5U1PA

Crystal structure of nadp-dependent carbonyl reductase from burkholderia multivorans in complex with nadp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
225
structure length
225
Chain Sequence
MKTVLIVGASRGLGREFVRQYQRDGWNVIATARDDASLAALRALGAHAHALDITQPEQIAALGWKLDGERLDVAVVVSGVYGPRTEGVETIASDDFDTVMHTNVRGPMQLLPILLPLVEDARGVLAVVSSRMGSISEATGTTGWLYRASKAALNDVLRIASLQTRHAACISLHPGWVRTDMGGAQAALDPATSVTGMRRVIAEAGADVSQSNGRFFQYDGVELSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NADP-dependent carbonyl reductase from Burkholderia multivorans in complex with NADP
rcsb
source organism Burkholderia multivorans (strain atcc 17616 / 249)
molecule tags Oxidoreductase
molecule keywords NADPH-dependent carbonyl reductase
total genus 90
structure length 225
sequence length 225
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2016-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5u1pA00
4HNHA 1Y8QA 4J1SA 3ZV4A 3PFWO 2CUKA 3R6DA 2PV7A 5I9LA 5L3ZA 1HF3A 1PJBA 4XIJA 1PGOA 2B83A 1BXGA 3VPXA 4ALMA 4DIFA 4PG6A 3WLEA 3WYEA 3GMSA 4YAGA 3S2IA 2V6BA 4O5OA 4FGSA 1VKOA 1EDZA 3UFXA 2J5QA 1DFHA 1NASA 3ZV3A 2UDPA 1MP0A 1PJCA 4Z3KA 2HKIA 4L8VA 2BRUA 5FYDA 3JQGA 1ZEMA 2HLPA 3A28A 5MGBA 4IQGA 4YR9A 2YJZA 4AJ1A 2ZQYA 4U7WA 1AXEA 1G0OA 3Q3CA 2OP0A 3GPIA 2G0TA 4PCVA 1I3MA 2PFGA 3E8XA 4QFCA 1VI2A 5TT0A 1ZXLA 1R6DA 2DAPA 2Y93A 1NX6A 3PJEA 3OA0A 4F6LA 3MJVA 4R1NA 4CLXA 3IP1A 4E33A 1Y9EA 4DMMA 4E0BA 5CDYA 1GAEO 1U4OA 4CMHA 2Y1CA 2YW9A 4UEOA 5HM8A 4DL9A 3GY0A 4N5NA 2PTGA 1WDKA 4B4VA 5JC8A 1ZK2A 4JJGA 4AFNA 1PGNA 1I2BA 2FZWA 3FR7A 4J4TA 1ISHA 5TGDA 4AVYA 2Q2QA 3PTZA 2FPIA 3WGOA 5T6BA 2DBZA 2GPTA 1U8XX 1U28A 4CL3A 3I4FA 2G17A 4LMPA 1ZUD1 3QWFA 1M75A 1B8PA 5ENDA 4MVJP 3I6IA 2I76A 4LMRA 2JHFA 4XA8A 4YJFB 3RUHA 4PRKA 3KEQA 4OH1A 4JXKA 6LDHA 4M89A 2A92A 3ZW9A 1ENYA 3ASUA 4YQYA 4BO5A 5JFOA 3ZWWA 5L7TA 3PHGA 4YRAA 1LDYA 3O26A 4OL9A 3PHJA 3WB9A 3BTOA 3PZRA 3TFOA 2FOIA 3TNLA 3UCEA 5L95A 3ZU5A 3F1LA 1OBFO 4GWGA 5ER9A 2VUUA 3PYMA 4BVAA 3LU1A 2VHZA 4Y67A 4J9UE 3OM9A 1LSJA 4GX5A 4ZN6A 3AUAA 2WTBA 5H82A 4BO1A 2O7SA 3JYNA 2I9PA 4FSHA 2OL4A 1PZGA 3BTUA 1UZLA 2ZK7A 4FDAA 4E32A 3H5AA 4YAEA 1VPDA 2Y1EA 3ABIA 2Y68A 1JU9A 1AE1A 4GSLA 3U9LA 1P3DA 4O1MA 3OQ6A 1HXHA 2X5OA 3VPGA 2QRLA 1LDMA 3QJ5A 3WIEA 3LYLA 4EEZA 4PFJA 3W4IA 3B20A 1DFGA 1UAYA 4AL4A 4ALKA 3CH6A 3KEOA 2VUTA 2BI7A 1E7MA 2EXXA 2QIOA 2W8ZA 4PLZA 3UGKA 1VE9A 1CJCA 1FJHA 1Y6JA 2P91A 1SO8A 3HHPA 4JQCA 3TRIA 1DC4A 1C3VA 3PWKA 1KVSA 2O7QA 4AJKA 1BVRA 4RZHA 2NU6A 4BUCA 1HEUA 1Y5MA 4WLEA 4YT5A 4C7KA 1GADO 1GZ4A 3GFBA 4YVFA 1U3UA 1M66A 4BNWA 2J3KA 5JDIA 1LI4A 2Z95A 1E77A 4J0FA 2DTDA 3TZQA 5C7IO 4JN6B 3K8ZA 2GN8A 3ST7A 3N58A 2ZCVA 5KIAA 4QO7A 2YHIA 2Q1TA 1HTBA 3FBGA 3GOHA 4YAJA 2VCYA 5IAAA 5ES3A 1I24A 2E49A 3FNEA 3EK2A 1YRLA 3WSVA 3GN1A 4NBRA 2JFGA 2FR1A 4R9SA 4YJGB 2VWQA 3TPCA 4PRLA 1PQUA 3ONFA 3HJAA 1XR3A 1BXZA 1JAYA 1ZZEA 2ZYAA 4II3A 3RAJA 4RLSA 5LDGA 4NQZA 2P9GA 1KC3A 4PZEA 3PP8A 4UEKA 2I67A 4HFJA 2HMWA 4IGEA 3FTPA 1ZXBA 3KVOA 5F21A 3DZKA 4BNUA 4TSKA 4BNJA 4YBZA 2VQ3A 2HMTA 2ZCUA 4E5MA 5COQA 1UXGA 1NTOA 3H9GA 4YJHB 1RYDA 5F1OA 4OSPA 2AE2A 2DBQA 3E9MA 3JYQA 4WCDA 1RM3A 2PH5A 1Y9AA 1MV8A 1P1FA 1GDHA 3EY4A 3H3FA 1LSUA 1QSGA 5A3JA 2WSBA 1ENZA 1X7HA 4OOFA 3PHIA 4O0LA 2IODA 4D43A 4D42A 4MVJG 4WOJA 3JQDA 1NAHA 1QYWA 2GR9A 5AXCA 1KIFA 2D2IA 4DQUA 4WKGA 2OGUA 5IDQA 3I3OA 3I4CA 2FSVA 5KNLA 4DA9A 1VLLA 3GHHA 5JY6A 2OO5A 2Y1DA 4FFOA 1I8TA 1UP6A 3ONEA 2YY7A 1O5IA 5K9ZA 1FDVA 3DZJA 1UDAA 3IJRA 3JD1A 4BO7A 5FWNA 4DPMA 1C1XA 1CWUA 3QW2A 3NJ8A 2BGKA 4N18A 3RVDA 1NYTA 3AJRA 4H16A 1N8KA 3TL2A 3QSGA 2VN8A 4YT8A 1O94A 4FGWA 1GQQA 2Q2VA 1LDEA 2NTNA 3T7CA 4E2WA 4AJJA 2CFCA 2ZB4A 1U4SA 5EINA 4B3JA 3BXXA 4IDEA 1KYQA 5G0TA 1UXJA 3DBRA 4W9NC 3NYWA 4JROA 4GBJA 1UXHA 1MG5A 1UH5A 5HS6A 3PK0A 4MVJA 2ZB3A 3LT2A 5A9SA 1HETA 1PS0A 3V1UA 3L0DA 5KVQA 2YQ4A 4IUYA 3L07A 5KCZA 4UVDA 5F1KA 4B79A 1JA9A 3RIHA 3O9ZA 1CIVA 1T2AA 3VAZA 4CV3A 2YUTA 3M1AA 4RVHA 3EUWA 2WWRA 2Z1NA 4DPLA 2C59A 4HBGA 2ZJ0A 1QYXA 3C85A 1XSEA 1R37A 4I9NA 4J9VA 3ZW8A 5CAEA 4FFPA 3U5TA 5EMHA 3E03A 1BHSA 3L77A 3LC1O 4KUGA 2OBYA 3PQFA 3IIEA 2IZZA 3VOSA 1EUZA 3O03A 3S2GA 4RF5A 5IFLA 5IZCC 2EP7A 2W90A 5ER6A 4PLHA 2Y05A 1IPFA 1PZEA 1JVSA 1TI7A 4WEQA 4J1NA 1HSOA 3GF4A 4LCEA 3DBRB 4MIEA 2QRJA 3ZWYA 5EESA 2EWMA 3JQAA 3AU9A 5AXDA 1C1DA 5T8KC 1NQ5A 4NU6A 1CQIA 2FSSA 4JNKA 4K6CA 2GSDA 1PWXA 1EVYA 2NQTA 2Z5LA 3HN7A 4ALJA 5FEUA 5DP2A 4EJMA 2E4AA 1E1LA 3JQFA 1PGPA 4Q3BA 1NFRA 1NAIA 3K92A 1CYDA 5EPOA 1R0SA 1D3AA 1W0CA 2NU7A 3H9EO 5KJEA 3EVTA 2VZ8A 3LT4A 4HADA 1B8VA 5F1PA 1HDRA 1EVZA 4WE3A 1UZNA 1N9GA 3GC6A 2YV2A 3WG9A 4D3DA 3VZRA 1C0LA 2IZ0A 1LBEA 4RPLA 2QX7A 3L4SO 4P4NA 1F0YA 1PZFA 3GAZA 3Q1LA 1K6XA 3UCFA 3OIDA 3KRTA 4RDIA 5DBGA 3TFQA 2BFAA 3VKUA 4M54A 4CV2A 2C2XA 2FR0A 2JJYA 4E2YA 3CINA 3Q9UA 3JQ7B 2VT2A 3FSRA 3QQPA 1XGKA 2W2KA 1KEUA 4XJTA 2VUSA 3RASA 3DQPA 5TQVA 3ONDA 4MKXA 3RBVA 3VZPA 3AOEC 1EK6A 3RFTA 3MWDB 1YS4A 4ZGWA 3K31A 1U7TA 5JCJD 1MLDA 2BLLA 1E3EA 4XGKA 4CUZA 5JCJA 2HCTA 3GHYA 3DHYA 2I5PO 1DHRA 3FPCA 1IOLA 1HDXA 3V5NA 4CLRB 3DBHA 1WWKA 1N9GB 1X7DA 4KP7A 3VH4A 3LSYA 2VNSA 1IL0A 1P33A 3VH2A 4UEJA 4PG8A 4BKPA 4JJFA 2C29D 3SEFA 1QMGA 2H63A 5CP8A 1V8BA 4XKJA 3WWYA 1QV6A 2X6TA 4IDCA 4LSWA 4ZQEA 2DUWA 2DC1A 1GYPA 3B1JA 8ADHA 3CTMA 1GEEA 1PTJA 2ZQZA 4GSKA 2P4QA 3RD5A 4OKNA 5BT9A 4BMVA 4HKTA 2EIHA 5G0UA 4NPCA 1I36A 4JP2A 3DZHA 4WUVA 1LDBA 1CRWG 1U3TA 3GDFA 1VC2A 2J5RA 4FFLA 2BFOA 5DOVA 2GD1O 2Q3EA 4HFNA 4M1QA 1DC5A 1HE3A 4DTIA 3JQBC 4CM7A 3BMCB 3ZWPA 3WS7A 4MVJH 2ZKLA 4RPHA 2BI8A 1Y8RB 1B3BA 4BNFA 4IPTA 3B1KA 4BMNA 2CSUA 1EUDA 3GDOA 2QHXA 3D3WB 2XF8A 5EN4A 1LLCA 4CQMD 3WSWA 3LF1A 5JAQA 2D4AA 3LDHA 3DTYA 1ADFA 3PQDA 5IDWA 5IXSA 3SC4A 3KBOA 4CLHA 3CZMA 4MP3A 1E3WA 3VVCA 1IYZA 1P45A 2Y99A 1DXYA 3SJUA 2ZYGA 3ROKA 3UHAA 4DIOA 4TVOA 4O59O 2UAGA 3INTA 3GEDA 4DVJA 1P77A 1J6UA 3ZNOA 1ISMA 1LRJA 3OECA 4R69A 5BNFA 4K6FA 4JBGA 5CHEA 4URFA 3HWRA 4II2A 5JW6A 3GRPA 2I99A 3BMCA 1YB4A 1EK5A 3WGGA 1DIAA 3COSA 1PWZA 5JAZA 3VTZA 2QRKA 4AJ4A 1Z7BA 1C14A 4UUMA 5K6AA 3I9JA 4N7RA 2I65A 5GMOA 2P9EA 4E4YA 2E48A 4QUKA 1GQYA 1KETA 1SEVA 4PLCA 4BNVA 1DO8A 3AM3A 3IS3A 3INRA 5JMPA 4GLLA 2NTJA 3NT4A 3DC2A 2CF6A 3JQAD 3PEFA 4L0QA 3KLPX 4OMUA 4GVLA 4WJZA 3PIIA 4YJDA 2QQ5A 4D41A 1CDOA 5TT1A 3LF2A 4GKVA 4OJNA 1SAYA 3LVFO 1ISGA 2B4RO 4BV9A 1IZ9A 1PJQA 1IHXA 1U3WA 1HYGA 3OJ0A 3U49A 1QV7A 1IB6A 3SLGA 4A10A 1WDMA 2NLOA 3ZU3A 4U0KA 1QG6A 4XGIA 1BW9A 3BHIA 3HFSA 4J3FA 3LQFA 3H3JA 3DXFA 5TJHA 5CEEA 3QWHA 1A27A 4WLFA 5IG2A 5IDXA 3L4BC 3VH3A 1BXGB 4JBIA 2EJVA 4K28A 1BG6A 5A04A 4R41A 4L9RA 1R15A 3R3JA 3V1TC 1T26A 2NM0A 3B6ZA 2YYYA 3RWBA 3QVSA 5EERA 1IHYA 1I3NA 2GZ1A 4RVFA 5THQA 3WOHA 1U7HA 3JQ8B 3ITDA 1H6CA 1ZK0A 2HK9A 2O4UX 4GQAA 5KJ6A 3AY3A 2C5AA 5TLSA 3ZWBA 4B4OA 1A71A 1AN9A 1KY4A 1UDCA 5JNLA 1PS8A 1BGVA 1LLQA 1YQXA 4FCCA 3A9WA 2UYYA 1AXGA 3LLSA 5TC4A 1K6JA 4GMFA 2DTXA 1RM4A 4J0EA 2J3HA 3CIFA 3H9QA 4XQGA 4ZQHA 2AW5A 1IULA 2GN9A 2JHGA 1BXKA 4IS3A 3TF5A 2HUNA 4R54A 4DQXA 3ZU2A 4XGNA 5T64A 2BFMA 4J2OA 5AYVA 5B4VA 1DIRA 4JJIA 3RBZA 1IZ0A 5KKAA 3BIOA 3QWAA 3U0BA 1BMDA 1LSSA 2QG4A 3DOOA 1FDUA 4FFMA 1ENOA 4DRYA 1IUKA 3LT1A 1DIGA 1PGJA 5HBRA 5A06A 3WYBA 4ID9A 1M2WA 1R12A 1RKXA 1V35A 4YEDA 4CM9A 1FDWA 5IZ4A 3H7AA 2JD1A 4YRBA 3DMTA 5TRTA 2CVOA 3ZNQA 1ID1A 1MC4A 2A94A 2Y66A 3PVZA 4BNZA 2ZTVA 4MO2A 3H5RA 2NACA 3OEYA 4MINA 5CEFA 9LDBA 2X9GA 2HK7A 4E13A 3DAGA 1U2GA 3OEWA 5A9SB 2IZ1A 4PLPA 1B0AA 3ZH2A 1LRLA 2BF7A 4XRRA 2EV9A 2Q1SA 3F5SA 3GGPA 1RM0A 3MJSA 3GNSA 3PJGA 4FOOA 1XDWA 4JIGA 1E7YA 4RZIA 4DXHA 5KWEA 1HZJA 1PR9A 3L9WA 5I7EA 4G65A 1ML3A 4BGIA 4EUFA 3WBFA 4GKBA 1LEHA 1SOVA 2A4KA 3I1JA 2ZTMA 3RUAA 1Q0LA 4R4JA 3L9XA 1JKFA 3I9MA 1JKIA 3DO5A 3WJ7A 1QLHA 4NJMB 3NT2A 1L7EA 3ZDFA 1BSVA 4R3NA 2R00A 4DYDA 5HS4A 5ILOA 2PA3A 4K1LA 4ND3A 4Y6RA 3PI7A 4JK3A 1HDYA 3PJFA 3KUXA 1DBVO 1RYEA 4D45A 4CM3A 5J23A 3HDQA 2DM6A 4MKZA 2PZMA 4RPGA 4D0RA 2Q4EA 3BMNA 2AG5A 3WJAA 2J6IA 1PR3A 2RHRA 1UJMA 1DJQA 4XQEA 7MDHA 4CV1A 3PWSA 3PQEA 1FDSA 1N2SA 2PGDA 4YRDA 4EGFA 2HMUA 1KBZA 3A1NA 2O3JA 3WDSA 3I5MA 5DP1A 5FF9A 3E82A 4ZQBA 1JLLA 2NNLD 1B3RA 3CEAA 3UCXA 5TSDA 4DIBA 4BO4A 2G1UA 5L7WA 3EZYA 3W8FA 4I08A 1MFPA 1VM6A 1TVEA 3C1AA 2W2LD 3G0OA 4WEOA 4ZJUA 3KXDA 1G0NA 5JDCA 4MVJE 2W2LA 3G49A 3HSKA 2DTEA 4DGSA 5DN9A 3AWDA 4P22A 1ZJZA 1KVUA 4UVEA 4D79A 3JQ7A 3W1VA 3ROQA 3E5MA 2EW2A 3T7EA 1HRDA 3KETA 1I33A 3NDJA 1Z75A 1D8AA 3DHEA 3GZ4A 3EAGA 4CR6A 3CSDA 3IL2A 4CMEA 2AQHA 3WFIA 3PGXA 3QHAA 1XYGA 4BL5A 4NMHA 2AXQA 5GY7A 1DOHA 1DIHA 2B4QA 5EJ2A 4BO9A 5JAMA 2C7GA 2H5LA 3EW7A 4BKOA 2PZLA 1E7SA 1YGYA 2B69A 1I30A 4GAEA 4OOEA 5ITVA 3ZHZA 4AICA 5HRUA 1X15A 1PJ2A 4FBGA 4UUNA 3U62A 4CLRA 3C7AA 4YJHA 5K6AC 1BDBA 4FR5A 1ZMOA 1ZNQO 4QEDA 2YQ5A 4A03A 2PY6A 4CUKA 3DL2A 4BNIA 1GU7A 4QT0A 3RBXA 4G2NA 2J3JA 4H7PA 1SCUA 1H9BA 1FMCA 3E1KA 1YQDA 4OGWA 3R3SA 4XIYA 3STHA 5DCYA 3WQSB 2NU9A 2VOEA 3DZGA 3PDUA 2GLXA 5G0VA 4DWVA 4FFRA 2EGHA 3E6AA 3MJEA 1G1AA 1DLIA 2HK8A 3DMTC 1MXHA 5COBA 1CERA 4RJTA 4RV9A 1J5PA 1CF2O 1NM5A 3QE3A 4XJSA 1ORRA 1LX6A 3AUUA 4RQUA 4IDAA 3ZV6A 4LVCA 3M2TA 4FN4A 3KB6A 5JYEA 2NV6A 4IM7A 3ULKA 4TWRA 2JFHA 1GEGA 3BHJA 1I3LA 4ZQFA 3KSZO 3AM4A 2BD0A 3SBOA 3TZHA 1IE3A 2I6TA 2Y1OA 4NDNE 1HZZA 4MPDA 4DC1A 3LC2O 2I3GA 3QV1A 4XWYA 1E6WA 4PZDA 1U5CA 4ITUA 2O23A 3NAQA 4DREA 4FQ8A 3JD4A 3JCZA 3W8DA 2VYND 1NPDA 2O48X 4UVHA 1PQWA 1DEHA 1LDNA 2GDZA 3FN4A 2WD7A 1A4IA 3LT0A 5B37A 2Y67A 4UUPA 2RHCA 3UKOA 2YFQA 4NI5A 1A7KA 3H4VA 4M87A 4GLOA 3HFGA 2X9NA 4RPJA 1XQ1A 1IY8A 3DAFA 4E5YA 2ZIZA 4R68A 1LU9A 1E5LA 4QX6A 2Y1GA 1WZIA 1PU2A 2XOXA 4PIVA 4R3WA 5EL0A 1OAAA 4PG5A 5TS3A 3SX2A 3UH1A 4ALIA 4XQ9A 1ISJA 4PN3A 3D7LA 1P9LA 1QYCA 1VL8A 1SB9A 1TLTA 1NQAO 2BGMA 2PZJA 3EC7A 2J8ZA 1A9YA 5I8ZA 4IJUA 4O6VA 3GVHA 4MVJD 1M67A 2X0RA 4CMIA 5L51A 1UP4A 4IMRA 1WMAA 2X23A 3VH1A 2QYSA 3TN7A 5K0ZA 1RM5A 3GR6A 2Y0EA 3NRCA 3ON5A 1WDLA 1H0KA 4I8XA 4BO2A 4W7HA 3ZHYA 2VHVA 2JD2A 3WGHA 1E7RA 4FC7A 5KVCA 1PIWA 1W73A 4AJOA 1DIBA 2Q50A 2GZ2A 5L40A 1DRWA 2HU2A 2YV3A 4L73A 2C0CA 1GYQA 1YL7A 4J7XA 4TMFA 5JDCC 3GAFA 5JO9A 1OOEA 3E5RA 1XELA 5G2OA 4BNNA 3EZLA 1DLJA 1EVJA 3RFVA 5I7FA 1D1SA 2HJSA 2OP1A 1K3TA 2DPGA 5TJ9A 3H65A 4EYEA 2AQIA 2IE0A 3O8QB 2GZ3A 3V8BA 1MG0A 2X4GA 2YDXA 2IXAA 3JYPA 1NQTA 2RAFA 4UVGA 4Z9XA 3RKRA 4LCJA 2O2YA 2JD0A 3PYLA 3X2FA 3BMQB 5JPIA 3NTOA 2Q2WA 2Q99A 1OZAA 3DOCA 4LRTB 5JXWA 4PVDA 1ZH8A 4OM8A 2FR8A 8LDHA 2X7HA 2XXBA 3MJTA 1R0KA 2QZ9A 1DSSG 1Z73A 4LK3A 1JN0A 4Z0HO 1XEAA 1EQUA 1Y81A 1NQOA 2D1YA 1X13A 5LC1A 1PJ3A 3PDJA 4L4SA 4IINA 3DMYA 5JMWA 5BSEA 3WGQA 2V6MA 3GEGA 1YL6A 2JL1A 4AJIA 3GVPA 4RF2A 4K26A 2JCYA 1GV1A 1JQBA 4WOKA 1YBVA 4PLFA 1E1NA 3K9QO 3OHSX 1UDBA 2PD3A 4NR0A 4XYBA 3ROPA 2WM3A 5GZ1A 1HLPA 5B1YA 4PGFA 1GCOA 5C7OO 1YVEI 2Q45A 1T1SA 4DBZA 4K9DA 1B2LA 1P31A 3N7UA 4XEHA 3OJFA 4Y6SA 4GGOA 4N54A 3ZWCA 2GCGA 2PKQO 1GYRA 4AJLA 2D3TA 4E5PA 1GUZA 5DBIA 3OIFA 1DC6A 4NK4A 4RQTA 5T67A 1WP4A 3ZGYA 3UUWA 1DPGA 1ADBA 5IN4A 3UXYA 3VKVA 4B3HA 2IXBA 2W4QA 3FF4A 2P2SA 3MCVA 4BNXA 4L74A 3MTGA 4GPD1 1ISIA 1E5QA 5CDSA 5BNIA 2AEMA 3F5QA 1F14A 3FNGA 1EBFA 1V3VA 2GO1A 3OF2A 4E2XA 4AJNA 3KYDB 3ZN2A 1P44A 4P8RA 3GVIA 3NKLA 4BGVA 4H15A 1O9BA 1Y8RA 1LA2A 3HQ4O 4CQLA 2EW8A 4EJ6A 5A5FA 1E3LA 4R5HA 5CPBA 2JKVA 1ZFNA 3D3WA 4XYMA 1I5RA 3BZUA 3KM0A 1R4MB 3PRJA 4R01A 2B4TO 4XDZA 3F9IA 4BOYA 1T4DA 2GN4A 3HADA 2VYNA 1VJ1A 1H6DA 3BYZA 3RROA 1ONOA 1ULSA 2X9VA 5FI5A 4NJOA 4BIIA 3NT5A 3PLRA 3GG2A 2HAEA 4E5NA 2VNAA 4XRGA 4FFNA 2HO5A 2WEKA 4NJMA 1B8UA 1EVIA 3BTSA 4DBVO 5BSFA 3PYXA 4BS9A 4CMKA 4IDGA 3DZFA 3SC6A 4UVIA 3C1OA 3P2YA 2WYVA 3V2HA 4CQMA 3BA1A 5A03A 2EEZA 3D4OA 1HKUA 1JWBB 4BO0A 4E21A 1N92A 3GT0A 1YJ8A 4CJXA 3IAHA 4I9HA 3RC2A 1YJQA 3QVXA 3AUTA 1PGQA 4XDYA 2PD4A 3QIVA 3FD8A 3FWZA 3KSUA 2CY0A 1SOWA 4W99A 2ZB7A 1X14A 4H3VA 3U4HA 2ILTA 4KTTE 1P1KA 2X0JA 3ETDA 2FZEA 1HWYA 5FI3A 2P5YA 3OSUA 1PJ4A 4B7XA 2ZATA 1ZCJA 3JYOA 1LQTA 4YAKA 1F8FA 1GPDG 4IJVA 4BO6A 1GZ3A 2EKLA 4UREA 2X58A 4ND2A 4W82A 1JWAB 2X5KO 4HP8A 2HMSA 4U6QA 5JC1A 4CLOA 3RCBA 3SVTA 2DQ4A 1PJSA 2VWGA 4GX0A 2AHRA 3IJPA 1YWGO 1K5HA 3BMOB 2OMEA 1GUFA 3W4JA 2G82A 4B8ZA 1ZBQA 3JD0A 5JDIC 5JYDA 1PZHA 2Y1FA 4DQVA 1D4FA 2PR2A 3MZ0A 4ILKA 5BR7A 4XR4A 3RJ5A 2FP4A 1WVGA 3K2BA 3O4RA 4J90A 4IXWA 2GUGA 3ENKA 3CPSA 1GTMA 4NU5A 1QLJA 4GL4A 3WYCA 4I5DA 3ORFA 4ZRNA 1Q7BA 4QQRA 2X22A 3X2EA 3H2SA 4BNKA 1V3TA 1XLTA 3ZCXA 4E2ZA 3CKYA 1ZJYA 4HWKA 1VL0A 4EUHA 1TT5A 3JQFC 5IN5A 4YACA 3SJ7A 3CE6A 3GFGA 4TKLA 3I83A 3JQ8A 4J91A 4CL8A 3CMCO 4NHEA 3GH3A 3RUEA 1ZK1A 3HB5X 1MC5A 3UW3A 3OMLA 4DPKA 2A35A 4IJWA 2O3TA 2NUAA 2SCUA 2DBRA 3TQHA 1LUAA 1XU9A 3WXBA 1MXFA 2P9CA 3G17A 4P4GA 1Y8QB 4E6PA 5ADHA 1Z6ZA 1DAOA 3BAZA 3DWFA 4A26A 2D5AA 3ADOA 4Q9NA 1ADCA 5AQ1A 5F5NA 2Q1WA 3G1UA 2CVQA 4LN1A 1C0PA 1ARZA 1BWSA 1H6AA 4LRSB 1H6BA 1LDGA 4IDFA 4J4HA 3WWZA 3DBLA 3GZNA 3QVTA 4OQYA 4RVDA 1A9ZA 4R9RA 5L53A 3M1LA 4JBHA 1H93A 4S1VA 4PG7A 1TT5B 3DZIA 1RJWA 4YQZA 1KY5A 2HDHA 3AFMA 4YDRA 3K73O 4KOAA 5DCWA 2CMDA 2J3IA 4BNLA 4WK6A 5HA5A 4KMSA 4MVJI 4DLAA 5JY1A 4W4TA 3QWBA 1LRKA 4RCVA 2GF2A 1NHGA 2O2SA 2EKQA 1ZEJA 1DC3A 4Q3NA 3K6JA 1E7WA 4YPOA 1ZK3A 3KYBA 4MKRA 1N1EA 4LVUA 5IJZA 2BELA 1J49A 2H6EA 4I1IA 1AHHA 3TJRA 4QECA 3H5NA 3H8VA 4FD3A 4DLBA 3R1IA 4TRMA 1E7QA 3VC7A 4TQGA 3ZWVA 4BV8A 2PKRA 3AW9A 4HFRA 4R51A 3FNFA 1Q1NA 2DBVO 2Y0DA 5H81A 1YB1A 3TDKA 3GZNB 4WASA 2VHYA 1L7DA 4CMAA 4OHUA 2X0IA 1EFKA 1E92A 1OFGA 1P1HA 2RCYA 3MWEB 3QVOA 2IEDA 4EBFA 3ZNPA 1T4BA 1V0JA 3E9NA 2OHXA 4YJFA 4CR7A 4WECA 3GPDG 3I6QA 5L4NA 1GPJA 4TROA 2OBNA 1NVMB 1TEHA 4TZKA 4FJ0A 1UAGA 5CPFA 2O3SA 1LLDA 3RU9A 2CF5A 3RU7A 2E6UX 2FPGA 4KTVE 3BMNB 1QP8A 3CXRA 4J4BA 4RDHA 4WGGA 4J49A 4WLOA 3C1TA 1UUFA 3E18A 1H9AA 4J43A 4CR8A 1GCUA 1LJ8A 3RC9A 1J0XO 4Q3AA 4IZHA 3F4LA 5B4TA 2YV1A 3IP3A 3WLFA 4CM6A 2JCXA 3IMFA 5JE8A 1P1JA 2CD9A 2EJWA 1OC4A 1WZEA 4N5MA 4YYZA 1EFLA 4ZA2A 3HDHA 1U5AA 1EQ2A 3IUSA 1YB5A 4A7PA 1A7AA 4IJKA 3K96A 2FWMX 2RH4A 4YB8A 2QW8A 5JS6A 5TX7A 2VRCA 4PLYA 1HDZA 4IZIA 3Q2IA 1S7CA 2DLDA 3D4NA 4ND5A 2IRWA 3WGYA 3BHMA 4KUHA 4A0SA 4D3FA 2JFFA 5KTKA 5DBFA 3EHEA 3GK3A 1PL8A 4HY3A 1WXDA 1LQUA 5DCUA 5KKCA 3IQDB 3O38A 3EYWA 5DNAA 5CDGA 5L4SA 1P0CA 4U5QA 4FW8A 5KVSA 1QYVA 2GN6A 2WD8A 3W6UA 4E5KA 3ASVA 2POQX 1S6YA 5JO0A 3K2EA 4BGUA 3VPSA 4NBUA 2WMDA 4OSOA 2X86A 3AM5A 4LW8A 3TZCA 2VWHA 2UUPA 4TZTA 1SNYA 1SZJG 4BB6A 5I9NA 5HWSA 4YTEA 3L6DA 1N1GA 2RBEA 5C7LO 3KO8A 4KUEA 2LDXA 2BKAA 3PJDA 1N7HA 1NFFA 4OQZA 5L4LA 1NPYA 1ZIDA 4LGVA 4BGEA 1HE5A 1QR6A 2DUUA 2I66A 4YWJA 4YJGA 4WCFA 2NADA 1T2CA 3WNVA 1I2CA 2AEFA 1LC3A 2NTVA 4Z0PA 3W4KA 4G5HA 4W9NA 3TZ6A 1E3IA 3ZWOA 3TSCA 5KJFA 2X5JO 3RUIA 2V65A 3ZI0A 2PGLA 5CG1A 2J5KA 3OQ1A 4C4OA 3A14A 1TT7A 3GNTA 1Z82A 1E6UA 1W8DA 4CMBA 3AOEA 4BQRA 5A05A 4OXYA 1NWHA 1FK8A 1HSZA 5I9MA 3VPHA 5ICSA 1UZMA 5IF3A 4CQLB 5ILGA 3UN1A 2B35A 1K6IA 5B12A 4EZBA 5JLAA 4IBOA 4CV0A 1R4MA 1XCBA 2WDZA 4Q3DA 3JQ9A 3D5TA 5T5QA 2O4CA 2DVMA 1NPTO 2O3QA 3FR8A 3WFJA 1KC1A 3DDNA 1Z45A 1VKNA 3PLNA 3JSAA 3GRKA 2PKQP 5TNXA 1DB3A 2DT5A 1YONA 3WMWA 5BSGA 3WTBA 1HL3A 4J7UA 1TXGA 4Z3DA 1JDJA 4WCFB 3I52A 2D8AA 4XX0A 1VJ0A 1XHLA 2BFPA 3C7CB 3RUCA 1GQ2A 2CNBA 3S2FA 4PLTA 4CM5A 3IDSA 3GGGA 4CM9D 1F06A 4I5GA 1PS9A 3W6ZA 1OI7A 1EUCA 1Y5RA 3FTNA 3SLKA 1E3SA 3NDIA 4NBVA 3WGTA 4LISA 3F47A 3I9KA 5BSHA 4DUPA 4XZ3A 2ZB8A 1UR5A 3WR5A 3G79A 4Z0TA 4EJ0A 2DU8A 3C7DB 4C7JA 3P19A 4IDBA 1R4NB 1W4ZA 2WYUA 3DFZA 1LNQA 2NVWA 2WE7A 1F12A 1BW9B 1QORA 1ONNA 3F4BA 2NVUB 1P1IA 3VTFA 4AJ2A 5C3MA 3GNQA 3ANLA 5JBIA 1PSDA 3FHLA 4NIMA 1H5QA 2C7VA 4IGFA 2ZJ1A 1HDCA 1JW9B 1XU7A 4WLNA 1PX0A 2CZCA 4QXMA 1ZO8A 1I32A 2UVDA 2NU8A 1XKQA 3LZ6A 3GDGA 3JQ9C 1OMOA 3ETGA 4CMEC 1YOVA 1WAMA 4GX1A 5G4KB 5EQFA 2AA3A 1BDMA 1F17A 4D0SA 4LSMA 4Y6PA 1MX3A 1Q7CA 7ADHA 4YAIA 5C37A 3OA2A 2Y0CA 1A72A 3AUSA 3KOUA 3F6YA 3ZU4A 2H9IA 4BNGA 1NWCA 2P68A 3RJ9A 1WMBA 3NGXA 4XD2A 1IPEA 2B37A 2VTEA 4XQCA 1A4UA 3G3EA 1H2BA 2Q1UA 2OXIA 2JAHA 4Z6KA 2X8LA 3HN2A 2ZYDA 3UVEA 1EDOA 1NR7A 5DDIP 3L4BA 4N5LA 3DONA 3Q11A 4I9UA 4Y98A 3V1YA 5CDTA 5JAIA 3NTQA 3E9QA 3PXXA 3WMXA 1SB8A 2P5UA 3MTJA 5A1TA 4CMCA 2PNFA 2VZ0A 3I9LA 3CMMA 3UICA 3U4DA 3TZKA 2C20A 1NHWA 4WCFC 4L4XA 3U4CA 1P1RA 2VZ9A 4EI2A 1EE9A 3BMQA 3RI3A 2W98A 5ITWA 3A06A 1ZKMA 2FRDA 1O6ZA 1W6UA 3ITKA 3RKUA 3JQAB 4JGBA 5AVOA 5TIIA 4FIZA 4MIYA 5LCXA 3MOGA 1HYHA 1YOVB 3D0OA 3QLJA 3QP9A 5G4KA 3GEMA 4CPDA 4D46A 4E12A 4BNMA 5BQFA 3ZNNA 1SPXA 1HYEA 1GD1O 1CQJA 4IIVA 3JD3A 2AQKA 3T4XA 5B4UA 1E6EA 3OH8A 3RC7A 4FOSA 1T2DA 4F6CA 4CM8B 1TB4A 3HB4X 4XCVA 2ET6A 1Y7TA 4NZ9A 3HG7A 3WQRA 1DHTA 1U2DA 1YBAA 2C2YA 1C0KA 3DZBA 1GY8A 4ESOA 2EF1A 3JTMA 3KYCB 5EQDA 4KWHA 3WQQA 3OIGA 4NG5A 2FY8A 4EEXA 5KVVA 1VL6A 2PLAA 2F00A 4FJ2A 4Q3EA 4QTZA 2IYOA 1VSUA 2EP5A 1O0SA 1UXKA 9LDTA 3HDJA 3Q6IA 4UULA 3RC1A 1H94A 3JQEA 4YT4A 3DBLB 2W2KB 2UUOA 4MVJF 4TKMA 3VHRA 4DYVA 4ZICA 3PFFA 1VRWA 1KEPA 4WPGA 2PH3A 2CDAA 4M49A 1EBUA 3DOJA 1I2ZA 1M76A 4R16A 2EHDA 4CMJA 2O3UA 4FS3A 2B5WA 4NFHA 1Q0HA 2VHXA 4F46A 4IQ0A 4YA6A 3KV3O 5KJCA 3ZHXA 3HNPA 4YCAA 3M6IA 2YFHA 3OJOA 3KYDA 1HE2A 5A9TA 4J7CA 1DRVA 3RFXA 3CUKA 1WNTA 4CMGA 4F3YA 5MDHA 2Q49A 3DBHB 4MVJM 3FNHA 5DT9A 3QA9A 5IDYA 4ONEA 5A3VA 4CM4B 2E82A 1HT0A 2D59A 3FPLA 4WLUA 3D64A 4S3MA 4A73A 1ZW1A 1D7OA 1B15A 4L76A 2AMFA 4MDHA 2O50A 4U6SA 4E3ZA 5G0SA 2DFDA 3OFSA 5CEJA 1X1EA 4J6FA 1PEDA 3DBVO 1FXSA 2OFPA 4RVUA 4I5EA 3NTRA 3NV9A 3WIDA 3DTTA 3T4EA 1JAXA 3RSHA 3VPFA 4Z9YA 4EITA 5A5EA 2E37A 2FN7A 2GRAA 4ALLA 1PJLA 3R0IA 2X0NA 1K2WA 4ZHSA 1E1MA 5T8KA 1E3JA 1HDOA 3U3XA 4UUOA 1ADGA 3AU8A 1D1TA 1X0VA 1EE2A 4B7UA 2D5CA 2TMDA 4RO0A 1KVQA 2HJRA 1MUUA 4CM1A 4PLWA 3HE3A 1O95A 1CETA 3MEQA 3H6KA 1Q0QA 1NBOA 3ZZNA 1WPQA 3GQVA 2H1SA 2EG9A 1P0FA 3VDRA 2CVZA 4J16A 3RUDA 3ANMA 1E1KA 1E3WB 2BMAA 2F1KA 1AGNA 1U3VA 3PHLA 5L7YA 3WNQA 4D3SA 2Z1MA 2WYWA 3U4IA 2HRBA 4PVCA 1B26A 1OC2A 4I5FA 4Q3CA 3WTCA 1YH3A 5C5IA 3ROMA 1WW8A 4RF3A 3VZQA 2GGSA 1U9JA 4M8SA 4U8GA 2O3RA 1YXMA 1LC0A 4CLOB 5A9RA 3HZZA 1L1FA 5U9CA 3NGLA 5A02A 1BVUA 2B0JA 4NK5A 3AI2A 3C3XA 4OXNA 2EGGA 4RLHA 2YHUA 4XB1A 1YDEA 4GI2A 3B70A 4OXKA 1ZK4A 3BMOA 5KJ1A 3JD2A 3ICCA 3SXPA 3V2UA 5L9AA 2TMGA 5F5LA 5AXBA 4QFDA 3AY6A 4HX5A 5G4LA 2PK3A 5KOIA 2VHWA 3PHHA 1JVBA 5H83A 5G0WA 3LK7A 4IDDA 1Z74A 4RGBA 1NNUA 2AG8A 3C24A 4A5OA 2X1HA 3QWIA 1XQ6A 5U1PA 3MJ4A 3UF0A 5T57A 4FJ1A 2IDZA 3E48A 4P4LA 3C8MA 5U4QA 3TOZA 3W8EA 1ZSYA 1DJNA 3AK4A 3F3SA 3Q0EA 1FF9A 4J1TA 3DR3A 1ONPA 4TRRA 4QSMA 3RQSA 2HMVA 1NP3A 1V6AA 1M6HA 1I3KA 1UXIA 3BTVA 1R0LA 5AXAA 1MFZA 3GA0A 5THKA 3OETA 3P2OA 2R6JA 2VRBA 2WD7B 2OZPA 4PG4A 4KDFA 3QVWA 4RVGA 2NQ8A 3PPIA 2VYVD 2IEBA 1NXQA 3GMDA 4BO3A 1GV0A 1HLDA 3HUDA 4IS2A 5CG2A 3H9JA 4BMSA 4KWIA 1M6WA 4HUJA 4OKIA 3ETEA 3PWZA 2YDYA 4YT2A 4GWKA 1NVTA 4XYLA 4BKQA 5CFZA 1C1XB 1GUYA 4ZD6A 1ENPA 3GG9A 4GH5A 5FFFA 3VDQA 4BNYA 3KSDO 2VOJA 4U0JA 1H2HA 1I01A 1PL7A 2ZTLA 4W7IA 1QRRA 4KDEA 1NVGA 1ZSVA 4NFSA 3FRJA 4DC0A 4CMIB 1T2FA 3KZVA 3D5QA 1ZMTA 4GMGA 3JYLA 3ZHBA 3B1FA 5A4DA 1NR1A 4OIMA 3WBBA 1VSVA 4ALNA 4INAA 3NEPX 4O63O 1J4AA 2GNAA 1ZSNA 4JP3A 2A9FA 3AI1A 3G1TA 5GZ3A 4ZQGA 2QYTA 3ANNA 4HNGA 1Y1PA 1EZ4A 3I9NA 3GN2A 4R1SA 1DDOA 2CDBA 1Z7EA 1B14A 4AJPA 3MOIA 1GFSA 3OBBA 5ENVA 1UP7A 1AHIA 2V6FA 4OYRA 2CDCA 4AJEA 4JX8A 5L45A 3OQBA 1R4NA 2FMUA 5ICMA 3O8QA 3IOYA 4FC6A 3JV7A 1GL3A 3ADPA 4WNCA 1BRMA 2XAAA 3GVCA 4NNJA 5DOZA 1WLYA 1XWFA 1KS9A 1V3UA 4Q39A 4M55A 4RORA 1VJTA 1KERA 3I9OA 4ZVVA 1MGOA 5DZSA 2OUIA 1QYDA 4YXFA 1C1DB 1XA0A 3S1LA 4L4RA 3UOGA 2JAPA 3KHUA 4XYEA 4B3IA 4FB5A 4J1QA 4WLVA 2C07A 4EW6A 1LLUA 3AFNA 4NFYA 4KQXA 4ROSA 5IXYA 3OICA 1E0DA 4ZU3A 4BKUA 2I3AA 3IUPA 3DFUA 2GASA 2AEJA 3TL3A 3AOGA 1R66A 3Q9NA 1NFQA 5DULA 2R00C 3GUYA 1PQPA 3L6EA 2EERA 4HXYA 4L75A 2DPHA 4MOWA 3WGIA 4ZRMA 1QKIA 3M2PA 3ICPA 4CLEA 1YE3A 1V9LA 2XXJA 3P7MA 2YHIB 1DRUA 1SC6A 4AJHA 4MP6A 1DAPA 3H2ZA 1TA4A 4E30A 1ULUA 1AUPA 2B36A 2B5VA 1SBYA 3K30A 1ISFA 2GYYA 3KLMX 4IQ8A 4WNIA 1T1RA 4E31A 3D4PA 3NJ4A 2V6GA 2P4HX 3ZWMA 1K89A 2JCVA 2XPCA 4NH4A 1T24A 2WJPA 2VWPA 1DFIA 3AY7A 5DF1A 2YZ7A 4RPKA 3IKTA 3GLQA 3JQBA 5LDHA 4HV4A 1YBMA 4Y9DA 4CM8A 4JLWA 2HRZA 2BGLA 2NWQA 3WICA 3GGOA 3V2GA 1MB4A 4R1UA 1I0ZA 2Q46A 2VRCD 4D44A 2V7PA 4IIUA 4EDFA 3S8MA 3KYCA 4OO3A 1GZ6A 5AOVA 4BB5A 3D1LA 4P38A 3LC7O 1LSOA 3NX4A 3I23A 3EGOA 4PZCA 4GVXA 2OORA 4CUJA 4M86A 4EUEA 3U09A 4TRNA 2NVBA 4BO8A 1X1TA 4RL6A 3RUFA 2FHSA 3DAPA 3F1KA 4HFMA 4BQPA 3NUGA 4R5MA 3NDRA 2Q4BA 1RPNA 3IKVA 4A27A 4DMLA 1T2EA 2DFVA 2VYVA 1BTOA 3S55A 2AQ8A 4RVSA 2UV8A 1O89A 3FWNA 4A2CA 4PLVA 1B7GO 4FPXA 4BHTA 2FPPA 1SMKA 2D0IA 4CQMB 2G76A 4B7CA 1C0IA 3VZSA 3ZWAA 3F46A 3WX0A 5IZCA 3INGA 2OOSA 1N5DA 4QO8A 3Q2KA 4DLLA 4TRJA 1GR0A 4BKRA 4CM4A 1JTVA 3QY9A 5JSFA 1QXSA 1RWBA 5HTOA 3P5SA 5TF4A 5COAA 1PL6A 1KVRA 2PWZA 3DB2A 2C5EA 4KQWA 4NBWA 3OJLA 1YL5A 2VTDA 2RIRA 3ZWXA 3IC5A 4AG3A 2EKPA 2RH8A 2VT3A 3HDYA 1XIVA 3DEYX 4BNHA 1X0XA 4J2HA 1HE4A 2AE1A 2HSDA 1FDTA 3ZV5A 3GVXA 4JCOA 3PGJA 2PZKA 4TVBA 3UAGA 4BNTA 4GGPA 4IXTA 5EIOA 5JCXA 2BH9A 1O8CA 2IYPA 3QRWA 4XR9A 3CZRA 2LDBA 4OAQA 2BHLA 4KZPA 3LLVA 3FCOA 4MJLA 4IMPA 4UAGA 1Q2XA 4B4UA 1F8GA 3EVNA 1G6KA 4GX2A 5CDUA 1Q7GA 1HDGO 2C54A 2PD6A 3JQ6A 3KTDA 3TWOA 4CLDA 2R2GA 4MIOA 5GZ6A 1XG5A 4XB2A 1B16A 1YDWA 4F45A 1A5ZA 3ZWNA 1T25A 4D7AA 5F3RA 1YO6A 2NVUA 1N7GA 2NSDA 5I8WA 3EMKA 2HQ1A 3OJEA 1LTHR 4G81A 3WGZA 4XYGA 3N74A 3GUCA 1KOLA 4X54A 4IY1A 4Z9FA 3D3EA 1ZVMA 4NBTA 5BNTA 1CEQA 3EDMA 3L6OO 2C82A 2G5CA 2QZZA 4Y8VA 4ND1A 3FI9A 1KVTA 4RF4A 3VVBA 3PIDA 3AI3A 4CODB 2PGJA 1R16A 4W6ZA 1EMDA 1SEPA 1KEWA 1X7GA 3JQGB 5I7SA 3MJCA 3DHNA 1JKJA 3S2EA 1U1IA 1I10A 4MP8A 3K5PA 1MA0A 1LXCA 1K0UA 6ADHA 1YQGA 3ENNA 3FBTA 2DKNA 1YKFA 2ZTUA 4R1TA 3TOXA 1U8FO 3JQCA 3A4VA 3PZBA 3OP4A 1EEHA 4ND4A 1PJTA 5I7VA 1KEVA 1P74A 2WE8A 3H9UA 2GERA 4B8WA 4B4WA 4PLGA
chains in the Genus database with same CATH superfamily
1LK7A 4UBMA 1ZUNA 1ZX1A 5EMKA 4UFOA 1OBCA 4W8HA 1IBLB 2CUKA 1RQGA 2G4VA 2YYSA 1CDDA 3HVKA 4I1SA 4QATA 4QYIA 3T7RA 1Q84A 1EX1A 2ZVJA 1RE1A 1EQAA 2ZUWA 4NZPA 4PQFA 4X1KA 4F1JA 1PJBA 2QBYA 3L6UA 2PXXA 1BXGA 1W36B 3A6ZA 4DIFA 1FU8A 1JL3A 2YXEA 3GMSA 4YAGA 3S2IA 1U2EA 1JAZA 2BFFA 4UPVA 5CDHA 3BE6A 1Y33E 2XNDA 1TYZA 4B4KA 3KQVA 1UBSB 1X1AA 4ASUD 5CU7A 2WUGA 4Z3KA 1M2KA 3L40A 4B09A 1IY1A 1R3DA 1W94A 1ZMBA 4OFBA 3R24A 3WLLA 4EAQA 5AM3A 2HLPA 4ON9A 4HGPA 2UZ4A 4R2XA 3GFQA 2ZQYA 3GJQA 1RU3A 1A2BA 4Q00A 5ARBA 3TUJC 3PL5A 1VHTA 4MVCA 1L5YA 1U8CB 3NCTA 1N2GA 3WC4A 2GKSA 4YR7A 5DTQA 5IX8A 2ZR8A 1ZYUA 2Z30A 4RTKA 2YMLA 2NGRA 2Y93A 5LP1A 3WOVA 1POXA 4FMBB 1Q44A 1SXHA 3S7ZA 4E33A 1Y9EA 2Q29A 2GYWA 1QM5A 3VC1A 1BCRA 1U4OA 2ZYIA 5BRAA 5HM8A 3T7DA 3IVMA 1JVNA 1S8FA 3GY0A 2WT4A 4Q7LA 1WDKA 1D2EA 1UXOA 2TMYA 4D9JA 5JC8A 5LMCA 5LP6C 4MDFA 4MCHA 3ZHTA 1I7DA 2HRDA 2GPNA 3R9XA 2PYIA 5CLHA 5TGDA 1KWKA 1YS7A 3DTNA 1AH2A 3I05A 3VU9A 1AQUA 2CHUA 3FYDA 1G5QA 2KPOA 2FPIA 4X5OA 2OR3A 4GE3A 2Q07A 3W9SA 1DQZA 4CIBA 2DBZA 3LP6A 1U8XX 2OFFA 3TUZC 4ZP1A 4CL3A 4I1PA 1PFUA 1EHIA 1BFDA 1Y8CA 1E0AA 4HVCA 4LMPA 1ZUD1 3QWFA 2UZIR 1UBRS 2P9YA 1JJ7A 1B8PA 3QYJA 3K15A 1TGVA 2GHRA 4B85A 5CVUA 1XP5A 1LV8A 2JEOA 3K0FA 3RSQA 2HHHB 4QUAA 3WAGA 6LDHA 1DWUA 4P7KA 3Q7IA 2BFEA 2P9ZA 2EX1A 4OHKA 1H3FA 1Z7GA 4BRZA 5JFOA 1JHQA 3QA3E 1OYYA 2I6FA 1JDTA 3A7EA 3AHEA 3LQKA 1EUDB 2UYQA 4YRAA 2AFIA 1UJCA 3CR3C 3PZRA 1XWWA 2JLRA 1BAPA 4PGGA 3UCEA 3LY5A 3LHIA 3UMSA 5L95A 3QHPA 4RTQA 4GM1A 3M49A 2FYTA 4I1RA 2EC5A 4GWGA 4H59A 5ER9A 3KWJA 3LU1A 4V0ME 5JZOA 4XOIA 3T06B 1QU3A 2O7SA 2BTQB 1GCIA 1N8TA 5DHQA 4B7ZA 1CUIA 2FUG1 5KB3A 3HXOA 1DV2A 1RE0A 1UZLA 2ZK7A 4MSUA 4WZZA 4ZO9A 2OQIA 1OHHA 5CUQA 4E32A 5JRJA 3H5AA 3BRCA 2Z2KA 3S2YA 2XB6A 1VPDA 1JU9A 2VPPA 1GL6A 1KI2A 2AOTA 2OLJA 3NNSA 4OB7A 3F8TA 2R6AA 2PWBA 5DHFA 3UZUA 4HMQA 3WO0A 3NBMA 5H3LA 5HOQA 1HXHA 2X5OA 3QITA 5GV7A 3O1IC 2QRLA 4K6OA 3VPGA 4BFVA 1KH3A 3KCQA 4I3GA 1CPYA 1RHMA 3SZGA 5A3RA 3SBXA 3AZQA 1KZGB 4R7TA 3B9QA 4AL4A 4D99A 3GLIE 1XVLA 1DQYA 2VUTA 3IHLA 1AA9A 1GAJA 4NCKA 2QIOA 4LX8A 2HCFA 5P21A 4PLZA 3WGNA 4A2WA 5CB4F 3LBNA 1C5KA 2P91A 1KFKB 1ZNYA 3JVIA 4JQCA 2VK4A 5FIUA 1NBAA 5KNBH 1RHRA 3PWKA 1P1BA 4C0QC 2NU6A 3P0JA 1YUNA 3L3BA 1Y5MA 3CZQA 2HXSA 3PXUA 4TV9B 2BMFA 2FW8A 2HF9A 2IV2X 2IGTA 3DS8A 5JUWA 2DUMA 1M66A 1W46A 4BNWA 4F5YA 3LX4A 1LI4A 4OX9Y 2PWAA 5KYXB 4J0FA 1DIOB 1CC1S 3QEMB 4JN6B 4MWZA 4BRSA 3ST7A 1WV1A 3WRVA 3N58A 5KIAA 1CZOA 4AIIA 3O1LA 3PQ5A 4LF5B 1CR0A 1HTBA 1XVUA 3FBGA 3GUVA 3OQVA 3GFTA 2P9JA 1GZVA 3TJMA 3RLFA 6GPBA 1SOAA 5FCDA 3IODA 5TEVA 3T5TA 3L6CA 4RE6A 2ZSHA 3AUKA 1XALA 2FR1A 3A3PA 2IHNA 1GPMA 2QROA 1RNLA 3T3DA 1X8LA 2B6HA 2O2EA 1WMEA 2V0NA 3KAKA 4MA0A 4P7GA 5I9SA 3C3AA 5B7QA 1QG0A 1K27A 1BXZA 1JAYA 2ZYAA 3RAJA 1MC1A 3CH4B 5AHXA 2P9GA 1KC3A 3BIJA 4PZEA 4EG7A 2FQQA 1PV1A 4BNJA 3B1VA 3OKPA 2BGNA 4MGYR 3WNCA 3MM4A 2HMTA 2ZCUA 3FCEA 3NVDA 4K6MA 4MARA 3RYFA 3DEKA 4HDMB 3FOBA 3BCHA 1TJNA 1ZLYA 3H9GA 5COQA 2XT9A 5IH7A 4OSPA 2DBQA 3ORHA 3E9MA 3CEPB 4N7JA 3T9DA 5KYXA 4JHLA 4XW2A 2PH5A 1THMA 3Q0TA 4H3KB 1GDHA 1L1RA 2A58A 1QSGA 3FHTA 3PJRA 3FHCB 4Q4CA 1MVOA 1R5NA 4G4SP 2RGUA 2OHFA 1CUEA 4UCWA 2V7XA 2YWHA 2DPYA 5JOQA 4O0LA 4D42A 2C9CA 1U0BB 2B8WA 3OIUA 3JQDA 3NHYA 4X97A 2C98A 2ZWIA 3DM5A 5B64A 5BORA 5JS2A 2TECE 5AXCA 4ZVSA 4LY3A 3PB3A 5I9TA 2E6KA 5IDQA 1NMZA 1YZHA 2MYNA 3I4CA 3ILVA 2WNHA 4WXYB 1V43A 3UMVA 5CYGA 5KNLA 2WJZB 1BDIA 1FSSA 4DA9A 2P35A 3H5OA 1ZWLA 3KUDA 1JEAA 1GG8A 1HQCA 1VLLA 2E4WA 2IYQA 1SVKA 3GHHA 5DEIA 5SY9A 2Y1DA 1SXIA 1THGA 1F4VA 2JDID 1MW8X 4JV5B 5I6DA 1I8TA 1A5AB 4YC7A 4GP9A 4TMVA 5KYUB 2WWVD 4RTMA 2NSLA 4OP1A 1M8FA 1O5IA 1G66A 4O4IB 5LMNB 1Z7WA 4AKTA 1II8A 4L1KA 4DZRA 1UDAA 4G2TA 3MINA 3FDZB 4U7HA 3TFOA 5GJBA 2I3DA 4RZ3A 3RVDA 2BGKA 2F59A 4LOJA 5H4GA 4EG3A 2ANCA 1LFDB 2WZDA 1OV4A 2YN2A 4GUAA 4P53A 3CCFA 3ELWA 3CF0A 3VPCA 3QSGA 1AVTA 1T13A 4JC0A 3KJIA 4FGWA 4ZC1A 1YASA 1PR1A 1LDEA 3QTBA 3E7DA 4FWIB 3QFSA 1VMDA 5EINA 4CF5A 4BRWA 5G0TA 5KQRA 4B34A 1D6NA 1LFAA 3BFVA 1Y1SA 4W9NC 1LBIA 1O77A 2OCLA 3ZQ4A 1Y42X 1MO6A 3QEOA 4IWXA 5CVEA 2YIVX 1GJRA 3AUJB 1H65A 4H1HA 1IIRA 2C8JA 1WR8A 2YQ4A 3U6KA 2PQ0A 5T7BA 1Z4JA 1N33B 4QTUB 4UVDA 1U4NA 1OXBB 1YZUA 1Z3CA 2E4XA 4U2EA 2HNKA 4RMNA 2FMKA 5C1DA 1JA9A 1XK7A 2AVDA 2OMKA 3GRVA 1CIVA 1EFPA 3GEHA 3N86A 3O9ZA 3OOSA 4JDPA 2YUTA 2CNOA 3GCZA 1NVBA 4GM4A 4LBYA 4TTIA 5FUYA 5AUNB 2WWRA 4AZ3A 1B76A 4D1YA 5IMSA 3EODA 1VPWA 3DCNA 1D0VA 4HN2A 3VU1A 1C8LA 1R37A 4DIEA 2ZI5A 2JLYA 4V0OA 1XF9A 1UFOA 1BHSA 4ZCLA 1B8NA 1QHIA 2OBYA 4YCBA 3PQFA 3TIGA 1RI5A 2ZI6A 1AIPA 1EUZA 2P40A 3A6JA 3O03A 4RF5A 1I6LA 4KXUA 4TXLA 3KJQA 5EZQA 3RVJA 4U7FA 4DVGA 1TI7A 4N0PA 4R2HA 3SOZA 4J1NA 1J7JA 1SVNA 4UHDA 3VRHA 1TLFA 3GF4A 2QTNA 3KEMA 1JJFA 3ED1A 2ZRMA 3DBRB 2JLXA 1H3NA 2FDRA 4HGYA 4RU1A 3D7MA 4O33A 3ZWYA 5EESA 3ZOZA 5IASA 3JQAA 3AU9A 3LUBA 4G9EA 1C1DA 3OZTA 5AXDA 4AYTA 1NQ5A 1L8AA 5FBVB 1HLFA 4Z4IA 2QPOA 1J09A 1C9EA 4JNKA 3ZBTA 2GSDA 2LIVA 3HN6A 4BE9A 4EY4A 5C1OA 2C7RA 1USIA 1P29A 2OT3B 1BQ4A 5BV1A 1IEQA 1X80B 5BQPA 2E4AA 1E1LA 4LE0A 2QD4A 3ZPXA 4Q3BA 1PGPA 2R9VA 4OUDA 1NFRA 1NAIA 1RD4A 2REBA 3K92A 2EHJA 3U3MA 4PXSA 2P0YA 3IQHX 1P19A 2PPLA 1CLEA 2Q2NA 4V2IA 5IC6A 5AVUA 1YUBA 3TLYA 3PVCA 5DYGA 2NZUG 4ARZA 1HDRA 2XF2A 1JJVA 4DIKA 5F98A 1DS6A 1U65A 3MWJA 3U4AA 3BE4A 3AR4A 1OJ7A 3CZAA 3VZRA 3JASA 4AIRA 3LUCA 1F7UA 3BXGA 4C0JA 2QM3A 1F0YA 3LPLA 2HO4A 4TX1A 3HLTA 3GAZA 2QD5A 1K6XA 4TTSA 5DBGA 1T9GR 1UT5A 1K8XB 2QN7A 3QBEA 4INJA 1BX1A 4UHKA 5EQTA 4AK9A 4CV2A 1XCLA 5REQB 4RK5A 1D03A 2AMLA 2FR0A 1T5BA 3W3AH 1OXSC 2PVSA 3Q9UA 1CUAA 3FSRA 4GT1A 4PZ0A 1U9CA 1MMFB 4HWSA 2P6PA 3B7WA 4AF8A 3F5MA 4MGHA 5MFPA 2VDMB 4MGEA 3VZPA 1EXVA 1EK6A 1UQTA 4L85A 3WKBA 1GAWA 1QWOA 3P96A 3QPAA 3B53X 5JZVA 1V6CA 2WSMA 4XWAA 5KYVA 1STOA 1U7TA 1OVMA 5KINB 2BLLA 1H8EA 2B4AA 4OUDB 4YASA 4Q34A 4XGKA 3R7WB 4A8TA 2IHKA 1EHCA 3GHYA 3FKSA 1A50B 3GJ7A 4MW1A 3RYTC 3FPCA 3M6AA 4NAUA 2DCUA 1AQYA 1SG9A 1S89A 1SURA 1EDDA 4CLRB 1QMPA 3U4QA 1SXJE 4RETA 3G9ZA 5AFSA 1JPJA 3VH4A 1JI3A 4QU5A 1P33A 2QLMA 4R8KA 4URHA 5K4AA 3KJGA 4J3NA 2MSCB 1AA6A 3CR7A 3VX3A 2C29D 1BCSA 1GGNA 1QMGA 4RJ2A 3SEFA 1E1CB 1ZD1A 3JTEA 4P4SB 3M89A 4FQ5A 2EOAA 2FZLA 3EVGA 4HG2A 5CP8A 1BHQ1 1QV6A 3HKBB 3RV4A 2H7YA 2DC1A 2BSQA 5HDBB 1GYPA 1U2SA 2EJBA 4YMSA 4GSKA 2YWCA 5G3YA 1XPUA 4QNRA 4RMHA 1PZNA 2F3TA 5LNK6 3GJRA 5BT9A 2Q2OA 2EATA 1Q95A 3UOWA 1DBWA 3O4IA 5EUQB 3EEBA 3ZQUA 3C6MA 3HGQA 5UKDA 2BFOA 2H4YA 4J2TA 4WN9A 1A5BB 4XFKA 4KGXA 1VCNA 1DC5A 3MRXA 4WZAB 1DAKA 4H7HA 1LPNA 4DIDA 1OZGA 2G80A 4CM7A 3BGDA 1CJSA 3BMCB 3F8SA 4HZUA 2M9MA 2DQKA 2MIIA 4D9MA 2H57A 4MVJH 2ZKLA 3WYFA 4P98A 3WA7A 1TK9A 2P3OA 1RXYA 4RSRA 4DDUA 3E2MA 3B1KA 1R64A 3OF3A 5GM2A 2OBXA 4KYVA 4X3OA 2MYTA 2XF8A 1ECLA 2WJGA 2O2XA 3E53A 3L05A 3T54A 4P6VF 4Q7KA 1H05A 2QXYA 2P2CA 4Y1GA 5IBRA 3WSWA 4CQMD 1AUOA 3L1HA 4I4TA 3NP9A 2D4AA 3LDHA 5JAQA 3TAHA 2BAGA 4HVLA 4KIGA 4C4AA 1NBWB 4P0TA 3KXIA 4ZT4A 3S0JA 5IDWA 4FZJA 2C94A 4HB0A 1SUPA 2WSLA 2XGSA 4CLHA 1YZTA 5KDLA 4CF7A 2BCEA 1E3WA 4JWTA 2A1TR 4RFSA 3UUEA 3H0CA 4MEJA 1OSNA 3EXHB 3WLOA 4F92B 4A4DA 3VR3D 5AW6A 1C8KA 2GTPA 1KMCA 1SHTX 4LHYA 5AJZA 4F56A 5ALTA 1MJNA 3R5SA 1IJKA 2FR8C 3MS7A 2VA9A 3OTQA 4QXRA 1MAUA 4O59O 1BEZA 1CUYA 1LS6A 1J8YF 1Z8HA 2REQB 3EDYA 3GLTA 4RY2A 3JVVA 3SEAA 3BD7A 3CQ9A 3OM8A 5BNFA 3X2SA 5BW5A 4KREA 4JBGA 1IBSA 3FPFA 4LVNA 4DHWA 5F76A 2C5GA 4KK3A 2B7LA 3GRPA 3GX1A 5JW6A 1EK0A 1JQKA 4HRVA 3AVVA 1EK5A 1J5XA 1DIAA 1QQ5A 1U9YA 3COSA 3DE1X 3NHSA 4GOOD 2SBTA 1N2JA 5LUBA 4AUMA 2OBLA 3GJ0A 2CDRA 1SBQA 3ODPA 5KX5A 3GRZA 3RRMA 3VTZA 5JAZA 4HNRA 1KOGA 3MLEA 2C4HA 3JQQA 4P80A 4IF6A 1Z7BA 1C14A 4UUMA 2WKSA 4IHJF 2MOKA 4RNCA 5GMOA 1RWKA 4Q1VA 3ZJYA 1LW6E 4E4YA 4EG1A 2C5FA 4YRLA 1T4GA 2OYCA 1RZRA 4I36A 1Z38A 4K6KA 3INRA 2XDWA 5CIYA 3S7TA 2Q8PA 3O1JC 2CF6A 4WI1A 5A7FA 2Z4RA 3PEFA 1ZY2A 4JOBA 4OMUA 3Q8MA 1II0A 1RJDA 5ED0A 3QU5A 4YRFA 4D41A 4KAFA 5E38A 2W2QA 4ODIA 5TT1A 4YFVA 1ACJA 3LUGA 2L0XA 3NBYC 3PNOA 2H2DA 3EUEA 1E1RA 5AI4A 3LVFO 4DANA 4TL7A 3PENA 1IVSA 1G3QA 2AN3A 4NDAA 3MW8A 4P5EA 1PJQA 3QG1A 4BV9A 2ID8A 3C87A 1MDBA 1ORIA 2VC2B 1L2TA 3OQIB 2XNHA 1KR2A 3FMFA 5CGZA 2RI1A 3N9IA 1CXZA 3QEKA 1KGSA 4BUZA 1QIFA 1VCMA 2SICE 3K53A 2X5NA 3G5UA 1UZUA 1DOAA 2Q6KA 5EJEA 1ZD8A 4S04A 4OHCA 2AX3A 1KSFX 5KX5B 1MOSA 3MJRA 3MCWA 4XGIA 4Y9RA 4B80A 2C61A 2XHEA 3G6WA 3HSYA 3H3JA 3DXFA 3CISA 5TJHA 1R9GA 5BUQA 2VT6A 4FDMA 3QWHA 1RJ9B 2PMBA 4WLFA 4ZYYA 2XB2A 1DKLA 3EXHC 3G1WA 3G5MA 3TK1A 5IDXA 3L4BC 5IJ0A 1H4SA 2A33A 4POAA 5K3AA 3P2IA 3IMEA 1XOIA 4A16A 4DB4A 3IE0A 3A10A 4WFKA 1R15A 3TRDA 4N4AA 1WE2A 1T26A 2N1MA 2NM0A 2WB4A 2YYYA 3RWBA 3J80A 1PR0A 1IHYA 4NULA 4RVFA 3VPBA 5THQA 2H4ZA 4FKMA 5J4LA 4GQAA 1PNTA 1T5IA 3MRVA 1YMQA 3O3NB 4QWWA 1KY4A 4G0PA 4RM2A 4QODA 4TLDA 2YY6A 3ZGXA 5H0IA 5AD1A 3O2QB 1P9WA 1Y3HA 2WP8J 5JAUA 1OA1A 2WMNB 2XI4A 2IW1A 4TN5A 1M2FA 1KIAA 3LLSA 3TQIA 1K6JA 1S1MA 3OQIA 3OKFA 2XDQA 2LKDA 2VYCA 1E66A 4XSVA 4A3SA 5BV7A 4U2BA 2VCHA 3OZIA 3DFKA 5EWJA 2JGRA 4GMKA 1HNWB 5CLLA 3RK1A 3TF5A 3CRNA 3ESDA 2BFMA 3IT1A 3HA3A 1OH7A 3RBZA 5KOYA 3V46A 3QWAA 2QG4A 1Y0BA 1D6MA 2NAPA 3DKVA 4AZ0B 5JSUA 3IAS1 1F0NA 2FUEA 2RGBA 4CKBB 2XMZA 2V59A 3LT1A 3OZRA 3EIFA 1OBOA 1H42A 1QGOA 3UJCA 4ID9A 3PNYA 3UTDA 2OKCA 3WYBA 4DGQA 1R12A 1RKXA 1V35A 3GB9A 1NN5A 4YEDA 4ZOCA 3T1VA 2JGDA 4D4LA 1HDIA 1W4AA 3A6FA 4P84A 1OREA 3ZS9A 2JD1A 1AZTA 1CUXA 1VDZA 2QZ4A 5F51A 5TRTA 3ZKWA 2CVOA 5AHRA 5JG7A 5C8YF 1ID1A 2A2ZA 2A94A 1L5HB 2Y66A 3IVCA 4JLBA 5K6TA 1NR5A 2EKZA 4UTOA 2FZ5A 4C08A 1K8ZB 5F4ZA 2HRQA 3PITA 4MINA 5I45A 3Q8LA 4E13A 1HEIA 2OLKA 1JDUA 4LFBB 2ZSAA 3ETLA 4MWSA 4Y2HA 5A9SB 3RAPR 2I4MA 2JIBA 5K0JA 2BF7A 1G63A 2HV9A 3MD0A 2EV9A 1MOZA 2Q1SA 1Y1RA 5TQ2B 5BXYA 2YJNA 4GOKA 1QQ7A 5M34A 1GZSA 4R40A 3NHMA 1W35A 3KD2A 2CXOA 3VR6D 4MDYA 1ITZA 1E96A 3K1AA 4Z2AA 1HFJA 2FWPA 1ACMA 1DX6A 1PR9A 1S5PA 2XITA 3ITEA 3K4QA 3O8DA 1N5OX 5LQSA 4E5DA 2I3ZA 4RADA 3IP6A 4JQYA 2OD7A 2ZKIA 1FP4B 2WU8A 3N05A 4QGSA 2Q3HA 2O7NA 5CNIA 3I1JA 2ZTMA 1J97A 4TYYA 4R4JA 4UXHA 3EDOA 4DRXA 3MWEA 1R8YA 1RADA 1JKFA 3I9MA 1JKIA 1DDGA 4PHHA 4QOFA 4DDHA 1CBUA 4XGRA 4MYSA 5LWHA 1JE0A 2H08A 1KYZA 4CDMA 3WMEA 2DPXA 1QHFA 1L7EA 1IRIA 1HEYA 5AJWA 4R3NA 4D3DA 1UMCB 2QM8A 1M8JA 4I6EA 4DYDA 5HS4A 2PA3A 4FHFA 4K1LA 1Z6GA 5C4GB 5TY0A 1R2QA 4KOEC 3ZEAA 8MHTA 1BD4A 3L5KA 3N75A 5THXA 3RVLA 2CXQA 1FFCA 2C2BA 1NUAA 1AGPA 3E2PA 3RVMA 1Z5GA 4YRRA 2D2VA 1IZ7A 1Y3IA 4CM3A 3RRBA 1E2IA 4L27A 3X0DA 2P9FA 1U2TA 4JSYA 3UMJA 4F4IA 1QYRA 2V45A 1KHHA 3IGFA 3ZLTA 2E5WA 4KE7A 1BIFA 2XHZA 2W8BB 3UPUA 4PSDA 3AZPA 4PBTA 5M2QA 3V9AA 5EGNA 2PGDA 4YRDA 2YZNA 3EVBA 1TTHA 3OCYA 5A5DA 5IHXA 3A1NA 5C52B 3QEBZ 2O3JA 1ZVVA 2BDEA 4HO1X 1V4NA 2HEIA 2P3LA 3NVAA 4CDRA 4NBSA 3ETJA 5FF9A 5K8UA 1GKLA 5HP4A 1JBQA 1C30B 2BDUA 1KU0A 3L8EA 2QMUA 3GGJA 2R11A 2NXWA 3NIGB 2NNLD 2RONA 3CEAA 1OFHA 4EMTA 2C4WA 2NT4A 4AWBA 4CKZA 3RTGA 1OYOA 1Y98A 3S44A 4R8SA 3L7JA 4YMLA 1J9GA 1OGIA 1VM6A 2IBMA 2W2LD 1EG7A 1JGTA 3ZVMA 4UQOA 1IBKB 3LP5A 2AI1A 2BZGA 2NZWA 4LA4A 3W2IA 3G49A 2DTEA 4BLWA 2XNJA 3DV0A 3TXAA 1RWQA 3AC0A 2LE0A 1S8OA 4YO7A 4OLAA 4OLFA 1KVUA 3KDSE 3KTAA 4RMIA 1CE8B 3TRFA 4OHVA 4WBSA 1EVLA 3UKJA 3TQOA 1HRDA 5K8TA 1E2NA 3BQ9A 2JCBA 5IFKA 1YB6A 2C03A 3IL2A 3CJTA 2NYRA 2QG6A 4NX2A 5BQ3A 2IV7A 1ZA1A 1T35A 1PP4A 2F1RA 4BL5A 4N03A 4D8YA 5J58A 1Z5VA 3M9LA 5GJCA 4BO9A 1NONA 5JAMA 5LMUB 2ODTX 2OV1A 1T5DX 2UYGA 2WVGA 1VYUA 3FYUC 4PFQA 5FV4A 4BKOA 3A2KA 3LHKA 1A8IA 3HYLA 4G1FA 2UXCB 2H18A 4OP2A 1OWNA 1XRMA 3FPAA 3H1EA 3I76A 3BEOA 2GM3A 4EENA 3ZJTA 3M5DA 2O8NA 4PICA 3EXIA 4M88A 3C7AA 3EGCA 3V55A 4YJHA 4UHEA 4FGLA 3O8NA 2MSWA 4KYTA 4CNQA 4Q05A 2Z57A 4DDKA 1P5JA 1ZNQO 2PKXA 3KOYA 4A03A 2PY6A 5F12A 3DL2A 3G2NA 4IHJA 2ODQA 4N9QA 4PPFA 1SZCA 4MLZA 3O90A 5E9JA 1Z4KA 4H7PA 1SCUA 1A04A 1DG9A 1YQDA 3QQ5A 2JLVA 1G8HA 2A9KA 1H2ZA 2O2GA 3PDUA 4INOA 2ORVA 4A8JC 3IP9A 4LRWA 1CQWA 2FWJA 4M37A 2R5FA 3L7CA 4OJKA 4UKDA 4BXOA 3MJEA 3RC8A 3R5XA 1NW8A 1DLIA 2HK8A 4JBYA 2QUZA 3CCCA 3DMTC 5K0BA 2AMYA 3FFBA 3GYBA 4FFDA 4EHIA 2B8JA 2WF9A 3X1KA 4XJSA 1ORRA 3B1YA 3BH6A 2DUNA 5B6JA 1PG5A 4CIWA 4IDAA 2GBLA 1UMKA 2BWJA 4LVCA 5IU6A 1AQJA 1DV1A 1S2GA 2NV6A 3PX7A 4IM7A 3ULKA 3HCAA 1SQSA 3FPHA 1GEGA 1J2UA 1RBQA 3ZDXB 3T7JA 5ICCA 3OCJA 1V1MA 3DVSX 1MJGA 1IE3A 2CHQA 2L82A 4NDNE 4TQUS 5LZ7A 3LC2O 3K16A 4YUXA 1WCWA 1E6WA 2V55B 3MGCA 1U5CA 4PZDA 1Y5LA 3U3DA 2WABA 4BMOB 1ZN8A 2Q4DA 2DOKA 2X8JB 3GMIA 4CN8A 2FRDC 3JD4A 3KDPA 4F6RB 1N75A 2VYND 2WM8A 3OOEA 4HOYA 4PPYA 4G0YA 1PQWA 2FMTA 1QHEA 2H07A 2HUPA 1QZZA 3FFAA 1TX4B 3VYUB 5J2TA 4OJTA 1A9SA 1TRKA 1A4IA 2JC3A 5DB4A 3LRTA 2D2FA 3ETCA 3K4PA 2XRFA 4ZEMA 4FKZA 2Y6VA 4KLNA 4QPCA 4RD0A 4C4ZA 2H2AA 3PFCA 4BVGA 2EWWA 1YFKA 1XQVA 3HFGA 3N0RA 4NEQA 3BFXA 2JH8A 5KOJB 2OV2A 3R5JA 1AK2A 5FWYA 1XQ1A 1IY8A 2PBFA 4U39A 1L1QA 1V5IA 4Q4AA 9GPBA 3AQ4A 5IBCA 1JQEA 2IEZA 2F90A 2VP3A 4QX6A 3BVPA 5DGDA 1O94D 3DDZX 5EL0A 2ZAOA 2ANBA 4PG5A 4G6ZA 5TMDA 1MAWA 4JODA 1J56A 4P82A 5EUCA 3UH1A 5HNKA 4PN3A 3W05A 1QE5A 1IDOA 2DPMA 3CGGA 3D7LA 1QYCA 3P27A 2J87A 5IJAA 2BUBA 5CAEB 1XMOB 1RHKA 1TLTA 1N2BA 4TYNA 4B48A 2CV1A 2C7QA 3EC7A 3ZDQA 5I8ZA 2JIQA 4IJUA 1M67A 2AWOA 3LUDA 1L0BA 4CMIA 1UP4A 3VH1A 2X23A 4N41A 3VJRA 2QYSA 4ZYUA 3I0NA 3KALA 4JNCA 1A4RA 4QOIA 1U04A 1WDLA 3QEAZ 3V42A 1GPUA 4QU9A 4RTPA 2VHVA 4RXUA 4RABA 5IJXA 1E7RA 1PT6A 1WUIS 4FC7A 3EBOA 2F1IA 1JXAA 1PIWA 3CW9A 1FP6A 2YXBA 4Y9SA 5DTMA 3HV0A 3OZAA 1OV6A 3WWPA 1DRWA 5L40A 1MORA 4JY7A 3M4YA 1VJ5A 2FPGB 4ZOBA 4ZEVA 1YZLA 2C0CA 1Z68A 3UWMA 4B44A 4EFLA 1E9AA 1NUSA 3FW1A 1WIWA 1JG6A 4PGAA 1XELA 5JCOA 5FWYB 1ZHOA 3WDLA 1SCQA 3R3HA 2IYNA 3SKYA 3FCYA 1K6MA 4Z7JA 4CBVA 4GP7A 3JATB 3CKKA 2OP1A 3R5TA 4OI1A 1K3TA 4DA8A 4Z7OB 1V11B 3HDVA 4ESVA 5ECGC 4EYEA 2OD9A 2GHQA 5AVKA 4G67A 2WTNA 4FYYA 3V8BA 5J9FA 2FPLA 4RY9A 3J81k 1E2HA 4UVGA 3WAKA 3RHZA 4Z9XA 4QJBA 3HKCA 3PF9A 1E9DA 2IXGA 4MTCA 1R0CA 4JB0A 1KARA 2J09A 1RRFA 2JD0A 3ZTWA 3Q8KA 2OOKA 4GD3Q 2DETA 1VHQA 2ODBA 4MMZB 4ZYZA 1Z47A 1CJMA 2GZSA 1X1CA 2PLRA 3IILA 5ERYA 1FUYB 3G68A 4NCAA 1OZAA 3DOCA 4LRTB 4HZGA 1FLNA 3ABZA 3R7DA 5D5PA 2H1CA 3A4TA 4BX0A 2R1VA 8LDHA 4YCMA 4JOQA 5AW1A 2HPAA 3KIPA 4LK3A 2B98A 4QPPA 4RSGA 3DBIA 1Y81A 1Q6YA 5AOBA 5B2ZA 2I55A 1X13A 2QTGA 5LC1A 3SQDA 2VDWA 1NJ6A 1IY2A 3DM9B 5BYKA 3E3NA 4CL2A 2QMHA 4I7EA 1F20A 4ESHA 4RELA 3LIPA 2PXCA 1PEAA 3LQ2A 4JDUA 1M2OB 2C2KA 1K8QA 9ABPA 5CT6A 2JL1A 1HDEA 5EHXA 4I50B 1V11A 3CZ5A 1IOZA 4UAVA 5DKFA 2WOOA 1G5IA 3BGIA 3IB6A 5FPQA 4E07A 2WHPA 2EYUA 4XYBA 3SMQA 2I2AA 3DE5X 2QK4A 5BPHA 1AB6A 1MT3A 1GCOA 5HF6A 5LIRA 2IHVA 1YVEI 3AWIA 1QFJA 1S1CA 4K9DA 4QXPA 1B2LA 4IFBA 3N7UA 4DUYB 4N54A 3I42A 4Z8YA 2CMGA 1ZINA 1JQDA 2WHQA 3D3QA 4O1HA 1EP1B 1XFAA 4ZDJA 4X95A 1U5BA 1GUZA 4QQKA 1DC6A 1WP4A 1OROA 3BSSA 5HMMA 3ZGYA 1W9HA 4JOCA 1KI4A 5AW5A 1PN3A 1BJTA 2H9YA 2CJWA 4BNXA 1RIFA 1SCDA 4L74A 3T9AA 3WGUA 3VR2D 4AS3A 2VK8A 3GAMA 3HCRA 2BF4A 1ISIA 1E5QA 5DIZA 5CDSA 3HBFA 1F14A 3FNGA 3ZLUA 2RAPA 3T3HA 1E61A 4FINA 4D82A 4HYQA 4AJNA 4E2XA 1RJFA 2H65A 1M2OA 1NUTA 5P8WA 1SRRA 1UMBB 4IRMA 4X71A 5ICGA 3GVIA 5DLQC 4BGVA 2D5IA 5J5VA 1Y8RA 1IMOA 1NYRA 2EDCA 3PGVA 4EJ6A 2VHTA 2DH6A 2H5JA 4NAHA 4HEHA 2JKVA 1ZFNA 4GC5A 1R8SA 2VKTA 2Q1XA 1EDEA 5H16A 2X13A 3KM0A 3PRJA 4MUYA 4R01A 4ZAGA 4ZT3A 4P31A 2A1UB 3EAFA 2B4TO 4HX9A 1NUPA 2B3TA 1SCKA 3CX3A 5KYTA 1T4DA 1NBHA 1Y6RA 1ZD5A 1UKAA 2MDTA 3PV0A 4KFRA 2H7XA 2OK8A 2V7TA 3FTDA 4TV9A 4PNHA 3WLSA 5KNBA 2X41A 5IVPA 4X6YA 3VHXB 1WCXA 5T6MA 4ECAA 4PHTA 1U5BB 1OCEA 3GG2A 3PR2B 2HAEA 3LOQA 4QDUA 1U2ZA 4Y2JA 2VNAA 4E5NA 3O31A 2AXPA 5JQGA 2IUEA 5B3AA 1SULA 3BTSA 1QO9A 2YJ4A 5IT5A 3D6TB 2A1TS 3WBKA 1V5EA 3SXJA 4BS9A 4WH0A 1CRQA 2NO6A 4IDGA 3VC3A 1JEQB 2AJDA 3PVSA 1QIKA 4UVIA 3NWBA 4I1VA 1L5GB 4C89A 2QMQA 1JWBB 4WY2A 3QLUA 5J1SB 2YCLA 2XYPA 4GXNA 4JI3B 2YICA 3CEJA 4I9HA 3I09A 1YJQA 2G77B 3P9XA 3AUTA 4HQ0A 1PGQA 1BEUB 2BHNA 1XZFA 3FD8A 1I1OA 3FWZA 3JVUA 3QIVA 4HYYA 2WT9A 4IV0A 4L28A 5BWOA 5F7OA 3T1TA 2XZLA 1M1XB 2IZ5A 3IQEA 2YVQA 3UAZA 1OTYA 2ZB7A 4M0FA 4ENSA 1X14A 3HEAA 3FLEA 4E5UA 3OQMA 1JXQA 3PHCA 1FE8A 2ILTA 3B9BA 1P1KA 4AM8A 4TWZA 3NHKA 1O9HA 5FI3A 3ENVA 1JLLB 1G2QA 4UOEA 2IYVA 2ZATA 3GLVA 4M4SA 1X8KA 2BHRA 2JKYA 5IAOA 1PKEA 2GFHA 4QAJA 1NF3A 4C1NA 4DARA 4ZI7F 5EP4A 4CIXA 1GA4A 2FK7A 1LNZA 1YS1X 2X58A 4ND2A 5EKTA 3Q3VA 4DR1B 2H4WA 4EHBA 1IBCA 2X5KO 3FTCA 3I73A 4HP8A 4U6QA 5IJZA 1NATA 3F9CA 3NBFA 2MINA 4UATA 1PKXA 5DHAA 3ZBPA 3RCBA 1ZQ9A 3A1FA 3SVTA 1E5DA 3KJFA 3KXLA 1ST3A 2JFNA 4BP1A 4DR4B 4QQ8A 2HR1A 3KEFA 1T6XA 3BMOB 5EYPA 4YP7A 5MF6A 1QOZA 3Q9SA 2ZRDA 1GUFA 2AZMA 1OLSB 3W4JA 5LXTB 2D00A 4B8ZA 1ZBQA 3AUFA 1SUEA 4C43A 5JDIC 2QNIA 3EVFA 2IPMA 4PAGA 5FPYA 5ABPA 2O8BA 4OH7A 3WMRA 5ALPA 3F9RA 1K1EA 2FP4A 1WVGA 2WC1A 3K2BA 3O4RA 3NC4A 4FVTA 4RWZA 2ZYUX 5KI6A 2B1IA 4UM9B 2PKYX 1T8YA 2WU3A 3VPDA 1EFTA 1P6QA 1UEJA 4H6PA 3FZYA 3PXDA 1G21A 1Q7BA 1NT2A 2CXHA 2GEUA 2X22A 3RV3A 1VGVA 3KVVA 1FQOA 4UD6A 4BNKA 3ZCXA 1XLTA 1JR4A 3E0QA 2PUTA 1GPNA 4UZSA 2ISCA 4B32A 4UJ5A 2BFWA 4HWKA 1W0KA 2OAEA 4MS1A 1JFTA 4IQFA 4QXAA 2XQFA 5ARCA 4DNQA 4Z8XA 1NMSA 4YACA 4F5EA 2GWRA 3SJ7A 1FZQA 3LH5A 3NH6A 4EZEA 5IVDA 2ODNA 1UPTA 1I1HA 3I83A 2W6ZA 3JQ8A 4G5XA 4F2HA 1FFAA 2RBKA 1AS2A 2G06A 3VTAA 2M6LA 3IKJA 4NHEA 3RUEA 1WXXA 3WQHA 3KK0A 4TQAA 1J00A 2ES4A 2IKQA 4D4IA 4G0WA 1UINA 3F3KA 3IR6A 4Q9JA 1XKTA 5AM4A 2J4CA 2PMKA 1I3OA 3G7SA 3IEUA 2ECPA 4IJWA 3KUUA 3MTBA 2NUAA 3W5VA 3AP1A 4LZLA 5LQMA 2I7CA 3AEKA 2H1RA 3PGLA 5BNZA 4CKWA 4KPUB 1NOKA 2QD1A 3G17A 1X7XA 1Y8QB 4QGHA 4YH1A 4JL8A 1O5TA 1DAOA 1HG1A 3O8OA 3KB2A 1GDTA 3VU3A 3W78A 4O4LB 2XSZA 1GAQA 5LD2B 1VOTA 5H8WA 4TZ0A 2XKBA 2Z4TA 3NXSA 5FDFA 1ULZA 3EXEB 4ZRDA 4E88A 3W7AA 5B58T 4LECA 2I9KA 3IT2A 4J4HA 3GZNA 2QJTA 3GI1A 1A88A 4MV6A 2WTXA 4R9RA 2YZKA 1DJPA 1H93A 4CKCA 4EKNB 1TT5B 3DZIA 2Z8ZA 4OQQA 3L1JA 4YQZA 3PQ3A 4M8IA 1ECBA 2IDMA 5ELMA 3TNDA 1U63A 1VSTA 2CMDA 3ACBA 3EFHA 4HYEA 4OQ4A 2QQFA 4YIKA 3V32A 4B3DA 7MHTA 4KFUA 2WR8A 4ZEWA 5JY1A 4MYRA 1T0IA 2RKWA 2QIPA 1HRKA 3LYAA 1X1QA 2X1MA 4Y6GB 1QF6A 1ZJ4A 1JIVA 4FR2A 3IEIA 4Q1FA 4RCVA 2GF2A 1OKKA 1DAMA 2X6QA 2O2SA 2PJRA 1MR3F 1ZH0A 3KXKA 5HF5A 4N5HX 1SKYE 1WOYA 2OXCA 2R86A 1U81A 2QJFA 3C3BA 4U2GA 4ZT2A 1BU5A 4INZA 3KR2A 1SUDA 1X80A 1J49A 2GPJA 2AC4A 3H5NA 1A9QA 1EFVA 4DLBA 1OLXA 2BONA 3I3SR 2V5UA 2AB0A 4TPKA 4BV8A 3AW9A 1Y37A 4R51A 3FNFA 3STXA 2DBVO 1QO0D 2Y0DA 4AWAA 3JWJA 3FYTA 3U3JA 3CEMA 5DX8A 4AF7A 4UCXA 4RZ2A 1UFQA 4IW3B 1J9ZA 3L0CA 2H5EA 4S24A 3ONWA 2VHYA 3QZUA 3IUJA 4CMAA 3BULA 1IXKA 1NKSA 5FOTA 1OFGA 3H1AA 4C0HA 2IY8A 4CKCB 3FTEA 4M6WA 4QGGA 2ONJA 3HUFA 2ZBVA 4P9NA 3VMFA 4ZT5A 2Z5FA 2QAJA 5BV2P 1IFXA 1V0JA 2QE6A 3QIAA 3AF6A 4CR7A 2PX5A 3DKPA 1TO1E 5FKJA 3GPDG 3IO5A 4MWTA 5C53B 1JA1A 4LZPA 1XRLA 2NSHA 3HZOA 3MUOA 4PHCA 4QDXA 2QVGA 3RGGA 4FJ0A 2D54A 5BUZA 4Z5XA 2O3SA 1LLDA 2BRUC 2O1XA 5PNTA 3LL4A 1ZWKA 4P36A 3WLMA 3KZCA 1QP8A 1OXTA 2GHIA 2GCOA 2P1RA 2WINI 4JYZA 2AYYA 4FNOA 5SYAA 4WLOA 3C1TA 2JH9A 4J43A 1H9AA 1LTKA 3AEUA 4HNTA 4W9MC 3I2YX 1J0XO 2RHBA 2VPXA 3IVGA 3EW9A 4KXMA 4Q3AA 1KRXA 1P2FA 1GTZA 2JB9A 3IP3A 2VP2A 5IAEA 1ODCA 3WLFA 1XKLA 1W85B 5F78A 2ZRQA 5JE8A 3M6VA 3GFVA 4N5MA 1EFLA 2B6NA 4ZA2A 2Y2VA 5E1OA 3SEQA 4CIYA 2POCA 1U5AA 5JNVA 3WAJA 2CEAA 5I48A 2OQVA 2FW7A 3EG9A 4RFLA 3SC2B 1A7AA 3NASA 1P7WA 3KFVA 4UQLA