5TVOB

Crystal structure of trypanosoma brucei adometdc-delta26 monomer
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
59
structure length
59
Chain Sequence
b'SFEGPEKRLEVIMRVVDGTHVSGLLAHDDDVWQKVIDAICAHIVSREFNEYIRSYVLSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine decarboxylase proenzyme
publication title Relief of autoinhibition by conformational switch explains enzyme activation by a catalytically dead paralog.
pubmed doi rcsb
source organism Trypanosoma brucei brucei (strain 927/4 gutat10.1)
molecule tags Lyase
total genus 9
structure length 59
sequence length 59
ec nomenclature ec 4.1.1.50: Adenosylmethionine decarboxylase.
pdb deposition date 2016-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.50 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 S-adenosylmethionine decarboxylase 5tvoB00
3H0WB 3EP6B 1I7BB 3DZ7B 3EP7B 1I79B 3EP8B 5TVOB 3EP9B 1MHMB 3DZ5B 3EP4B 1JENB 3DZ6B 1I7MB 1I7CB 3DZ2B 3H0VB 3EPAB 1I72B 3EP5B 3DZ4B 3DZ3B 3EPBB 3EP3B
chains in the Genus database with same CATH superfamily
2VYVA 1NBOA 4H3VA 5EERA 3WBFA 2GZ3A 3CEAA 3U3XA 2B4RO 2BHLA 5EIOA 1IHXA 1H6CA 1P9LA 4PLPA 1RM3A 4R51A 3DO5A 4RL6A 5T73A 1YL7A 1NWHA 4R4JA 3JSAA 4HADA 3DOCA 2CZCA 3B1KA 1DIHA 3EP3B 3LC1O 3UW3A 1QMIA 2OZPA 2XF8A 2EP5A 1H94A 1NVMB 5A06A 4MVJG 3DTYA 1H93A 3DR3A 4PG7A 1OZAA 3E1KA 3DZ2B 1F06A 1XEAA 3DZ3B 1DPGA 4MKXA 3EVNA 4PG5A 4R54A 2Q22A 1U1IA 4R3NA 3FD8A 2NQTA 4ZICA 2D2IA 1LC0A 3RC9A 1BRMA 4L8VA 4MVJE 3NT2A 3GFGA 5M6DA 3EP4B 2GD1O 5EESA 1E5QA 4XB2A 1UYJA 3ZCXA 1CF2O 2FPNA 3IP3A 5KVSA 3BTVA 3V1YA 2PKQO 4CLQA 4NHEA 1DSSG 3RVDA 4GMFA 1S7CA 3BTSA 4PG6A 2I3GA 3NT5A 1PQUA 3GDOA 1GCUA 5A04A 3V5NA 3Q0EA 1T4DA 2PKQP 1Q2XA 1I7CB 1EBFA 2I5PO 3HSKA 3B1JA 3WGZA 3TUXA 3EPBB 1QKIA 1DC3A 3KV3O 5KVQA 5JYEA 4GMGA 1P1FA 4MJLA 3PWKA 3EP8B 1XYGA 1RM5A 3PFWO 2Q49A 3PYLA 2EP7A 1NQ5A 2IXAA 4KOAA 3DZ4B 3TV1A 3C8MA 3KUXA 1GD1O 5C7LO 3HQ4O 3PQVA 2DUUA 3QVSA 1I32A 4TVBA 4XQ9A 4EW6A 4IQ8A 3E9MA 3INGA 1DC6A 5A05A 3H9EO 1PR3A 3ABIA 5EINA 2GLXA 4MVJH 3E82A 3IWDB 2QZ9A 1T4BA 1LA2A 4PG8A 5JYFA 1DBVO 2G17A 3DB2A 1DC4A 4GQAA 3QV1A 3WGYA 3IDSA 2Q4EA 4O59O 1H9BA 4XQEA 2YV3A 3QVTA 4DBVO 2YYYA 3STHA 3QY9A 3RBVA 1GR0A 2DAPA 4JN6B 1DRWA 3MZ0A 4MVJA 3GPDG 3NTRA 3V2UA 3OHSX 2X0NA 1H9AA 1VKOA 1VSUA 4MVJF 3HNPA 4AK1A 1GL3A 4YDRA 1DRUA 5AQ1A 4LGVA 2VYND 1ARZA 1MB4A 2GZ1A 1Q7GA 1E5LA 1RM0A 2X5JO 1H6DA 4LSMA 3WYBA 3PZRA 1FF9A 3PYXA 3DZ5B 4WNCA 5C7OO 5JW6A 4P8RA 3DZ6B 3RC2A 4ZHSA 1H6AA 3E6AA 3NTOA 2DC1A 2VYVD 2G82A 4MKZA 2AXQA 3EP6B 3FHLA 4IQ0A 4WOJA 3EP7B 3WBBA 3IWCB 1IHYA 1NPTO 3TW3A 3C1AA 3QVXA 1PS8A 3K2BA 2IXBA 1PQPA 1RYDA 2O48X 1MHMB 1VM6A 2POQX 1YDWA 3ZDFA 2BH9A 3PZBA 3F4LA 1RM4A 3VAZA 4R5MA 4XB1A 5GZ6A 4DPLA 3NTQA 3DZ7B 1H6BA 1YS4A 1U8FO 3Q2KA 1MC4A 3QW2A 1NQOA 1HDGO 4MVJI 3Q1LA 4QX6A 1SZJG 3Q11A 3OA2A 4XQCA 1EVJA 2CVOA 1NX6A 3EP5B 4WNIA 1NWCA 4L9RA 3WGQA 3CINA 3EZYA 1CERA 4LRTB 2VYNA 2X5KO 1H2HA 2PKRA 3VOSA 2R00C 1A7KA 4O89A 1C3VA 1JKFA 3K9QO 4F3YA 3BIOA 1E77A 4INAA 3RCBA 2R00A 3TUTA 3EP9B 3HXLA 4MIEA 1I7MB 1QXSA 1DRVA 3LC2O 1I72B 3LC7O 5CEFA 3GNQA 2NVWA 1I79B 3WYCA 1JKIA 1YL5A 4XR4A 4PG4A 4XRGA 3WB9A 3NT4A 4MINA 4N54A 5GZ3A 1JENB 3TZ6A 2HJSA 3H0VB 1K3TA 4MIYA 1GYQA 5A03A 1EBUA 3KSDO 3LVFO 1J0XO 1LC3A 1OBFO 3DAPA 1OFGA 3IJPA 3L6OO 4YWJA 2DBVO 1QMHA 1E7MA 1PU2A 2P2SA 2HO5A 4II7A 1GPDG 4MVJP 1CRWG 4MIOA 1GADO 4HKTA 1P1KA 3MTJA 1P1JA 1J5PA 3I23A 3EUWA 4O8JA 3EC7A 5BNTA 1E7YA 1I7BB 1ML3A 3DBVO 1TLTA 1GAEO 3RC7A 4DIBA 1NQAO 3MOIA 4GPD1 3HJAA 1JN0A 4O63O 1DC5A 2GZ2A 5J9GA 4BOYA 1YL6A 2PH5A 1I33A 5C7IO 3EPAB 3KSZO 3ZJXA 3DMTC 2B4TO 3IWBB 1ZNQO 5DDIP 4DPKA 1TB4A 4K9DA 3H0WB 3DMTA 1P1HA 3CIFA 5AVOA 1ZH8A 1TVEA 4FB5A 3M2TA 3CPSA 4XQGA 3OQBA 3WGOA 2HKIA 3O9ZA 4MVJD 4LRSB 1VKNA 3PWSA 3CMCO 1GYPA 3UUWA 3PYMA 4Z0HO 3L0DA 4R41A 5GZ1A 1RYEA 1P1IA 2DPGA 3E18A 4R3WA 2GYYA 2EJWA 3OA0A 4DPMA 1DAPA 5A02A 1VSVA 3B20A 3E5RA 3KGDA 1TA4A 3RC1A 5JY6A 5TVOB 1B7GO 5JYAA 2O4UX 1YWGO 2H63A 3L4SO 4R5HA 1VC2A 3K73O 3Q2IA 3BTUA 2I3AA 4MVJM 3QVWA
chains in the Genus database with same CATH topology
3DZ3A 3EP6B 3EPBA 3H0WB 3DZ4A 1I7BB 3DZ7B 1VR7A 1TMIA 1JL0A 3EP7B 1I79B 3EP3A 3H0WA 1MSVA 3EP6A 1I7BA 3DZ7A 3EP7A 3EP8B 1I79A 5TVOB 3EP9B 1MHMB 3DZ5B 3EP4B 3EP8A 1JENB 3DZ6B 1I7MB 5TVOA 3EP9A 1I7CB 3DZ2B 3H0VB 1MHMA 3DZ5A 3EP4A 3EPAB 1I72B 1TLUA 1JENA 3DZ6A 3EP5B 1I7MA 2IIIA 1I7CA 3DZ4B 3DZ3B 3DZ2A 3EPBB 3H0VA 3EPAA 1I72A 3EP5A 3EP3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0W B;  3EP6 B;  1I7B B;  3DZ7 B;  3EP7 B;  1I79 B;  3EP8 B;  5TVO B;  3EP9 B;  1MHM B;  3DZ5 B;  3EP4 B;  1JEN B;  3DZ6 B;  1I7M B;  1I7C B;  3DZ2 B;  3H0V B;  3EPA B;  1I72 B;  3EP5 B;  3DZ4 B;  3DZ3 B;  3EPB B;  3EP3 B; 
#chains in the Genus database with same CATH topology
 2VYV A;  1NBO A;  4H3V A;  5EER A;  3WBF A;  2GZ3 A;  3CEA A;  3U3X A;  2B4R O;  2BHL A;  5EIO A;  1IHX A;  1H6C A;  1P9L A;  4PLP A;  1RM3 A;  4R51 A;  3DO5 A;  4RL6 A;  5T73 A;  1YL7 A;  1NWH A;  4R4J A;  3JSA A;  4HAD A;  3DOC A;  2CZC A;  3B1K A;  1DIH A;  3EP3 B;  3LC1 O;  3UW3 A;  1QMI A;  2OZP A;  2XF8 A;  2EP5 A;  1H94 A;  1NVM B;  5A06 A;  4MVJ G;  3DTY A;  1H93 A;  3DR3 A;  4PG7 A;  1OZA A;  3E1K A;  3DZ2 B;  1F06 A;  1XEA A;  3DZ3 B;  1DPG A;  4MKX A;  3EVN A;  4PG5 A;  4R54 A;  2Q22 A;  1U1I A;  4R3N A;  3FD8 A;  2NQT A;  4ZIC A;  2D2I A;  1LC0 A;  3RC9 A;  1BRM A;  4L8V A;  4MVJ E;  3NT2 A;  3GFG A;  5M6D A;  3EP4 B;  2GD1 O;  5EES A;  1E5Q A;  4XB2 A;  1UYJ A;  3ZCX A;  1CF2 O;  2FPN A;  3IP3 A;  5KVS A;  3BTV A;  3V1Y A;  2PKQ O;  4CLQ A;  4NHE A;  1DSS G;  3RVD A;  4GMF A;  1S7C A;  3BTS A;  4PG6 A;  2I3G A;  3NT5 A;  1PQU A;  3GDO A;  1GCU A;  5A04 A;  3V5N A;  3Q0E A;  1T4D A;  2PKQ P;  1Q2X A;  1I7C B;  1EBF A;  2I5P O;  3HSK A;  3B1J A;  3WGZ A;  3TUX A;  3EPB B;  1QKI A;  1DC3 A;  3KV3 O;  5KVQ A;  5JYE A;  4GMG A;  1P1F A;  4MJL A;  3PWK A;  3EP8 B;  1XYG A;  1RM5 A;  3PFW O;  2Q49 A;  3PYL A;  2EP7 A;  1NQ5 A;  2IXA A;  4KOA A;  3DZ4 B;  3TV1 A;  3C8M A;  3KUX A;  1GD1 O;  5C7L O;  3HQ4 O;  3PQV A;  2DUU A;  3QVS A;  1I32 A;  4TVB A;  4XQ9 A;  4EW6 A;  4IQ8 A;  3E9M A;  3ING A;  1DC6 A;  5A05 A;  3H9E O;  1PR3 A;  3ABI A;  5EIN A;  2GLX A;  4MVJ H;  3E82 A;  3IWD B;  2QZ9 A;  1T4B A;  1LA2 A;  4PG8 A;  5JYF A;  1DBV O;  2G17 A;  3DB2 A;  1DC4 A;  4GQA A;  3QV1 A;  3WGY A;  3IDS A;  2Q4E A;  4O59 O;  1H9B A;  4XQE A;  2YV3 A;  3QVT A;  4DBV O;  2YYY A;  3STH A;  3QY9 A;  3RBV A;  1GR0 A;  2DAP A;  4JN6 B;  1DRW A;  3MZ0 A;  4MVJ A;  3GPD G;  3NTR A;  3V2U A;  3OHS X;  2X0N A;  1H9A A;  1VKO A;  1VSU A;  4MVJ F;  3HNP A;  4AK1 A;  1GL3 A;  4YDR A;  1DRU A;  5AQ1 A;  4LGV A;  2VYN D;  1ARZ A;  1MB4 A;  2GZ1 A;  1Q7G A;  1E5L A;  1RM0 A;  2X5J O;  1H6D A;  4LSM A;  3WYB A;  3PZR A;  1FF9 A;  3PYX A;  3DZ5 B;  4WNC A;  5C7O O;  5JW6 A;  4P8R A;  3DZ6 B;  3RC2 A;  4ZHS A;  1H6A A;  3E6A A;  3NTO A;  2DC1 A;  2VYV D;  2G82 A;  4MKZ A;  2AXQ A;  3EP6 B;  3FHL A;  4IQ0 A;  4WOJ A;  3EP7 B;  3WBB A;  3IWC B;  1IHY A;  1NPT O;  3TW3 A;  3C1A A;  3QVX A;  1PS8 A;  3K2B A;  2IXB A;  1PQP A;  1RYD A;  2O48 X;  1MHM B;  1VM6 A;  2POQ X;  1YDW A;  3ZDF A;  2BH9 A;  3PZB A;  3F4L A;  1RM4 A;  3VAZ A;  4R5M A;  4XB1 A;  5GZ6 A;  4DPL A;  3NTQ A;  3DZ7 B;  1H6B A;  1YS4 A;  1U8F O;  3Q2K A;  1MC4 A;  3QW2 A;  1NQO A;  1HDG O;  4MVJ I;  3Q1L A;  4QX6 A;  1SZJ G;  3Q11 A;  3OA2 A;  4XQC A;  1EVJ A;  2CVO A;  1NX6 A;  3EP5 B;  4WNI A;  1NWC A;  4L9R A;  3WGQ A;  3CIN A;  3EZY A;  1CER A;  4LRT B;  2VYN A;  2X5K O;  1H2H A;  2PKR A;  3VOS A;  2R00 C;  1A7K A;  4O89 A;  1C3V A;  1JKF A;  3K9Q O;  4F3Y A;  3BIO A;  1E77 A;  4INA A;  3RCB A;  2R00 A;  3TUT A;  3EP9 B;  3HXL A;  4MIE A;  1I7M B;  1QXS A;  1DRV A;  3LC2 O;  1I72 B;  3LC7 O;  5CEF A;  3GNQ A;  2NVW A;  1I79 B;  3WYC A;  1JKI A;  1YL5 A;  4XR4 A;  4PG4 A;  4XRG A;  3WB9 A;  3NT4 A;  4MIN A;  4N54 A;  5GZ3 A;  1JEN B;  3TZ6 A;  2HJS A;  3H0V B;  1K3T A;  4MIY A;  1GYQ A;  5A03 A;  1EBU A;  3KSD O;  3LVF O;  1J0X O;  1LC3 A;  1OBF O;  3DAP A;  1OFG A;  3IJP A;  3L6O O;  4YWJ A;  2DBV O;  1QMH A;  1E7M A;  1PU2 A;  2P2S A;  2HO5 A;  4II7 A;  1GPD G;  4MVJ P;  1CRW G;  4MIO A;  1GAD O;  4HKT A;  1P1K A;  3MTJ A;  1P1J A;  1J5P A;  3I23 A;  3EUW A;  4O8J A;  3EC7 A;  5BNT A;  1E7Y A;  1I7B B;  1ML3 A;  3DBV O;  1TLT A;  1GAE O;  3RC7 A;  4DIB A;  1NQA O;  3MOI A;  4GPD 1;  3HJA A;  1JN0 A;  4O63 O;  1DC5 A;  2GZ2 A;  5J9G A;  4BOY A;  1YL6 A;  2PH5 A;  1I33 A;  5C7I O;  3EPA B;  3KSZ O;  3ZJX A;  3DMT C;  2B4T O;  3IWB B;  1ZNQ O;  5DDI P;  4DPK A;  1TB4 A;  4K9D A;  3H0W B;  3DMT A;  1P1H A;  3CIF A;  5AVO A;  1ZH8 A;  1TVE A;  4FB5 A;  3M2T A;  3CPS A;  4XQG A;  3OQB A;  3WGO A;  2HKI A;  3O9Z A;  4MVJ D;  4LRS B;  1VKN A;  3PWS A;  3CMC O;  1GYP A;  3UUW A;  3PYM A;  4Z0H O;  3L0D A;  4R41 A;  5GZ1 A;  1RYE A;  1P1I A;  2DPG A;  3E18 A;  4R3W A;  2GYY A;  2EJW A;  3OA0 A;  4DPM A;  1DAP A;  5A02 A;  1VSV A;  3B20 A;  3E5R A;  3KGD A;  1TA4 A;  3RC1 A;  5JY6 A;  5TVO B;  1B7G O;  5JYA A;  2O4U X;  1YWG O;  2H63 A;  3L4S O;  4R5H A;  1VC2 A;  3K73 O;  3Q2I A;  3BTU A;  2I3A A;  4MVJ M;  3QVW A; 
#chains in the Genus database with same CATH homology
 3DZ3 A;  3EP6 B;  3EPB A;  3H0W B;  3DZ4 A;  1I7B B;  3DZ7 B;  1VR7 A;  1TMI A;  1JL0 A;  3EP7 B;  1I79 B;  3EP3 A;  3H0W A;  1MSV A;  3EP6 A;  1I7B A;  3DZ7 A;  3EP7 A;  3EP8 B;  1I79 A;  5TVO B;  3EP9 B;  1MHM B;  3DZ5 B;  3EP4 B;  3EP8 A;  1JEN B;  3DZ6 B;  1I7M B;  5TVO A;  3EP9 A;  1I7C B;  3DZ2 B;  3H0V B;  1MHM A;  3DZ5 A;  3EP4 A;  3EPA B;  1I72 B;  1TLU A;  1JEN A;  3DZ6 A;  3EP5 B;  1I7M A;  2III A;  1I7C A;  3DZ4 B;  3DZ3 B;  3DZ2 A;  3EPB B;  3H0V A;  3EPA A;  1I72 A;  3EP5 A;  3EP3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...