2XKOA 2XASA 2LNBA 4A5NA 2CG4A 1TQMA 1D5VA 1USSA 2VBUA 5A8AA 2HGCA 2HEOA 4Q47A 1XGMA 2QLZA 4GYGA 4RAZA 2HKXA 4R79A 2ISZA 1P4WA 2PFBA 3TGNA 1XGOA 1W7PA 4AD9A 2LKPA 3F3XA 2DK5A 4LLLA 1W7PB 1R00A 5BQTA 3J81K 2JPCA 2NNYA 4CYDA 5LRRA 4ZYHA 2L3DA 3U9GA 1S29A 2K7LA 1ZLJA 1DPRA 3B02A 4XLNF 3MWMA 2RQPA 3FF5A 4LLGF 4CZZA 3F72A 4G6QA 1SAXA 3RPQA 1P4MA 5FNZA 3L7WA 2FEZA 2RNJA 3FX3A 3E5XA 1XDSA 2ZJ2A 3CUQC 1UFMA 3L00A 3TO7A 3HRUA 4L0YB 4P9FA 1TLHB 1KYWA 2DQLA 1ULYA 2FF4A 2NYXA 5FLXZ 4ENMA 4M9ZA 3BOQA 3R4KA 4KYWA 1ZREA 4KIFA 2K27A 4P5OA 2OZUA 4OINF 4CXFA 3T1BA 3KLNA 2CQKA 2KJBA 3CO7C 4OIQF 2FQ3A 2XROA 3ELKA 3K1NA 3ABTA 4L9TA 2P8TA 1K7AA 2V9VA 2HKOA 1KQ8A 3KP2A 1E17A 3ROUA 3L09A 3CJNA 3M1EA 5JFRA 3CUQA 3U1DA 1S6LA 2PQ8A 5E8IA 4UZEA 5HDKA 3B73A 4IRGA 2DBBA 1ZH5A 2NAZA 2TDXA 3Q5FA 2HDCA 2GIVA 2XAFA 1EH6A 3W6KB 5D5VB 4L9NA 4I01A 3OV8A 1Q9SA 5K5QA 3LAJA 1IN5A 1S7OA 4P96A 2VE9A 2QYOA 4UVAA 2J5OA 1K79A 4B09A 4LB5A 5H20A 3WE2A 2FOKA 4JQFA 5DUKA 3NEUA 1J75A 1AOYA 4OMZA 4BAYA 1XD7A 4XSZF 5HDGA 1HW5A 2PN6A 3ABUA 4M9XA 1P4AA 2IVMA 1R23A 4KNYA 4PDKA 1MJBA 2ZO4A 1U8RA 3ZN1A 3SZPA 4IVNA 1R1VA 3HOSA 1JHHA 1R7JA 2VXZA 5TJJA 4HAMA 1XN7A 3FXUA 2QVOA 1FX7A 1CF7B 4R8HA 3J80K 3TDZC 4EMSA 3BPVA 2RC4A 4RB1A 1A04A 4IHSA 2K02A 2L01A 3I4PA 1BC8C 2IPQX 2HWVA 3I5UA 2D45A 2KIUA 2LF7A 3KP7A 1BOAA 1P4XA 5EEHA 1ODDA 1MD0A 4D0PA 5DCMB 1I1GA 2PBIA 1YS6A 5LBQA 1O3RA 3Q9SA 3BNWA 1IF1A 5D5UB 2DPDA 1FY7A 1WWXA 3DV8A 2PMUA 5BMZA 1U2WA 1TBXA 4BHBA 4JK1X 3K69A 5A2QZ 3G73A 4KMFA 5HOOA 3LQRA 4AVPA 3R60A 3QP5A 1BI0A 5FD5A 4CGZA 2G7UA 2VBXA 1YW7A 2YX7A 3DKWA 3JSOA 1KU9A 2IA0A 1T6YA 1EH8A
chains in the Genus database with same CATH superfamily
2QQ8A 4C3JJ 2QEXB 2OCCH 1QX4A 1Z3XA 2K85A 1SFUA 2ZSIB 1OR7A 4XN3A 3ZMTA 2HS5A 1RUOA 3HJEA 3MCZA 4MEYF 2FNPA 1SANA 1L0OC 4HX8A 1YRNB 4LG0A 1UB9A 3PQKA 4WZEA 1WRJA 1BM9A 1FSEA 4BXUA 5LHHA 2QE7A 2Z16A 5FLMJ 1FNCA 3GVKA 1XSDA 3GTGJ 2LREA 2V7FA 1FRQA 1N75A 2JSCA 2ZZEA 4B48A 4I98B 3CCSI 2CFOA 3FM5A 4A3DJ 5AIPA 4YEJA 3S1RJ 2FNAA 2BE5F 1Z77A 5CVIA 4RCZA 4MIMA 1XTAA 2OTJB 1IAWA 3A1YA 2B5OA 1HW2A 1BQEA 4ITVA 4JX4A 4AVZA 2HR3A 5D8KB 3RPUA 1JKRC 3SFZA 2YWGA 3ZRGA 3DF8A 4CYCB 4XRFA 4GDFA 1WI3A 3G4SB 5HZBA 3KETA 1J7KA 1Y1WJ 2XV4S 3BR2A 5HNHA 2COMA 3J7ZI 1FP2A 2FBKA 2KZVA 2LKSA 2RV8A 3PVDA 2RKHA 2XNDA 5BPIA 5TRDA 3C3WA 3MVPA 4G1BA 1R5HA 2K9QA 2GA1A 3SDBA 2PLFA 2IT0A 1BW5A 2MA3A 3QPTA 1P92A 2XF6A 4GCVA 3K0LA 4B1RA 4KIBA 2DMUA 2VC0A 3I53A 3KYCB 4X6AJ 1TWHJ 5E18F 3BCAA 3DEWA 3VO2A 1W7PD 2FJ1A 3AG4H 4G6DA 2HLDA 1KMHA 3V8LA 1GVHA 3FMSA 1VI0A 3LOCA 3NWSA 3ISXA 4OU0A 2ZFUA 4IZZA 1VLYA 4BHPA 2M4GA 3WODF 4G6TB 2X0LA 1YI2I 3H3VK 3BR0A 1H8AC 2JVGA 2X51A 4OPVA 4WXHA 4XM3A 2QZ8A 2LYCA 4PCQA 2R7XA 4CCJA 3WXMA 1YS7A 2Z2SB 3B82A 3OZUA 3OY9A 2EFGA 2XZOA 3CUQB 2LP0A 4BKXA 1HKSA 2Y69H 4EJOA 5E3MA 1H9GA 1RUNA 3L2WA 2D3NA 1B72A 1OCZH 1LFBA 3GVAA 1S4MA 3TOBA 1P9QC 1QVGB 2DI3A 2CQQA 4KN7X 5DS9A 2VE8A 1YIJB 4LJZF 2NVTJ 3GFMA 2OBSA 4OOIA 1FTTA 1I18A 3F22A 3CCUI 4LBYA 3FXKA 4P2NA 3VPRA 1NG7A 3BZ6A 2AXLA 1FT9A 2COBA 2JUCA 4HPQA 5KK1A 4M72A 3RJPA 1D1CA 1SVOA 4RJLA 3KEQA 4BQNA 4RAYA 3S16J 1OFCX 5A89A 3PFIA 2KLOA 1WJCA 4X7CA 2P0WA 1GXQA 2UV1A 2O9LA 4Q5SF 1IRXA 2YUSA 1QFZA 2X48A 3T8TA 4GYIA 5D5WB 2C5BA 3OEHA 4X0GA 1R1UA 1SD4A 3FBNB 2DU9A 2OAZA 1BX1A 1JJ2B 3LSGA 2DLLA 2WAQA 2FRHA 2KISA 1G4DA 2GA2A 2EIJH 2VBYA 2XPVA 3JRBA 3I1FA 3IC7A 3ESWB 3KPHA 1G7CA 2YWHA 3QP6A 3KL9A 3R6JA 3I9V2 4DZJA 2NOJB 1B8IB 3HOUJ 3CCJB 1OR7C 3OL4A 5ICCA 2GJKA 1HW1A 2A61A 5E8GA 4YALA 5GAHJ 4U0YA 4XKCA 1ZRFA 3WGGA 2WV0A 4G7OF 5HS9A 2E36A 1KRHA 4RGRA 2GOMA 2IJLA 2V6CA 2VOPA 3H9QA 1R5BA 1PUEE 1G59A 3A3GA 1ZM9A 2RN7A 4KIGA 3CDHA 1V5EA 2HQAA 2ME6A 3JREA 1D2EA 1TWFJ 2DYSH 4IW3B 3MN2A 1JKPC 1QBJA 2VJJA 5EG0A 1G8XA 5A88A 1IXSB 3Q0UA 4C43A 2DAOA 3HOTA 2WWYA 4G7ZF 3HIFA 2HYFA 1F5TA 3ONUA 4PSWA 1ZAOA 3LSPA 2QN6A 2EZHA 5CVJA 3CLQA 1DU6A 3LFUA 1J09A 3HOWJ 2WPDA 2P7VB 4PC1A 2ZXIA 3KP4A 3O8HA 3N97A 4UNOA 3LSJA 3MKLA 2JJ1A 3WG7H 4Y7CA 1X1BA 2VC1A 1QVFB 4DOZA 2Z6BD 4KN4X 5E20A 1TTYA 3MZ8A 5FRMA 1OCOH 2E19A 5LEJA 3OW2B 1NG6A 4KITB 2V26A 1FSHA 5F08A 1ITYA 3RZDJ 3G2BA 1BI1A 1SM4A 1XMXA 3W2HA 1S7EA 3PM1A 2P6TA 4DBRA 5DUIA 4LK1F 3AAFA 4DK0A 1IJFA 3L2UA 2WTEA 5JBQA 2CJJA 2HOTA 2R7WA 1MMGA 2WY8Q 1TLLA 1VF9A 3I58A 4BYYA 2F43A 1D1BA 2H1LA 5CDFA 4XICA 1FNDA 2CW5A 1PP7U 3HSRA 4GXOA 3A8IA 1OKRA 1YYVA 1GAWA 5B1AH 2K9MA 3K2ZA 4M3FA 4BJ5C 3LFKA 4CCOA 2LD5A 4GGGA 2Y30A 2VBSA 5IPAA 1F1ZA 1YO5C 3GIRA 4ZGNB 3HRTA 1YTYA 2V7QA 3U21A 2A69F 3C18A 1A8PA 3HEFA 1T39A 1W1WE 2XZLA 1DDGA 3PNTA 1RQRA 2F5CA 3OMYA 4DNRB 3E3VA 1BI2A 1PJRA 3EETA 3QU3A 1V3FA 2WC2A 2F4MB 3E97A 2WAEA 3KE2A 3V8JA 4D1QA 4RCYA 1OB5A 2PI0A 5B6IA 2EZKA 1K9MD 3Q3SA 1OPCA 3FXRA 4MNUA 5DCFA 3A01A 4ASNA 3DFGA 4L9JA 2ZFWA 5D8LB 3F8CA 4BQOA 1K78A 5HZAA 2FD5A 4O6JA 2CRVA 3ES9A 1WSUA 3I4MJ 1T6SA 1I6HJ 1O4XA 3AG3H 2VOOA 1LB2A 5B66C 2DA7A 2VNJA 2HI3A 4BBSJ 5BPDA 1HCRA 4XLFA 4KISA 4Q48A 1QGAA 3WQZA 1Y39A 3DCFA 3BG9A 3QODA 1E3HA 3ECOA 1GO2A 4ROXA 2AS5F 3DPLC 2HFHA 1KA8A 1HDDC 3QPSA 3HZJA 3VSLA 3KEOA 3PSFA 4Z4YA 2K4JA 2RAEA 3OIPA 5JI6A 2X1DA 1H9TA 2BBYA 5FKNA 1MBHA 3I3LA 1QGPA 3QE2A 1YE9A 4FE4A 1LJ9A 2IA2A 2WADA 5JVGF 3W2AA 3BROA 2EFWA 3IWZA 1IHMA 1SKQA 2MH2A 2KIFA 3ZCOA 3KEWA 5AIQA 1MIJA 4HX4A 1KQ0A 1DP3A 4HG2A 4FCYA 2B63J 2GJPA 1JUSA 3OOCA 2DOGA 2WBMA 2BPOA 1U5TC 3JW4A 1GV2A 3FM3A 3KZZA 5K1YA 2YWFA 4MFEA 3V4GA 2W1OA 2RDPA 3T51B 2E34A 2OQRA 2VNIA 5GAEJ 4XRMA 4RDJA 1MBJA 4L5IA 2E1BA 3PSIA 3VYRB 1ORKA 3S1NJ 1G2HA 2JZYA 2OYNA 3HB9A 2ECCA 1OMIA 1VQ9I 1SFKA 3BZCA 3NAUA 4LMYA 1JUPA 4EJTA 1DQUA 1S7AA 1VQ9B 2CW7A 2A68F 4MEXF 3J7AO 3BR1A 2K86A 3CESA 2PE3A 5IP9J 2X8KA 1GXPA 2EINH 3GF2A 4MTEA 3HL2A 3EPZA 1R6RA 5K5OA 5FLVA 2ZL6A 4BJ6C 2WB1A 2DFHA 3BJAA 1U5TA 2E60A 3BTCA 4II3A 1AKHB 1Q82D 1RESA 2HYGD 3IL2A 4X7DA 4GFBA 2B9SA 3E6CC 1RKWA 2F1LA 3T8RA 3GCMA 2EFNA 2K4BA 3IH3A 4RAGA 2W84A 3RIRA 1W0TA 3BPXA 2DCUA 3KEYA 3VNUA 4MTDA 1KC8D 3R61A 4QSHA 3FXMA 3W2VA 4PAAA 1J0RA 2NXNB 1X1CA 2XSDC 3K4KA 3PUNA 1YJ9B 1MSFC 1BX0A 3QRFF 2F4NA 4MYTA 3CCMB 1FLIA 3D1NI 2ZTGA 3IKVA 5JVTA 3IKTA 2UZKA 3CB4A 4P1VA 1T2KA 5HXBA 3E0JB 3B78A 2VZLA 2XGJA 4P6YA 1TQPA 1I8DA 4BHCA 3WBKA 2JJ2A 1XMKA 5E3LA 1ZARA 2P5VA 4IPAA 2Q6OA 1ZR4A 1N25A 2P5LC 1WKMA 1ETYA 3QYBA 4PGGA 2MGQA 4AYBN 1TTTA 2VT3A 1Z7UA 1IRFA 4QIWN 3CCUB 3WNCA 1K28D 2IRFG 4FK8A 1K61A 4RM2A 3E6MA 3JTHA 1UCRA 4TKOB 3GFIA 1LEBA 3F8FA 4RBOA 1R5ID 1OHHA 3H5NA 4HNTA 1ZR2A 4MHGA 1RZ4A 3J81k 5CVUA 1AMOA 4I02A 2WA0A 2JPBA 3BY2A 2BOLA 3W5VA 1M90D 5GTHC 2JTVA 4QPQA 2L9SA 4ENJA 2FX0A 1CQXA 5FB2A 3JRGA 1KU3A 2LH9A 2M8GX 2MH9A 1U8BA 2ZZGA 1FEXA 4G5GA 2BEOA 1OYWA 3FMQA 5K7FA 3ULQB 1B2RA 2OJED 3ZZ0A 3IWFA 1VQNB 2D2WA 3EUAA 1TWGJ 2LSOA 4MO7A 1BJAA 3SZGA 2DA6A 4BU2A 4MGRA 4L5JA 1D3YA 3VEPA 4M3GA 2HQNA 1IN4A 3GWZA 5F27A 1WPCA 3F8MA 1JUMA 3K70D 3WU1B 3SJMA 4HW0A 2YR2A 1YIOA 3ZMDA 2I10A 5E79C 1OCPA 3T0YA 1LNWA 2A05A 2GZWA 4Y13A 1BR2A 3RQIA 4Z4WA 3RKQA 2WJVA 3CMAI 1F43A 2HQRA 1S3JA 2KDOA 5FKMA 4D5CA 3BZKA 5ED4A 5BSXA 4BBRJ 3ZQ7A 1DG1G 3H9NA 5J40A 1XE1A 4M4SA 1TWAJ 2MLGA 3CZ6A 3KCCA 4ZYAA 1HZEA 3IP4B 3P9IA 1EV7A 4I2OA 1YG2A 3SQNA 3GZ5A 3PUBA 1MNEA 3JRHA 4M71A 3KX2A 2IP2A 5KVRA 5D6FA 3ERMA 1MZBA 4TMTA 3C1DA 1P7JA 2KJCA 5LHGA 3Q38A 1VQ8B 3Q0VA 3K4JA 3EUHC 5L3CA 3GZ6A 4KA4A 1W0KA 2DMNA 5F1RA 3UR3C 2I1LA 4EJWA 3BDDA 3H94A 4BPRA 1K78B 1I50J 2NS8A 4UV9A 1YW8A 5CYVA 1VQ6I 2D1HA 4I99C 3OYGA 3H3UA 3OYMA 2F1MA 4XKVA 4Y7NJ 4X7EA 1I1SA 2D3LA 1E62A 3U1KA 2GQQA 1F60A 1QPIA 1BIBA 3SXYA 3KZYA 5KAIC 3F8NA 1D0YA 4BE0A 2K3FA 5EGOB 1X1AA 4F91B 4RD0A 2Y0SN 1S72I 1OB0A 1BPLA 4RMNA 5TISC 1FRNA 3V42A 1Y8RB 3PQJA 2FMYA 1I27A 4PK4A 4BNCA 1H8HA 1BN5A 4I7HA 2WB1N 5EZHA 2WYRA 2JRMA 3V7RA 2O0YA 4B43A 1ZRDA 2M30A 1NB9A 4MFDA 2R5YB 4LBVA 3SLNA 1OB2A 2P6SA 5BNGA 3CCJI 3ASQA 1QZYA 3WU2C 3DKXA 2IGMA 4C3HJ 4HLYA 1RR8C 3VO1A 3OR2C 4DNTB 1VTNC 2B7BA 1YOVB 4N4NB 3KP6A 2A6HF 3AVWA 3KIOA 5IP6A 2XEXA 5HLTA 2Y9ZA 4ETSA 2M0MA 5JHFA 2NV4A 3V8KA 2JA7J 3RQ4A 1ZG5A 3MKYB 2X85A 2LKXA 1G7TA 4WXDA 4NCNA 1JT6A 2OTJI 5F6FA 2KRCA 2ZJPF 1PJ7A 1CF7A 4ZJZA 2QKLB 4I09A 4OOXA 5HDNA 5BOXA 1VZ0A 1WFXA 1Z21A 4L9VA 4HX7A 4HE5A 5EMNA 1T0FC 4TSFA 2Q2EB 1QUEA 5F64A 1V5VA 3NARA 4F3QA 5J4VA 1T8IA 3GBGA 4GO1A 1Y0YA 4NHJA 3L2CA 3RKXA 2EV6A 2OF7A 2LR8A 3QOPA 4IHTA 4GQNA 3S1MJ 1MW7A 2AQEA 5KHDA 4Z4UA 2DQRA 1YITB 3BP8A 1I3AA 3QPHA 3R0AA 1IZ1A 2L4MA 2QEXI 4OPOA 4Z4VA 3OYCA 2EV5A 3M8JA 3J7AY 1T98A 2JK3A 3MMPA 1JHFA 4XQFA 2LC2A 2OU2A 2ZB9A 3OS2A 1IJWC 2VNKA 1WH7A 2JVHA 4RB3C 1VQ7I 3OAAA 2YSRA 1WJ5A 1KQ9A 2D1VA 2EA2A 2R93J 1A6IA 3CCRI 3DBRB 2Y31A 2LBFB 3BWGA 4LOCA 2BYVE 3VWBA 3DU5A 1GDTA 5IP7J 2CMPA 2YX4A 2Z3YA 4ZH4F 4O5VA 4DYQA 4QVAA 1WPKA 5B5EC 1YX3A 1T5EA 2JN9A 4G1VA 3HHGA 2EZIA 4BEHB 3I56B 4B3XA 4M3DA 4Q7JB 1TL8A 5D6EA 3QAHA 4R1HA 4ASUA 3G1LA 3D5SC 1KK2A 2E2JJ 3G6EB 4A69C 4LIVA 4ZYDA 2KFDA 4EJUA 2ZXJA 3VOEA 2EIKH 4KDPA 1JA0A 2STWA 3DLLF 3DLAA 1XSVA 1Z6RA 4A3JJ 1RR7A 3IH2A 1SD6A 2ZMEC 1N08A 1YHQI 2E35A 3FDYA 2DT6A 2VODA 1J59A 3G4SI 3E5QA 4NB5A 3FXQA 4ZGQB 2P3MA 3ZQIA 2XB0X 3LSTA 4Q4ZF 1I5ZA 4X7FA 2VKHA 3TW6A 1S8NA 3M07A 1VQ4I 3P5JA 1QHHD 3GTOJ 4BY1J 2F6CA 2GAUA 5ICEA 1W5TA 3GO5A 3QOEA 4I0BA 3HOVJ 1PJ6A 5HLHA 1ZN2A 1T08B 3SDGA 2VN2A 4M9SA 1IW7F 2L4AA 4OAZA 1FX0A 2YWEA 2MSYA 4JX5A 3GXOA 4LITA 4XONA 2BHYA 3ZGKA 4BDYA 3J7YJ 3F6OA 2CF4A 1FBUA 2VPRA 3F9KA 3E6DA 4IXAA 2J7KA 4HE6A 3LQQA 1X4OA 1J9IA 4A6EA 4UUSB 2V7UA 4DQKA 2XIGA 2ZBKA 3TMOA 5LFAA 2CW8A 3KP5A 1HC8A 2X0KA 2A5WA 4ZZLA 2IGOA 2GXGA 4IHXA 2V79A 1E3XA 1GVDA 4RGSA 3HHHA 3QPLA 3L2VA 5CJ9A 2XB5A 4A3LJ 1WOSA 1WZ2A 2HXOA 2DDBA 4S04A 1N0UA 1VQMI 5ICFA 3TO6A 2XZPA 2F5DA 4N9HA 4WZTA 2BVNA 1N0VC 3M8FA 2RC5A 2WR8A 3JQRA 5F0FA 2RGVA 5FIUA 1GHCA 3JRCA 2V1DA 4P26A 4O3MA 2QBYA 3B6CA 1ACIA 1ERDA 4ZTJA 1BJZA 4PJ0C 2GQFA 5IYPA 2OD5A 1UAAA 3MKZA 1KGSA 2F2EA 1WTHD 2EV0A 3ZUGA 1VQ5I 3AGPA 1Y6IA 3FKJA 4A3GJ 5DEQA 3EDPA 3R0JA 2OBRA 4YAUA 4AUXA 2QDXA 5AN9A 3HC7A 3V76A 3IAS2 3PO2J 3F21A 5THXA 4F92B 3IV5A 4C2TA 2Q2EA 3ABLH 3ECHA 2Z9OA 3SKBA 3BJOA 2PJRA 2IAIA 3K4LA 4X8IA 4CCMA 4KKSA 2R3SA 3WGHA 2XRNA 4B44A 3C2GA 2EPFA 1E0EA 2R7FA 2DXIA 1B59A 1W4MA 5FO5A 5E1WA 2W57A 1F36A 2RC6A 2Q0OA 4IL6C 1YQAA 1MDMA 1FNNA 2NS7A 4V2FA 5FFXA 2A6TA 1D0ZA 5JHUA 4TMWA 3BTIA 3FPPA 4L5EA 5HS8A 3CC7I 2DMPA 1FWZA 1MNDA 4ZDPA 4XRSA 3JU4A 4B8XA 2KRFA 3VODA 4AYBA 1IXCA 4E7LA 3IRQA 2XAQA 3CCLB 1MNMC 2VUMJ 2VBZA 3G71I 2XGCA 3JSPA 4FISA 3UKGA 1UJ8A 4Z4RA 1V5FA 3PIOF 1HDPA 2HZTA 3G3ZA 2R5ZA 2V1UA 2G9WA 1VQKB 1B6AA 4X0CA 4WZLA 1EXMA 3KP3A 3LL7A 1QPMA 2K9LA 5J8FA 5TV2A 4L0ZB 1ETQA 5LMZA 3JQQA 2E1CA 2RREA 3LSRA 2GWRA 2XAHA 4PJLA 1ZHFA 3WTWC 2M7BA 3BQJA 1E3PA 2DJNA 5D4SA 3PIPF 1DPUA 1UD5A 3ZQFA 3TW7A 3DEUA 4GRIA 1B9NA 1LVAA 2HTJA 2LOOA 2G7HA 4HDVA 4A3CJ 1E1RA 4P25A 2BZTA 2DIEA 3EYIA 3L2RA 1K8AD 2X6OA 1QQIA 1BL0A 2ELJA 2DY1A 3CMMA 2R9VA 1VQLI 3HG9A 4UUSA 1KZLA 2H27A 4FT8A 4F55A 1SMYF 1WJFA 1S72B 1X3UA 2V4JC 3RYPA 1KYZA 4KICA 5E3NA 1DDNA 1FMWA 1OJLA 4AIDA 4LG0B 3Q6RA 3U2QA 2R7QA 5ILUA 1NBMA 5FFZA 2C6YA 1EFTA 2NOGA 5ERIA 4MYUA 2DT7B 2VKDA 3E5UA 2NVQJ 2FX3A 5H2FC 3FKSA 1X3WB 4Y4RA 2DDAA 3OPOA 1B9MA 2CUJA 1NH3A 1FDRA 2B0LA 1WSRA 1IO2A 3ZBUA 1OYIA 4B3GA 4G12A 5JLWA 1QVUA 4QFMA 2MLKA 1KK1A 2PG4A 2XVCA 3IUOA 1B8IA 1KONA 4TMVA 5L3EA 5J1RA 1ZG1A 1Y0NA 3DKYA 1K83J 4H4KC 3M4OJ 2KT0A 4ZC3A 1UG0A 5DDGA 2Q1ZB 1LFUP 1FOKA 1LE8B 4YG2F 2XGXA 2HVSA 3H5AA 3K4MA 2HYJA 2FQ4A 3LNQA 4UUVA 5HLGA 4H0EA 4WXCA 1NTCA 1POGA 3C2BA 2CWEA 3AKZA 3B8HA 3CJQB 2PMHA 1YX5A 4P3IA 3CJRB 3QQAA 3ZOBA 3GVLA 4B3FX 1J9ZA 3CW2A 1IUFA 1FYLA 1MJAA 4DZPA 2V9KA 3WE3A 2VQLA 4AWXB 1GR1A 2DT5A 4BDZA 2DOFA 4JBAA 2LF8A 2ZMEB 1PYVA 1X1DA 5IT9Z 3VR6A 3I54A 1V54H 3BR6A 4QLCU 5C4XJ 3OYEA 3BG3A 2V1XA 1Q86D 2QA4B 4HYEA 5CQEA 4TT3A 4HQMA 4A3BJ 1EA3A 3W3CA 3FWEA 5F04A 4UY8I 4WWCA 5KSWB 5F4MA 3BQZA 4DYRA 2E7WA 3F8BA 2XHKA 3NWTA 3ERED 1VFCA 1JGGA 1V55H 4IQJA 1BBYA 4U0WA 4FQGA 1LPQA 2F5FA 1ZKGA 2A5YB 4UV8A 3FHZA 5M5WJ 4RLZA 1A5JA 2DFIA 3OP1A 2VJIA 1IN6A 4NQWA 4U0VA 2HNHA 2H8RA 4P12A 1QO0D 2ACJA 4G7HF 4YAOA 2VKEA 4UVBA 4BGDA 3TDUC 1FIPA 5FD6A 3CP2A 4ZTFA 2OCEA 1P6RA 1EP1B 1MRZA 3WTUC 2BSAA 3ZMUA 4M6YA 3GMEA 1RQPA 3WBJA 2IA1A 3K1MA 3S3MA 1KTVA 1D8JA 2M34A 3BR3A 5IT3A 1PP8F 4Y52J 2X6XA 3BG7A 2YU9J 2VI6A 4PUSA 4UZFA 1E3OC 2XGEA 3TOAA 4RM3A 3OIOA 4RD6A 3W2IA 2HOEA 9ANTA 3IRRA 1Q1HA 3A03A 3DBLB 5J3OA 1HSJA 5HLIA 5HVQC 2GK6A 2PX9A 4KUMA 4RDUA 4LLNA 2GM4A 1H8EA 1BR1A 2MC3A 5GP9A 3E20A 5CKTA 4RGXA 2BW3A 3BCBA 2DFFA 4UB8C 3BLYA 2NVYJ 3LWFA 3PUMA 4YAWA 2OTLB 3FPKA 5GADJ 3HKZN 2OQGA 4IX7A 2IBDA 3ZZUA 2ZBVA 1IN7A 4IRHA 5J8CA 3W2FA 5M3FJ 1U5TB 2OBPA 3SEJA 2ADUA 2ISYA 4PABA 3VYUB 5LGTA 3SFIA 4Z4ZA 1IN8A 4Y3OA 3S93A 4OIOF 3COAC 5D4RA 3E7LA 5EEGA 1XX5A 1FNMA 3CUOA 5EGOA 3PJRA 1R36A 3ZMSA 3I59B 2MBFA 3W2WA 3CCLI 3QFCA 5EJCA 2M3AA 1RI7A 2V7WA 4IQ4A 1Z91A 1WJAA 3K2AA 4WX9A 1XC5A 4V19K 2OZ6A 2C4UA 1I7PA 4H9GA 3EUHA 3VSKA 1AA7A 4IF4A 3A01B 3CCQB 4BJTA 4EVIA 1Y0UA 2JN6A 1PUFA 1JNYA 2WSSA 2WAFA 1MMNA 3WHCA 3HUGA 4Z2YA 5DD8A 1BJKA 1XCVA 3HSEA 1VQ8I 2R7SA 5FL7A 1J2XA 3ZPLA 5H5JA 1ZELA 1W0JA 3JQPA 4DW6A 4W1UA 5DM7F 4PJJA 1MSEC 2BGCA 4EJVA 3GTQJ 1O7LA 3M9AA 1IXRC 4S05A 1VQOI 3UNGC 5GV7A 3JRIA 2CNDA 1PUFB 4C2UA 2MD5A 5M5XJ 4Y15A 1SD7A 1JB9A 4M73A 2W00A 4HF0A 2JQ7A 2R7UA 3LNNA 1Y56A 4Y17A 3LSIA 4HZFA 4AIHA 1WDTA 2Z99A 2E5ZA 4MLOA 2VNHA 3JAMK 2PMDA 2PMZA 3G6EI 1B23P 4WCGA 1R1TA 2UXXA 3A0HC 1WGXA 2EB7A 3HGGA 4W97A 2VIXA 5DSZA 2FE3A 2NPFA 1U9NA 3NRVA 3CD6B 2EFPA 1QGZA 2QQ9A 2CBXA 1T56A 4HNVA 3OE7A 2OC6A 4KT5C 4J00A 5FLXK 1K6OA 3RCOA 2H8WA 2ZCWA 2ZXHA 4X06A 1P7IA 1XQBA 1FJLA 1DUXC 4OOVA 3H92A 5C44J 3ML6A 3CCRB 2XF7A 1GJRA 4M0LA 4WQMA 2PIAA 2ELKA 2CQNA 1VQ7B 3GFJA 4UZUA 2BW3B 4P3YA 1R4MB 2ZL7A 1MABA 5LGUA 1VHOA 5AONA 1TNTA 2BVMA 5EG0B 1WOOA 3OL3A 2EA4A 3ABMH 3DP7A 3E6BA 4MQ9F 3BG5A 1RC9A 2ESHA 1K4SA 3MMYB 1WJEA 4PFPA 4BE2A 4C3IJ 4B3AA 2Z5UA 1XCBA 4FHTA 1MH4A 4HA8A 3REOA 1QZZA 1Q1VA 3J80Z 5A2QK 1T38A 1Q81D 2DFEA 3U6KA 1LUJB 1ZG3A 3C2HA 2VQHA 1PVEA 1SC7A 1Z1DA 1JA1A 3CJTB 1QGYA 4EM1A 2HMAA 3O6BB 4ZZDA 1D8KA 3O3KA 4PZJA 3VFZA 4BL0B 2K3PA 4KFCA 2YU3A 2LDUA 3CCYA 3ASRA 1ONVA 1SVLA 3VYTB 1YI2B 3MZYA 4FASD 2EZLA 3JR9A 4ZV4A 2BXZA 3QYEA 4WZKA 2BF4A 1K6YA 2FXAA 2CO5A 3F23A 3KFWX 2L9VA 2DTRA 3LSHA 3GTLJ 1NDHA 4E0FA 4DIQA 3ZPNA 1FOWA 2R7DA 2ZMEA 4E7JA 4RS8A 4ESFA 4CQJA 2Y0MA 5H6RA 1BIAA 3OIQA 4WF2A 4YHBA 1ZM3A 2X4HA 3ISPA 5GV8A 3I71A 2XF5A 3HDDA 1KU2A 1TW2A 1Q7YD 4JP0A 1SMTA 3OZWA 2DMTA 2M9HA 3DTIA 2LBFA 1V5GA 3HTUA 3M7GA 4RGUA 4XKWA 3I55I 2V4DA 1E3ZA 3FK7A 3DXJF 3S15J 3G1MA 3MEXA 1LQ1A 3RZOJ 3ASSA 4LK0F 1Y1VJ 5E3OA 2VYQA 1MDMB 3FBIB 4PJMA 5K5RA 1FIAA 4A3KJ 1R5NA 4A0YA 3V7CA 2R7OA 3ZQLA 1G3SA 2CS3A 2EFOA 3S2HJ 3CO6C 3W6VA 1W2BB 5LHIA 2V7XA 4ESJA 4YIRX 2E5NA 2VBWA 2CW0F 2C77A 1FC3A 2HTSA 3WTTC 1W9XA 2GXBA 4IKFA 4X05A 1V4RA 1HSTA 1XFOA 3FKIJ 4BXXJ 3H0DA 3AVTA 1R22A 3J81Z 4FX4A 3TBIA 2XKPA 3O2PE 4C9YA 4JX6A 2ECBA 3BTJA 4E7ZA 3N4MA 2QWWA 4K2EA 1KQSB 4ENNA 2M1BA 1UD2A 2P5KA 2W4SA 2HPIA 1DARA 2Q6IA 1UZCA 4EGZA 1K4TA 5IYCJ 2ME0A 2FSWA 1GT0C 1LEAA 3DPTA 4UB6C 1S0UA 1FZPB 2OK8A 3CCVI 3LA3A 1G7SA 3OR1C 3GZNB 2O03A 3A4CA 1D8TA 2XAGA 2VT2A 4I76A 2KIQA 4P9UA 2CYYA 1ZM4A 2JUGA 4HV6A 2QM3A 1W34A 4UAJA 4C2MJ 2UUZA 4S0HB 2ICWG 4A3EJ 4LB6B 3WG9A 2FU4A 1YJ9I 6PAXA 3BY6A 1EFRA 1KD1D 3GSIA 2BHZA 3HM5A 4X07A 3D5LA 4G7WA 4FE7A 1I3QJ 1E64A 2VL8A 2W82A 2HVQA 3Q9VA 2O6GE 4E4HA 2HVRA 3GW2A 2UWMA 3E1SA 1X3ZB 4D7NA 2M4KA 2R7ZJ 2LRDA 3NQOA 3CDIA 2DA1A 2LY1A 4N9IA 1B1BA 3GFLA 4XLEA 2MYSA 5J6XA 3OYDA 1N78A 3H1CA 2Y2ZA 4IHVA 3R6KA 5M3MJ 1ZUNB 2V7VA 3M8EA 4U7BA 1YJWI 2DERA 2L02A 2XPWA 3HXLA 4U88A 4AIJA 1APLC 1IUYA 1T0FA 3A8JA 3W5HA 4L18B 5KCMA 4RA2A 1XB4A 3GLXA 1YIJI 4OMYA 2Z33A 1K73D 3OYFA 4I0AA 2IS4A 4OP7A 2QSGX 2JA6J 3LAPA 2JRTA 2ZL5A 4Z1MA 1Z6TA 4DQLA 2V31A 2DPUA 1DGRM 1BMFA 4RLFA 2PJPA 2PJRB 2DA3A 1WI9A 4HOBA 4CO8A 5IY5H 2CFXA 1R71A 1QU3A 2GPJA 1HKTA 1WP6A 4PC6A 4RM0A 4ENKA 2KL4A 4XLHA 1QH0A 2V7TA 2YPRA 2BN4A 3DQVC 1NHAA 2X53S 2LZJA 4ZCLA 1N05A 2VKVA 4RD4A 1IGNA 2JIZA 4XRSG 3WGIA 3CC4I 3CTAA 4MQVA 2BVLA 1ZQ3P 1TC3C 2VBVA 4BY7J 5FROA 4XLPF 4DBQA 2NRAC 3HSFA 2XPUA 3ZMZA 1JXSA 3HRMA 2LG4A 2W24A 5BS6A 4AF6A 2BV6A 4CICA 3OYJA 1TNSA 3F6VA 4BE1A 1BLIA 2WJYA 2OA4A 5DS0A 3DBHB 1S9HA 3I64A 2NS0A 1CGPA 4M74A 2M45A 1TQIA 4LGWA 4C0SA 3K10A 1AU7A 2VJ4A 3V7SA 2DA2A 3RYRA 3CCEI 5GPCA 1WHUA 5HODA 2ZZQA 2E2IJ 3P9KA 2H94A 2HQ5A 2OV7A 3BT9A 1USTA 1FYKA 3HAGA 5J35A 5L46A 4ACBA 1ZGAA 2MC4A 3A02A 1ZRCA 5IYRA 1P2FA 2EWNA 3AVUA 3QSYA 4II2A 1WH5A 2DCEA 2FUG2 1BOBA 4CUGA 2WAQN 4CHUA 3GYHX 3OSFA 1XGSA 3D26A 1MMDA 2BY3A 5J47A 4A12A 2EFQA 3S3OA 2CU7A 3HKZA 2XAJA 4XR6A 2W85A 1O3TA 3U2RA 3TL4X 3ZXSA 1XDUA 1JJ6C 2YS9A 1FPQA 1IDYA 1TVCA 3VB2A 1BC7C 4TN1A 2M7AA 4PFOA 3TQNA 1OCCH 1HBXG 2ZBUA 3FXJA 5LLQA 2XNJA 3AG2H 3S3NA 3AGQA 2CSOA 3MQ0A 3WU0A 3W6JB 1B4AA 3R6SA 4ZCIA 2VASA 1T6XA 2QBYB 3ZQQA 2H6BA 1X2MA 5L3FA 1KU7A 4N0BA 4CZCA 3K70C 3GQBA 1J5YA 2F5EA 3FZVA 3I59A 3K9TA 3DTEA 1JE8A 2MABA 2QQBA 4G8XA 2DOEA 1H88C 2XUBA 5EYRA 3T53B 2VJ5A 3ZP5A 3SZTA 3JAMZ 1U78A 1C0WA 2H09A 1YJNI 4XORA 4A3MJ 4HF2A 5D5XB 4HBLA 1RNLA 3FHNA 2QA4I 4A6DA 3ZN0A 2ZC2A 2EK5A 1E79A 3IH4A 2EQRA 5FO1A 5IYQA 2KMUA 2VQCA 1N77A 1HKQA 3P9CA 4AU7A 1JJ8C 4FWTA 1G7RA 2X6YA 1MH3A 3OYLA 4NDLA 3CCVB 2QQAA 3MFKA 2W6JA 2DTZA 3PNVA 3OS0A 4UVCA 4EGYA 1VNDA 1QRYA 1EKEA 3FXOA 2V6EA 1LDJA 3LMMA 2I5UA 4AC0A 5C3EJ 2ZNZA 1LVKA 4UXNA 1A31A 1PDNC 5TR9A 2JT1A 5BSYA 4BXFA 5LEKA 1YW9A 1U9OA 3DTKA 2X1EA 3M1CA 1JGSA 4CDGA 2Y75A 1N07A 3F0CA 3OFNA 3CPXA 4ACAA 5JR3A 2CGPA 1M1EB 4LIUA 2EH3A 1QHGA 2D9RA 1IV6A 5LGNA 4F7ZA 4IJAA 3QU6A 5EEAA 3FXLA 2DO7A 3P27A 2EILH 2R6HA 3EUKL 3MAJA 4BQAA 2AHOA 1VQ5B 1PJ5A 2R4GA 2ZNYA 4NQWB 2D74A 2K9SA 4HNUA 3BY1A 4P6VF 5IT9K 3WNDA 2ZSHB 3A8KA 2W48A 5E6TA 3VYSB 1RETA 2FBHA 3SYTA 3WTZA 1CNEA 4G7XA 2LVSA 4YFXF 1YJWB 4NC6A 3ZQGA 1JTXA 5IOYA 1DDIA 5FO0A 2ETHA 3LSMA 5F4OA 1W35A 3CDLA 2DA5A 4F7DA 1OGJA 4KMUX 4XNFA 5L3GA 3QFTA 5E1XA 2O8XA 5KW9A 3JRDA 5J1YA 1HQCA 1MGTA 4QTRA 1CNFA 1ZK8A 4FETA 1FP1D 1Z05A 1QA6A 4ZDOA 4RAFA 3OYIA 2P4WA 5JLXA 1YFHA 3CP8A 5DTDA 5FRNA 3EQLF 3CC4B 1TT5B 3IHUA 3OOPA 3GVJA 4AF7A 2DEUA 1G3WA 4RPDA 2E1NA 3MZHA 3K1PA 1W5SA 3V7AA 4XMYA 3TKYA 4XBFA 2VXDA 4HV5A 2CV2A 4XLAA 2DK8A 4HQEA 5TY0A 1Y0RA 3CLOA 5LRSA 1IRGA 1A35A 1Y8QB 1W36C 3GUDA 3CPWB 3CC7B 4CYCA 4PGHA 2JA8J 4AM3A 1ETOA 2KIMA 5H6QA 1MKMA 2MFZA 4PC2A 2HZDA 3LA2A 3QYFA 1L3LA 4RD1A 1VQPI 3P7NA 3AL0C 1SKYB 4M6VA 4CA0A 4J01A 3WTXC 2W25A 1F4KA 2F48A 3GTKJ 2Y0SA 2BMWA 5FKLA 2QUFA 4RB0A 2DOAA 4ANJA 2R7RA 3OYAA 1Z9CA 1OYYA 3WTVC 1A6QA 5E17F 2ZITA 1TW3A 1BA5A 4A2UA 4NBSA 3ZQHA 1U6GA 2DW4A 1X4PA 1XSXA 2MD0A 2CC2A 2M87A 2XDVA 3BTLA 5L3DA 4E7HA 1JT0A 4IRIA 4G9YA 1O7FA 2FBIA 5CVVA 4HLXA 3JTGA 1JTYA 2C4TA 1XGNA 1CQTA 4OWRB 1ON1A 4YIFA 4P22A 4P1WA 4P55A 1WU8A 5HS7A 1EH7A 3MD2A 1VHEA 2EJRA 3SJPA 3C7JA 2UXNA 1QFJA 1TT0A 4NC8A 3WTYC 1GUUA 1XMAA 3SHFA 3D0SA 3O8GA 4I6ZA 1T95A 3LA7A 3WYAA 2JA5J 4A3IJ 3BC8A 1NB0A 1HOMA 3G71B 4AIKA 1ZM2A 2X6WA 4LBZA 5ICGA 1YX2A 3CCEB 3I55B 4ON0A 1O3SA 3OEEA 3DWLE 3RDIA 2BM1A 3TEDA 5H59A 1VQMB 1G6NA 3I0TA 1U2RA 5FA6A 1H0MA 1GVJA 2JA2A 3CRZA 2ESNA 1F9NA 5C4JJ 1RIOH 3S2WA 4RD2A 2GOXB 2BGIA 2B7CA 5ILVA 5DYMA 1YLOA 1SAUA 2IW5A 3LO8A 1O57A 1UHSA 2EBIA 1W36D 1ZLKA 4UHTA 3PA1A 3OWTA 4LD5A 2LK2A 3A0BC 2LY9A 5M5YJ 3LVBA 1LE8A 2QENA 5HNFA 4D7MA 1N06A 1HF0A 1TWCJ 2RVCA 3LQ6A 2ZZFA 1SFXA 4WK8F 2CV0A 4U9UA 2AQFA 3CF2A 4DNCA 4DYCA 2P81A 1KJZA 3D5RC 1DU0A 5F0CA 2GLOA 5CLSA 4RD3A 1LDDA 1OISA 3Q0WA 1SD5A 1MJ9A 3HRSA 5IYBJ 2C5HA 4A5MA 4EM2A 2A6EF 4QHYA 3HUGB 2V1NA 4KKTA 4QWQA 4M6XA 2IGKA 3PNYA 2ZKZA 4A3FJ 3OJWA 1UELB 2QGUA 2HU9A 2QSFX 1U3EM 4TV7A 3SEQA 2VONA 4YFKF 4HRIA 3SEZA 1VF7A 4J0QA 2CV1A 5B3SH 4LBWA 3PENA 2BM0A 4LG3A 2KRHA 2X9DA 3ZQCA 2PLYA 1XG1A 1UHMA 2FMLA 1R49A 1R5GA 1T6ZA 4ESBA 2XNCA 2M5WA 5ILSA 4FXUA 2BXYA 3CQZJ 3HTSB 3LQEA 4XOTA 1AWCA 1N8RD 3BQYA 1FTZA 1EFUA 1OQYA 4G94A 3TO9A 2E2HJ 1UG2A 4A0ZA 2M2EA 1G3YA 1FBSA 2J5PA 2JWTA 2HPMA 4OIPF 1KK0A 2HOSA 2HCJB 3KZIC 1OLTA 4BH9A 2JJ7A 3GTMJ 3A35A 3GEZA 2Y48A 2L54A 3GLLA 2R0QC 4PC7A 2BY1A 2AHQA 4QV2A 3CCSB 3RKYA 2NVUB 2K5CA 3QFSA 1MBEA 4EQQA 1R58A 5K7HA 4OIRF 5F1JA 1HXDA 1V0EA 3FJOA 3HOXJ 2M8EA 2L7FP 2E1MB 2M0CA 3CCQI 4HF1A 3RI4A 3KLOA 1BI3A 3S14J 4RB2C 1TUIA 4M53A 1VQOB 2MW8A 5CVRA 2OK7A 3OYKA 3L9FA 4HIZA 3M3YJ 1UD4A 1VQ4B 3S2DJ 4DK1A 3KYDB 5EF6A 4U87A 4NBQA 2NNNA 5DCMA 2W6IA 3BJ6A 4L8JA 2F5VA 3HYIA 1KK3A 2VBTA 5FGMA 1FYMA 1JKQC 1ENHA 1ZTRA 1ZYRF 3T5XA 1SFOJ 4YIIA 1ON2A 2P7CB 3AVXA 2K40A 4P9SA 5DD4A 2A3SA 4XSXF 1YLFA 1XB2A 5DV5A 2A07F 1LKXA 1HA8A 3CXCB 1IV8A 1FBQA 2GK7A 4HSRA 1MBFA 2CUEA 4FX0A 2E7XA 4E70A 3ZMVA 3WTSC 1LDKB 4ZYGA 1O3QA 3W5UA 2KKOA 4KKUA 1E2XA 4IOCF 2ELHA 4U7DA 4RPBA 2F4IA 4EV0A 1UHWA 3ONQA 3SJZA 4DQ2A 2C78A 1WQ2A 4E6KG 3CD6I 2VLAA 5CQGA 1E1QA 1MBGA 2L9RA 2O61A 3HPGA 1WSVA 3Q6QA 1I6XA 4F93B 4HDUA 4IEJA 3RKWA 3CC2B 4A0XA 3RTRA 4BUPA 1EF4A 4RDKA 5IYWA 2R5ZB 4QVJA 3L1PA 2STTA 1MBKA 2PEXA 1QVTA 4YFNF 2M5SA 5L3BA 1REPC 1G3TA 3WNBA 2FOWA 4FTHA 4J19A 1SFEA 2CRGA 3FISA 1A36A 3H3ZA 1FOXA 4Y9UA 1DP7P 4EM0B 2F4OB 2Q8KA 3EYYA 4LFUA 4NNJA 3GX4X 4E7IA 2N8GA 1STZA 3FK6A 3PA2A 2KZGA 2O3FA 3B6AA 1QNTA 2H6CA 2HDDA 4OPSA 2L9NA 4ZYEA 4K1XA 3CF5F 3RPUD 2FA5A 1ZGJA 2BY2A 3FMRA 3Q3AA 1IC8A 1I39A 5E1ZB 1Z7LA 2XKOA 2JDIA 2XASA 4B4DA 5TGTA 1DGWY 2LNBA 4M3BA 4A5NA 2CG4A 1TQMA 5GAGJ 2CUZA 3H9GA 1D5VA 3BC9A 3VNVA 1HVXA 1USSA 2O5RA 1GAQA 1TP4A 3DEEA 3L2QA 3H9JA 2H1KA 1VQLB 3QWLA 3OSGA 2Q6KA 2VBUA 3CMEI 5A8AA 4NUBA 2HGCA 2HEOA 4Q47A 3OYBA 1XGMA 2QLZA 3X2QH 1COWA 4OAYA 4GYGA 3H35A 4RAZA 2HKXA 4NC7A 4R71A 1BR4A 2IGNA 4R79A 5J4YA 2ISZA 1P4WA 5F4JA 1U0JA 1H85A 2PFBA 1F20A 3PL8A 3TGNA 2XSJC 1XGOA 4XOPA 2GXAA 4EATA 4JMQA 2ZJQF 1BW6A 1W7PA 4AD9A 1YHQB 2LKPA 4BS9A 2EIMH 1UD3A 2LMDA 3F3XA 4HSTA 4Z4TA 1ETXA 2CQ7A 2DK5A 2JMWA 4LC0A 4LLLA 1WVRA 2L5QA 5B1BH 1W7PB 1EWYA 2ID6A 1R00A 3FIWA 5BQTA 3J81K 2JPCA 3BH4A 5EZGA 3OYHA 2NNYA 4B47A 4A93J 4CYDA 5LRRA 1E43A 2KPMA 4ZYHA 2L3DA 2Q6LA 3HGYA 3OW7A 2GIZA 3U9GA 1S29A 2CUFA 3K4CA 2BGJA 2K7LA 5LD2C 1ZLJA 4CCNA 1DPRA 5FJ8J 3ZZTA 1D1AA 3B02A 4XN0A 4XLNF 5F0HA 3KYLA 3MWMA 2RQPA 3FF5A 4LLGF 4CZZA 1VQ6B 2AO9A 3F72A 2W7NA 2OBTA 4G6QA 4BQQA 1SAXA 3RPQA 1P4MA 2L7MP 4Z4SA 3H5RA 3WHBA 3ZBTA 5FNZA 1QZEA 2Z1DA 2BV3A 5J3LA 3L7WA 2FEZA 4DGWB 2RNJA 2WZPP 3FX3A 4AC9A 3S17J 3E5XA 1YITI 1XDSA 2GBYA 2QKMB 4PSXA 1VJSA 2ZXWH 2DYRH 1S5LC 2E1OA 3RSNA 3JRFA 3Q39A 2L2OA 1QUFA 2ZJ2A 3S1QJ 2QF7A 1QG0A 3ASTA 3HPHA 3CUQC 2RNGA 2XC7A 2E1MC 1JKOC 1AHDP 1FMVA 1UFMA 1IG7A 3L00A 3A3BA 2GJRA 4DJAA 5DN6A 3TO7A 3S32A 4C30A 3HRUA 4PGOA 4L0YB 4P9FA 4N3NA 2G0EA 1HA3A 4Y9RA 1TLHB 4ZCMA 1KYWA 3PO3J 1X1PA 1ULYA 2DQLA 3S8PA 2FF4A 2LLKA 2NYXA 1H89C 1XS9A 2QMUA 2QGGA 2WY7Q 4OOSA 4G6IA 5FLXZ 4Y33A 4ENMA 2XOKA 3ONYA 4M9ZA 3BOQA 3R4KA 4F52A 4KYWA 2I8DA 2GREA 1KZHA 2KDZA 1VQNI 4V2GA 3AG1H 4KJZA 4D5FA 1E63A 1ZREA 4KIFA 2K27A 4P5OA 2OZUA 4OINF 1LFPA 1SVMA 4CXFA 1IB0A 2OUMA 2OTLI 2KVOA 3T1BA 3U6BA 3KLNA 2B7EA 2CQKA 2KJBA 3DU6A 3CO7C 5FKKA 4OIQF 2E1RA 3HBLA 3K4NA 1ELOA 2FQ3A 2XROA 2R7TA 3ELKA 1ETWA 3K1NA 3ABTA 4L9TA 2P8TA 2QCOA 1SEUA 1K7AA 2DYIA 2V9VA 3HOZJ 4X1EA 1IRZA 2KHMA 1W5CC 2HKOA 2WV1A 4UUTA 1VQPB 3ABKH 5GPAA 5IK2A 2CH0A 1KQ8A 1NRKA 5DM6F 1HLVA 3KP2A 1E17A 2AXTC 3ROUA 3L09A 1EP2B 2CK3A 2HXIA 3CJNA 3M1EA 5CPRB 1V0FA 1R4NB 3ASPA 2DETA 2V9PA 5IOZA 1D1NA 5JFRA 1WJDA 2Y9YA 3CUQA 3T56B 3U1DA 1S6LA 3CMYA 3OJXA 1UD6A 1NK2P 2PQ8A 5GTIC 5E8IA 1IDZA 2MG4A 4UZEA 5HDKA 1WJBA 3B73A 4TMZA 1GV5A 4IRGA 4IHYA 2DBBA 1ZH5A 2C2WA 2WZNA 2NAZA 2RQQA 2TDXA 4CH7A 2IS2A 4XL9A 3Q5FA 1W0UA 3GTPJ 2HDCA 2GIVA 2R7VA 1VQKI 2DN0A 2XAFA 2TRTA 3DDYA 1OCRH 2CQXA 1EH6A 1WCMJ 3AVVA 3W6KB 4M2LA 4IO9F 5D5VB 3I56I 4L9NA 4I01A 3GTJJ 3K7AJ 3OV8A 1Q9SA 5K5QA 2R5YA 3WY9A 3LAJA 1IN5A 1S7OA 2L0KA 4JOMA 4P96A 3K6GA 2VE9A 4E7SA 3H36A 2QYOA 4UVAA 5J1UA 2J5OA 4YAFA 1RRJA 2LTPA 1K79A 1YJNB 4B09A 4QUZA 3OS1A 3P26A 5IYNA 3MKWB 2O8KA 1UMKA 3ASOH 1ZGWA 1W87A 4XD7A 2XRLA 1X58A 3TP3A 3A2KA 2XGDA 4LB5A 1PKVA 5H20A 5KAFC 1OCTC 3WE2A 1OGIA 2FOKA 2DA4A 4RLQA 4JQFA 5DUKA 4YXWA 2IS1A 3NEUA 3BCDA 3ASNH 1J75A 1UMQA 2LFBA 1Z67A 3HOYJ 1AOYA 3OZVA 3BR5A 4OMZA 4YRVA 2ZJRF 3ZR8X 3JCUC 4BAYA 3I4NJ 1ETKA 1XD7A 2IEKA 2R92J 1EJ9A 4XSZF 5HDGA 1HW5A 4Z6YA 3K4BA 2PN6A 3ABUA 4M9XA 2DODA 1P4AA 3G05A 1Z0XA 2IVMA 2KQRA 4CCLA 1R23A 4KNYA 4YELA 4PDKA 2FVGA 4FN5A 4RDLA 3BG6A 3ZC3A 4CSWA 3PUFA 3TP0A 2PMZN 3AL0B 1MJBA 2JSPA 2ZO4A 5K7ZA 1U8RA 3ZN1A 2TCTA 4ABZA 3SZPA 4IVNA 1R1VA 4XLCA 3HOSA 4E7KA 2X3UA 1Z3YA 1JHHA 1R7JA 2VXZA 4XKBA 5TJJA 4XIDA 2IS6A 4N4OB 4HAMA 3OKXA 1ETVA 1XN7A 2K9NA 3A1PA 3FXUA 2QVOA 2HDWA 1R5OA 1FX7A 1CF7B 1XPXA 4M3EA 3CCMI 5EDNA 2L7KA 4R8HA 4EH1A 4D9JA 1NJID 3J80K 4XK4A 3TDZC 1UD8A 4EMSA 2HDNB 1EP3B 3BPVA 3MHPA 2QTLA 2HOAA 4EEFG 4BEHA 2DJIA 2RC4A 4IOAF 1X19A 1MMSA 3RY8A 4KT6A 4RB1A 4TMXA 1A04A 4IHSA 2K02A 2L01A 3I4PA 4IHWA 1BC8C 3CMEB 2IPQX 2HWVA 2EIXA 2DMQA 4PC3A 3JRAA 3I5UA 1FNBA 2D45A 4B4CA 2X1CA 2KIUA 2LF7A 3G1OA 1JI8A 4WWVA 1RPWA 3KP7A 3VDXA 1BOAA 2VPLA 1EFCA 1YRNA 1VLOA 2VB6A 1P4XA 5EEHA 1ODDA 1MD0A 4D0PA 5DCMB 1I1GA 2PBIA 5KNLA 1YS6A 5LBQA 2BY0A 2VQGA 1B72B 2KP6A 3DPUA 1O3RA 3ZIAA 4BACA 3Q9SA 2QTZA 5FKOA 3BNWA 1IF1A 3OYNA 1WORA 2ID3A 2L7ZA 5D5UB 2DPDA 1FY7A 1IJEA 3NE5B 3AFHA 4PJNA 3N05A 1WWXA 2XAUA 2ZTNA 3DV8A 1R9TJ 3VMFA 2PMUA 5BMZA 3SLDA 1U2WA 4ZDLA 1TBXA 1MMAA 2D5VA 4JYKA 3MCAA 1D0XA 3QFRA 3CMAB 1NK3P 5HKKA 3IAM2 4BHBA 4CCKA 3CC2I 2O7OA 1D5YA 3PFYA 4JK1X 3LSKA 4M1KA 1FOYA 4N3GA 3W2GA 4HEA2 3K69A 5A2QZ 2QSHX 1AIPA 3E1YE 3W2EA 4QPOA 3G73A 3BCFA 2NVXJ 4KMFA 5HOOA 1GLNA 3LQRA 1M1KD 2LY2A 2OPTA 1AKHA 4AVPA 1H42A 3AVYA 2IXSA 3R60A 2E71A 1BI0A 3QP5A 1RKTA 5FD5A 4CGZA 1T33A 1WOPA 2G7UA 2VBXA 3H0GJ 1YW7A 2YX7A 3DKWA 1TZLA 3JSOA 3OOUA 1KU9A 2IA0A 1X2NA 1QFYA 1T6YA 1EH8A 5IYDJ
chains in the Genus database with same CATH topology
1SFUA 1OR7A 3ZMTA 2HS5A 1RUOA 3MCZA 4MEYF 2FNPA 1L0OC 4HX8A 4LG0A 1UB9A 3PQKA 1WRJA 1BM9A 1FSEA 4BXUA 5LHHA 1XSDA 2JSCA 4I98B 3FM5A 5AIPA 2FNAA 2BE5F 5CVIA 1IAWA 1HW2A 2HR3A 5D8KB 3RPUA 3SFZA 3DF8A 4XRFA 3KETA 1J7KA 2XV4S 2COMA 1FP2A 2FBKA 2RV8A 2RKHA 5BPIA 5TRDA 3C3WA 1R5HA 2GA1A 2IT0A 2MA3A 3QPTA 1P92A 4GCVA 3K0LA 4KIBA 2VC0A 3I53A 5E18F 1W7PD 4G6DA 3V8LA 3FMSA 4OU0A 4BHPA 3WODF 2X0LA 4WXHA 2QZ8A 4PCQA 1YS7A 3CUQB 1HKSA 4EJOA 1H9GA 1RUNA 1S4MA 3GVAA 3TOBA 2DI3A 4KN7X 2VE8A 4LJZF 3GFMA 4OOIA 3F22A 3BZ6A 2AXLA 1FT9A 5KK1A 4M72A 3RJPA 3KEQA 4RAYA 5A89A 3PFIA 1GXQA 4Q5SF 3T8TA 4GYIA 5D5WB 1R1UA 1SD4A 2DU9A 2OAZA 2DLLA 2FRHA 1G4DA 2GA2A 2VBYA 3IC7A 3QP6A 5ICCA 1HW1A 2A61A 5E8GA 1ZRFA 4U0YA 3WGGA 2WV0A 4G7OF 5HS9A 4RGRA 2IJLA 2V6CA 2VOPA 1PUEE 2RN7A 4KIGA 3CDHA 1QBJA 5A88A 1IXSB 2DAOA 3HOTA 2WWYA 4G7ZF 3HIFA 2HYFA 1F5TA 1ZAOA 5CVJA 2P7VB 3KP4A 3N97A 4UNOA 2VC1A 4KN4X 5E20A 1TTYA 5LEJA 1FSHA 1BI1A 2P6TA 5DUIA 4LK1F 3AAFA 2WTEA 3I58A 4BYYA 1PP7U 3HSRA 4GXOA 1OKRA 1YYVA 3K2ZA 3LFKA 4GGGA 2VBSA 1F1ZA 1YO5C 3HRTA 1YTYA 2A69F 3C18A 1T39A 2F5CA 3E3VA 1BI2A 3EETA 3QU3A 1V3FA 2WC2A 3KE2A 3E97A 3V8JA 2PI0A 1OPCA 3FXRA 4MNUA 5DCFA 4ASNA 3DFGA 4L9JA 2ZFWA 5D8LB 3F8CA 1K78A 4O6JA 1WSUA 1T6SA 2VOOA 1LB2A 5BPDA 4Q48A 3ECOA 2AS5F 3DPLC 2HFHA 1KA8A 3KEOA 2K4JA 1H9TA 5JI6A 2BBYA 1QGPA 1LJ9A 2IA2A 3BROA 2EFWA 3IWZA 2MH2A 2KIFA 5AIQA 4HX4A 1KQ0A 1U5TC 3JW4A 3FM3A 3KZZA 5K1YA 3V4GA 2RDPA 2OQRA 4L5IA 2JZYA 2OYNA 1OMIA 4LMYA 4EJTA 1S7AA 2A68F 4MEXF 3J7AO 2K86A 1GXPA 3GF2A 4MTEA 5K5OA 3BJAA 1U5TA 2HYGD 3IL2A 3E6CC 3T8RA 2EFNA 2K4BA 2W84A 3RIRA 3BPXA 4MTDA 3R61A 1J0RA 3QRFF 1FLIA 3IKVA 5JVTA 3IKTA 2UZKA 1T2KA 1TQPA 4BHCA 1XMKA 1ZARA 2P5VA 4IPAA 2P5LC 1WKMA 4PGGA 2VT3A 1Z7UA 1IRFA 2IRFG 3E6MA 3JTHA 1UCRA 3GFIA 1LEBA 3F8FA 4MHGA 1RZ4A 5CVUA 4I02A 2JPBA 2JTVA 4ENJA 5FB2A 1KU3A 2MH9A 2BEOA 1OYWA 3FMQA 3ULQB 3IWFA 2D2WA 2LSOA 1BJAA 4MGRA 4L5JA 1D3YA 3VEPA 2HQNA 1IN4A 3GWZA 3F8MA 3WU1B 4HW0A 2YR2A 1YIOA 3ZMDA 3T0YA 1LNWA 2GZWA 4Y13A 2HQRA 1S3JA 5ED4A 3ZQ7A 2MLGA 3KCCA 3P9IA 1EV7A 4I2OA 1YG2A 3SQNA 3GZ5A 4M71A 2IP2A 5KVRA 5D6FA 1MZBA 3C1DA 2KJCA 5LHGA 4KA4A 3GZ6A 5L3CA 5F1RA 2I1LA 4EJWA 3BDDA 1K78B 4UV9A 1YW8A 5CYVA 2D1HA 3H3UA 1I1SA 2GQQA 1BIBA 3SXYA 3KZYA 3F8NA 3PQJA 1I27A 2FMYA 4BNCA 1BN5A 4I7HA 3V7RA 2O0YA 1NB9A 1ZRDA 2M30A 2P6SA 1QZYA 4HLYA 1VTNC 3KP6A 2A6HF 4ETSA 3V8KA 1ZG5A 4WXDA 5F6FA 1CF7A 4I09A 5HDNA 5BOXA 4L9VA 4HX7A 5F64A 4GO1A 4NHJA 3L2CA 3RKXA 2EV6A 3QOPA 4IHTA 2DQRA 3BP8A 3QPHA 3R0AA 1IZ1A 2L4MA 2EV5A 1T98A 1JHFA 2OU2A 4RB3C 2YSRA 1KQ9A 2D1VA 2EA2A 3BWGA 2BYVE 2YX4A 2Z3YA 4ZH4F 4O5VA 3HHGA 5D6EA 3QAHA 4R1HA 4ZYDA 4EJUA 2ZXJA 3VOEA 4KDPA 2STWA 1XSVA 1Z6RA 1SD6A 1N08A 2VODA 1J59A 3E5QA 4NB5A 3FXQA 2P3MA 3LSTA 4Q4ZF 1I5ZA 1S8NA 2GAUA 5ICEA 1W5TA 3GO5A 4I0BA 5HLHA 1ZN2A 2VN2A 4M9SA 1IW7F 2L4AA 3GXOA 3F6OA 1FBUA 3E6DA 4IXAA 3LQQA 1J9IA 4A6EA 2XIGA 2ZBKA 3KP5A 2X0KA 4ZZLA 2GXGA 2V79A 4RGSA 3HHHA 5CJ9A 4S04A 5ICFA 3TO6A 2F5DA 4N9HA 3M8FA 2RGVA 1GHCA 2V1DA 4O3MA 2QBYA 2OD5A 1KGSA 2F2EA 2EV0A 3ZUGA 5DEQA 3EDPA 3R0JA 3F21A 2Q2EA 2Z9OA 3ECHA 3BJOA 2R3SA 3WGHA 2XRNA 2R7FA 1B59A 1W4MA 5FO5A 5E1WA 2W57A 2Q0OA 1YQAA 1MDMA 1FNNA 5FFXA 5JHUA 5HS8A 1FWZA 4B8XA 2KRFA 3VODA 1IXCA 3IRQA 2XAQA 2VBZA 3JSPA 2HZTA 3G3ZA 2V1UA 2G9WA 1B6AA 3KP3A 1QPMA 5J8FA 4L0ZB 2E1CA 2GWRA 2XAHA 1ZHFA 3WTWC 1DPUA 5D4SA 3DEUA 1B9NA 1LVAA 2HTJA 2G7HA 4HDVA 3EYIA 1QQIA 2H27A 4FT8A 1SMYF 1X3UA 1DDNA 3RYPA 1KYZA 4KICA 4LG0B 5ILUA 5FFZA 2C6YA 5ERIA 3E5UA 1B9MA 2B0LA 1OYIA 2MLKA 2PG4A 2XVCA 5L3EA 1ZG1A 5DDGA 1FOKA 4YG2F 2XGXA 4UUVA 5HLGA 4H0EA 4WXCA 2CWEA 2PMHA 1FYLA 1MJAA 3WE3A 4AWXB 2DT5A 5IT9Z 4JBAA 2LF8A 2ZMEB 3I54A 4QLCU 2V1XA 4HYEA 4HQMA 3FWEA 4WWCA 2E7WA 3F8BA 2XHKA 3ERED 1BBYA 4U0WA 2F5FA 2A5YB 4UV8A 3FHZA 2DFIA 3OP1A 1IN6A 4NQWA 4U0VA 1QO0D 2ACJA 4G7HF 4UVBA 3TDUC 5FD6A 1P6RA 1MRZA 3WTUC 3ZMUA 4M6YA 2IA1A 3K1MA 1D8JA 5IT3A 1PP8F 4UZFA 3TOAA 2HOEA 3IRRA 1Q1HA 1HSJA 5HLIA 5HVQC 4KUMA 4LLNA 2MC3A 4RGXA 3LWFA 2OQGA 1IN7A 4IRHA 5J8CA 1U5TB 2OBPA 2ADUA 2ISYA 5LGTA 1IN8A 4OIOF 3COAC 5D4RA 5EEGA 3CUOA 1R36A 3ZMSA 3I59B 2MBFA 1RI7A 1Z91A 4WX9A 2OZ6A 3EUHA 4IF4A 4EVIA 1Y0UA 3HUGA 4Z2YA 5DD8A 1XCVA 3HSEA 1J2XA 3ZPLA 2BGCA 4EJVA 1O7LA 3M9AA 1IXRC 4S05A 2MD5A 4Y15A 1SD7A 4M73A 4HF0A 4Y17A 4AIHA 4HZFA 2Z99A 3JAMK 4WCGA 1R1TA 2UXXA 2EB7A 2FE3A 3NRVA 2EFPA 2QQ9A 4KT5C 5FLXK 1K6OA 2ZCWA 1DUXC 3H92A 3ML6A 3GFJA 5LGUA 5AONA 1TNTA 2EA4A 3DP7A 3E6BA 4MQ9F 2ESHA 2Z5UA 1XCBA 4FHTA 4HA8A 3REOA 1QZZA 3J80Z 5A2QK 1T38A 1ZG3A 1Z1DA 4EM1A 3O6BB 4ZZDA 1D8KA 3O3KA 4PZJA 3VFZA 4KFCA 2YU3A 2LDUA 1ONVA 3MZYA 2FXAA 2CO5A 3F23A 3KFWX 2DTRA 2R7DA 2ZMEA 4RS8A 4ESFA 2Y0MA 5H6RA 1BIAA 4WF2A 2X4HA 3ISPA 3I71A 1KU2A 1TW2A 1SMTA 3HTUA 3M7GA 4RGUA 3DXJF 3MEXA 1LQ1A 4LK0F 1MDMB 5K5RA 4A0YA 3V7CA 1G3SA 2EFOA 3CO6C 5LHIA 4ESJA 2VBWA 2CW0F 1FC3A 2HTSA 3WTTC 2GXBA 1V4RA 1HSTA 1R22A 3J81Z 4FX4A 2XKPA 3O2PE 3N4MA 2QWWA 4K2EA 4ENNA 2M1BA 2P5KA 4EGZA 2FSWA 1LEAA 3DPTA 1FZPB 3LA3A 2O03A 2XAGA 2VT2A 4P9UA 2CYYA 4HV6A 2QM3A 4LB6B 3WG9A 2FU4A 6PAXA 3BY6A 3D5LA 2UWMA 2O6GE 3Q9VA 3GW2A 3NQOA 4N9IA 5J6XA 1B1BA 3GFLA 3M8EA 4U7BA 2L02A 4U88A 4AIJA 1IUYA 1T0FA 4L18B 1XB4A 3GLXA 4OMYA 2Z33A 4I0AA 3LAPA 2JRTA 1Z6TA 2DPUA 2PJPA 1WI9A 4HOBA 4CO8A 2CFXA 1HKTA 4ENKA 2YPRA 3DQVC 1NHAA 1N05A 3WGIA 3CTAA 4MQVA 2VBVA 4XLPF 2NRAC 3HSFA 3ZMZA 1JXSA 3HRMA 2W24A 5BS6A 2BV6A 4CICA 1TNSA 3F6VA 2OA4A 3I64A 2NS0A 1CGPA 4M74A 2M45A 1TQIA 4LGWA 3V7SA 3RYRA 3P9KA 2H94A 1FYKA 1USTA 1ZGAA 1ZRCA 1P2FA 2EWNA 4CHUA 3GYHX 1XGSA 4A12A 2EFQA 2XAJA 2W85A 1O3TA 3U2RA 1XDUA 1FPQA 3VB2A 1BC7C 3TQNA 1HBXG 5LLQA 2CSOA 3MQ0A 3WU0A 3W6JB 1B4AA 3R6SA 1T6XA 2QBYB 2H6BA 5L3FA 1KU7A 4N0BA 1J5YA 2F5EA 3FZVA 3I59A 3K9TA 1JE8A 4G8XA 2QQBA 2XUBA 1U78A 3SZTA 3JAMZ 3ZP5A 1C0WA 2H09A 4HF2A 5D5XB 4HBLA 1RNLA 4A6DA 3ZN0A 2EK5A 5FO1A 1HKQA 3P9CA 2QQAA 3MFKA 4UVCA 4EGYA 1LDJA 2ZNZA 4UXNA 1PDNC 2JT1A 5LEKA 1YW9A 1JGSA 4CDGA 2Y75A 1N07A 5JR3A 2CGPA 5LGNA 4F7ZA 4IJAA 3QU6A 2DO7A 3MAJA 4BQAA 2ZNYA 5IT9K 2FBHA 3WTZA 4YFXF 5FO0A 2ETHA 4KMUX 5L3GA 5E1XA 2O8XA 1HQCA 1MGTA 1FP1D 1Z05A 2P4WA 1YFHA 3EQLF 3IHUA 3OOPA 1G3WA 2E1NA 3MZHA 3K1PA 1W5SA 3TKYA 4XBFA 4HV5A 2DK8A 4HQEA 3CLOA 5LRSA 1IRGA 3GUDA 4PGHA 2KIMA 5H6QA 1MKMA 3LA2A 1L3LA 3P7NA 1F4KA 3WTXC 2W25A 2QUFA 4RB0A 1Z9CA 1OYYA 3WTVC 5E17F 1TW3A 4A2UA 1U6GA 2DW4A 1XSXA 2M87A 5L3DA 4IRIA 4G9YA 1O7FA 2FBIA 5CVVA 4HLXA 3JTGA 1XGNA 1ON1A 4YIFA 4P55A 5HS7A 1EH7A 2EJRA 3C7JA 2UXNA 3WTYC 1XMAA 3SHFA 3D0SA 3LA7A 1NB0A 4AIKA 5ICGA 4ON0A 1O3SA 3RDIA 1G6NA 3I0TA 1H0MA 1GVJA 2ESNA 1F9NA 1RIOH 3S2WA 5ILVA 5DYMA 2IW5A 1O57A 1ZLKA 4UHTA 4LD5A 2QENA 1N06A 2RVCA 1SFXA 4WK8F 4DNCA 5CLSA 1LDDA 1SD5A 1MJ9A 3HRSA 4A5MA 4EM2A 2A6EF 4QWQA 4M6XA 2ZKZA 1U3EM 2VONA 4TV7A 4YFKF 2PLYA 1UHMA 2FMLA 1R5GA 1T6ZA 4ESBA 2M5WA 5ILSA 3HTSB 1AWCA 4G94A 3TO9A 4A0ZA 1G3YA 1FBSA