5TRDA

Structure of rbkr (riboflavin kinase) from thermoplasma acidophilum determined in complex with ctp and its cognate dna operator
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
219
Chain Sequence
DQYYRAIKKIKEAAEASNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKRGQILNITEKGLDVLYTEFADLSRILAIKNNVVITGTVTSGMGEGRYYVARKQYIIQFQEKLGIIPYLGTLNIKVDQASLPELRKIRGFRGIHIEGFKTEDRTFGSVKAFPAKIQNIPCFVIMPERTVYTDVIEIISDKYLREEINLHDGDRVSVEVYTEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Riboflavin kinase
publication title Structure of RbkR (Riboflavin Kinase) from Thermoplasma acidophilum determined in complex with CTP and its cognate DNA operator
rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase/dna
total genus 70
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2016-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5trdA01
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5trdA02
2K4BA 1ZREA 3IWZA 5L3GA 1X3UA 3LQQA 4B09A 3F8CA 1ZN2A 2KIUA 4CGZA 3QAHA 4L18B 2LDUA 3ZMDA 3S2WA 3PFIA 5D4RA 1J9IA 4KT5C 2XUBA 5HOOA 3VOEA 4BHBA 3CUQA 1KU7A 2ESNA 3W6KB 1BC7C 2ZNYA 2VBVA 2EFWA 1JE8A 4CICA 2RQPA 1HSTA 3HHHA 5AIPA 2W24A 4MHGA 5ICGA 1B9NA 2K7LA 1B9MA 4L0ZB 1TQMA 2EJRA 3I58A 4EJWA 1T39A 4KIBA 3BJ6A 4M73A 1FY7A 4I0AA 1LDKB 4ZYDA 1Z7UA 2PMHA 1W7PD 4MEYF 3L9FA 1YG2A 4RGRA 4NHJA 4UHTA 3FMSA 3R60A 1H0MA 2UWMA 4I09A 2OD5A 5EEGA 3EUHA 1UCRA 1G3SA 3FXUA 4YFKF 5D5UB 3GLXA 4P9UA 4BAYA 1QZZA 4KFCA 3TGNA 2XV4S 3KLOA 2Z5UA 3F3XA 4KNYA 2OQRA 4N9HA 5D8LB 3WTVC 2HYFA 3C18A 1YW8A 2VT3A 3H92A 3JSOA 1F4KA 3MCZA 2JPBA 1WKMA 2EA2A 3HTUA 2XRNA 1SD6A 2HYGD 2HZTA 2R7FA 1MRZA 1K6OA 1K7AA 3ULQB 4M71A 1HKTA 2Y75A 1S7OA 2L4MA 2K27A 1USSA 1SD4A 4L9NA 5JR3A 5FO1A 1ZAOA 4EJUA 3CUQC 1SFXA 3ZPLA 1U2WA 3U2RA 4LLLA 1O57A 4OIQF 1IN8A 2DPUA 4CO8A 3BROA 3WTZA 2XHKA 2HR3A 3SHFA 1WWXA 3GFJA 2AXLA 5FD6A 3SXYA 3OP1A 1QPMA 5CVVA 2VODA 4IJAA 2UXXA 3F8NA 3LWFA 4MEXF 3CUOA 3WTXC 4EQQA 4DQ2A 2L01A 2RC4A 2CYYA 1YIOA 3N4MA 2XAHA 5DD8A 1TQIA 1HW2A 2XAQA 1R23A 4O3MA 2STTA 5ILUA 2R3SA 2Y0MA 2KIMA 2D2WA 2EV5A 3F6VA 4XLNF 3KP7A 1Q9SA 2V79A 2OAZA 4LB5A 1EH8A 4LMYA 4ESJA 1IRFA 2X0LA 2FNPA 1FX7A 2MLKA 2KJCA 4BNCA 3E5QA 4DNCA 4LK0F 4M72A 2A07F 3NEUA 3WU1B 1AOYA 3K1NA 3T8TA 2L54A 1D5VA 4G6DA 2W85A 2P8TA 3WTTC 4L9JA 1H9TA 5D5WB 2V1XA 2DT5A 2G7HA 2F5DA 4U88A 3I0TA 1ODDA 1LVAA 2OBPA 4LLGF 2DAOA 4EJTA 1S8NA 1R00A 4EM1A 4GYIA 1Z05A 1R1VA 1NB9A 3KP5A 1YO5C 3R0JA 3H3UA 1TNTA 1C0WA 2FXAA 1SMTA 4UV8A 1RIOH 4ENKA 2ZMEA 4U0YA 1NHAA 3AAFA 3E97A 2A6HF 4G7HF 1D8JA 5HS8A 3F21A 3RPUA 4Q4ZF 3B73A 3RYPA 5E8GA 4Y17A 3DXJF 1XGNA 5LHGA 1PP7U 1EH7A 2KRFA 4UZEA 4GO1A 3WGGA 5J6XA 1YFHA 4QWQA 1O7LA 2IVMA 1PP8F 3HOTA 3MQ0A 2XROA 4I2OA 4L5IA 2RDPA 2YPRA 3CUQB 2WWYA 3V8KA 2HTSA 4YFXF 2P6TA 4ENJA 4KA4A 5BPDA 4KDPA 3E6DA 2H6BA 3WE3A 1ONVA 2FA5A 2WV0A 3HTSB 4RS8A 4UNOA 4N9IA 3F6OA 1ZG5A 4XBFA 3WTWC 1FP1D 2EV6A 1DUXC 3RDIA 1UHWA 3J80K 4KIGA 1XMKA 3U1DA 4G9YA 5LHIA 1TBXA 5LRSA 2UXNA 1K78A 1PDNC 1BC8C 3MAJA 3HSEA 5L3DA 2Q2EA 2FMYA 2QQAA 1OYYA 4A2UA 1YW9A 1LDDA 5LEKA 1XDUA 3Q5FA 2IA2A 1WI9A 5H6QA 5FNZA 1T6XA 4LGWA 4YIFA 3V8LA 4JK1X 2M30A 3BZ6A 3FMRA 1CF7A 3MZHA 1B6AA 4BYYA 3IC7A 3K69A 2R7DA 3K0LA 1B59A 2MA3A 2ACJA 1W5SA 5ICEA 2GZWA 2CGPA 3PQJA 4XLPF 3EETA 3JTGA 1J7KA 2HWVA 3E3VA 5JHUA 4A12A 1G6NA 5D6EA 3KP4A 4HQEA 2ZFWA 3P9KA 1HQCA 2FNAA 3F8MA 2A61A 2YU3A 3M8EA 4PDKA 2O03A 2H09A 4A0YA 5E20A 3Q9VA 3ISPA 4GCVA 2QBYA 3LA3A 2Z3YA 5ICCA 1IAWA 1T98A 3RKWA 1T6SA 2IA1A 2DQRA 4KMUX 4M6YA 4UVBA 5HDNA 5A8AA 2V6CA 4PCQA 1J75A 2QWWA 4U7BA 2ZKZA 4KN4X 4HYEA 2K02A 3ZN0A 3RKYA 1Y0UA 2EB7A 1SD7A 1LEBA 4GYGA 1N06A 2VT2A 3TO6A 1HKQA 1Z1DA 4WXHA 4FX0A 1SAXA 1FYLA 5K5OA 1HXDA 2QLZA 2XAFA 5BPIA 3VODA 1YS6A 2PLYA 5LRRA 3IKVA 3DPLC 4MNUA 5BMZA 2YR2A 3R4KA 4OIRF 2XASA 4ENNA 5E8IA 1XB4A 3WGIA 3P9IA 3I54A 4B8XA 1FP2A 1UB9A 1XCVA 4HZFA 5E1ZB 2IPQX 5DD4A 1QGPA 4PZJA 3L2CA 5FD5A 2G9WA 2M45A 2NRAC 1T0FA 1L0OC 2K86A 4RB3C 2QQ9A 1ZG3A 3R6SA 4EVIA 5FFXA 1MKMA 3TOBA 5ICFA 2CG4A 1Z6RA 3BPXA 5FO5A 3F72A 4RB1A 4NB5A 2ZBKA 3BDDA 3WE2A 2VXZA 3NQOA 2EFNA 2ZMEB 1U3EM 3GW2A 5JFRA 2ISZA 4D0PA 1CGPA 2CW0F 1KQ0A 5F1RA 2PEXA 1I27A 3WU0A 3BWGA 1DPUA 3R61A 2JT1A 2VBUA 1E2XA 1BIAA 4L9TA 3ZQ7A 5IT3A 2NNYA 2O0YA 1JHFA 5J8FA 4WK8F 4BXUA 5BOXA 3GZ6A 1KU9A 4Y13A 1W4MA 1DP7P 5HDGA 1P4AA 4YFNF 4A6EA 4XSZF 3FHZA 2DU9A 1KU2A 1O3RA 1EH6A 2RKHA 1LEAA 3M7GA 2CWEA 4RGSA 2GXGA 3KFWX 2ZXJA 3P7NA 3IHUA 1T6ZA 3T1BA 3G73A 2OYNA 2RVCA 5DUIA 2RNJA 2VC0A 2Z33A 3CO7C 4M9XA 3I59A 4ZZLA 1LQ1A 4UXNA 2FBKA 2MLGA 2VBXA 4P96A 4A6DA 1XN7A 2QM3A 3IL2A 5L3CA 1KGSA 3ZMVA 3KETA 3WTUC 5LLQA 3GYHX 1RI7A 4LD5A 1U5TA 2JTVA 1MD0A 2M87A 3RIRA 2PN6A 1G3YA 1FNNA 2F5FA 1XMAA 4BH9A 4CYDA 1BI3A 2A3SA 3GWZA 1BI2A 1ZGAA 3FZVA 3CO6C 4HA8A 1OMIA 2C6YA 3U9GA 4IXAA 3V7RA 2EFOA 3FX3A 5HS9A 2WTEA 4MTEA 1CF7B 3KZYA 5AONA 2F5CA 1MJAA 3DP7A 1MZBA 2E1NA 1LJ9A 5A2QZ 1TTYA 3QPTA 1YS7A 2NAZA 3ABUA 1FZPB 3FWEA 4ZYGA 4OIPF 2DFIA 3C7JA 2QVOA 3GZ5A 1FBQA 4U0WA 3KLNA 3GVAA 3KCCA 1J5YA 4AIHA 4ASNA 2BE5F 5HDKA 1RZ4A 2GXBA 4HW0A 3R0AA 3DV8A 2VONA 1F1ZA 2X0KA 2A6EF 1HW5A 1QNTA 3VFZA 1T2KA 2DBBA 1DPRA 1LB2A 2H94A 2ADUA 4ON0A 5JI6A 2PG4A 1MDMA 4M74A 4L5JA 5A2QK 2QBYB 5L3FA 5CVRA 4IRHA 2D1HA 1G4DA 1FT9A 2W25A 3BPVA 1BOAA 2HKXA 4HDUA 2PFBA 2QENA 3ZUGA 3T0YA 5D5VB 4IHSA 1K79A 2PBIA 1YLFA 2VBTA 5K1YA 5ERIA 5HLIA 5CVUA 2ZO4A 3V8JA 3KEQA 5CVIA 3K1PA 1U5TC 1FYMA 1FC3A 2DK5A 4M6XA 1I1GA 3DFGA 3HSFA 2J5PA 2EA4A 4RAZA 1P2FA 1G3WA 2VC1A 4QLCU 2PI0A 2WC2A 2Q8KA 4KICA 1P4WA 2CSOA 2FQ3A 3CJNA 4OINF 1BJAA 4LLNA 1R1TA 2M8EA 1ZG1A 1KU3A 2XAJA 3FM5A 2ISYA 3J81Z 1REPC 1ZRCA 4Q5SF 4UV9A 1IXSB 1FYKA 1FLIA 3QU3A 2L02A 3F8FA 3M1EA 5FFZA 2JSCA 2KKOA 3SZTA 3IRRA 1KQ9A 2V9VA 5J8CA 1D3YA 3IWFA 3EYYA 1ZRFA 5ED4A 3O2PE 1BBYA 2CQKA 3IKTA 2E7XA 4HDVA 1E17A 2COMA 1H9GA 5HS7A 5FGMA 3TQNA 1QQIA 2FF4A 2LKPA 1ZRDA 4RB2C 1IRGA 1ZARA 3EYIA 3FF5A 4E70A 2NS0A 2VBZA 3GFIA 4O6JA 3Q9SA 4EM0B 2CO5A 1L3LA 1P6RA 2GA2A 4M9ZA 3IRQA 4ETSA 1EV7A 4U0VA 2EK5A 4IVNA 2LNBA 3CDHA 4XSXF 3QPHA 5LEJA 1I1SA 2FE3A 2EFPA 5E17F 1XGOA 3ZMSA 4P5OA 5F64A 2Q0OA 4I0BA 2IT0A 1FPQA 1MJBA 1Z91A 1ZGJA 4UVCA 2GIVA 2XAGA 2BYVE 4P55A 4EGYA 5K5QA 3DPTA 1W5TA 3HYIA 5DV5A 1FBSA 1U8RA 3I59B 3ZMUA 4FHTA 4KYWA 4MQ9F 1IZ1A 3T5XA 4Z2YA 2HTJA 3GXOA 4AWXB 2I1LA 1TQPA 3LA7A 3D0SA 3GUDA 5D8KB 3FXQA 3HRMA 3V7SA 4CXFA 3RI4A 4EM2A 5K5RA 1U5TB 5A89A 2P7CB 4WXDA 2DO7A 1SMYF 2F5EA 4WF2A 5FLXZ 3ECOA 4FX4A 2K4JA 3CLOA 1GVJA 2KIFA 3JW4A 3BJOA 5JVTA 3CTAA 4WWCA 1JHHA 2RV8A 1W7PA 1QZYA 2QUFA 3ML6A 2FEZA 4ESFA 4CHUA 5DCFA 2NNNA 3I4PA 1UFMA 4I7HA 3HRUA 2X4HA 2A68F 2KJBA 2DLLA 1OYIA 1YQAA 2DTRA 5FLXK 2J5OA 3TKYA 2AS5F 3N97A 3M9AA 1P4MA 5H20A 5D6FA 3RYRA 1RUNA 4H0EA 2F2EA 4WX9A 2FBIA 5CYVA 1XCBA 3V7CA 4ZZDA 2DPDA 1XSXA 1WQ2A 4HX7A 2OQGA 5BQTA 2YX7A 3SFZA 1TW2A 2DW4A 5IT9Z 1OPCA 1GHCA 5TRDA 3K9TA 3C1DA 3ROUA 4OOIA 3G3ZA 4HAMA 1YW7A 1Z6TA 1F9NA 4JBAA 1U6GA 3RJPA 4FT8A 1XD7A 3V4GA 2XKPA 3TOAA 4L0YB 2JRTA 2ELHA 5DCMA 3RKXA 1HKSA 3BJAA 4JQFA 1RUOA 2GAUA 5IT9K 1TLHB 4PGHA 1IUYA 4LK1F 4WXCA 5CJ9A 3COAC 1OR7A 1ULYA 3LSTA 3F23A 1GXQA 2MC3A 2Z99A 3ECHA 4OMYA 2XIGA 4R1HA 4HF1A 4AIJA 2V1DA 1KYZA 2ZNZA 3J7AO 1LDJA 5KK1A 2W84A 2H27A 4LG0A 4A5MA 4BQAA 5LGNA 3LAJA 1YTYA 2W57A 1UHMA 1S4MA 2HFHA 1F5TA 2P6SA 2GWRA 4AVPA 3KE2A 4ZH4F 4F7ZA 5CVJA 4IRIA 2P7VB 4PGGA 2ETHA 1BIBA 2TDXA 3ELKA 3GEZA 4IPAA 4HF0A 4I02A 4G7ZF 3DF8A 4KIFA 4HLXA 1N07A 1IN6A 4HQMA 2HKOA 2HEOA 3O3KA 2E1CA 3TO9A 2P4WA 5DUKA 1LNWA 1ZLJA 2QQBA 5CLSA 2BEOA 2YSRA 4ENMA 1Z9CA 2VOOA 2H6CA 1BI1A 1V3FA 3JAMZ 2IA0A 4BHPA 3VEPA 1S29A 4G7OF 3WTSC 1IF1A 3DEUA 4LB6B 2IRFG 4TV7A 1MGTA 2O6GE 3ABTA 1D8KA 3HUGA 2UZKA 3P9CA 3ERED 2HOEA 3HOSA 1TW3A 3QRFF 3I5UA 2D45A 4L9VA 2MBFA 2HDCA 1FBUA 3E6CC 2XGXA 4HOBA 2FMLA 3LAPA 4UUVA 4N0BA 1R5GA 2VOPA 1J59A 3JAMK 2O8XA 4GGGA 5DYMA 1K78B 3HHGA 5F6FA 5BS6A 4EJVA 5AIQA 4YIIA 1FOKA 3KP3A 1ZLKA 1IN4A 2BV6A 3E5UA 3L7WA 5D4SA 2EFQA 4HF2A 4KN7X 1KA8A 2JPCA 2HQRA 3O6BB 1I5ZA 1QO0D 3HRTA 2OA4A 1STZA 1O3TA 3ZMTA 2B0LA 1SFUA 1YYVA 4Q48A 1O3QA 3D5LA 1S3JA 1U78A 1N05A 4MTDA 2GA1A 4S05A 2FSWA 4R8HA 1NB0A 4IRGA 4NQWA 1B1BA 2FRHA 3QOPA 1IN5A 1SFEA 4G94A 2IJLA 1FSHA 1XSDA 3LQRA 3SZPA 2DK8A 4OIOF 2OZUA 2FBHA 5HLGA 2QZ8A 4IHTA 2JZYA 3EQLF 5DEQA 4LJZF 4G8XA 1T6YA 1BN5A 4GXOA 3F8BA 3WTYC 3M8FA 3DQVC 1VTNC 1R22A 3JTHA 3GX4X 1W7PB 2XKOA 5D5XB 5ILSA 5E1XA 3TO7A 2D1VA 4MGRA 1HSJA 4EV0A 1PUEE 3WODF 1R7JA 1T38A 2O61A 4RAYA 1JGSA 1XSVA 3RPQA 2VBSA 3WGHA 5EEHA 3QU6A 2P5VA 5DDGA 1KYWA 1XGMA 1WRJA 1MJ9A 3MZYA 3WG9A 3ZN1A 4AD9A 1USTA 4EMSA 3E5XA 4KMFA 5E1WA 2ZCWA 3I64A 3C3WA 1B4AA 2E7WA 2V1UA 4M9SA 4MQVA 4I98B 5LBQA 1HW1A 3EDPA 2IW5A 5LHHA 3MEXA 1G3TA 1N08A 3E6BA 2LF8A 3E6MA 4OMZA 2P5KA 2P3MA 3HRSA 4UZFA 1JXSA 1J0RA 3KP6A 1XGSA 2YX4A 3NRVA 4XRFA 1ZHFA 5DCMB 3ZP5A 4CDGA 2VBYA 2STWA 2M1BA 4HX8A 1FWZA 3BY6A 3GF2A 4ESBA 4IF4A 4HBLA 2LSOA 1SD5A 4O5VA 2XVCA 3KZZA 1V4RA 3J81K 2BGCA 2HQNA 3T8RA 2QYOA 4LG0B 4UVAA 2Y48A 5FO0A 1O7FA 2VE8A 3HSRA 3J80Z 2ESHA 1IXRC 5FB2A 3FXRA 2HGCA 5L3BA 1ZH5A 1J2XA 5HLHA 5LGTA 3B02A 3QP5A 1WSUA 4R79A 3F22A 1DDNA 2PQ8A 5A88A 3I71A 3GFLA 2BBYA 5KVRA 4OU0A 2CFXA 1HBXG 2LF7A 2RN7A 5E18F 1P4XA 2M5WA 1R58A 3BOQA 4YG2F 3BNWA 1IXCA 2MH2A 3FM3A 1P92A 1OKRA 4WCGA 4HLYA 1S7AA 3L09A 4HX4A 1QBJA 4EJOA 2DQLA 1OYWA 3SQNA 3I53A 1FSEA 4P9FA 2OU2A 3W6JB 3MFKA 5ILVA 4A0ZA 6PAXA 3TDUC 1S6LA 1A04A 4U7DA 4CZZA 1IW7F 2PJPA 3FMQA 5H6RA 1I6XA 1R5HA 1ON2A 3KEOA 4EGZA 4LFUA 1GXPA 2DI3A 2RGVA 2ZJ2A 3GFMA 3DKWA 1ZYRF 4A0XA 4G6QA 3GO5A 3ZMZA 2GQQA 3PQKA 3L00A 5L3EA 1BM9A 5LGUA 4Y15A 2VE9A 2L4AA 3K1MA 3K2ZA 4RB0A 2O3FA 2G7UA 4HV6A 1IN7A 4S04A 4Q47A 1BI0A 3MWMA 5TJJA 3VB2A 4RGUA 4HV5A 1O3SA 2P5LC 4KUMA 3OV8A 4AIKA 2EV0A 1ON1A 4A5NA 5HVQC 2A5YB 2VN2A 2L3DA 3RTRA 3LA2A 3KP2A 1Q1HA 4I01A 4RGXA 1AWCA 1KQ8A 2PMUA 3HIFA 2MD5A 4ZYHA 3LFKA 2OZ6A 4BHCA 4ZYEA 2Z9OA 2NYXA 1R36A 1RNLA 2A69F 2EWNA 1TNSA 3H3ZA 2IP2A 1XDSA 2HS5A 3TDZC 3OOPA 4K2EA 1MDMB 2FU4A 3BP8A 2MH9A 3QP6A 3JSPA 1R1UA 2FOKA 2VBWA 3REOA
chains in the Genus database with same CATH superfamily
1Q82D 2K4BA 2ZSIB 3J81k 3MKYB 1ZREA 5F27A 3IWZA 4AU7A 5C3EJ 4Y9RA 1P9QC 5L3GA 2QN6A 1RC9A 3CQZJ 1WU8A 1X3UA 2ZSHB 3LQQA 4B09A 3JRAA 2OF7A 3F8CA 2D3LA 3ZQGA 3VPRA 3IV5A 4I6ZA 2HI3A 2W7NA 1ZN2A 3QYBA 2KIUA 5M5YJ 2JK3A 4CGZA 3QAHA 5F4OA 4L18B 2LDUA 3ZMDA 3S2WA 2X6XA 3PFIA 5D4RA 1I6HJ 1J9IA 1R5NA 4KT5C 1LVKA 2XUBA 5HOOA 2JA8J 1BMFA 1VF7A 3VOEA 4BHBA 3CMAB 3CUQA 3BTJA 3OYMA 1KU7A 1OCZH 2ESNA 1GR1A 2HDNB 3W6KB 2VJIA 1BC7C 2VJ4A 2ZNYA 1B72A 3BG5A 3TP3A 1QGZA 3H35A 2VBVA 2EFWA 2V26A 3RY8A 1JE8A 4CICA 2RQPA 5JLWA 2OV7A 5DS0A 5C4XJ 2CS3A 4XLAA 3VSLA 2CUZA 1HSTA 3HHHA 3M8JA 3A2KA 3B6AA 5AIPA 2W24A 4MHGA 5ICGA 1B9NA 1MH4A 1K61A 1IC8A 3CW2A 2K7LA 2ZXHA 1MABA 4MFDA 3FPKA 1RKWA 2UUZA 1B9MA 4L0ZB 1D0ZA 2UV1A 4C3IJ 1TQMA 2EJRA 3I58A 4AYBA 4BEHB 4EJWA 1ITYA 4FE7A 3DTIA 1T39A 2Y2ZA 2WZPP 4KIBA 5GP9A 2CK3A 3GTQJ 3QPSA 4TMZA 3S1NJ 4HSTA 3BJ6A 4M73A 1N25A 1FY7A 2VASA 1LDKB 4I0AA 4NNJA 4ZYDA 5LD2C 5K7HA 2CUJA 3KL9A 2QKMB 3LSIA 1Z7UA 5KHDA 2BY1A 2PMHA 2GJPA 1W7PD 1Y6IA 3L9FA 1YG2A 4MEYF 4RGRA 4DW6A 4XORA 1R9TJ 1ETVA 4Z1MA 3W2IA 4NHJA 3GTJJ 4UHTA 3KZIC 3GTOJ 3NE5B 3FMSA 1UMKA 1VZ0A 4FXUA 3R60A 1TP4A 1U9NA 1KZHA 3GLLA 1H0MA 2UWMA 2VKEA 4I09A 1FNMA 3LOCA 2TCTA 1NJID 2JN6A 2OD5A 4RD1A 1ZR4A 4A3BJ 1UD6A 3PA1A 1RKTA 2V7VA 1KK3A 5EEGA 3BZCA 3QYEA 4C9YA 2JVHA 3EUHA 1UCRA 1G3SA 3FXUA 4XRSG 4RLFA 4YFKF 3OEEA 3A8IA 5D5UB 3GLXA 4P9UA 1W0KA 3S17J 4C0SA 4BAYA 1QZZA 2Y0SA 1TWHJ 3A35A 4BS9A 2CFOA 3WNBA 3ASOH 4KFCA 4RAGA 2NV4A 2YWFA 3OSFA 1E3ZA 3TGNA 3WNCA 2RC5A 2XV4S 3TW7A 4FCYA 3OZUA 4DQKA 1YI2B 3KLOA 1X3WB 3EUKL 3OL3A 2VYQA 1FNDA 1N78A 2PX9A 1N0VC 3OS2A 4JMQA 5F0FA 2Z5UA 3F3XA 4F92B 4KNYA 2OQRA 4N9HA 5D8LB 3WTVC 4M0LA 2HYFA 3C18A 5B5EC 1YW8A 2VT3A 1CQXA 1Z3YA 2B5OA 3H92A 3VSKA 3JSOA 2EZHA 1F4KA 3MCZA 3JU4A 4U9UA 4F93B 2JPBA 3L2WA 3VO2A 1WKMA 2IBDA 2ZL6A 1WJCA 1D0YA 2EA2A 2MW8A 2XRNA 1SD6A 3HTUA 4OOSA 3ZZTA 2HYGD 1OCOH 2HZTA 2E19A 2QTZA 2BZTA 3W2AA 1FIAA 5BSYA 1SFKA 3JQQA 2R7FA 1MRZA 1K6OA 1K7AA 3ULQB 1HA8A 2NS8A 1GO2A 4M71A 1HKTA 2Y75A 1S7OA 4AUXA 1VQ7I 1QVUA 2F4IA 2E5NA 1JA0A 1QVGB 3LVBA 3ONUA 2L4MA 4ZTJA 4ACAA 2K27A 4Z4WA 1USSA 1SD4A 2EPFA 4L9NA 1LKXA 5JR3A 1ZGWA 5FO1A 1ZAOA 5FL7A 4EJUA 2HQ5A 2DA6A 3CUQC 1SFXA 2OUMA 2L5QA 4OAZA 4M3GA 3LSPA 1BLIA 3JRGA 3ASRA 2CV1A 4P22A 2R4GA 4IKFA 4RM3A 1HZEA 3ZPLA 1U2WA 4NBSA 1FTTA 3OIOA 3ISXA 3KPHA 4JOMA 4IHWA 2F5VA 5GTHC 3U2RA 5IYQA 4LLLA 1O57A 4TKOB 1YJNI 4OIQF 3FKSA 1K6YA 4HNUA 4PC6A 3A03A 2BW3A 2BF4A 2M7AA 1IN8A 2DPUA 4CO8A 3BROA 3WTZA 5GV7A 2ZJQF 2XHKA 2HR3A 2ELJA 2OBTA 1I39A 1NDHA 4F7DA 3SHFA 1WWXA 3FJOA 3GFJA 3MZ8A 2AXLA 2XOKA 5FD6A 5EDNA 1R49A 3PUNA 3D5SC 3SXYA 5DM7F 5IYNA 3OP1A 4GDFA 1QPMA 4Y3OA 4UUSB 5CVVA 2DYSH 2VODA 1MBGA 3A0HC 4YIRX 2KPMA 1R6RA 1D8TA 2OTJB 3CJTB 4IJAA 2UXXA 1Y0YA 3F8NA 3OJWA 3LWFA 4MEXF 3CUOA 2JA5J 3HGYA 3SDGA 3TL4X 1RQPA 3WTXC 3BG7A 4EQQA 4DQ2A 2L01A 2RC4A 1YLOA 2C4UA 2CYYA 4DZPA 2WJVA 4PJ0C 1YJWI 2EZKA 4DYRA 1YIOA 2VI6A 2JWTA 2R7VA 2E5ZA 3FXLA 3HJEA 3AFHA 1ZTRA 3N4MA 2KT0A 2PMZA 1VHOA 4WZKA 3H0DA 2LBFA 2HLDA 4Y7CA 3V76A 3ZC3A 2DA7A 2XAHA 2QSHX 2YWHA 3AGQA 1EF4A 1ZM4A 5DD8A 1TQIA 4CYCA 1MMAA 3S93A 1QFZA 3SLNA 2NVXJ 4RD3A 2RREA 1WGXA 1HW2A 2JN9A 2XAQA 1R23A 1J09A 2CU7A 1YJNB 5TISC 4O3MA 2STTA 4A93J 3CCJI 4RM0A 5ILUA 2R3SA 4X06A 2XPVA 2Y0MA 2KIMA 1S9HA 2D2WA 2A6TA 4BBSJ 2EV5A 1E79A 3F6VA 2AHQA 4XLNF 2MGQA 3KP7A 1Q9SA 2V79A 3JQRA 1E1RA 2OAZA 1RR8C 3FKIJ 4LB5A 1ETOA 3SFIA 1EH8A 3JQPA 2ZBUA 4WZTA 4LMYA 1HC8A 3WNDA 4ESJA 2DA2A 1IRFA 2X0LA 2X51A 2RC6A 2FNPA 1FX7A 1GVHA 4QVAA 2VKDA 3OIQA 4DBRA 2MLKA 4CQJA 2XGEA 3VYTB 3OL4A 2KJCA 2ZJPF 4BNCA 1FMWA 1MMGA 3E5QA 1VQ5I 4HSRA 4DNCA 1ETWA 4LK0F 4M72A 1PJ5A 2A07F 4M53A 4RPDA 4G1VA 2BSAA 3NEUA 3WU1B 1AOYA 1UD4A 1YX2A 3K1NA 4CCMA 1JA1A 1V0EA 3T8TA 2L54A 3GTMJ 3CZ6A 4IEJA 4G6DA 1D5VA 5HXBA 1LE8B 2W85A 2P8TA 3S3MA 2WB1A 3WTTC 4L9JA 1H9TA 1VQPI 2V7TA 1D1CA 5D5WB 2V1XA 4HE5A 2X6WA 2YS9A 4H9GA 3BCDA 2C2WA 2DT5A 2G7HA 2K9SA 2M4KA 2F5DA 1BR2A 2JA2A 2Y9YA 3QYFA 4ZDOA 4U88A 2LG4A 3I0TA 1ODDA 1SC7A 1LVAA 2OBPA 4LLGF 2DAOA 1YIJB 1PJ7A 1E62A 2EZIA 3HL2A 4EJTA 1S8NA 2V7QA 1R00A 2VNHA 4EM1A 4GYIA 5FKMA 1HVXA 1Z05A 1S5LC 2CJJA 2CRVA 1X1CA 1R1VA 2X53S 2GK6A 3H9NA 9ANTA 1NB9A 3KP5A 4BXXJ 2Y30A 3JREA 1YO5C 4MYUA 2F1LA 3R0JA 3OYCA 2LLKA 2VPRA 3OYEA 2D5VA 1N0UA 3CC7I 4CSWA 3H3UA 5CPRB 1TNTA 4BUPA 1C0WA 2FXAA 2GQFA 3A01B 1UAAA 1B2RA 1SMTA 4UV8A 1RIOH 2Y69H 4ENKA 2IS4A 2XF6A 4C2TA 3CPXA 1VQ5B 1W0UA 4R71A 3IAS2 2ZMEA 4U0YA 3T53B 1NHAA 3AAFA 3E97A 2A6HF 4G7HF 2XAUA 4E7IA 3RQIA 1D8JA 1GJRA 4G6IA 4OOXA 4X7DA 2KISA 1LFUP 5HS8A 2VKHA 3F21A 1VI0A 3RPUA 5F0HA 5E3OA 1EP2B 3HOWJ 1VQPB 2WBMA 4Q4ZF 2GPJA 3B73A 3RYPA 5E8GA 5HNFA 4CCNA 1KZLA 1RETA 5J3OA 2WV1A 3G1OA 2VZLA 1UZCA 4Y17A 3CC4I 3DXJF 1XGNA 5LHGA 5GADJ 4TSFA 1PP7U 1EH7A 2KRFA 5FLVA 3E1YE 3SLDA 2XB5A 4Y7NJ 4GO1A 3WGGA 1WVRA 5J6XA 4QWQA 1YFHA 4UZEA 4PC3A 3WHBA 1O7LA 1Z3XA 2IVMA 4BQNA 1PP8F 1QPIA 3HOTA 3MQ0A 2XZOA 2XROA 2DTZA 1WHUA 3WU2C 2GLOA 4I2OA 4L5IA 2RDPA 4KITB 1QUEA 2YPRA 3BTLA 1K9MD 3CUQB 1W1WE 1FRNA 1SVMA 4Y52J 4X7EA 2WWYA 3V8KA 5THXA 2WSSA 2WAFA 2HTSA 2ID3A 4YFXF 4NDLA 1B72B 2GIZA 3T51B 2P6TA 1IDZA 3Q6RA 4ENJA 3W5UA 4EATA 1ZKGA 5L46A 4KA4A 3OIPA 3BTIA 5BPDA 3E0JB 4KDPA 1UD3A 3E6DA 2H6BA 2BY3A 2CV2A 3WE3A 5EF6A 2Q6KA 1A5JA 1ONVA 3HKZA 4TMTA 2FA5A 1X2MA 1OB2A 3CMEI 2WV0A 3HTSB 2WYRA 3I55B 2IGNA 4RS8A 4UNOA 2ZZGA 2BXZA 4N9IA 3F6OA 1ZG5A 2VQCA 2ZL7A 5DS9A 1DDIA 3OR1C 3CCLI 3CC4B 1WI3A 4IQ4A 3G4SI 5IYDJ 4XBFA 3WTWC 3BR2A 1FP1D 1W36C 2F43A 2EV6A 5BNGA 3RDIA 1XG1A 1DUXC 1UHWA 2DYRH 4J19A 4G7WA 3J80K 2HU9A 4KIGA 4PGOA 2EIJH 1V54H 4M3FA 2VQHA 2XDVA 1XMKA 3U1DA 2R7ZJ 2ZXIA 4C3HJ 1VQ6I 4G9YA 5LHIA 3WQZA 2XB0X 1TBXA 5LRSA 2WAQA 2UXNA 1K78A 1PDNC 1BC8C 4XM3A 3MAJA 3HSEA 5L3DA 3MMYB 2Q2EA 4F55A 4UUTA 2FMYA 2QQAA 1EFTA 1E3HA 1OYYA 4A2UA 4E7SA 4A3GJ 1YITI 5JLXA 2M7BA 1YW9A 1LDDA 5LEKA 3FKJA 3VYRB 2OBSA 4MO7A 4OPVA 1XDUA 3CMEB 2X1EA 3Q5FA 2W48A 3SZGA 1BQEA 2ZMEC 3CP2A 3GTLJ 1NK2P 1OB5A 3QFCA 2ECCA 3CCLB 2IA2A 4XOTA 3G4SB 1D5YA 1WI9A 2K3FA 5H6QA 5FNZA 3G6EI 4IHVA 1J9ZA 1AMOA 2E1BA 4NBQA 4II2A 3S1QJ 4P2NA 2H8RA 1T6XA 3K70C 4LGWA 4YIFA 5IY5H 2DFFA 3V8LA 1XB2A 4JK1X 4ROXA 1D1BA 4ZTFA 4LC0A 1EKEA 1GV5A 2CW7A 2M30A 3BZ6A 4XMYA 4XK4A 4M2LA 1X1BA 4PABA 3FMRA 4C3JJ 3BQJA 2DFEA 1RESA 1HLVA 2JDIA 2BHYA 1CF7A 3MZHA 2L7MP 2FQ4A 1E1QA 3G05A 5EZGA 1B6AA 1VQ6B 2CNDA 3A8JA 4BYYA 3IC7A 3K69A 2R7DA 3K0LA 3AL0B 1B59A 2MA3A 2ACJA 1W5SA 1TWGJ 3QPLA 4IX7A 5ICEA 1ETQA 3CDLA 2GZWA 2CGPA 3PQJA 1DU6A 4XLPF 2CQNA 3EETA 4XRMA 3OS1A 3JTGA 1J7KA 2KDZA 2HWVA 3ASNH 3E3VA 5J1UA 1BR1A 2DXIA 3FISA 5JHUA 3SDBA 4AYBN 4A12A 1G6NA 2W6IA 3EUAA 5D6EA 2PE3A 2X6YA 1SAUA 5GAGJ 3KP4A 4HQEA 2WY7Q 2ZFWA 3P9KA 1HQCA 1QVTA 1GAQA 3OYDA 2FNAA 3F8MA 3S14J 1GT0C 4RLZA 1VQ8B 3ZPNA 1X58A 2A61A 1JKPC 4NC7A 3H94A 3LNNA 2CMPA 2YU3A 3M8EA 4PDKA 2O03A 2H09A 1QX4A 3Q3SA 1X19A 2B7EA 3G2BA 4P25A 2BW3B 4G7XA 5GTIC 4A0YA 5E20A 4P3IA 4TMWA 3JRIA 1FJLA 2IS1A 3OSGA 1OQYA 4TMXA 4BE2A 3Q9VA 5DM6F 5E79C 2R92J 1MSFC 2DMUA 2O7OA 3JRBA 1X1AA 3ISPA 5IP9J 5K7ZA 2XGJA 4GCVA 2QBYA 2F1MA 2BVLA 3LA3A 2Z3YA 1T5EA 5ICCA 1IAWA 1T98A 3RKWA 1MNEA 1T6SA 3OE7A 4C43A 3VNUA 4N4NB 1K4TA 1W2BB 2GXAA 2IA1A 2HMAA 3SJZA 2DQRA 4KMUX 4M6YA 3Q0UA 4UVBA 4W97A 5HDNA 1PUFA 3CRZA 5IP6A 5A8AA 2V6CA 4PCQA 2K9LA 5B66C 1J75A 2Y0SN 1P7IA 1YX5A 1VNDA 3LSMA 2E34A 4RMNA 3TBIA 3VYSB 2V7XA 2EINH 2QWWA 3HPGA 1VHEA 4NQWB 4U7BA 2CBXA 3MCAA 2ZKZA 3S1MJ 4KN4X 4AM3A 4HYEA 2VIXA 3FXJA 2DOAA 2XNDA 1UD2A 2K02A 3BQZA 1DG1G 2V7WA 3Q6QA 3ZN0A 4XLCA 3RKYA 2LBFB 1Y0UA 2EB7A 2A5WA 1RRJA 1SD7A 1LEBA 3PNTA 5E3MA 3CC2I 2R7TA 1BR4A 4GYGA 1BJZA 3SEQA 5GAHJ 1N06A 3VO1A 2KFDA 2VT2A 2B7CA 4A3LJ 2JIZA 3GCMA 3Q0WA 3TO6A 3HB9A 1HKQA 3B82A 1Z1DA 4WXHA 2LKXA 4FX0A 2LOOA 1SAXA 2O9LA 4LITA 1MIJA 1FYLA 5K5OA 1HXDA 2QLZA 2XAFA 3GIRA 2ID6A 2ME6A 3DBHB 5BPIA 3VODA 2OCEA 5FLMJ 4IL6C 1HOMA 1W34A 4BACA 4DGWB 1X1PA 1YS6A 5LRRA 2PLYA 3QODA 3KYDB 3IKVA 3DPLC 1FX0A 4MNUA 5BMZA 2YR2A 1T56A 1WJ5A 3R4KA 4OIRF 4UY8I 1VQNI 3BZKA 2HVRA 2XASA 4PJLA 1Y39A 2WA0A 3MN2A 4ENNA 5E8IA 1XB4A 3IP4B 3WGIA 2CW8A 2R0QC 3P9IA 4BL0B 3I54A 4B8XA 2W6JA 1FP2A 2LZJA 3PENA 5AN9A 1A35A 1G7TA 3OYJA 3CCQI 2PLFA 3U6KA 1UB9A 1XCVA 4KKSA 1R71A 1UD8A 1JI8A 1K4SA 1ZM2A 4HZFA 2JJ2A 5E1ZB 2IPQX 3M1CA 3QFTA 5DD4A 1QGPA 4PZJA 1JJ8C 3K2AA 3L2CA 5FD5A 3H9QA 2H1KA 2G9WA 3JRFA 2M45A 2NRAC 3HOYJ 1T0FA 1WJDA 4E4HA 1L0OC 2K86A 4RB3C 3OYNA 2V7FA 2QQ9A 1ZG3A 4ZC3A 3R6SA 1JJ6C 3BR3A 2KP6A 1IO2A 2GBYA 5FFXA 1MKMA 4EVIA 1MNMC 1WJEA 3TOBA 2X3UA 5ICFA 2CG4A 2KHMA 3HOVJ 2EQRA 1UJ8A 3IUOA 3BCFA 4LBZA 1Z6RA 3BPXA 2KRCA 5FO5A 2XZLA 3F72A 2IS2A 2HVQA 4RB1A 4QSHA 1K83J 1AIPA 4NB5A 5C44J 4WZEA 2ZBKA 3BDDA 1T08B 3WE2A 3FHNA 2VXZA 3NQOA 2EFNA 2ZMEB 1U3EM 3CCEI 2V9PA 1YX3A 3GW2A 2M9HA 5JFRA 2ZJRF 2ISZA 2PMZN 4D0PA 1CGPA 1A8PA 2CW0F 3A0BC 4X07A 2L0KA 5BSXA 1KQ0A 5F1RA 2PEXA 2FD5A 1DGRM 3PFYA 2Q6LA 1I27A 3CCQB 3WU0A 2QSFX 3FDYA 2DT6A 2M8GX 4II3A 3LL7A 3BWGA 1DPUA 3R61A 3Q38A 2JT1A 2KVOA 1E2XA 2VBUA 2NVQJ 1BIAA 4L9TA 3SJMA 2EILH 4Z4VA 4PJMA 4S0HB 3ZQ7A 1D1NA 1T33A 2R7RA 5IT3A 2NNYA 2ZTGA 1OHHA 1DQUA 2O0YA 1JHFA 3ZQHA 3J7AY 4QUZA 5J8FA 3C2GA 3LSHA 1JJ2B 4RA2A 4WK8F 2L9SA 2F4MB 2K9NA 4BXUA 5BOXA 3GZ6A 1KU9A 4Y13A 1W4MA 1DP7P 4HIZA 5HDGA 2W1OA 1P4AA 3OMYA 1WJBA 4YFNF 1QH0A 4QPOA 4A6EA 4X05A 3KEYA 4XSZF 3S8PA 3FHZA 5TY0A 2DU9A 4XN3A 2NXNB 1VF9A 3ZQIA 3SYTA 3L2UA 5GPAA 1FOYA 1NG6A 5LMZA 3WXMA 1KU2A 1O3RA 3WG7H 1EH6A 1TWCJ 2RKHA 5FJ8J 3CXCB 1LEAA 3M7GA 2WB1N 5F1JA 2CWEA 4RGSA 3MD2A 1H42A 2GXGA 4QFMA 3CESA 3CCEB 1IGNA 3KFWX 5EJCA 2ZXJA 3P7NA 3IHUA 1T6ZA 2H8WA 4B3AA 4RDLA 3T1BA 3G73A 2OYNA 1ZQ3P 2XF5A 3GSIA 4XONA 2XSDC 2RVCA 5DUIA 2EBIA 2RNJA 5KW9A 2VC0A 3ZZUA 4BKXA 4LOCA 3BG6A 5TGTA 3ZCOA 3NWTA 3AKZA 2Z33A 3IH2A 3CO7C 4PSWA 4F52A 4M9XA 3I59A 4ZZLA 2YU9J 5EEAA 1LQ1A 4UXNA 1AKHB 3CJRB 2FBKA 2MLGA 1EXMA 3SEZA 4YAWA 2VBXA 1OB0A 1Y1VJ 2IEKA 3CMMA 2E2HJ 4P96A 2I10A 4A6DA 1XN7A 2ECBA 2ELKA 2QM3A 3IL2A 5L3CA 3W2EA 1KGSA 3ZMVA 3J7ZI 4B4DA 3KETA 4A3IJ 1T0FC 3WTUC 1MMNA 3MMPA 2DMPA 3ABMH 2VXDA 3PSFA 1AA7A 4NC8A 4CCKA 2DDAA 5LLQA 3GYHX 1RI7A 4LD5A 4YALA 1U5TA 2JTVA 2Q2EB 1MD0A 2M4GA 2M87A 3TMOA 1W35A 5CQGA 2DFHA 3RIRA 2PN6A 3ZXSA 1RPWA 3I4NJ 1G3YA 5GPCA 2CV0A 1FNNA 2Q6OA 2F5FA 1KONA 2X6OA 1XMAA 4BH9A 4CYDA 1QGAA 1BI3A 2A3SA 3QQAA 4XL9A 2DIEA 2LVSA 1N77A 3L2QA 3GWZA 2Y9ZA 4I76A 1BI2A 1ZGAA 4LBYA 3FZVA 3CO6C 2K9MA 4A3KJ 4HA8A 1OMIA 4G12A 2C6YA 1VQ7B 3MKLA 5JVGF 3U9GA 4J0QA 4IXAA 3V7RA 4P6YA 2EFOA 3A1PA 2E1OA 2QDXA 3FX3A 5HS9A 1CNEA 1G59A 2WTEA 1TWFJ 3HZJA 4MTEA 2GM4A 4X8IA 2CQ7A 4FTHA 2X48A 1CF7B 3KZYA 5AONA 2F5CA 1MJAA 2OJED 3DP7A 1MZBA 2E1NA 5J4YA 1LJ9A 3CCUI 1MBEA 3I1FA 2Z2SB 1MBFA 3JCUC 4FE4A 1IJEA 4EEFG 5A2QZ 3RKQA 3HXLA 4RLQA 4BPRA 1TTYA 3HKZN 3S3OA 3QPTA 3EUHC 2DYIA 1YS7A 3M3YJ 2NAZA 2V4JC 3ABUA 4HPQA 1FZPB 1VQ9I 4ZCMA 3FWEA 4ZYGA 4PJNA 3PVDA 2HNHA 5JBQA 1DGWY 2QGUA 4OIPF 2DFIA 3C7JA 2QVOA 3GZ5A 1FBQA 4U0WA 2B7BA 2ZL5A 3KLNA 3P27A 1V5GA 3GVAA 1H8EA 4GQNA 2KIQA 3A4CA 3KCCA 5CDFA 3PO2J 1GV2A 1J5YA 4PSXA 5H5JA 2R93J 4AIHA 4ASNA 2BE5F 2CQXA 2MFZA 4DBQA 5HDKA 1RZ4A 2GXBA 4E7HA 4ZCLA 1K28D 1R4MB 1A36A 3AVVA 4HW0A 4H4KC 3R0AA 3DV8A 1HF0A 2VONA 1F1ZA 1ETKA 2DJIA 2A6EF 2X0KA 1OLTA 1HW5A 1QNTA 3W5HA 3VFZA 1T2KA 2DBBA 4B44A 1DPRA 1LB2A 2H94A 2ADUA 4ON0A 3ESWB 2PG4A 5JI6A 4M74A 1MDMA 4L5JA 3CCVI 5IYWA 5A2QK 4XKWA 1X4OA 2CW5A 3F0CA 1WP6A 4B3FX 1Q1VA 2WAQN 5IYCJ 2GJRA 1UHSA 1YJWB 2BY0A 2QBYB 5L3FA 1G7CA 5IOZA 5CVRA 1V5FA 4IRHA 4XNFA 3AL0C 2C4TA 2D1HA 1IJFA 1G4DA 5FKLA 2X8KA 3ONYA 3PUFA 4TN1A 1FT9A 2W25A 3BPVA 1IRZA 1PKVA 5HZBA 1BOAA 2HKXA 2E1MC 4HDUA 2ICWG 2PFBA 1PUFB 2QENA 2R7OA 5F04A 3T0YA 3ZUGA 4KKTA 4WWVA 5D5VB 1EFCA 2JMWA 4IHSA 4PJJA 3W2GA 3A3GA 1VQ9B 1K79A 3SJPA 3CCJB 2PBIA 3L1PA 1YLFA 2YWGA 2VBTA 3PNYA 1BX1A 1WJFA 5K1YA 5ERIA 3CF5F 1KRHA 5HLIA 2EIXA 1ACIA 2DA3A 1WDTA 1E3PA 5CVUA 4DYQA 2ZO4A 4Z4ZA 3PO3J 3V8JA 5IYPA 1SANA 1TL8A 3QSYA 3KEQA 2BGJA 5CVIA 3K1PA 2E2IJ 5F4MA 1U5TC 3FBIB 2QMUA 2DMTA 1FYMA 2WR8A 2GOMA 2IGMA 1FC3A 2DK5A 1HDPA 2DT7B 4M6XA 2LK2A 4ZV4A 1D1AA 2LMDA 1ZM3A 2CC2A 4ASUA 1I1GA 3DFGA 3HSFA 3G1MA 4E7KA 4DNRB 3K4KA 1DU0A 2C77A 2J5PA 2EA4A 4Z4YA 4RAZA 2XPUA 2R5ZA 1ZK8A 3HG9A 1Z77A 1P2FA 1G3WA 2VC1A 1R5BA 5IYRA 4QLCU 5J35A 2PI0A 2F6CA 2WC2A 2L9VA 4HE6A 1XS9A 1W87A 4MFEA 2Q8KA 4KICA 2X85A 1OJLA 4BDYA 2O8KA 2F4NA 2LYCA 3N05A 3BCAA 1P4WA 3DPUA 2CSOA 4Y33A 4KISA 2FQ3A 3CJNA 4OINF 3OAAA 1VQKI 1BJAA 4LLNA 1R1TA 2M8EA 1ZG1A 1WSVA 2KMUA 1GDTA 3ASQA 1KU3A 2XAJA 3FM5A 1ELOA 1XE1A 2ISYA 5H59A 4BJ5C 2HXIA 3J81Z 4B3XA 1REPC 1I3AA 3S1RJ 2QGGA 1ZRCA 3BQYA 4Q5SF 4UV9A 1IXSB 2EFGA 3E1SA 1FYKA 1FLIA 3QU3A 1WORA 2RQQA 2L02A 1IV6A 3F8FA 4A3CJ 1BOBA 4P1VA 3M1EA 2VPLA 3CC7B 2LR8A 2M2EA 1SFOJ 2DMNA 4HNVA 3HOXJ 5FFZA 2R5YA 2JSCA 1UMQA 3LMMA 2KKOA 3SZTA 3H0GJ 2XF7A 1KQ9A 2V9VA 2VJJA 1XTAA 5J8CA 3IRRA 1D3YA 3IWFA 3W2WA 3JRHA 3A02A 3R6JA 5EMNA 2QTLA 3EYYA 2NOGA 1ZRFA 3H5AA 1MH3A 1EWYA 5ED4A 2JA6J 2JA7J 2IAIA 2KRHA 4J00A 3O2PE 3PL8A 1BBYA 2CQKA 3IKTA 3HC7A 3NAUA 1VQKB 2E7XA 4HDVA 2Z6BD 1E17A 2COMA 1H9GA 2NOJB 5HS7A 2OK8A 3CCSI 2QCOA 5FGMA 2C5HA 2V31A 2VKVA 1QQIA 3TQNA 4F3QA 2COBA 2M0CA 3S3NA 1IHMA 2FF4A 2LKPA 2JSPA 1EA3A 1ZRDA 1F36A 4RPBA 4RB2C 2HOSA 3DWLE 1IRGA 3BY1A 2BY2A 1QHGA 1W0TA 2VNKA 2CUEA 4L8JA 1TT0A 4M3EA 1ZARA 4XKCA 1VQLI 1QG0A 3EYIA 1EJ9A 2HOAA 1Z21A 4CCJA 3FF5A 1I50J 3WHCA 2KZGA 4RD4A 4E70A 2NS0A 1E43A 2VBZA 3RQ4A 4ANJA 3GFIA 2OCCH 2M3AA 4M4SA 4O6JA 3DBRB 2R9VA 2XSJC 3D5RC 3Q9SA 2HOTA 2BPOA 4N3NA 4EM0B 2CO5A 1S72I 2XZPA 1L3LA 1ETXA 2HZDA 1P6RA 2XNJA 1A31A 2AO9A 2GA2A 4M9ZA 3IRQA 4ETSA 1TC3C 2DODA 2XC7A 1W36D 2DCEA 1EV7A 1U0JA 1IG7A 3UKGA 2FVGA 4U0VA 4K1XA 1KC8D 1VQMI 1BL0A 2EK5A 1P7JA 4IVNA 2LNBA 3CDHA 2NPFA 4XSXF 3OYFA 1XPXA 1QZEA 2M34A 1BW6A 1PJ6A 3QPHA 3CCRI 1CQTA 4BBRJ 5LEJA 1I1SA 1K8AD 2FE3A 1MBHA 2EFPA 5E17F 1XGOA 3ZMSA 5EYRA 3CMYA 3CCSB 1WOOA 4P5OA 5F64A 2H1LA 1W0JA 3TW6A 2WJYA 2Q0OA 4I0BA 3QOEA 2AHOA 2IT0A 4JP0A 1FPQA 4IZZA 4B43A 1MJBA 1Z91A 1ZGJA 4UVCA 2GIVA 2XAGA 1WPKA 1VQLB 2BYVE 2F4OB 1I7PA 3PSIA 4P55A 4EGYA 1BX0A 4DK0A 1WZ2A 1B23P 1BJKA 2X1CA 4Z4UA 2KQRA 5K5QA 3ASTA 4YAUA 3DPTA 4BY7J 1W5TA 1ZR2A 1R5OA 2WAEA 3HYIA 5DV5A 3R6KA 4ABZA 1FBSA 1U8RA 2ZC2A 4OPSA 3I59B 1OCTC 2C78A 1S72B 3ZMUA 2HPMA 4FHTA 5LFAA 4KYWA 5IK2A 4MQ9F 1FOWA 2JJ7A 1TVCA 2E1MB 1KJZA 4CUGA 1IZ1A 3T5XA 4Z2YA 2HTJA 3GXOA 3H9JA 1YITB 4AWXB 3K70D 2I1LA 4Z4RA 1VQMB 1TQPA 3LA7A 3D0SA 1X3ZB 1DARA 1H8HA 3KYCB 3OYLA 2BMWA 4OP7A 3CCRB 3GUDA 1JTXA 4NC6A 5D8KB 5K7FA 3FXQA 3HRMA 3V7SA 3PJRA 4FWTA 3E20A 4CXFA 3RI4A 4EM2A 4Z6YA 2TRTA 3FK7A 1SM4A 3P5JA 1UD5A 1IV8A 4A69C 5K5RA 1U5TB 2PIAA 3RCOA 5A89A 1SVLA 3WYAA 4UB8C 5GAEJ 2B63J 2P7CB 4I99C 4BQQA 4AC9A 3G6EB 4WXDA 2DO7A 1SMYF 3O8HA 1V5VA 2ZZFA 4DIQA 2F5EA 4WF2A 5CQEA 5FLXZ 2OTLI 3ECOA 2ZZEA 2NVYJ 4PC7A 4FX4A 3CLOA 2K4JA 1GVJA 2KIFA 3JW4A 2E1RA 4M1KA 3BJOA 5JVTA 3CTAA 4WWCA 1JTYA 1JHHA 4IOAF 2RV8A 1W7PA 2XPWA 5J4VA 1QZYA 2QUFA 3ML6A 4RCZA 2AQEA 2LY2A 4P26A 2FEZA 3OYBA 4FK8A 4ESFA 4TMVA 3JRCA 4A3EJ 1OCCH 2O5RA 5FKKA 3ZQLA 2V4DA 1Q81D 4WZLA 4CHUA 1BPLA 5DCFA 2NNNA 3I4PA 3IAM2 1Y56A 1UFMA 3OJXA 4I7HA 1QGYA 2Z16A 3HRUA 2X4HA 2W00A 2A68F 2KJBA 3VYUB 1WH5A 2DLLA 3G71I 2D9RA 1OYIA 3BC8A 1YQAA 2DTRA 2BV3A 1M90D 1O4XA 3DKXA 3QFSA 4XIDA 1VQOI 5FLXK 5DN6A 5IOYA 1U9OA 2J5OA 2GK7A 3CCMI 4CYCB 4UB6C 3TKYA 2R7UA 3P26A 4DNTB 3K6GA 3DEWA 2AS5F 3N97A 3Q39A 2CUFA 3M9AA 1P4MA 1Z0XA 2BOLA 5B3SH 5H20A 3LNQA 4HEA2 4HNTA 3GVKA 3BCBA 2OTLB 5D6FA 2ZZQA 3RYRA 1RUNA 4H0EA 4XOPA 2F2EA 5JHFA 4WX9A 2FBIA 2D74A 5CYVA 1XCBA 3V7CA 4ZZDA 2DPDA 1XSXA 1WQ2A 4XR6A 4HX7A 3ZR8X 3OYAA 2OQGA 4FN5A 4X0GA 5BQTA 2HDDA 2YX7A 3SFZA 3K4LA 4ZDLA 5EGOA 1TW2A 4W1UA 2DW4A 5IT9Z 2NVTJ 1OPCA 4BE0A 1GHCA 5TRDA 3K9TA 3C1DA 5EG0A 3ASPA 3ROUA 1Z7LA 4OOIA 1U8BA 1VQ4I 3G3ZA 4HAMA 3LQEA 4A3DJ 1E3OC 1YW7A 1Z6TA 2NVUB 3U6BA 1F9NA 3HBLA 1G7SA 4JBAA 1JNYA 1U6GA 3RJPA 1QUFA 4FT8A 1XD7A 1BA5A 3V4GA 2XKPA 3OR2C 3Q0VA 3G71B 3TOAA 4L0YB 2ME0A 2JRTA 5KAIC 2ELHA 4D9JA 2L9RA 5DCMA 2BVNA 1ZM9A 1VQOB 1V5EA 2BM1A 2FJ1A 4XICA 3RKXA 5TR9A 5F4JA 3LSJA 2BM0A 3ABKH 4N3GA 3CC2B 3CCMB 1HKSA 4OAYA 3BJAA 4JQFA 1RUOA 4QV2A 4YAOA 3S32A 3A1YA 2GAUA 1YRNA 1MMDA 4ITVA 5KAFC 2L7KA 3HDDA 1TLHB 4PGHA 5IT9K 1IUYA 3BR1A 2DOFA 4LK1F 4WXCA 3UNGC 5CJ9A 1B8IA 3COAC 1OR7A 1ULYA 2E35A 2XGDA 3LSTA 3ZOBA 3IH4A 3F23A 2PJRA 1GXQA 4EH1A 2LRDA 2MC3A 2Z99A 3ECHA 4OMYA 2XIGA 4R1HA 4HF1A 4AIJA 1S7EA 3OOCA 4RDJA 3VDXA 2V1DA 1KYZA 3W2HA 2DY1A 2HVSA 2ZNZA 3W6VA 1WPCA 3J7AO 2CRGA 3FXMA 1LDJA 2KZVA 2W84A 5KK1A 2H27A 1VQ4B 1D2EA 4LG0A 3X2QH 2VJ5A 2DOEA 4A5MA 4CCLA 5LGNA 1XC5A 4N4OB 4BQAA 4D1QA 1RQRA 1OISA 3LAJA 4C30A 5FA6A 2R7QA 1GLNA 1YTYA 2W57A 1VQNB 4LIVA 2R5ZB 1UHMA 2W82A 2C5BA 1S4MA 2HFHA 2ZB9A 4CH7A 3AG1H 3ZGKA 3OZVA 1F5TA 2P6SA 2GWRA 4AVPA 4ZGQB 3W2VA 4D5FA 1A6QA 3CB4A 3GMEA 3KE2A 1S0UA 3S15J 4ZH4F 3ZIAA 4F7ZA 5E3LA 1DDGA 3M07A 2JVGA 3VWBA 5CVJA 2BGIA 3BH4A 4IRIA 2P7VB 4PGGA 3V42A 1YI2I 3FXKA 3HOZJ 1IJWC 4E7ZA 2ETHA 1BIBA 1CNFA 2TDXA 3ELKA 4V2GA 1SEUA 3GEZA 1U2RA 4XRSA 4IPAA 4L5EA 4HF0A 4I02A 4XQFA 4BE1A 4G7ZF 2W4SA 3DF8A 2IGOA 4KIFA 1UELB 4HLXA 1HA3A 4M3DA 3K7AJ 1IN6A 1N07A 2V7UA 4GRIA 4KKUA 4PC1A 3CDIA 4HQMA 2HKOA 2VLAA 2HEOA 1W5CC 3O3KA 2K5CA 2E1CA 1EP1B 3TO9A 3DLLF 1N75A 2I5UA 2P4WA 5DUKA 1M1KD 1LNWA 1ZLJA 2QQBA 5J3LA 4FQGA 5CLSA 4RJLA 5M3FJ 2BEOA 2RNGA 2YSRA 2LH9A 3CF2A 4QIWN 4ENMA 4TT3A 1Z9CA 2Q6IA 2X1DA 3I9V2 3Q3AA 3QE2A 2R7XA 1VJSA 4P6VF 2D3NA 2R5YB 1SKYB 2VOOA 3A8KA 1KD1D 2H6CA 1BI1A 1V55H 1YOVB 1V3FA 3ES9A 5IYBJ 4YAFA 4D5CA 5HKKA 5HZAA 3JAMZ 1E64A 2IA0A 1H85A 4JYKA 3JR9A 4BHPA 1WTHD 3VEPA 1S29A 4E6KG 1FRQA 4G7OF 3WTSC 1IF1A 3DEUA 4LB6B 3ZQFA 5HNHA 2OBRA 2IRFG 1R5ID 4TV7A 1MGTA 3BG9A 2MABA 3H3VK 2RAEA 2O6GE 3ABTA 4XLEA 1D8KA 4IW3B 3HUGA 3P9CA 2Z1DA 1LFBA 2UZKA 3ERED 1AU7A 2XNCA 2HOEA 3GBGA 1TW3A 3HOSA 1DP3A 3LO8A 1JKRC 3H36A 3QRFF 2QQ8A 3DEEA 3I5UA 2D45A 4P3YA 4AF6A 4L9VA 3BR0A 3PIPF 1SVOA 2MBFA 3W2FA 4BJTA 2HDCA 1FBUA 3E6CC 2LY9A 3M4OJ 3PA2A 2XGXA 4HOBA 2FMLA 3PNVA 3DTEA 3LAPA 2R7SA 4UUVA 4N0BA 1MNDA 1JUPA 1R5GA 2VOPA 1J59A 3JAMK 2O8XA 3O8GA 3ZRGA 4GGGA 2IS6A 5DYMA 3K10A 3OW2B 1OR7C 1K78B 4RM2A 2OTJI 5B1AH 1T8IA 1EP3B 1NTCA 1KTVA 3HHGA 3L2VA 5F6FA 3BY2A 1PVEA 2PMDA 1KK1A 2LFBA 1VFCA 5BS6A 2K3PA 4EJVA 3KX2A 4QVJA 5AIQA 4YIIA 1FOKA 2DEUA 3KIOA 3KP3A 1ZLKA 3C2HA 1K73D 1RR7A 1IN4A 3ABLH 3MHPA 3S2HJ 2BV6A 3E5UA 3LSKA 3L7WA 4AVZA 4HRIA 2GJKA 5D4SA 2EFQA 4C2MJ 3DCFA 4V2FA 2K85A 3D1NI 1Y0RA 3I4MJ 3K4MA 4HF2A 4KN7X 4PUSA 2ZTNA 4PAAA 5FIUA 3ASSA 1KA8A 2JPCA 2HQRA 3CJQB 3PIOF 3FIWA 4IHYA 1XQBA 3O6BB 3TP0A 5IPAA 1I5ZA 4DOZA 4QTRA 1QO0D 3HRTA 5F08A 4OPOA 4Q7JB 2OA4A 2LKSA 2NS7A 1STZA 2OPTA 1O3TA 2QEXI 2E60A 2HYJA 3C2BA 3ZMTA 5M5WJ 3U2QA 2B0LA 2P0WA 2EIKH 2V1NA 1SFUA 2QA4I 4YXWA 3HOUJ 3AVUA 1YYVA 2XRLA 1OCRH 4Q48A 2YWEA 3ZBTA 4LG3A 1MBKA 4BGDA 1O3QA 5E6TA 3K4CA 3RZOJ 1OFCX 1H89C 3H5RA 4HG2A 1E0EA 3D5LA 1S3JA 1U78A 1N05A 4X0CA 4MTDA 2GA1A 4OWRB 2QE7A 2LREA 2E2JJ 4S05A 1FTZA 1JB9A 2DJNA 1EFRA 2FSWA 4R8HA 1OCPA 2VB6A 1HCRA 1NB0A 4BDZA 3B8HA 2Q1ZB 1YHQI 4IRGA 3GTGJ 2M5SA 3AG3H 2LY1A 2QF7A 4NQWA 1NH3A 1B1BA 2FRHA 3QOPA 1Q86D 4X7CA 1IN5A 1SFEA 1TUIA 2L7ZA 3SKBA 4G94A 1XX5A 4IO9F 5F0CA 4X7FA 2IJLA 1X4PA 1FSHA 1I8DA 1XSDA 2DN0A 3LQRA 3SZPA 2DK8A 2JUGA 2OZUA 2FBHA 3W3CA 5HLGA 2JQ7A 4OIOF 2QZ8A 1QHHD 5FRMA 4FISA 5DSZA 4IHTA 2JZYA 3EQLF 1YIJI 3GTKJ 1TLLA 4DK1A 4RD2A 4D7MA 4FASD 2CF4A 1Y1WJ 3GQBA 1APLC 5DEQA 4YRVA 4LJZF 4G8XA 1T6YA 1BN5A 3K4JA 2QEXB 3BG3A 3CD6I 4QPQA 3HEFA 4GXOA 4MIMA 3F8BA 3WTYC 3M8FA 3DQVC 1VTNC 4X6AJ 4XKBA 1R22A 1E63A 1XMXA 3VMFA 3JTHA 3GX4X 2QA4B 1W7PB 2XKOA 5D5XB 3BT9A 3FK6A 4FETA 5ILSA 5E1XA 5J47A 3QFRA 4Z4TA 4C2UA 3CCUB 3TO7A 2D1VA 4MGRA 1HSJA 2HDWA 3RSNA 4EV0A 4RBOA 1PUEE 2KLOA 3ONQA 3RZDJ 3WODF 4J01A 2LTPA 3ERMA 2I8DA 3S16J 1R7JA 1T38A 1POGA 4E7LA 5KSWB 4YHBA 1UG2A 2O61A 2DERA 4RAYA 5KCMA 1YHQB 2R6HA 3D26A 3FBNB 1Q7YD 1JGSA 1XSVA 3RPQA 2VBSA 5M3MJ 3AVTA 1JUMA 3WGHA 2WADA 1GVDA 3QU6A 5EEHA 2P5VA 1JGGA 5DDGA 1IUFA 1KYWA 1GAWA 1XGMA 3H1CA 2GREA 1WRJA 3JRDA 1MJ9A 3MZYA 1COWA 2VNIA 3WG9A 3FPPA 1ORKA 3ZN1A 2FX3A 4AD9A 2K40A 1USTA 2M0MA 1QFYA 2CH0A 4EMSA 2YUSA 5J40A 3HGGA 2V6EA 1WFXA 3E5XA 3HM5A 4AF7A 1VLYA 4KMFA 3MVPA 3CCVB 5E1WA 2ZCWA 3EPZA 3I64A 3CD6B 2E36A 4RDKA 3C3WA 3F9KA 5M5XJ 1NG7A 3QWLA 4PFPA 1B4AA 3G1LA 4B47A 5J1YA 4OOVA 4MYTA 4ACBA 2E7WA 2V1UA 4BY1J 5EGOB 1VLOA 1Y0NA 2JJ1A 4M9SA 4MQVA 4QHYA 4I98B 1LFPA 4CCOA 5LBQA 1JT0A 2LC2A 5EG0B 1HW1A 3EDPA 2IW5A 4A3MJ 5LHHA 4WQMA 1I18A 3MEXA 1D0XA 1G3TA 1N08A 3E6BA 2LF8A 3E6MA 4OMZA 4AIDA 2P5KA 4BEHA 3CPWB 4NUBA 2P3MA 3HRSA 4A3FJ 1ZUNB 4UZFA 1FOXA 1JXSA 2VQGA 1J0RA 4BU2A 5TV2A 3KP6A 1FIPA 1WJAA 1XGSA 2YX4A 3NRVA 4JX5A 4XRFA 4UAJA 4IQJA 3AVYA 1ZHFA 2J7KA 1I3QJ 5DCMB 3ZP5A 5FRNA 4CDGA 4UZUA 2VBYA 1MMSA 3I55I 3BR5A 3OYKA 5HLTA 3ZZ0A 1AHDP 3OYIA 2STWA 2L7FP 1IDYA 3PUBA 1QVFB 3OY9A 4BXFA 1IRXA 2WY8Q 2M1BA 3H5NA 1YRNB 3GTPJ 4XN0A 4MLOA 1QFJA 2HCJB 4HX8A 1OGJA 1FEXA 1FWZA 1WOPA 3BY6A 1JT6A 3GF2A 3OPOA 1A6IA 1G2HA 4P12A 4ESBA 3OOUA 4RCYA 1B8IB 4IF4A 2PJRB 1H88C 5IP7J 1FMVA 4HBLA 1X2NA 2LSOA 2MYSA 4X1EA 2VQLA 1SD5A 2Y31A 4O5VA 5FKOA 1UG0A 3OW7A 2XVCA 3KZZA 3DLAA 1V4RA 3J81K 2JRMA 2MD0A 3WBKA 2BGCA 3SEJA 1TWAJ 1EFUA 4Y4RA 2HQNA 3LSGA 2WZNA 3T8RA 3A3BA 2QYOA 4LG0B 2K9QA 4UVAA 2Y48A 4PK4A 5FO0A 1O7FA 2VE8A 3HSRA 4F91B 3J80Z 4CA0A 1Y8QB 2ESHA 3NWSA 1ZELA 1IXRC 5FB2A 3FXRA 2P81A 2HGCA 5L3BA 1ZH5A 1J2XA 2DDBA 1G8XA 1FNBA 4G5GA 5HLHA 5LGTA 4NCNA 3B02A 3VR6A 3QP5A 2E71A 2FOWA 2AXTC 5HODA 1T95A 2EZLA 2B9SA 3NARA 1WSUA 4M3BA 2GOXB 4R79A 3F22A 3BC9A 1DDNA 2PQ8A 4ZYAA 1JKQC 2XEXA 1QRYA 1ENHA 2A05A 5A88A 1BW5A 3I71A 3GFLA 4PFOA 2ZBVA 2BBYA 5KVRA 4DZJA 4OU0A 1FDRA 5B6IA 2X9DA 1ETYA 3K4NA 2CFXA 1HBXG 4RD0A 2XGCA 3DKYA 2L2OA 1LUJB 2LF7A 2RN7A 5E18F 1P4XA 2M5WA 1F60A 2OK7A 1AKHA 1R58A 2ZFUA 3BOQA 4G6TB 3UR3C 1XFOA 3IH3A 3T56B 2DOGA 2EH3A 4YG2F 1QU3A 3BNWA 4DQLA 1IXCA 3L2RA 2MH2A 3HPHA 1F43A 1WH7A 4LBVA 4ZGNB 3FM3A 1P92A 1JUSA 1OKRA 3U1KA 4E7JA 2VUMJ 1WSRA 2DA4A 3CLQA 5CKTA 1S7AA 4WCGA 4HLYA 3BLYA 1X1DA 3L09A 4HX4A 4YELA 3KEWA 2VL8A 1QBJA 4EJOA 2DQLA 2MC4A 1OYWA 3SQNA 1IB0A 2JUCA 4P9SA 3I53A 5H2FC 4E0FA 4XKVA 1FSEA 4P9FA 3BTCA 4KT6A 2OU2A 2LD5A 2FUG2 3I3LA 3W6JB 3MFKA 1NBMA 1HDDC 3OKXA 5ILVA 1NRKA 2OC6A 2MSYA 4A3JJ 4A0ZA 3AVWA 1PYVA 3TEDA 3E7LA 1VQ8I 6PAXA 3V7AA 4CZCA 3HUGB 4DYCA 3TDUC 1E3XA 2L9NA 4UUSA 3J7YJ 1S6LA 5C4JJ 1A04A 4U7DA 4CZZA 4Z4SA 3H9GA 1IW7F 2PJPA 3DU6A 2DCUA 2KDOA 3OEHA 2FX0A 3FMQA 4XLFA 5H6RA 1I6XA 3RPUD 1R5HA 1Y8RB 1LPQA 3S2DJ 1ON2A 3KEOA 4EGZA 3GVLA 4LFUA 3B78A 4JX6A 4Y9UA 4V19K 1GXPA 5DTDA 5KNLA 4M6VA 3HAGA 3MKWB 3ZQQA 2DI3A 2WPDA 2RGVA 2ZJ2A 3GFMA 3DKWA 1ZYRF 4A0XA 4G6QA 4AC0A 1W9XA 3GO5A 3ZMZA 2GQQA 3CCYA 3PQKA 3L00A 5L3EA 1BM9A 5LGUA 3ZBUA 5FROA 4Y15A 2QSGX 2VE9A 1GUUA 2L4AA 3K1MA 3K2ZA 3AVXA 3MKZA 4B4CA 1KMHA 4RB0A 3AGPA 1YJ9I 1SKQA 1WCMJ 2O3FA 4GFBA 2AQFA 4XD7A 1Z67A 2G7UA 4HV6A 1WOSA 1IN7A 4S04A 4U87A 1TT5B 4B48A 4JX4A 4Q47A 2BVMA 1BI0A 2G0EA 3MWMA 5TJJA 3I56I 4B3GA 2HXOA 3DU5A 3VB2A 4RGUA 3PUMA 3CP8A 3GZNB 1KK0A 4HV5A 1TZLA 1O3SA 4ZJZA 3DDYA 2P5LC 4KUMA 5B1BH 3OYGA 3WY9A 1FNCA 5EZHA 2HPIA 3OV8A 4AIKA 1M1EB 2DETA 2N8GA 2EV0A 1ON1A 5GV8A 3U21A 4A5NA 5HVQC 4B1RA 2R7WA 2A5YB 1LE8A 1YE9A 2VN2A 2L3DA 3RTRA 3LA2A 4LIUA 1NK3P 2VNJA 4PC2A 3KP2A 4RDUA 1TTTA 5FKNA 2IXSA 3VNVA 2CQQA 3DBLB 2IGKA 4BQOA 1Q1HA 3DTKA 1JKOC 3GVJA 4I01A 2QKLB 4RGXA 4XLHA 3K4BA 3OFNA 1MBJA 1AWCA 1KQ8A 3PM1A 1ERDA 2PMUA 4ZCIA 4IHXA 3HIFA 3AG2H 2F48A 2MD5A 4ZYHA 4LBWA 2KL4A 4ZDPA 2BN4A 3AG4H 4YEJA 3OS0A 1F20A 3LFKA 2OZ6A 5E3NA 2ZITA 1YJ9B 4D7NA 4RAFA 4BHCA 4IOCF 4ZYEA 4RD6A 2Z9OA 1KQSB 3BR6A 1KK2A 3FXOA 2ZXWH 2NYXA 1OGIA 1R36A 3I56B 3KYLA 1RNLA 2A69F 2EWNA 1TNSA 3H3ZA 3CMAI 2IP2A 1XDSA 4BJ6C 1MW7A 2BHZA 3A01A 2HS5A 1N8RD 3TDZC 3ZQCA 3OOPA 1G7RA 2LP0A 4K2EA 4DJAA 3LQ6A 1PJRA 1MDMB 3LSRA 2FU4A 3BP8A 4P1WA 2MH9A 3W5VA 3QP6A 3JSPA 1R1UA 1QA6A 3OZWA 5J1RA 1MSEC 3OWTA 4G1BA 3B6CA 2FOKA 3OYHA 4KJZA 2VBWA 1H8AC 2BXYA 2DMQA 2HQAA 2V9KA 3WBJA 2DA5A 3LFUA 3REOA 1R4NB 2MG4A 1V0FA 2DA1A 2EIMH
chains in the Genus database with same CATH topology
2K4BA 1ZREA 3IWZA 5L3GA 1X3UA 3LQQA 4B09A 3F8CA 1ZN2A 2KIUA 4CGZA 3QAHA 4L18B 2LDUA 3ZMDA 3S2WA 3PFIA 5D4RA 1J9IA 4KT5C 2XUBA 5HOOA 3VOEA 4BHBA 3CUQA 1KU7A 2ESNA 3W6KB 1BC7C 2ZNYA 2VBVA 2EFWA 1JE8A 4CICA 2RQPA 1HSTA 3HHHA 5AIPA 2W24A 4MHGA 5ICGA 1B9NA 2K7LA 1B9MA 4L0ZB 1TQMA 2EJRA 3I58A 4EJWA 1T39A 4KIBA 3BJ6A 4M73A 1FY7A 4I0AA 1LDKB 4ZYDA 1Z7UA 2PMHA 1W7PD 4MEYF 3L9FA 1YG2A 4RGRA 4NHJA 4UHTA 3FMSA 3R60A 1H0MA 2UWMA 4I09A 2OD5A 5EEGA 3EUHA 1UCRA 1G3SA 3FXUA 4YFKF 5D5UB 3GLXA 4P9UA 4BAYA 1QZZA 4KFCA 3TGNA 2XV4S 3KLOA 2Z5UA 3F3XA 4KNYA 2OQRA 4N9HA 5D8LB 3WTVC 2HYFA 3C18A 1YW8A 2VT3A 3H92A 3JSOA 1F4KA 3MCZA 2JPBA 1WKMA 2EA2A 3HTUA 2XRNA 1SD6A 2HYGD 2HZTA 2R7FA 1MRZA 1K6OA 1K7AA 3ULQB 4M71A 1HKTA 2Y75A 1S7OA 2L4MA 2K27A 1USSA 1SD4A 4L9NA 5JR3A 5FO1A 1ZAOA 4EJUA 3CUQC 1SFXA 3ZPLA 1U2WA 3U2RA 4LLLA 1O57A 4OIQF 1IN8A 2DPUA 4CO8A 3BROA 3WTZA 2XHKA 2HR3A 3SHFA 1WWXA 3GFJA 2AXLA 5FD6A 3SXYA 3OP1A 1QPMA 5CVVA 2VODA 4IJAA 2UXXA 3F8NA 3LWFA 4MEXF 3CUOA 3WTXC 4EQQA 4DQ2A 2L01A 2RC4A 2CYYA 1YIOA 3N4MA 2XAHA 5DD8A 1TQIA 1HW2A 2XAQA 1R23A 4O3MA 2STTA 5ILUA 2R3SA 2Y0MA 2KIMA 2D2WA 2EV5A 3F6VA 4XLNF 3KP7A 1Q9SA 2V79A 2OAZA 4LB5A 1EH8A 4LMYA 4ESJA 1IRFA 2X0LA 2FNPA 1FX7A 2MLKA 2KJCA 4BNCA 3E5QA 4DNCA 4LK0F 4M72A 2A07F 3NEUA 3WU1B 1AOYA 3K1NA 3T8TA 2L54A 1D5VA 4G6DA 2W85A 2P8TA 3WTTC 4L9JA 1H9TA 5D5WB 2V1XA 2DT5A 2G7HA 2F5DA 4U88A 3I0TA 1ODDA 1LVAA 2OBPA 4LLGF 2DAOA 4EJTA 1S8NA 1R00A 4EM1A 4GYIA 1Z05A 1R1VA 1NB9A 3KP5A 1YO5C 3R0JA 3H3UA 1TNTA 1C0WA 2FXAA 1SMTA 4UV8A 1RIOH 4ENKA 2ZMEA 4U0YA 1NHAA 3AAFA 3E97A 2A6HF 4G7HF 1D8JA 5HS8A 3F21A 3RPUA 4Q4ZF 3B73A 3RYPA 5E8GA 4Y17A 3DXJF 1XGNA 5LHGA 1PP7U 1EH7A 2KRFA 4UZEA 4GO1A 3WGGA 5J6XA 1YFHA 4QWQA 1O7LA 2IVMA 1PP8F 3HOTA 3MQ0A 2XROA 4I2OA 4L5IA 2RDPA 2YPRA 3CUQB 2WWYA 3V8KA 2HTSA 4YFXF 2P6TA 4ENJA 4KA4A 5BPDA 4KDPA 3E6DA 2H6BA 3WE3A 1ONVA 2FA5A 2WV0A 3HTSB 4RS8A 4UNOA 4N9IA 3F6OA 1ZG5A 4XBFA 3WTWC 1FP1D 2EV6A 1DUXC 3RDIA 1UHWA 3J80K 4KIGA 1XMKA 3U1DA 4G9YA 5LHIA 1TBXA 5LRSA 2UXNA 1K78A 1PDNC 1BC8C 3MAJA 3HSEA 5L3DA 2Q2EA 2FMYA 2QQAA 1OYYA 4A2UA 1YW9A 1LDDA 5LEKA 1XDUA 3Q5FA 2IA2A 1WI9A 5H6QA 5FNZA 1T6XA 4LGWA 4YIFA 3V8LA 4JK1X 2M30A 3BZ6A 3FMRA 1CF7A 3MZHA 1B6AA 4BYYA 3IC7A 3K69A 2R7DA 3K0LA 1B59A 2MA3A 2ACJA 1W5SA 5ICEA 2GZWA 2CGPA 3PQJA 4XLPF 3EETA 3JTGA 1J7KA 2HWVA 3E3VA 5JHUA 4A12A 1G6NA 5D6EA 3KP4A 4HQEA 2ZFWA 3P9KA 1HQCA 2FNAA 3F8MA 2A61A 2YU3A 3M8EA 4PDKA 2O03A 2H09A 4A0YA 5E20A 3Q9VA 3ISPA 4GCVA 2QBYA 3LA3A 2Z3YA 5ICCA 1IAWA 1T98A 3RKWA 1T6SA 2IA1A 2DQRA 4KMUX 4M6YA 4UVBA 5HDNA 5A8AA 2V6CA 4PCQA 1J75A 2QWWA 4U7BA 2ZKZA 4KN4X 4HYEA 2K02A 3ZN0A 3RKYA 1Y0UA 2EB7A 1SD7A 1LEBA 4GYGA 1N06A 2VT2A 3TO6A 1HKQA 1Z1DA 4WXHA 4FX0A 1SAXA 1FYLA 5K5OA 1HXDA 2QLZA 2XAFA 5BPIA 3VODA 1YS6A 2PLYA 5LRRA 3IKVA 3DPLC 4MNUA 5BMZA 2YR2A 3R4KA 4OIRF 2XASA 4ENNA 5E8IA 1XB4A 3WGIA 3P9IA 3I54A 4B8XA 1FP2A 1UB9A 1XCVA 4HZFA 5E1ZB 2IPQX 5DD4A 1QGPA 4PZJA 3L2CA 5FD5A 2G9WA 2M45A 2NRAC 1T0FA 1L0OC 2K86A 4RB3C 2QQ9A 1ZG3A 3R6SA 4EVIA 5FFXA 1MKMA 3TOBA 5ICFA 2CG4A 1Z6RA 3BPXA 5FO5A 3F72A 4RB1A 4NB5A 2ZBKA 3BDDA 3WE2A 2VXZA 3NQOA 2EFNA 2ZMEB 1U3EM 3GW2A 5JFRA 2ISZA 4D0PA 1CGPA 2CW0F 1KQ0A 5F1RA 2PEXA 1I27A 3WU0A 3BWGA 1DPUA 3R61A 2JT1A 2VBUA 1E2XA 1BIAA 4L9TA 3ZQ7A 5IT3A 2NNYA 2O0YA 1JHFA 5J8FA 4WK8F 4BXUA 5BOXA 3GZ6A 1KU9A 4Y13A 1W4MA 1DP7P 5HDGA 1P4AA 4YFNF 4A6EA 4XSZF 3FHZA 2DU9A 1KU2A 1O3RA 1EH6A 2RKHA 1LEAA 3M7GA 2CWEA 4RGSA 2GXGA 3KFWX 2ZXJA 3P7NA 3IHUA 1T6ZA 3T1BA 3G73A 2OYNA 2RVCA 5DUIA 2RNJA 2VC0A 2Z33A 3CO7C 4M9XA 3I59A 4ZZLA 1LQ1A 4UXNA 2FBKA 2MLGA 2VBXA 4P96A 4A6DA 1XN7A 2QM3A 3IL2A 5L3CA 1KGSA 3ZMVA 3KETA 3WTUC 5LLQA 3GYHX 1RI7A 4LD5A 1U5TA 2JTVA 1MD0A 2M87A 3RIRA 2PN6A 1G3YA 1FNNA 2F5FA 1XMAA 4BH9A 4CYDA 1BI3A 2A3SA 3GWZA 1BI2A 1ZGAA 3FZVA 3CO6C 4HA8A 1OMIA 2C6YA 3U9GA 4IXAA 3V7RA 2EFOA 3FX3A 5HS9A 2WTEA 4MTEA 1CF7B 3KZYA 5AONA 2F5CA 1MJAA 3DP7A 1MZBA 2E1NA 1LJ9A 5A2QZ 1TTYA 3QPTA 1YS7A 2NAZA 3ABUA 1FZPB 3FWEA 4ZYGA 4OIPF 2DFIA 3C7JA 2QVOA 3GZ5A 1FBQA 4U0WA 3KLNA 3GVAA 3KCCA 1J5YA 4AIHA 4ASNA 2BE5F 5HDKA 1RZ4A 2GXBA 4HW0A 3R0AA 3DV8A 2VONA 1F1ZA 2X0KA 2A6EF 1HW5A 1QNTA 3VFZA 1T2KA 2DBBA 1DPRA 1LB2A 2H94A 2ADUA 4ON0A 5JI6A 2PG4A 1MDMA 4M74A 4L5JA 5A2QK 2QBYB 5L3FA 5CVRA 4IRHA 2D1HA 1G4DA 1FT9A 2W25A 3BPVA 1BOAA 2HKXA 4HDUA 2PFBA 2QENA 3ZUGA 3T0YA 5D5VB 4IHSA 1K79A 2PBIA 1YLFA 2VBTA 5K1YA 5ERIA 5HLIA 5CVUA 2ZO4A 3V8JA 3KEQA 5CVIA 3K1PA 1U5TC 1FYMA 1FC3A 2DK5A 4M6XA 1I1GA 3DFGA 3HSFA 2J5PA 2EA4A 4RAZA 1P2FA 1G3WA 2VC1A 4QLCU 2PI0A 2WC2A 2Q8KA 4KICA 1P4WA 2CSOA 2FQ3A 3CJNA 4OINF 1BJAA 4LLNA 1R1TA 2M8EA 1ZG1A 1KU3A 2XAJA 3FM5A 2ISYA 3J81Z 1REPC 1ZRCA 4Q5SF 4UV9A 1IXSB 1FYKA 1FLIA 3QU3A 2L02A 3F8FA 3M1EA 5FFZA 2JSCA 2KKOA 3SZTA 3IRRA 1KQ9A 2V9VA 5J8CA 1D3YA 3IWFA 3EYYA 1ZRFA 5ED4A 3O2PE 1BBYA 2CQKA 3IKTA 2E7XA 4HDVA 1E17A 2COMA 1H9GA 5HS7A 5FGMA 3TQNA 1QQIA 2FF4A 2LKPA 1ZRDA 4RB2C 1IRGA 1ZARA 3EYIA 3FF5A 4E70A 2NS0A 2VBZA 3GFIA 4O6JA 3Q9SA 4EM0B 2CO5A 1L3LA 1P6RA 2GA2A 4M9ZA 3IRQA 4ETSA 1EV7A 4U0VA 2EK5A 4IVNA 2LNBA 3CDHA 4XSXF 3QPHA 5LEJA 1I1SA 2FE3A 2EFPA 5E17F 1XGOA 3ZMSA 4P5OA 5F64A 2Q0OA 4I0BA 2IT0A 1FPQA 1MJBA 1Z91A 1ZGJA 4UVCA 2GIVA 2XAGA 2BYVE 4P55A 4EGYA 5K5QA 3DPTA 1W5TA 3HYIA 5DV5A 1FBSA 1U8RA 3I59B 3ZMUA 4FHTA 4KYWA 4MQ9F 1IZ1A 3T5XA 4Z2YA 2HTJA 3GXOA 4AWXB 2I1LA 1TQPA 3LA7A 3D0SA 3GUDA 5D8KB 3FXQA 3HRMA 3V7SA 4CXFA 3RI4A 4EM2A 5K5RA 1U5TB 5A89A 2P7CB 4WXDA 2DO7A 1SMYF 2F5EA 4WF2A 5FLXZ 3ECOA 4FX4A 2K4JA 3CLOA 1GVJA 2KIFA 3JW4A 3BJOA 5JVTA 3CTAA 4WWCA 1JHHA 2RV8A 1W7PA 1QZYA 2QUFA 3ML6A 2FEZA 4ESFA 4CHUA 5DCFA 2NNNA 3I4PA 1UFMA 4I7HA 3HRUA 2X4HA 2A68F 2KJBA 2DLLA 1OYIA 1YQAA 2DTRA 5FLXK 2J5OA 3TKYA 2AS5F 3N97A 3M9AA 1P4MA 5H20A 5D6FA 3RYRA 1RUNA 4H0EA 2F2EA 4WX9A 2FBIA 5CYVA 1XCBA 3V7CA 4ZZDA 2DPDA 1XSXA 1WQ2A 4HX7A 2OQGA 5BQTA 2YX7A 3SFZA 1TW2A 2DW4A 5IT9Z 1OPCA 1GHCA 5TRDA 3K9TA 3C1DA 3ROUA 4OOIA 3G3ZA 4HAMA 1YW7A 1Z6TA 1F9NA 4JBAA 1U6GA 3RJPA 4FT8A 1XD7A 3V4GA 2XKPA 3TOAA 4L0YB 2JRTA 2ELHA 5DCMA 3RKXA 1HKSA 3BJAA 4JQFA 1RUOA 2GAUA 5IT9K 1TLHB 4PGHA 1IUYA 4LK1F 4WXCA 5CJ9A 3COAC 1OR7A 1ULYA 3LSTA 3F23A 1GXQA 2MC3A 2Z99A 3ECHA 4OMYA 2XIGA 4R1HA 4HF1A 4AIJA 2V1DA 1KYZA 2ZNZA 3J7AO 1LDJA 5KK1A 2W84A 2H27A 4LG0A 4A5MA 4BQAA 5LGNA 3LAJA 1YTYA 2W57A 1UHMA 1S4MA 2HFHA 1F5TA 2P6SA 2GWRA 4AVPA 3KE2A 4ZH4F 4F7ZA 5CVJA 4IRIA 2P7VB 4PGGA 2ETHA 1BIBA 2TDXA 3ELKA 3GEZA 4IPAA 4HF0A 4I02A 4G7ZF 3DF8A 4KIFA 4HLXA 1N07A 1IN6A 4HQMA 2HKOA 2HEOA 3O3KA 2E1CA 3TO9A 2P4WA 5DUKA 1LNWA 1ZLJA 2QQBA 5CLSA 2BEOA 2YSRA 4ENMA 1Z9CA 2VOOA 2H6CA 1BI1A 1V3FA 3JAMZ 2IA0A 4BHPA 3VEPA 1S29A 4G7OF 3WTSC 1IF1A 3DEUA 4LB6B 2IRFG 4TV7A 1MGTA 2O6GE 3ABTA 1D8KA 3HUGA 2UZKA 3P9CA 3ERED 2HOEA 3HOSA 1TW3A 3QRFF 3I5UA 2D45A 4L9VA 2MBFA 2HDCA 1FBUA 3E6CC 2XGXA 4HOBA 2FMLA 3LAPA 4UUVA 4N0BA 1R5GA 2VOPA 1J59A 3JAMK 2O8XA 4GGGA 5DYMA 1K78B 3HHG