The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
70
|
sequence length |
219
|
structure length |
219
|
Chain Sequence |
DQYYRAIKKIKEAAEASNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKRGQILNITEKGLDVLYTEFADLSRILAIKNNVVITGTVTSGMGEGRYYVARKQYIIQFQEKLGIIPYLGTLNIKVDQASLPELRKIRGFRGIHIEGFKTEDRTFGSVKAFPAKIQNIPCFVIMPERTVYTDVIEIISDKYLREEINLHDGDRVSVEVYTEGH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of RbkR (Riboflavin Kinase) from Thermoplasma acidophilum determined in complex with CTP and its cognate DNA operator
rcsb |
| molecule tags |
Transferase/dna
|
| source organism |
Thermoplasma acidophilum
|
| molecule keywords |
Riboflavin kinase
|
| total genus |
70
|
| structure length |
219
|
| sequence length |
219
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
2.7.1.161: CTP-dependent riboflavin kinase. |
| pdb deposition date | 2016-10-26 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01982 | CTP-dep_RFKase | Domain of unknown function DUF120 |
| A | PF13545 | HTH_Crp_2 | Crp-like helix-turn-helix domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant, subunit A | Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | ||
| Mainly Beta | Beta Barrel | Elongation Factor Tu (Ef-tu); domain 3 | Riboflavin kinase-like |
