5YASA

Hydroxynitrile lyase complexed with hexafluoroacetone
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
total genus 91
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5yasA00
3O0DA 1XKLA 2WFLB 2GZSA 1N5MA 1P0QA 2WIFA 4QDUA 3TEJA 4J0CA 2HADA 4PSCA 1G4HA 3PFBA 3PUIA 4HXGA 2FUKA 3I2GA 4B85A 2V97A 1ZJ5A 5IH7A 3Q0TA 1CUUA 1W1IA 3VJMA 3UUFA 4OYYA 3PICA 4GLBA 3W2TA 3R3ZA 2C5FA 3VVMA 3ESCA 1QFMA 2CB9A 2ACEA 4BVLA 4G8BA 1QFSA 2AJLI 4BDSA 4C4XA 1F8UA 2GZRA 4FBLA 3M81A 4J0GA 2JEYA 3F96A 2XT0A 1SC9A 4QWWA 5HQ3A 4OB7A 1KU6A 5IVKA 3FSGD 3D0KA 1K5PA 3I1IA 2XLBA 2UZ0A 3WWOA 1CUCA 5JZ9A 1VE7A 4BB0A 4C4YA 5ALIA 3A6ZA 2WU3A 2PPLA 2PUHA 4UFNA 1XZBA 3DKKA 3VVLA 1A8UA 3WJ1A 4HZGA 1DX4A 1O6GA 1YAHA 1XZAA 4IHAA 3MUOA 2WFZA 5IVDA 4BDTA 3WK4A 1W75A 4Q82A 1U2EA 5ALHA 2VF2A 4B0OA 2PM8A 4X6YA 1ZICA 3PF8A 2YYSA 3D3NA 1AUOA 3Q8WA 1BCRA 1CUHA 1TRHA 2WUFA 3GBSA 3OURA 4X6UA 5AM0A 4AXBA 4GEGA 4G8DA 4FLFA 2H7XA 5JAUA 3ANTA 5EHZA 1CUVA 1TQHA 1ZI9A 2D0DA 4G1FA 4PO3X 4Z49A 2JGJA 2BJHA 3QPDA 2QR5A 4C6HA 4EY8A 1CEXA 1RP1A 3RKSA 2OCIA 2HRQA 2O2HA 1GZ7A 4HVTA 5LZ2A 4B9AA 4M0MA 4WFJA 3WA7A 2AJ8A 3DJYA 2K2QB 1TK3A 1R1DA 3H1BA 5JATA 4Q1VA 1VE6A 1U8EA 4E14A 1FFAA 1CFJA 3C6BA 3H2HA 3T4UA 5AI8A 4DNFA 3LLCA 1P0MA 1YR2A 1G66A 3NGMA 3CN7A 4FBMA 3R3YA 4FHZA 5JIBA 5AI4A 3WWCA 4Y2RA 1Y7HA 4BE9A 4TPKA 3FLAA 1UOQA 1ZOIA 5K3CA 4BZWA 3K2IA 2GBCA 2PL5A 1NX9A 4C4ZA 3C45A 1OXMA 2QXUA 2IIVA 1LNSA 4UFPA 2QMQA 4KAJA 1A88A 3BF7A 3WKAA 1A8SA 3DYVA 1CUBA 1GQSA 1E8MA 1TIBA 5AI6A 1E66A 1JJFA 5A2GA 2HU8A 3WQHA 2OQVA 4BC1A 5DYWA 4K6KA 3DL7A 3N2ZB 3OPMA 4KE6A 1W52X 3O9VA 5EHNA 2J4CA 3VJLA 4FFVA 3WWDA 3WYDA 2RHWA 2ES4A 3TGLA 1IZ8A 1GKLA 1XRQA 2O7VA 4MEBA 1LPOA 2WG0A 4XVCA 3D2AA 3V1LA 5CXXA 5ALEA 4I4CA 4OYLA 1XQVA 4TVKA 3HZOA 3STVA 2BFNA 4EBBA 1MAAA 2DHEA 5JD5A 2ZYIA 5D6OA 4QLAA 1XZLA 1QIFA 2G5PA 4JEIA 2HIHA 3W04A 5ISMA 3KXPA 2PBLA 4N8EA 3X3HA 5LIPA 3WJ2A 4UBNA 3W9BA 1C7IA 4YX9A 4H7JA 3WYNA 2CJPA 5DJ5A 1J2EA 3DL4A 2BKLA 4GDMA 1K4YA 3IDAA 4UHCA 1OCEA 4HXFB 1XRNA 3G9ZA 2V9ZA 1QIEA 4BCBA 3FAKA 4H0CA 4P92A 4OB8A 2H9YA 3HACA 5ALOA 1CUGA 2VATA 1ETHA 3WKEA 1M33A 1VXOA 3RARA 2WUEA 2C0QA 5LKRA 3H2JA 1CQWA 2XMRA 3OC0A 2G5TA 4LYEA 3W06A 2DCMA 1WCYA 4KACA 5SYNA 1WM1A 2D5LA 4KAFA 3W05A 3RK4A 5CBKA 5FUMA 1YSCA 5EIAA 2Y1KA 1YA8A 3KD2A 4BVJA 4MXDA 2GYUA 2H7CA 5LKAA 3FLBA 4DSZA 1FSSA 3TRDA 5AK5A 5D7BA 1HL7A 4MYDA 4X6XA 5AKIA 1AGYA 1EK2A 3WK9A 3AIMA 4W1SA 4C89A 1TCAA 1QIIA 3D5EA 1P0PA 4MWTA 4X3CA 4N8SA 1UWCA 5SYMA 3PDCA 5CH8A 1HLGA 4G5XA 4BRZA 3FYUB 4X90A 2BCEA 4ZWNA 2XUOA 3L1HA 1JU4A 1QIKA 3SX4A 3ESAA 4H35A 2WJ4A 3FYUA 1Q84A 2WM2A 5YASA 2C7BA 1H23A 2J3QA 4P08A 1UK6A 4J7AA 3FOBA 3R3UA 4BZZA 3F67A 2JGLA 5A7GA 5CW2A 4CG3A 1XQXA 1EH5A 4M0FA 4W1PA 5DWDA 5AP9A 4IH4A 5HZGA 2OG1A 2GYVA 4QLOA 4EY6A 1YA4A 4X00A 3O4GA 1Q0ZA 2V96A 5E4TA 1CRLA 3NUZA 4DYHA 4ZXFA 2OXEA 5EGNA 5AKGA 1LBSA 5ALGA 4DMCA 4U2BA 4MYSA 3C70A 5ALDA 1O6FA 3IUMA 5K3FA 4Q34A 1VJ5A 1EB9A 1MNAA 5DLPA 2HFKA 2WFMA 2JGEA 3BJRA 1U65A 2P8SA 5AI0A 2CUTA 1EDDA 1ODSA 1UOOA 5A7FA 1MT3A 4AZ0A 1ORVA 5AKJA 2XUDA 2FJ0A 3K6KA 3KDAA 5I8PA 2WUDA 4LXHA 3P2MA 2B20A 1IUOA 5I9IA 1DINA 4AO7A 4C88A 3G9TA 3GFFA 4QNNA 3G9UA 5KBYA 2NW6A 1THTA 3M82A 4Q3KA 1JMKC 3IURA 2QRUA 5JANA 4G4IA 4IQ4A 3IULA 2Y6VA 3ICVA 5AIBA 5K3FB 5LZ5A 1XZFA 4L0CA 2EDAA 1QE3A 3QMVA 4RPCA 3I2FA 4KR0A 3RM3A 4GBGA 4FOLA 4EY7A 3M83A 1BRTA 4MQMA 1EK1A 1CUEA 5JARA 3G0DA 4DGQA 4DMHA 5ALVA 4JYPA 4CIAA 3VXKA 1C4XA 2Y2UA 5ALNA 4ROTA 2JGKA 3IUJA 4OB6A 2XMZA 2WLSA 1EX9A 4X7BA 3WL5A 3VJKA 3ESDA 1CUYA 4WFIA 1F6WA 4MWSA 2PVSA 1FFBA 1J1IA 4U2DA 3R3XA 1WOMA 3STWA 1IVYA 1J06A 2HA5A 3C87A 5T4FA 4B83A 1W6RA 4X93A 3F98A 4H7IA 3A2NA 4LXIA 1IZ7A 3BDVA 3DOIA 1NU8A 1CUDA 2HA0A 4B9EA 3LIIA 3A2LA 2I3DA 1ZIYA 5DNUA 4DLNA 3QYJA 4H77A 1FJ2A 1AQLA 1R88A 3BE8A 4Y2PA 3E4DA 5FP0A 2WG2A 1LPAB 4XIIA 5AOCA 1UOPA 1XQWA 5DTJA 1DWPA 2IITA 5KWJA 2DHDA 2VAVA 3WMRA 4G8CA 4B81A 2GYWA 3H18A 3QVMA 5K3EA 2QJRA 3WKCA 6YASA 5JZBA 3C8HA 1QIJA 4AN0A 3EF3A 4PF1A 4U2GA 3V1KA 1EDBA 1EB8A 1QIHA 2VAXA 2QXTA 1YASA 2WHPB 2HA4A 3ILSA 1ZD5A 2ZJ7A 4HTAA 5LYYA 4J0DA 1TCCA 1K8QA 1MX5A 4FFWA 1DWQA 4BAGA 5CT6A 2VJCA 3AZQA 2QUAA 1QO9A 3C8DA 1EHYA 3ICWA 3H17A 1QOZA 2XE4A 1R9NA 3I2IA 2JF0A 1QIDA 4GHWA 4Y2SA 2QKYA 3D2BA 4GWLA 1WHTA 2EDCA 3B12A 3LIPA 3ZV7A 4GXNA 5HCUA 2BGNA 3EQ8A 4W1RA 2XQJA 1VLQA 1KU0A 3V1MA 4B84A 4KE9A 2XUAA 4AMYA 2Y2VA 3I6YA 5AM1A 2CZQA 3I1YA 1ZD4A 4QDTA 4DM7A 1JT2A 5FRDA 1Q0RA 1QIGA 4OCZA 4H18A 2OPHA 1HBJA 3ZLTA 3A70A 2J3DA 2OGZA 2WU4A 5CT9A 3AUKA 1L7RA 3ED1A 2PSDA 3IIIA 2OCLA 4IH1A 4NVRA 1CIJA 3DEAA 1CLEA 4KRXA 3G0GA 3ANSA 4B7ZA 4A16A 1VXRA 1CR6A 1TCBA 4X92A 4Q3LA 4DMFA 1XLWA 4WDRA 4XWGA 4Y7DA 1LZKA 1AC5A 3I6ZA 1XZIA 3PE6A 3BIWA 2DSNA 2XMSA 1EI9A 4L72A 1E8DA 1CQZA 1P0IA 3S2ZA 2BUBA 2PSHA 2QTBA 1LPSA 1ZJ4A 1QO7A 3I2JA 4PW0A 5EHXA 2B4KA 2W22A 5EIHA 3V1NA 2VA9A 3CXUA 1LBTA 4B6GA 2PSJA 2PSEA 4G4JA 1XFDA 1XZKA 1DX6A 4N8DA 1XROA 1AX9A 4BAUA 3KWJA 4NMWA 5JASA 1SFRA 1VOTA 2GBIA 1SCKA 3LP5A 3WLAA 1A7UA 4WCVA 1JU3A 1CUIA 4UBKA 5A7HA 1DU4A 1XZGA 5FPPA 4BYMA 5CXUA 2FJPA 3H2GA 1YB7A 4D9JA 2CMFA 2OGTA 5DYTA 3WL8A 2XB6A 4BATA 5BV7A 4RE6A 5ALSA 3WK8A 3GROA 1UXOA 1CUWA 4ZGBA 4Y9SA 5CT4A 4OD0A 2OQIA 2XUKA 2WILA 4JYMA 4UHFA 1OILA 4Y2UA 4AN1A 4O08A 4X94A 2PUJA 1L7QA 1GQRA 2HL6A 4L3WA 2PX6A 3JWEA 4YPVA 3WKBA 5CH3A 1JJIA 1BROA 1X70A 1BN6A 2WJ3A 2XQGA 4DSAA 2VJDA 3STTA 4U2FA 5LP1A 1K6EA 4LHEA 2QM0A 3L1IA 5FV4A 1ZI6A 4E11A 3D2CA 4IO0A 4J3JA 4W63A 1XRMA 4Y2QA 3FSGA 3FLEA 4Y2XA 5ALPA 5AI5A 4W9RA 4AB1A 2BGRA 4Y2YA 2ROQA 2HHAA 4G4GA 1GT6A 1YAJA 5EIEA 2OCGA 1PV1A 1H2YA 3L1JA 2BAGA 4FNGA 2XUPA 1LPBB 1QONA 4XX1A 5JADA 1LZLA 3WZLA 2DQZA 2QOEA 1D07A 2R11A 4NS4A 1X2EA 4QEKA 2GBFA 5CTAA 5T4BA 1ZIXA 3QMMA 1CUAA 2B9VA 3ZLVA 3HYSA 4CFSA 2C0PA 5K3BA 1TAHA 1EXWA 1XQYA 3BL8A 1QTRA 4WDQA 4MQLA 5ALFA 5J3JA 5C8ZA 1W4LA 4OU4A 1GKKA 3GA7A 4BP9A 2WFLA 1FFEA 1QIMA 2BUAA 2XUJA 2ZYHA 2QUBA 2VTVA 4U2CA 5AKXA 4F21A 4B80A 5BOVA 4J03A 4X95A 2DHCA 4E46A 4BCCA 3H2IA 4HAIA 5D3KA 1YCDA 3EQ7A 5HK8A 4JH0A 3HC7A 3BWXA 5DNWA 1T2NA 4OSEA 4BC0A 2HA2A 3JW8A 4ZRDA 5AKZA 4UBMA 5CH5A 2VSQA 5JYCA 4TGLA 3YASA 2C58A 2OLEA 4WFKA 2G63A 1IMJA 3O9MA 1VKHA 4GI1A 1AURA 1XLVA 5FPQA 4UBIA 4ZV9A 4FKBA 2O2IA 3DD5A 5ALKA 4RGYA 3WIBA 2ONCA 3D59A 4Q3OA 1JJBA 4CIBA 5AM5A 5DNVA 3STUA 5ALTA 1PJAA 5K3DA 3DDUA 5AO9A 5HF9A 3E1GA 5AOAA 2XQIA 4PV7A 3B5EA 3AINA 5DYYA 2PKYX 5AHXA 3O4IA 3QITA 4AX4A 2XLCA 1W76A 1DTEA 3HI4A 4UHHA 1R3DA 4A23A 3M3DA 5HF8A 5C8VA 3EIOA 1UZAA 5I7UA 3RLIA 2RI6A 1EVEA 2ZYSA 5EHQA 4EB0A 4X97A 2WG1A 4AMZA 3EBLA 1ZI8A 5ALXA 4X71A 1XRLA 1G5FA 2ZJ6A 3OOSA 4XJVA 1CUXA 3TJMA 1SCQA 3GZJA 4JNCA 5IVHA 1DT3A 4BTVA 5BWCA 2X5XA 2Q0XA 1IUNA 1ORWA 2QT9A 2PU5A 5FDFA 5LZ8A 1HDEA 3STXA 1MO2A 1DWOA 1G42A 5CURA 1BS9A 3IA2A 1N5RA 2FX5A 4INZA 2ACKA 4KE8A 3H19A 4ITVA 3AJAA 3OG9A 3FCYA 1R50A 5ALMA 3AIKA 1MU0A 3CCCA 3UMJA 3PUHA 3E3AA 1JMYA 3IB3A 1DQZA 3U1TA 3KWFA 2LIPA 5ALQA 2XUHA 2JGMA 1BEZA 3PF9A 2WIKA 3G0BA 2VJAA 2YH2A 2XMCA 3WK5A 2XMDA 2Z8ZA 5LZ4A 2HM7A 3ZWQA 1VZ3A 5FXMA 5CT5A 1ZGCA 3S8YA 2WHPA 4QWMA 2C4HA 1UKCA 4FTWA 4X85A 3N0TA 5ALYA 1Q83A 5E4YA 4UBLA 3WZMA 3C6ZA 5AJHA 4G9GA 2OGSA 3EQ9A 2HU7A 1MX1A 5ESRA 5LZ9A 4ETWA 2QJWA 3AZOA 5FLKA 4V2IA 4KJXA 2O2GA 2CKMA 3R0VA 4H7EA 3DS8A 1HPLA 3IVMA 2Y6UA 4L9AA 5AK4A 1EINA 3HLKA 2WTMA 1ODTC 5JAHA 4QDZA 5K3AA 5AM2A 4MJ3A 4HRXA 3AFIA 3H0CA 1Y7IA 4BAZA 1XKTA 4LIPD 2XDWA 1RYYA 2H7YA 3WWPA 5K5EA 2HFJA 3O95A 4K2AA 4EY4A 4A5SA 5IVIA 3VKFA 1KEZA 3C6YA 3D7RA 3DCNA 4UUQA 4CCYA 4LKOA 1H22A 2B61A 3VISA 2VQ6A 1EA5A 2Z3WA 3C5WP 3O4HA 1B41A 3I6MA 2JEZA 7YASA 4RE5A 3G7NA 2ZYRA 1A8QA 4H7DA 4J0IA 4WY8A 4QDXA 1DT5A 2XQKA 2JGFA 2E3JA 2C5GA 2IX9A 1F0PA 2O7RA 5AKYA 5AM4A 3MUNA 3MGAA 4GW3A 2VT6A 1C7JA 1SCIA 3SWWA 2VJBA 4NZZA 4CG1A 3U0VA 1MNQA 5FOQA 4DNOA 4BCDA 3CCBA 3WA6A 2YXPX 4UHEA 2Z3ZA 3A2MA 1H2XA 4PQEA 1RWQA 1USWA 1YB6A 3DOHA 5AKKA 3F9CA 4UHBA 5AI9A 4N5HX 2H1IA 3QPCA 2V98A 4I3FA 3E0XA 3OM8A 4KYVA 4ZI5A 3QH4A 4G9EA 5ALWA 4KE7A 4UHDA 1ISPA 1GXSA 2PSFA 4C01A 3AZPA 5AOBA 3OTQA 1CUFA 3UUEA 1L7AA 2WIJA 4BTLA 2VEOA 4W1QA 1YS2X 1LPPA 3VDXA 5HKBA 2HA6A 1QLWA 4AO6A 1VA4A 3O4JA 1THGA 3R40A 4PSUA 4X91A 2DQYA 1LPMA 3G0IA 3GELA 2OAGA 4B82A 4BE4A 3H2KA 3FVRA 4UPDA 2I78A 5HFNA 3QPAA 2DR0A 3C6XA 1CVLA 1ACJA 4Y2VA 4P93A 4PNZA 3DQZA 1XZDA 3KOOA 2JGIA 1TKRA 1WPXA 1IUPA 1I6WA 2VT7A 4CG2A 3DLTA 2DFPA 5JAOA 4Y2JA 4CCYB 5D3ZA 1FFDA 2QS9A 1HQDA 2RIPA 2ORYA 5AKEA 1E89A 1XZJA 1MX9A 1LPNA 4HS9A 3AILA 3I2HA 1MPXA 2XUGA 1UT6A 2AJCA 2WTNA 4KEAA 1BN7A 2RGUA 2AJDA 1MN6A 4YK7A 3HEAA 1X2BA 5T4HA 4H7KA 3I2KA 5HF6A 2XQFA 2OCKA 1BE0A 2YASA 3LCRA 4DNQA 3K9BA 3G0CA 3FCXA 4EUSA 2W6CX 1ODCA 1GPKA 5AKLA 4CI9A 4U2EA 5A62A 4M0EA 2QVBA 4YASA 4HXEB 5AKHA 4ZV7A 5LLSA 4FLMA 1GGVA 5ALLA 1WHSA 3FVTA 1CV2A 4OU5A 1AZWA 3PFCA 2QZPA 4BRSA 3WL6A 4DTCA 5LZ7A 2HA7A 3B3QA 5CT8A 2EEPA 3HXKA 5HK9A 4ARBA 5E4JA 3IUQA 4FNMA 3BF8A 3ESBA 3V48A 5DTIA 2XMGA 5KWIA 3WWEA 2WQZA 2RONA 1XLUA 2CEKA 3IBTA 4K6HA 1N1MA 2CBGA 4K5QA 2XI4A 1EVQA 4EZIA 3LS2A 1XRPA 5JZSA 1S8OA 3WL7A 3BXPA 1H2WA 2Z8XA 4C87A 2WUGA 2HRRA 5EI5A 3GUUA 1WB4A 1QGED 1ZD2P 3HSSA 3DNMA 4ARAA 3FYUC 3T52A 1B6GA 5HFAA 1GPLA 5T4EA 4FDMA 5A6VA 1EDEA 4AZ3A 4AO8A 3FBWA 1MJ5A 4CCWA 4S0XA 4EA6A 1E3QA 3DKRA 3HRHA 3STYA 2I3ZA 2WIDA 2ZSHA 1DQYA 3ZLUA 2ZJFA 4ZREA 2Z5GA 5KREA 3QBJA 4BBZA 4BVKA 4DMKA 1GPNA 3WI7A 4GECA 1XZHA 1E8NA 3W9UA 1R4ZA 3QMWA 1F0NA 3BIXA 5EFZA 2ECFA 4KAAA 3D4LA 3BDIA 5IKXA 3C43A 3QM1A 3H1AA 3MVEA 1WB5A 2BUCA 5AM3A 4DIUA 1H2ZA 1XRRA 3ZI7A 4H7FA 1R9MA 3V9AA 1CUJA 5JAPA 1UKAA 3F8SA 3JYHA 4B0PA 2XUQA 2HA3A 1J07A 5JALA 2JIDA 2WJ6A 5CMLA 5F4ZA 3WKDA 5AIAA 5JD4A 5FKJA 2WKWA 4QA9A 2AJBA 1QZ3A 5ALZA 4QDOA 5CRIA 5JD6A 4UFOA 4P9NA 4DNPA 1LGYA 4KRYA 2J4FA 4HRYA 2G4LA 1CUSA 1XZMA 4JUIA 5AH0A 1VZ2A 3SC2A 1BEEA 2R8BA 3G02A 2WHQA 2XMQA 4UBJA 3FWHA 1MTZA 5ALUA 4F0JA 5C7YA 4BP8A 3F97A 1BU8A 1U4NA 1JI3A 1SOMA 3R41A 4QE3A 3WK6A 3FYTA 1JFRA 4J0HA 4Y2TA 4AQDA 1UFOA 4WJLA 1WB6A 4PSDA 2ZSIA 4F5ZA 4WY5A 1UKBA 3DYIA 2WSLA 4RNCA 4H7HA 2X8BA 1N8SA 5AICA 3WK7A 1QJ4A 1NU6A 5H3HA 2XMBA 1CPYA 2RHTA 5BWBA 4LYDA 5AK3A 4UBOA 2ZVDA 2HDWA 1Z68A 4N5IX 5E2IA 4OUKX 5HKAA 3HJUA 4LXGA 3G9XA 5ALJA 3NWOA 3R3VA 3FNBA 2OAEA 4OPMA 2HU5A 3QZUA 1XZEA 2X76A 3G8YA 4MEAA 2XUFA 1Y37A 4J0KA 1BCSA 2PU7A 1ACLA 2I03A 5AK6A 4E15A 4IH9A 1LLFA 3KSRA 3R3WA 3HABA 3SK0A 1VA5A 5C81A 4F60A 2AXEA 3CN9A 1ZD3A 1UK9A 3WIOA 5C8XA 1WPRA 1ZGBA 1MAHA 4FLEA 4J0JA 2XUIA 1FFCA 5HQ3B 1CUZA 1YS1X 1HKHA 3C5VA 3I28A 4EHBA 3BJMA 5A71A 1JKMA 4QZVA 4K6GA 4FMPA 3NOXA 2JBWA 2WHRA 1QTIA 1UK7A 1XZCA 5HF5A 1K63A 3AIOA 3H04A 1AKNA 5ALRA 4I19A 3PI6A 3IUNA 2GBGA 2RAUA 1PFQA 1T4MA 4Q05A 2WIGA 1E5TA 1AMNA 3ZPXA 4EY5A 1UK8A 4FWBA
chains in the Genus database with same CATH superfamily
2G76A 5I7VA 1XKLA 3F7NA 3LUGA 3HN6A 2WFLB 1E9VA 2I76A 4KXQA 1G7SA 4J0CA 1T91A 4EG4A 1O9GA 5HHTA 5DGDA 4CT4B 2J5BA 2QGNA 5D8DA 1KY4A 2QTZA 3CZRA 4HXGA 5TF4A 4DKJA 2VJPA 5B7NA 2CNDA 1UT8A 1MX3A 1FDWA 1H4VB 4HXYA 5KYXB 4DG8A 4TMVA 2NXJA 1WUKS 3PA8A 5IH7A 1URPA 4S12A 1V4BA 5JDIC 3I9OA 1GR0A 1IBRA 4Q66C 3HXMA 4HSEA 3M5WA 2I2XB 5EWJB 3U4MA 2R5FA 2FWIA 4DMUB 2PQ0A 1P3JA 4QT0A 4TYQA 3ZOKA 4G0YA 2DBZA 1P73A 2H0QA 1A2BA 2FSUA 1YULA 1Z6AA 4NNJA 5JQGF 1KI9A 3MPUA 1NRXA 3PXXA 3BFKA 1XYVA 2IY9A 4IXDA 2A57A 2PD3A 4CUKA 3QHPA 3KBBA 2J9FB 4G8BA 1QFSA 2AJLI 3VX4A 4Q4CA 1N6PA 2YQ5A 3BIJA 3BREA 3ELWA 1F8UA 1VG9B 1YJBA 2C2YA 3GT0A 4BXOA 5F3WB 3W8NA 2Y8EA 5REQA 1E9RA 2C97A 4HAXA 2IHZA 3BMQB 4C14A 2OBXA 3F96A 1YS7A 2GARA 4QWWA 4DLZA 5HQ3A 2EZTA 2JDID 5AJTA 3PS9A 2A1TS 5WRFA 2A9QA 3FSGD 2WF6A 2O6LA 3HWSA 1UC4B 1SQ0A 4LXQA 2CDBA 1W581 3KVYA 3LLVA 1K5PA 1ZM3A 1R5OA 5CD9A 3GJ7A 1CLUA 4G97A 4KIFA 4MVJA 3WWOA 1OYVA 4EX7A 4F4JA 1BU5A 4ESHA 1A98A 2Z0MA 4IS2A 4G36A 8GPBA 4C4YA 4WESA 2JCBA 3A6ZA 1M6NA 1YKSA 2DXIA 1JS1X 2O2ZA 4JZYA 3AESB 2WU3A 5U1PA 1L3CA 2PPLA 1JDTA 2PUHA 2X4LA 4PAWA 4XWTA 5A0FA 1PEYA 2C4NA 3DTVB 3OZGA 3R8XA 3U7IA 4EJFA 3PLNA 4YJ2A 2FJUA 3I1FA 3IHWA 2R96A 3F5SA 1UJ6A 4KKVA 4A0FA 4EWLA 4RV9A 2EBHX 1BQEA 3S7TA 4JAVC 3TS1A 4FB5A 1SHKA 1DX4A 1L1RA 3CYFA 2NAPA 3VKHA 1YAHA 3FUUA 3X1MA 1FDSA 1R74A 2WFZA 4L16A 4BBJA 1KVSA 1W75A 2DKFA 1KDVA 5IASA 2WAAA 3ZBUA 4C4OA 3QU7A 1L5RA 4WN3A 2HWXA 3A26A 2VF2A 3O8CA 1U2GA 2PM8A 3DH0A 4DQDA 1NVKA 4RZHA 4R1LA 4MKGA 2YYSA 1YDEA 5EXTA 3WJAA 1PN3A 1E79D 2REBA 3A0UA 3TUZC 2XDYA 4LF6B 4XQEA 1L7MA 3GLSA 3Q8WA 1JX6A 3F78A 3Q3IA 1IAQA 4XDHA 3T3NA 1CUHA 3CVOA 1GDDA 2FPOA 4O59O 4DDVA 3O90A 3FCSB 1UXIA 2BDUA 3V8RA 5KHAA 1G8JA 5JI2E 4O6VA 5CLQA 1OUMA 3ZY6A 3OOEA 4DXHA 1NVXQ 2XDQA 4WX2B 4AXBA 2GD1O 4JKIA 3HADA 2ZB7A 4GU5A 4GEGA 2YKGA 4YRRA 5EKDA 3TR0A 3UMFA 5JAUA 4JLWA 4LOKA 4KRFA 1DPFA 3SAJA 4L2IB 1ISRA 3KSUA 3KZ1E 1HLPA 4XJXA 2ZKLA 3FOZA 1Z62A 4QT4A 3RVOA 5EHZA 5CDHA 3C5HA 4C07A 1QZUA 1YMQA 3CRNA 3WNBA 4D57A 3MJTA 4RV5A 5SV2A 2Y4NA 5AXBA 2HBYA 3IH5A 4D9EA 2GEDA 2IEAA 3TBKA 3WRWA 2NO6A 2YRXA 1EXVA 4MRPA 3L0OA 3RAGA 4ECEA 2I4RA 1ZVJA 1I2DA 4Z49A 2A94A 1JE0A 5LCXA 4N6NA 4JX8A 2IOFA 2QR5A 2ZYAA 3AG5A 2J7PA 2JI9A 2Q3HA 1Z4QA 2J48A 4C6HA 1BKSB 1GITA 1SMKA 1BXZA 4EY8A 3O47A 2EL9A 5PGMA 1CEXA 1ML4A 1YRYE 1RP1A 2FF5A 2BMVA 2IOHA 1IJEA 1ECGA 3PC8A 4ZAYA 5FI0B 3RKRA 4XASA 4J91A 2K7FA 5BR7A 4N3AA 3NCHA 1GZ7A 5TDHA 2JHCA 4PQGA 2FCRA 3BXFA 4HVTA 2R9VA 1HE8B 2DPXA 1L8XA 4TKVA 3GJRA 5FH9A 5FX2A 1LY1A 2YS6A 3HDVA 4LNHA 3R7WA 4NCAA 4NE7A 1FNNA 3LO8A 1KBQA 3A3YA 2BKEA 3LSYA 3Q2OA 3ZU3A 1PAUA 2PANA 4AJNA 2W6JD 4TZ0A 1EGQA 3H99A 3HXLA 1GPUA 1W1UA 4CCSA 3CE9A 3BIFA 3DO5A 2EYUA 5BVHB 2H51A 2OR3A 5CG2A 1ULZA 1VE6A 5JPCA 1KE1A 3G89A 3LNCA 4E70A 2KI5A 4ESOA 3NLLA 1FFAA 1OBCA 3G5MA 1EE9A 2PLNA 3H2HA 4FOOA 2BFPA 3WFZA 1XFAA 3B3FA 1UBMS 1GQ2A 3FTPA 2EQAA 3SVTA 2QV7A 1Y4ZA 2XOXA 2FSFA 4DSNA 2P62A 3HYCA 2W42A 1KPHA 2PMWB 1E6CA 1YR2A 1O96A 3RVRA 1NQAO 3I05A 2GCEA 1G64A 2W6ID 1XA0A 1SQ5A 2DFVA 4RK1A 1A8IA 1CEEA 4FHZA 1FNSA 1EJ6A 1Q16A 4NKRA 4NFLA 3GZTB 3HZRA 3V34A 4M1QA 1GUYA 2Q3BA 4WEOA 3UWKA 3ECAA 4KOEC 3B5JA 5KZMB 3WWCA 4PIMA 3EEQA 1SKMA 2IWHA 3VSCA 5I4KA 4R41A 2FPIA 4B6PA 2Y1GA 4J9UE 1FSPA 4TPKA 1R16A 1CJUC 1MJGM 1PLKA 3DFFA 3FLAA 4PO9A 2AN5A 2H1LA 2FZVA 5K3CA 4BZWA 4XPIA 4D02A 4D3YA 1SUCA 3D7SA 4D8VA 1U2SA 4HDSA 1ODLA 1GFSA 1POXA 3ZH2A 1KWGA 4MQUA 3VC1A 4BMYA 4HGPA 4WBNF 3QE3A 4C4ZA 1E60A 4DGSA 3PPXA 1OXMA 2B78A 4OHPA 4YN3A 3CBGA 3TM5A 5DM60 4PWYA 2IIVA 1LNSA 3HUEA 3N8IA 3QVUA 3SXPA 5E6RB 4PGHA 5C80A 2O48X 3QSGA 1R0XA 3T9AA 2I80A 3BBPA 3H3JA 5FWNA 5J2UA 4KUHA 1JLMA 3HTXA 4WUVA 2V5AA 4EKGA 2PXXA 2X3FA 4L7VA 4OATA 4J2TA 5JSKA 5TEVA 4BQQA 1Z7GA 3ITKA 3GFVA 4YAKA 2ZAMA 4MA4A 2H48A 2HJVA 5CYFA 4C7BA 1B26A 1U3WA 3BRWD 2P1RA 2RI0A 3FPSA 3NV7A 4BNIA 1WE2A 4Z4HA 1HEIA 3QUCA 4YRGA 4KQWA 4D5GA 1E8MA 4P86A 5LQCA 4OXQA 2R751 1PJCA 2QX7A 4GH5A 1Q1GA 1TIBA 2AA3A 4TMYA 3EXG1 3G5AA 5AI6A 3KJIA 5CFQA 2C96A 3PQFA 4ZPXA 1V96A 1Q17A 1YK0A 4B31A 4BV9A 3JATA 2PL9A 4JOQA 3F90A 4WZ6A 1TC1A 5JBQA 3EDOA 3SHTA 4MPJA 5I47A 1P6QA 2YJ3A 2BL4A 1DARA 2QE6A 1OWLA 3T3DA 3VNUA 1L4NA 3R9XA 3OPMA 3NXKA 4HFMA 2Q5IA 5EHNA 1L7OA 4PVDA 2J4CA 4DLAA 3RTBA 3PNYA 2RHWA 2ES4A 2IYLD 2P30A 3TZKA 1SBCA 3B38A 1D3AA 1GKLA 1XRQA 2M2IA 4MEBA 1LPOA 1P18A 5FR1A 3ZD8A 2H1WA 3ZHTA 2FFAA 1Z0IA 2YWXA 2B35A 2XOKD 1KMMA 3CKLA 5EEGA 2XTMA 3UFXA 2EX4A 2FFBA 5HJ5A 2B37A 4UMFA 3R7FA 4ARZA 4XIJA 2BEUA 3NR2A 5CXXA 1N8NA 5ECGC 2ZRGA 2ADFA 2SKDA 5C1IA 4MA5A 4TVKA 4PCLA 2FN4A 4KLNA 3UUGA 3GD7A 1U2PA 3CKMA 1EIZA 2QAIA 1VRCA 5D86A 4TMKA 3EW9A 4Q9IA 2ODEA 3U3DA 1YCGA 5JVDF 4EBBA 1ZJ6A 5JROA 1XTJA 3FYHA 3PUXA 2COKA 1XTRA 1LSJA 2DHEA 1QP8A 4JI6B 2LIVA 3VQTA 1CBUA 4B2IA 5BPFA 3PJRA 2ZE7A 5D6OA 1YJ8A 4MR7A 4A8JB 4RHUA 5M04A 3JQFA 2RHGB 5EZSA 3LYHA 1KP9A 1J5PA 1XZLA 1EE1A 2BFEB 3JWPA 1QRAA 2DH5A 1QIFA 1WZNA 3KVRA 3NEPX 3NVMB 5DIFA 2HIHA 4KI7A 5THKA 1I7PA 3RTDA 3EXFB 3T1HB 3UWSA 3D31A 5DSZA 2ILVA 5IMSA 2ACWA 4O2BA 5EYPB 4X65B 3P9RA 5EWMB 3FUWA 3NTQA 2N1BA 4QJ4A 3TEMA 3GRYA 3H11B 1KMHB 4AJIA 2FMHA 3BTOA 3HJAA 4YBZA 5IT4A 1LTHR 5LIPA 4KNYA 1U9CA 2ZBEA 4UBNA 3DPIA 4N48A 2ESRA 5D87A 1XD8A 2X9NA 4QYSA 4XGQA 3TBHA 2D1RA 1RRVA 2CCKA 1YQXA 4QVKA 2H1FA 2R65A 3W9BA 4U6NA 3WYEA 4F9GA 1JG1A 3SU8A 1C7FA 1J2EA 1QGUB 4DPMA 2GBLA 2V4MA 3ZEAA 3DL4A 1BMFA 5DEIA 3UO8B 4G0XA 3ZHQA 2WWIA 5CJ2A 2BBWA 3O4FA 1QKJA 3M1LA 1N2CB 1T6YA 4N40A 4WOJA 3Q1LA 1OXSC 1GFZA 1ZEJA 2ZJ5A 3HUUA 2QD2A 3AR8A 4PRZA 5FWAA 2P0EA 5B6JA 4MJLA 4ATNA 4PZAA 5J40A 4AKIA 2F2TA 1QIEA 3DGEC 4NV0A 4JLPA 4XR9A 3AUYA 1XMJA 2GLTA 2QP9X 2AMLA 3J81k 2IS6A 2ZREA 3HACA 4LMBA 3KEMA 5F7XA 2XNDD 2IYUA 5JNTA 4YTEA 1ETHA 2PT7A 5JD3A 2V1UA 1M33A 3ZE9A 3WSTA 4V0ME 5H02A 3DSRA 3RUIA 2FB9A 2OP0A 4ZICA 4N18A 1OD6A 4RKWA 1YK1A 2V1XA 3DFKA 3RFCA 1LB1B 2NU6A 3CUTA 3RUDA 3OC0A 1H4QA 2ZE6A 2QZSA 2WMNB 1SQ6A 3CCFA 2X8LA 4KACA 4NFSA 4E7OA 2IA5A 1HETA 3FMOB 1J8YF 4KAFA 4TSFA 3W05A 3FPAA 4G67A 1I51A 4Q7MB 2VDNB 3OOYA 3RK4A 2BD0A 1QK5A 5A02A 2G0TA 1YZ3A 2HLPA 4MQEB 4B6SA 5FUMA 1YSCA 4V0OA 4C6TA 1XZNA 4Z3KA 1SO8A 1HYQA 4X7PA 3T35A 5A0TA 1P17A 5B53A 5A9SA 2G80A 3CNNA 1WHSB 4C1NA 3IVGA 2ISSD 3K6JA 3FROA 4R1MA 4I50A 4FP9A 1NJGA 2JL1A 3CW9A 3FLBA 4K46A 1WSAA 4OHMA 5DDIP 4DSZA 1PT5A 3V7YA 621PA 4E03A 1DC5A 5D7BA 3JYQA 2Q07A 3VO2A 3WB1A 4WZBA 4CVNA 4MYDA 1KSHA 5AKIA 1AGYA 1YZVA 5E7JA 3FPEA 5E0KB 2QG9A 5GP1A 4XPIB 2C29D 2X2OA 4MVXA 3WK9A 3KFXA 4HEQA 2XY4A 1TZJA 5KTYA 5L6LB 3EG9B 2EERA 4UAJA 1SNYA 4DDUA 3D5EA 4DQ0A 3GFGA 4X3CA 3IUBA 4M1TA 2AOVA 4TL6A 4ACAA 1IM5A 2FQWA 4CIWA 4N3CA 3B7WA 1UQTA 3HUTA 1RRFA 2ORVA 5BN3B 1HK7A 5GADl 3T1QA 1P7CA 5CH8A 3T6KA 5IM4A 3QUSA 1ZMXA 1U9JA 2VDLB 5BMVF 1CS4C 1KMHA 4PX9A 3VA7A 1PS8A 4JU8A 2YY5A 2XYQA 1S2IA 3O84A 1BH2A 1CY8A 4N49A 2YC4C 3IR7A 1KBOA 2QRZA 3ER8A 4XLLA 1Y9AA 2VRBA 1NOJA 3H42B 1HDXA 1SA0A 4NBLA 5EY5B 4G2TA 4AU1A 3GN1A 3D7LA 5JEDA 3ESAA 2WSSA 1CQIA 1XX6A 1RQ2A 3B36A 5G41A 5U4QA 3FYUA 4C2BA 4R01A 4R9RA 3KQLA 1Q14A 2BEVB 4NEQA 1G8HA 3BMCA 3B1YA 2D7JA 4I46A 4PR3A 4LY3A 2CD9A 4BQEA 2GN0A 1PSDA 2AUMA 1CT9A 4MCJA 1ILWA 4DADA 5KQMA 4LF7B 5KCMA 5EN4A 1O57A 1VGQA 3IXLA 4P08A 4R2IA 1QHHA 2R1VA 2VTEA 3QFFA 4J7AA 3KJHA 1C30A 3ZHCA 4XH9B 2RK3A 2YFKA 3GHHA 3T12A 3LL4A 1HFJA 1XQXA 4OHYA 5K8UA 5THXA 4W1PA 5DWDA 2I55A 3VU8A 4K9LA 1KZGB 4EEXA 2JPDA 1RADA 5MFPA 3BXGA 5HZGA 2WYIA 1DZIA 1QDEA 3LY7A 4FYKA 4E5UA 4PPFA 1R64A 3KR0A 3QUBA 4YRJA 3H13A 1QH9A 5CB6A 3GNLA 4X00A 1YDMA 4IICA 1JG7A 3ASUA 1GWNA 1YZUA 3IEPA 8LDHA 3QF4B 1OYYA 3V3TA 1O5IA 4MKHA 4WKPA 4K03A 3S28A 1X8JA 1SN7A 2OXEA 4MQEA 5F3DA 3DBLA 4N0MA 4PYKA 3OPYI 1CK4A 3CV3A 4YCCA 5BMOA 4U2BA 4TM8A 3GJ5A 1S0UA 4DT1A 2I3AA 5GGYA 4E5DA 3MWDA 3SR3A 5ALDA 3A8TA 4ITUA 4RDXA 4XLZA 4LZOA 5L4NA 5EUCA 1O6FA 3LI2A 2JKVA 1IXKA 1L8LA 2ZK7A 4LVNA 4KLAA 4QBFA 2O19A 3WE7A 1LDBA 1EWVA 1U0EA 1BE8A 2DBQA 4HNUA 1GOTA 1NF9A 1NLMA 3PGXA 2IDJA 2WFMA 4DJDC 2JGEA 3HRKA 4HBGA 2NGRA 5FULA 3RVJA 3WR5A 1U65A 2HMUA 3A06A 3DUFB 2QRPA 3JYLA 1YCHA 1UODA 1N8TA 2YHSA 4NOMA 2ONZA 4AZ0A 1ORVA 2FSSA 2XUDA 2YVQA 3GRUA 2II6A 3DV9A 3OPNA 3D3WA 4S1NA 4PGAA 4C7KA 3A6FA 1J42A 1I4EB 1U7XA 2FEWB 2WUDA 2WUWE 3BMNB 3B9RA 2W6OA 2EFDB 1P8AA 3S2FA 3U3MA 2B20A 1IUOA 1E3SA 5DK4A 2RBGA 4L4YA 3DMYA 4B47A 5JS8A 5F51A 2EARA 3H9QA 3U3ZA 4AO7A 1SBTA 2VPYA 3UIEA 4JOCA 3WIEA 4NRDA 2RGWA 4WOKA 4Z4EA 5F1KA 2HH9A 3G9TA 4PZLA 2BGUA 1EFKA 3HY3A 4MKRA 2LTAA 4UD6A 4Q1BA 1U1GA 3FMIA 2NW6A 5DSTA 3ZK9A 1JAXA 3PC2A 3TSOA 2QXYA 3TXXA 1F8FA 1S02A 1JMKC 1NOIA 4OJTA 2JFPA 4Q3KA 4QU9A 3L0PA 4BX3A 5BR1A 1HOTA 1IMOA 3IURA 3UBTA 1K2VN 2FFQA 5DTEA 1FMTA 2V0GA 3HUDA 3CU5A 4KTTE 2XSZD 5K3FB 1MVLA 1XZFA 2BM8A 5FO1A 4B3HA 3HXOA 3ZBQA 3IDQA 4OYHA 2PS0A 1Z0UA 1KI2A 2Z6QA 2B83A 1P45A 1YVUA 3RG8A 4G5GA 2C9MA 1GNLA 3TDKA 5BY2A 4CKCB 4UJ3A 1AXRA 4AMVA 1X7WB 3UNXA 4GBGA 4S1WA 4YY3B 3LC1O 4FOLA 1WNFA 2MSNA 3M6AA 1J8DA 3LKZA 2YOGA 4EKDA 5IBCA 3ER9A 4MQMA 2CY0A 2VHUA 1Z4IA 3UJNA 2O8DA 1JFLA 1YKGA 1CUEA 4NE2A 4PNPA 3OTIA 3ZVNA 4BUCA 4FUTA 4DGQA 1W36B 1HE1C 2ZR7A 3HYTA 1UJNA 4R84A 4KXFB 3RVNA 2FNAA 2Y67A 3NBUA 2IHVA 5BSHA 3VXKA 2AZ4A 3ZX5A 1C4XA 3C2QA 3HGTA 4BGIA 4EG5A 1VGRA 2PE5A 1M2VB 1O0BA 2OCDA 4DHEA 5LR6A 3W8EA 1Y1PA 5KNBD 2EW1A 1PLLA 3WMWA 4FQ5A 1TM3E 1IXRC 3QLEA 1QNLA 3IUJA 1PGOA 1EVLA 1AUPA 3OZDA 1SEPA 2IZOA 1EX9A 3JQFC 4NI5A 4X7BA 3LUCA 5CDSA 4RY0A 1UZMA 4EELA 1U5BA 1JP7A 1Q3HA 1Y89A 2PX4A 2WMOB 2XB9A 2Z08A 3QLTA 1CNEA 1G3QA 2QAGB 1LC3A 1UAAA 5F9FA 3HM2A 1C9DB 4XARA 4XTCS 5FOXA 4CPDA 5IXJA 5L3SA 4LJYA 1DFHA 4P4GA 5DCYA 3Q5DA 3RIMA 2QDXA 1XXHE 4P82A 2YV2A 1RWWA 3QBTA 1EHCA 3WLEA 1Z34A 1NZDA 3EWAA 2EFGA 4OA8A 4YRFA 2M6RA 1Q1ZA 1B8UA 3AM3A 2FSPA 4CTNA 3GUYA 2MIIA 3HCRA 4Q37A 1W88A 4U2DA 1MO6A 4KSBA 3HSYA 4O0MA 1DELA 1TQ6A 3EXAA 3L6CA 1WOMA 3QI2A 4QHYA 3RT9A 1OFVA 3C87A 5AJWA 2AOUB 5T4FA 4PSVA 3W0LB 3WB0A 4CM6A 5HKOA 4JEUA 1P7VA 2ZWPA 4REMA 1E5DA 5FORA 4BQNA 4EW3A 3F3SA 4L78A 4N12A 3CX7A 4JJZA 3VAZA 3CLTD 3N0VA 3MNFA 2O4UX 4QU8A 1NN0A 3VR3A 5CEFA 4O5AA 2QTHA 3O94A 2EJTA 2XF8A 1BDJA 4EA9A 4KN9S 4MK4A 4CFZA 4MKIA 2QIOA 3B1XA 3QOFA 4AJ9A 4BKRA 1WMDA 4PZCA 2R6DA 3RTEA 3LIIA 2L0XA 3A2LA 4F84A 5J4LA 4M36A 3VSEA 3GRAA 4JLOA 1FLAA 2G71A 1T3TA 2YWRA 1ZO8A 1CQJA 3WX0A 2GX6A 3O83A 2EWWA 1RBZA 1NBAA 4PU0A 2FR1A 1HZZC 3LGAA 4E21A 3K71B 2ZU6A 1FFXA 3CZ4A 1PO7A 3PLRA 4Y18A 4P54A 2EBUA 4KIUA 1Z4KA 4MPTA 2ZOSA 4Y30A 4QQFA 3DR3A 2OB1A 4H77A 3B78A 3ODPA 4MLZA 2V55B 5AUQA 4RX1A 1FXSA 4AF8A 4F8EA 4LRYA 5JNWA 1V1RB 2JB9A 4GE0A 1R88A 3DZGA 3M70A 4X63A 4YI3A 4Y6SA 3W5VA 5LQRA 1WCXA 3CVVA 1T6XA 2WJGA 2Q6LA 1K89A 3F3YA 4KFTA 4OGWA 1EESA 4JMPA 5ICCA 1R4MA 1XCBA 2WG2A 4BPBA 2CV2A 4FEAA 3CTPA 1KFKB 4XIIA 1W19A 2A9OA 4FYJA 4O1IA 2VG8A 1L9XA 5BUZA 1RU3A 3F6RA 3GFTA 4RKYA 2NNLD 5DTJA 1DWPA 4QODA 1JZTA 2EIHA 1C3VA 2EOAA 3AESA 3JQBA 3PE3A 1RW4A 1S2GA 2P7HA 2P9ZA 3KZMA 4KLRA 4KVGA 4Q7KA 5EJGA 5F7JA 3ESRA 3RVLA 4IDBA 1AGXA 4JJGA 4ER5A 3TXYA 5EKUA 1GQYA 2QU7A 4QEDA 3CO5A 3QVMA 4HATA 3N0WA 5DCLA 3W8DA 5JAPA 1SHLA 4FONA 4B8WA 2UUOA 4LDAA 2QF7A 4N7MA 2JHPA 4WCFC 2YCLA 6YASA 4H17A 3PEVA 1XU4A 3C8HA 4LOAA 3PITA 3TJRA 2FOXA 3CVWA 3O26A 2BFCB 4JJEA 1HT0A 4PF1A 1EYZA 1VSBA 1NZJA 2BMFA 3QY0A 1VSQA 4A0QA 1EB8A 2EZ9A 5JMTA 1QIHA 2CZGA 4IFIA 1YASA 2WHPB 1KY5A 5LQNA 1Z17A 3V7WA 3H84A 3ROEA 1G21E 4JXXA 4E5MA 4DCNA 3ILSA 2YWFA 1NI4A 1ZD5A 3UXHA 3DEHA 3FHLA 5LYYA 2GGSA 4POOA 1MZVA 1CDEA 1HMYA 2D1TA 1LK7A 1TTQB 1TCCA 2XKJE 1RNLA 3FMFA 4GI3A 2I87A 1WU7A 2C5AA 4B45A 3L4JA 3F49S 3F3KA 3HO1A 3FHCB 5JTUA 2UYQA 2YCBA 2HT1A 1FP6A 3WSWA 4DMLA 4PX3A 4DJ5X 4K26A 1EHYA 3C3PA 3FSRA 3ICWA 2OM6A 4M76B 1QOZA 4UHKA 1BS2A 1LLCA 3VPDA 4ZGGA 2XE4A 4TM7A 4G86A 3TW8B 4GHWA 4Y2SA 5AJZA 3ZYZA 3ERCA 2QKYA 4J7XA 3BT7A 3Q3VA 1TMKA 4ZAVA 5CP8A 4DMMA 1GR1A 1NNLA 4FSXA 3VHXA 4YCSA 4ZI7F 5EERA 4DRXB 4J2HA 2MSKA 1GZ5A 1QCZA 1IRXA 2Y0BA 2NT4A 1BXRB 1CHDA 3H5AA 1XCMA 3LIPA 2E48A 4HLQB 4QX6A 2DZDA 1CU1A 3BHNA 5BWNA 1FVOA 1GA1A 3BJIC 1JECA 4I5GA 4B46A 3G13A 3J7AC 4OGFA 3SZMA 4GKVA 4BO8A 1ATIA 4G5FA 4RA6B 3U7QA 1B8OA 5EWJA 4JC8A 2Q6OA 2YWHA 4JBXA 4C4AA 4I1YA 3QELA 4JOBA 5IKPA 4W1RA 1S5PA 1YBFA 1Q0QA 2HMYB 4QYXA 3TZ6A 5K4GA 3A27A 1WBJB 2VBGA 2IHTA 1JG3A 2WT9A 4B84A 2CVQA 1TKCA 2XUAA 2CVPA 1JTEA 4AMYA 5TIIA 3G59A 4GLOA 3QI7A 5JBNA 3ZDRA 4QXMA 4TKLA 5BSWA 4QGGA 4IQGA 3JVEA 1ZD4A 4QDTA 2PAFA 1K6JA 1NF2A 4XYBA 2ZDQA 5AW6A 1FMLA 4YJDA 3DEYX 4YJKA 1UBTS 4KK4A 3WGZA 1DRUA 2NLOA 4ITRC 3TD6A 3M7IA 2I2BA 3DE1X 4BJ5A 4MW5A 3VYVA 4C0AC 3Q40A 3RSOA 1IBMB 2HGSA 4I66A 1FE8A 4OCZA 3H4TA 2QVCA 4TZ6A 4CV1A 1QV7A 4LXYA 1DBSA 4IXTA 1FDOA 5DW3A 2J6CA 1EFPA 3EGCA 3N5KA 2ZIZA 3WLLA 2VDVE 2QTFA 2IIPA 4QVGA 2OV4A 3FOEC 1L6IA 2QI9C 2QPOA 4RO0A 1X1QA 2QT0A 5EIBC 5DBOA 4Z8XA 1BFDA 3RG2A 3JXEA 3LCMA 4ZJPA 2QTTA 1XTTA 3KQPA 3N6XA 2PZKA 4GOXA 4IH1A 1A2QA 4I50B 1FCJA 4ZVRA 3V1UA 4YAGA 1GSIA 3E5HA 2WB4A 2WPNA 1Z0FA 3R6LA 3OWHA 4KPEC 1YR1A 2I1WA 4EI9A 3IV9A 4IEEA 4QOJA 3BB1A 1U9YA 3UJPA 2V65A 4RH1A 4UEWA 4XSVA 5IJWA 1LSSA 5BN1A 1VXRA 5AXAA 1ZC4A 2YFYA 3SHVA 4X92A 3PIRA 4M8SA 3BH7A 4Q3LA 4DMFA 2DG2A 4O4IF 1FUIA 1FP4A 1K27A 1XLTA 5D5HA 4CMGA 1G6KA 4HH4A 1HH4A 2ZWMA 4F2WA 1XEAA 3EVFA 2HTFA 4C2AA 1R12A 4CNQA 2C92A 1L1FA 4IGIA 5H3CA 1IDN1 3QYAA 5IJ0B 2NG1A 2VUHB 2ZJAA 2XT6A 4YRPA 3AJ9A 1SBNE 4BMVA 2NZVG 1KYZA 1NMEA 3DD1A 1E8DA 1P0IA 4GXQA 2BLLA 1SUPA 2PSHA 1GCOA 2QTBA 2WU0A 3GQBB 1PT7A 4J4TA 2DVMA 3JZDA 5DCUA 1W5SA 3IB6A 3A11A 3I2JA 3IQXA 5FFMA 5EHXA 5BV8A 4HBZA 3OQVA 4RVOA 1UBSB 3RANA 3V1NA 1C1DA 2PZGA 4LXTA 4F1JA 3X1DA 2SECE 1LWOA 4PYOA 1UP4A 5D3MB 4B6GA 2CSUA 3LJKA 2D59A 3D64A 4UTRA 3UXMA 1GAEO 4ZCIA 3HJTA 2XZTA 3M34A 1P5FA 3BWCA 3VH2A 4GOMD 4O4LF 2FZ5A 4ZQEA 1OHHA 1XROA 1O77A 2AF3C 4BLWA 3TM4A 1MOQA 5C34B 1C7ZA 2CL7X 4GPIB 4CMAA 5I4CA 2HSZA 2QD1A 1SFRA 3PXEA 2D7DA 4XX0A 4N5MA 1OBFO 4AKHA 1P80A 1LW6E 1A7UA 4WCVA 1E1CB 2A14A 5B57C 2ZCVA 3FN4A 1HYBA 2W11A 3KIPA 4UBKA 4KW7A 5DM2A 3ZDYB 1MCZA 3PGA1 5FPPA 4LFAB 1S3FA 1H3EA 3UOGA 3ILVA 5EGSA 4YIHA 1SA0B 1Y5LA 4B76A 3AEZA 4HJXA 2BELA 1KOLA 4NTZA 3ZGNA 1VYUA 3WLNA 4OHCA 4LGVA 3UJCA 1RI5A 3DVAB 1PEAA 1CZKA 2CMFA 3WL8A 1ZM9A 3CR7A 2C82A 3W3AH 4ZFNA 5K99A 2XD9A 3EZ6A 4NQRA 4QBHA 4LHVA 4QJBA 4J0FA 1B74A 2PXAA 4KYIB 5BN3A 2IXTA 1UXOA 4MWBA 1CUWA 3H6GA 2Z57A 3A3KA 1IHDA 4Y9SA 5CT4A 4ZJUA 5FUVA 2XB2A 4DM4A 4JYZA 4I36A 4HQ6A 5LB4A 2WILA 2OB2A 5KKAA 3B53X 2HXSA 4ZAWA 1UPCA 1YNOA 4NG4A 1J33A 2EF0A 4NESA 1LX6A 4Y2UA 9ABPA 3IHLA 4CQMB 1L7QA 1TU4A 2GAFA 3CX6A 4TMFA 2YQZA 2AG6A 5K45A 1ECBA 2PX6A 3JWEA 3PHHA 4FZ3A 4HH1A 2GRUA 3JYPA 4M9ZA 4MITA 3IAAA 1JJIA 3BXOA 3FHTA 5FNVF 3PCTA 4REOA 1J0EA 2Q0SA 3OLQA 4NX2A 3M8KA 2IEDA 1BN6A 1L6RA 1DAPA 2VZ9A 4DCMA 1BGVA 2WJ3A 2VPIA 3LBAA 2ZR8A 4DSTA 4N1AA 1Z75A 4OJMX 3T1NA 4C76A 3STTA 1X3LA 4U2FA 1K6EA 3WICA 5L9AA 5LP1A 1W85A 3HVIA 3B82A 3HHPA 2XRFA 3T4XA 1ONBA 1EP1B 4HEJA 3IOCA 1XRMA 1LRLA 1A7JA 2GSDA 2VT3A 1U0NA 3MLBA 3STHA 5KNDA 1X1AA 3N76A 3F5FA 4Y2XA 1YZYA 4DDWA 5A1JA 2X14A 1U0GA 2QJOA 2AD5A 3DFZA 2FZEA 2R48A 3FG9A 3K4QA 4ZVUA 5IWAB 2B82A 5ALPA 3LOPA 3N6VA 4RZSA 4MUEA 1U0LA 4W9RA 3UB4A 5BV1A 4NQZA 4P32A 1QRUA 1H1LA 2XODA 4EMUA 3U49A 1L7NA 4HWPA 5KTOA 1WVGA 2CLLB 1XU7A 2V0CA 3Q7PA 3LX5A 1DMSA 5DLQC 5G2OA 3QYPA 2D62A 4W8OA 2GESA 2HHAA 3H5NA 4GS5A 3MMPA 5I9BA 3ZIAA 3TLJA 1CCWA 1M2OB 1XXHB 1VIDA 3LUFA 3QLVA 4B4WA 4Q39A 2DFTA 3AR3A 2J46A 3OJ0A 3ZHZA 3Q5EA 3OF3A 4A6EA 1QHFA 4R8LA 4AWXA 2OV1A 2P78A 2HMTA 4X1IA 2ZUUA 2YJZA 1WW3A 2XZOA 3A9RA 3R6DA 2C4KA 1L5ZA 2YRFA 1LPBB 1VI2A 1WVIA 5T7BA 1T9GR 1OIWA 1NW4A 3PJFA 4U2KA 3AY6A 3ZV3A 4ALLA 1VKJA 1IPEA 4B7AA 3U5TA 1QNFA 4R0NA 2AFIA 4JQYA 4WK0B 3FVWA 3PIDA 2HRDA 4QEKA 2GBFA 5AUNB 4LC1A 2D2VA 4YAWA 4V02A 1LS6A 3MJCA 5T4BA 2WTXA 1FX0A 1G5HA 2WBLC 1WZCA 3IHKA 4CIVA 1JIQA 2B9VA 3GLIE 3ZLVA 3H3XA 2EL7A 3S70A 3FRJA 2C0PA 1QRRA 1NDHA 4EMTA 1YZNA 1TAHA 4BNNA 1EXWA 4YHBA 2XIJA 4YRNA 3F7TA 2LKDA 5FNVA 4XGKA 4UTOA 4X20A 3FUXA 3KOWA 3OZFA 3R9KA 4V0SA 1LK0A 1ZESA 5ALFA 4Q3EA 3HBNA 4Y9DA 1RSZA 3VZSA 5HKKD 2EX0A 2L82A 2GRAA 3KYCA 2PKRA 3OIDA 4IZIA 2FWNA 1KKMA 2OCYC 1GVHA 1R8SA 4WHMA 3ORRA 1CJSA 5JCOC 1C80A 1FY2A 3HL0A 3G2MA 3UWPA 4CR7A 4F8JA 2BUAA 1YZKA 5I4BA 1PKEA 2ZYHA 3ENZA 5IKOA 2YXNA 1TYZA 3EFEA 3SMQA 4YT4A 3OFJA 5AW5A 1JTFA 5IANA 1N2SA 3BXZA 5BW8A 3NWBA 3V6LA 3Q0IA 3RQIA 3RVSA 2YS7A 7GPBA 2D5AA 3L0SA 5AKXA 4Y9RA 3VH3A 4G0PA 3CUSA 3CT4A 3BTVA 2VUTA 5T3YA 5BOVA 2MCFA 1O6BA 4KXWA 3T5MA 4F9TA 3JYNA 2CFOA 4OQDA 4X95A 3S5UA 3HU1A 3N8DA 4GE3A 3DXYA 3OFSA 4D0RA 1RQPA 1IXSB 1FFYA 3CG4A 1Q7GA 4L7QA 4BGEA 2DQKA 2DUUA 2J85A 2IV2X 5E95A 4JH0A 5IHPA 1TA4A 2C99A 3MS4A 3C39A 1HT1E 5DNWA 3E15A 2PGDA 1AKTA 3OLCX 2BE9A 5C7IO 4OSEA 3MRXA 1WG8A 4IWNA 5IDQA 2HA2A 1J8FA 3JW8A 1B8NA 4S2EA 1R6UA 3OQPA 2Q3LA 4GF5A 4UBMA 1N7IA 3RS9A 1R9JA 2DLCX 3X43A 5KTSA 3A4YA 5CH5A 1RWPA 4BL5A 1EWKA 3CJQA 1J2RA 5BUQA 4R16A 4JROA 5DX1A 1ZHHA 1YV9A 3QTBA 4F9EA 4B40A 3OT1A 1Q1NA 1U0FA 2AG8A 3TN7A 5FTJA 4DFDA 3IL2A 4ZOCA 3D6MA 1SCAA 1QB7A 2ZB3A 4ZODA 3C6MA 4J29A 1VKHA 4GI1A 5E2AA 5FPQA 1YRHA 4RKQA 5AVTA 3EFHA 4FKBA 2O2IA 3IILA 1B43A 3U3KA 4LK2A 4RPGA 5E6SA 1KJNA 2WKPA 2ZGVA 1SBHA 2I9PA 2NACA 2VI5A 3PQ2A 4D3DA 1AMUA 4DA7A 1AZTA 4GGPA 1Q92A 1J09A 1XTZA 1XEWX 2Q5JA 4O0LA 3KQUA 1IHYA 2QSYA 1ZN7A 4PPYA 2P6RA 4Q3OA 3LAWA 1JJBA 2RE8A 4A8HA 3IBYA 2VYQA 4MUKA 4UCXA 5ALTA 2EIXA 3DDUA 4BMNA 5AO9A 1PHPA 2QRGA 1GGFA 1O6ZA 2I62A 4A91A 5JQGA 2ATVA 4MGEA 2CW5A 5AOAA 1TQ4A 2Y1LA 3B5EA 4DCGA 1U2QA 1VIAA 4KTVE 1G8GA 4KG7A 1RYHA 3V4RA 4AUNA 3AERA 3PVSA 2IDMA 4NK5A 2F64A 4FZRA 4AX4A 2DT8A 5L8VA 2I9KA 4KQHA 5EPUA 1KRWA 3VUEA 2DR2A 1R3DA 2O57A 4ZMRA 1C4WA 3A05A 2C5HA 4M8NE 1Y33E 2XTJA 4X62B 2I1LA 3A9WA 1PVDA 1N1DA 3EIOA 1EGAA 3TQIA 1M1YB 2BM0A 2G67A 2RI6A 3MMSA 3WGJA 4BE7B 4L08A 2JAOA 2QPTA 1XLTC 4AURA 3MMNA 2GAOA 1JJAA 1P5HA 1U3UA 2WNHA 2D2FA 1ESZA 1Z8DA 2C61A 2N0SA 3OJLA 4I2NA 3HCOA 4JSYA 4ZT6A 4MRAA 4YRDA 3TLBA 4CZ2A 5A4DA 4C6RA 1WUYA 2P9EA 5C46F 3NVAA 4UE3S 5L3QB 4XJVA 3OOSA 3PDUA 4ZT4A 2VYVD 1Z4NA 3H1GA 2GLXA 2HCTA 2G9UA 3C3AA 3TQTA 1NUUA 1M2NA 3TJMA 3KQKA 5K3SA 1DEOA 2R8EA 2OCAA 4JNCA 4ZOLF 3G1UA 2C20A 3RYIB 3UJ7A 4YRBA 3V8BA 5ES3A 1DT3A 2OO7A 1XAJA 2WINI 2PD6A 2BZSA 3PNKA 5KYYA 5IVHA 4QM6A 4NCJA 3EZ9A 2I1QA 2O0MA 3SXJA 4CEIB 1KP2A 2UYHA 4G1VA 4MA0A 1IUNA 1VLLA 4EKNB 3PWTA 4LJLA 1RM5A 1ZQ1A 1GRNA 2XCIA 4P2BA 4QBKA 4Y67A 1MQ9A 4M49A 3GBVA 5LZ8A 1S2OA 3HN2A 1QU2A 1A82A 1OMOA 1XPJA 5KI6A 4LGYA 4CKEB 1QGUA 1YI1A 3I6IA 2JLUA 2IGTA 4RHEA 4RLSA 3CF4G 2X4GA 3UC9A 4CTJA 4JLUA 1N5RA 2BRUA 3M6XA 3PHCA 1QXSA 5JH7A 2Y9MB 4U7HA 2H1SA 3IP3A 4IQ0A 4CQMD 1KMQA 1IEVA 1Y9JA 4I1UA 4UMVA 4ZU1X 2NYAA 4A92A 4CTKA 1TYEB 1HMPA 3R7WB 2I4MA 1DC4A 1QP4A 1COZA 3CCCA 3PUHA 3GEEA 1U7DA 3A14A 1JMYA 1WW8A 4I55B 2HIMA 4MMZB 1Y8QB 1M6EX 1QF7A 1CR0A 3GGPA 1TJYA 3RAJA 3DE3X 3SJZA 4PICA 4RIHA 2JARA 3FNIA 1ZCFA 2WOOA 4CKWB 1M9NA 2IZ7A 4CM5A 3I73A 1KF0A 3MBOA 3R6WA 3JR7A 1SUIA 4JJ8A 4N6GA 3TB6A 4U7DA 4HT3B 4PYIA 3VSBA 1GCGA 3CUEF 1WZIA 3D6FA 3L0BA 2HF9A 1JE1A 5IFLA 2WM3A 3ZCTA 1D04A 3Q9UA 4LOJA 1OXTA 2V7TA 1QP7A 2PAAA 4WVFA 1DBVO 2BI4A 3KR9A 3TNYA 4EEZA 3I5YA 2C77A 2HRZA 2CHUA 2PUGA 2P6NA 4YAFA 2B92A 3LM8A 3NDPA 3WK5A 1UP7A 2ZAIA 3MJ4A 2Z8ZA 4FHDA 1JEQA 2JBAB 3CY6A 2XKBA 2V6GA 1SUSA 3WGIA 3ETGA 4P7BA 1RJWA 3QVLA 3NUGA 1EU1A 2VT2A 1KK1A 1PNOA 5E8JA 1SOVA 4A5OA 3QKIA 3T15A 2QLJA 3DF7A 5AD1A 4XPZA 2OYRA 2DPHA 2RKOA 1UQRA 4WNCA 3QU2A 3ENQA 1P5ZB 4OP1A 4QWMA 4DA9A 4I55F 4OHZA 4C7MA 2A92A 2VKQA 3HWX1 2GPYA 2ZRDA 2KS6A 3A4IA 4MWCA 1QUFA 4XVHA 3ZE6A 4UPVA 3WZMA 3C6ZA 4C04A 4I6EA 1GLVA 4E2WA 1N5DA 3EQ9A 1MX1A 5I7HA 1RPJA 3ADKA 3MINA 4I4LA 3W9SA 3O4RA 3MTQA 5IM5A 1SELA 4R8SA 1X7XA 4U8GA 3H05A 1OASA 2B30A 2WJPA 3SQWA 1Y8CA 2LR0A 4YJHB 5JFTA 3V7NA 3O93A 3QXHA 5FLKA 4BVHA 5K8TA 5TMPA 3ETEA 4W82A 1XCPA 4HJRA 2JATA 4KJXA 4ZCSA 2CKMA 1SZDA 2E5FA 2ZRIA 4HAOA 3DS8A 3P9SA 5J2UB 4B5KA 2CBZA 1A9TA 5BYAA 5DTRA 1ZQ9A 4NEHB 5BQ5A 3Q8XB 3QLVC 2X8WA 4QTTB 2YBDA 4FC6A 4E4YA 3F3MA 3IYLW 5EMMA 2GAAA 5CR9A 3TRFA 2RCYA 4RAQA 5JCXA 1ODTC 4EO9A 3HP7A 4H7PA 2FPPA 1E2IA 2OY0A 4FNOA 1PFUA 3W6PA 4P83A 5K3AA 5BNIA 2BI8A 3GCZA 3UHFA 2V6FA 2WMYA 4B33A 3K2QA 5ADWA 3ZWVA 3A6DA 3ETNA 4MRMB 1T3ZA 3RRJA 1R8XA 3H5TA 3EY4A 3PEEA 4OXKA 2W0SA 3C7TA 2HQRA 3ELBA 1Z0DA 2AHRA 2V7WA 2XVAA 3ESXA 3C4QA 3NAMA 3RC9A 3FDFA 3I1JA 3QVXA 3LP8A 4MS3B 5CFRA 1HFKA 4GOND 4YGXB 2XDWA 3AUSA 1KJZA 3BKWA 3CEPB 4ZO7A 821PA 3PC6A 3PQ6A 5K5EA 3K1AB 1HURA 4YS6A 1W36C 3KKLA 1YOBA 2BWJA 1IEQA 3D7RA 4JVOA 4UOQA 4G5OA 5EAIA 3QNUA 3ZI4A 4EHAA 4LK3A 5IJAA 3DCNA 5FHQA 3FNGA 2I34A 4DQKA 1H22A 1Z6PA 3U17A 5KWVA 2O0LA 3M6UA 2WVAA 1EA5A 1ZA1A 1PK9A 1HE2A 3AX6A 4URVR 4P80A 2VXYA 2QZ9A 2R8ZA 1VJCA 1PWYE 7YASA 4OBEA 2OK8A 3I30X 3I8XA 4RE5A 2G7MC 3SIXA 4M98A 3H8SA 4DIEA 3GJQA 4HC4A 4JLBA 5IC6A 3AWIA 3OJXA 3TOSA 2QP3A 3EAGA 2ENWA 4J1SA 4H7DA 4J0IA 4FDVA 1Z0ZA 1OU0A 4D56A 4WY8A 3ZVRA 4QDXA 3HCNA 2XQKA 3T54A 4LJRA 5FPSA 5C18A 2UUAB 3S6JA 4DS3A 5C53B 4KREA 5T6MA 1G3MA 3T8YA 1AKVA 1QH1B 1RHRA 2C5GA 3BEDA 1GZ3A 4P36A 3U4AA 1F0PA 2KMLA 1IPHA 1FYDA 1TVCA 3U44A 1OFGA 1U9IC 2F67A 5J5VA 1IOWA 1CRQA 4HSGA 2SNIE 4EAAA 4F3RA 3DZFA 2Y9PB 3MUNA 3MGAA 4QNMA 1K3FA 1N0HA 1V16A 2JLVA 4HUJA 3PP8A 3NYRA 2VT6A 1PTJA 1KJQA 1S7GA 1CY1A 5CDTA 2NSJA 3SWWA 3JV7A 2PIDA 4UUNA 1N5OX 4KR3A 2WYWA 1Y5RA 3OF5A 3ZDAA 2P2DA 2X9LA 3GL9A 4XVUA 3H11A 1T9KA 2BHNA 5JVDB 2JFOA 5J2TF 5FOQA 1OFTA 2K5UA 5F3RA 2NVBA 2V7VA 3IV7A 3OM9A 1Y1KE 4A1FA 4DNOA 3K1AA 3CCBA 4KQEA 1YMVA 1U7TA 2YXPX 3HR7A 2V54A 4XUEA 2Y0CA 3GZ4A 4UHEA 4HN2A 3AVXA 3P4UA 2SKCA 2Z3ZA 2ZXUA 1VKOA 3A2MA 2WHEA 2EFHB 4MZXA 3TLMA 2QLBA 2ZTUA 3AHCA 2YNMA 4PG6A 4D3SA 4KMOA 4GKBA 3DNFA 5DULA 4GLJA 5F33A 2R00C 3F9CA 3PVZA 4UHBA 5AI9A 5TR9A 3HKCA 2M1ZA 2V98A 4I3FA 2BZGA 1AMOA 1W4RA 3RRZA 1HF3A 3OM8A 5HTKA 4ZI5A 1M1NA 3FPHA 4UM9B 4KQJA 4I9FA 4PQFA 3KE8A 1Z6YA 2X9QA 4NC9A 2O1EA 1NC3A 5ADVA 3REGA 4RVHA 2H1HA 1ISPA 1D0VA 2PSFA 4B3CA 5CLJA 1OVMA 4O2AF 4Q4DA 1VHWA 1TZKA 5EP4A 1TNDA 5AW8A 1J0XO 1L7EA 3WISA 4EHJA 2MYNA 2ZJZA 3FSJX 1CUFA 1FBNA 2GZMA 3DO8A 4R05A 2IYNA 1GTG1 3I9V6 1RQRA 2ZRKA 3GXBA 2HHCA 5BV2P 1KSGA 5TARA 3BPSA 1OY1A 3OFNA 1Y3AA 3ZU4A 3TI9A 3RSQA 1JR3A 2AFVA 4U9HS 1P4JA 3GZNB 3WLSA 2WT4A 1C9MA 1XEFA 1E99A 1R5NA 1XTPA 2AG0A 3GLFE 2WE8A 1J97A 2JC3A 3FPJA 4HQ0A 1GADO 4ND2A 5TGDA 5A4AA 4TXHA 5E6UB 2AVDA 1ZJWA 3FIUA 2CNWA 2QWXA 4E0BA 4V0MA 3GG2A 4R3WA 3COPA 4MOWA 5KQRA 4WCFB 3U56A 4JCCA 1Z6GA 3IAHA 4TS1A 5DYGA 1NVVQ 1IN5A 1RWOA 4BNGA 4ZO4A 3NT2A 2I4NA 5HFNA 2P3QA 3TTTA 2QMZA 4EFNA 5A1TA 3OP1A 1BYUA 3V7FA 2C7GA 2ZI7A 5ULLA 5FWYA 1JFFB 3DL0A 1ODKA 1W2WB 4LWPA 2MYPA 3N2YA 4OO3A 5A6SB 3GJYA 3M1AA 3C6QA 5GPBA 3IT0A 4MVWA 1Z9BA 2NZXA 2P6OA 5MN6A 4HNQA 3EPLA 2SICE 3OLYA 4HQOA 3S4YA 1BFUA 1JFSA 1YC2A 1Q2XA 3G5TA 5JNLA 2LUOA 4BNJA 3DQZA 3A6EA 1QQAA 1PRYA 3HDYA 4KXVA 3UJ3X 5LUAA 5FLXA 1XZDA 3AY0A 3KOOA 5ARCA 1NTRA 2J41A 3HA5A 4OHWA 1AKRA 3BSYA 1JB1A 1K7XB 4BB9A 4KDFA 3KKPA 2C9CA 4RK6A 1TZBA 2HREA 1W0JA 2E7ZA 5I9TA 3ROFA 1UP6A 4LNUB 1QFJA 5H82A 3DXXA 4CG2A 1CYDA 5EHIA 1SD2A 3C48A 3RJZA 1M5RA 2A0YA 3GFRA 4R5MA 4ILKA 5D3ZA 4HDKB 1TT5B 5ILQA 3VZRA 4CCYB 6LDHA 2HV9A 3ZD6A 2QS9A 2OBNA 3E9MA 5JY1A 3CFYA 3NHZA 4G0VA 5LA6B 3WL4A 1OFUA 2RIPA 2ORYA 1Q0LA 1BAPA 1BKDR 3PD7A 3I8OA 3K5HA 1MX9A 4M1YA 4EO4A 3TDMA 1AQIA 4HS9A 4BB5A 3CE6A 3B1ZA 3VR4A 2L42A 2NO1A 2YMPA 3IP1A 3NKLA 3IQFA 3ZWAA 2JFVA 4IX9A 2JIBA 5F12A 5FWXB 3GRFA 2HUPA 2XUGA 1OBHA 1UT6A 2WTNA 1CS0A 1Z5NA 3LA6A 3JQ8A 1QMGA 3M2TA 4O4HF 1ISMA 2PV0A 2AN4A 4ENVA 3HDTA 3ZUGA 2PXHA 3NC0C 3K73O 3UQYS 1RMYA 3OPVA 1JA1A 4WK6A 4B6FA 3Q3CA 6REQB 1Z3CA 1R0RE 1Z26A 1MB9A 3CUKA 4MYCA 1P1JA 221PA 5T4HA 5JUWA 1RC1A 4H7KA 5HF6A 1Y42X 3VM6A 1T2DA 1RQXA 3SYRA 4DOMA 2QENA 5GONB 5KJ6A 2YVLA 3LCRA 1JIUA 5DTMA 1KC3A 4JLVA 2W6CX 4K9DA 3AHGA 3FM9A 4KQ9A 4OKIA 5ECYA 2HJ9A 4XCQA 1WLSA 1GUZA 5AKLA 4WCFA 2PG3A 4YLGA 4OIMA 3T0FA 4DA0A 5FUBA 2Z83A 5C52B 4GI7A 3DDZX 3CR8A 2R5NA 4FB4A 3W3AD 4D8UA 4ZKEA 1G5QA 1L5YA 4GGOA 4B3JA 3CC8A 4FLMA 2QTLA 1ABBA 2P2NA 3LRPA 4DUYB 4IRUB 4JLAA 4DR4B 1EIWA 1OI7A 4RTPA 5ALLA 3AVOA 3FVTA 1HR0B 1CV2A 2NXNA 4O4JB 3RYTC 4OU5A 1X0XA 4JFAA 4M1KA 1CDDA 3IOEA 3O2NA 5AVKA 3HBJA 4YYEA 3RRXA 1E1RA 3IFSA 2R0QC 5CNKA 4OX9Y 1C7EA 1T0JB 5G1OA 4PHHA 5AW2A 2XGMA 1P75A 1X7DA 3H5WA 3RFTA 3TH5A 3ZYCA 3F1KA 1GTL1 2H4ZA 4BRSA 3C85A 4ZKDA 3U09A 2CLCX 4DTCA 5E3JA 1RYDA 1VL0A 2O2YA 3VVCA 4B4KA 2VLBA 1F9EA 1PYDA 2NV2B 2VRCD 5KU1A 3M6FA 2TMDA 4UJ5A 1NA5A 5CA0A 1JEYB 3MT7A 3HXKA 4IFBA 5HK9A 4RHCA 2L17A 3W5SA 3RJTA 2OYSA 2YTZA 1ADJA 1SK9A 4IXMA 5DN9A 3ETJA 5MN5A 4IHQA 2CCJA 4FXPA 1RP7A 3I5UA 3OI7A 3L7MA 5J5AA 3ESBA 1XI2A 3THYB 1A77A 2HK9A 3WGYA 5A0VA 4HQFA 3PFFA 1TCUA 1X19A 4HF7A 3K6SA 5H8WA 2BFFB 4UXIA 4Z0NA 2G7ZA 4HNSA 4EW2A 3GFPA 3BWVA 3FCEA 5DISB 2E4UA 2PO7A 1ND6A 2ZBQA 4GRIA 4HDSB 4F46A 6NULA 5GZ3A 2PUTA 3OE7A 2PBRA 4WZBE 5AW7A 1O7JA 1J56A 1X1EA 1XE3A 1H94A 4EHNA 4K6HA 2BHLA 1DG1G 1S2MA 4NECA 4CKXA 4C4RA 1OWMA 4ERNA 1NKVA 4TWAA 2R6HA 1L5OA 3LUJA 3EZLA 4MR8A 2YX1A 6Q21A 4LF5B 4OMDA 4LMRA 1NVMB 2ZS9A 2INGX 1EM8B 4O2LA 1JG4A 4K86A 2OKCA 2CN1A 1T1GA 1ZWLA 3ORHA 4UNNA 2GRJA 3PNLA 3U62A 121PA 2IPMA 1AA6A 2CHVA 1MR3F 1U7WA 3C97A 1S8OA 3WL7A 2J31A 1H2EA 1NSFA 4QDJA 4KDEA 2O1XA 2G6TA 2QPLA 3OFND 4PINA 3RC8A 3KOZA 3FTNA 1GUAA 1MEOA 2VJNA 2WUGA 4EOGA 3JQ7A 3OPQA 4HX5A 3UT5A 1KI4A 2OESA 3OE7D 3SFTA 4F2PA 1IIBA 3B6ZA 3WADA 3LDFA 4XSGA 3A1EA 3KX2A 3FYUC 4Z3DA 4L02A 1B6GA 5FTWA 4R5HA 3CLUC 4MO2A 1K75A 3TLGB 1VMEA 1O87A 2CNWD 2A33A 2H9AA 3JSXA 1ZNWA 2ZWAA 2XZPA 3VZCA 5IT5A 5AXCA 1TECE 2P3SA 3GK3A 3DYBA 2F3SA 3GLTA 4BU0A 2H54A 3V8PA 1FUEA 1KK2A 2X77A 3FBWA 1NVVR 3MBKA 2VVTA 2QRLA 2REOA 3K8QA 3MTEA 1G3IA 4CCWA 4H1TA 1ISGA 4FVTA 1U6KA 3Q7IA 3QJGA 3DKRA 1PZHA 1YOVA 3QVJA 1TMOA 2DB3A 4Q9NA 4LS3A 2FOIA 4ZO9A 4KR6A 1ML3A 1C1HA 1OT3A 1AHHA 4FFBB 2NO5A 4I99A 1XPOA 1DQYA 1ATZA 2HRCA 2IPAB 3CX8A 3DWIA 4A03A 2C9DA 2BZ0A 3E22A 1RPNA 4X1KA 2AUTA 3VX3A 5KREA 2XX3A 4FYHA 1TAUA 2W2LD 3QRWA 4K6MA 4PFSA 1UOEA 3FPLA 5IDYA 1H0RA 2BVNA 3PB3A 4FR5A 4JB8A 3DEFA 2GNAA 3CLRD 3WB9A 4BVKA 4CKBB 1COWA 2PMKA 3HY6A 2OD9A 5EQFA 3E27A 3WI7A 1DKQA 1NE7A 1P4AA 4I1SA 1E8NA 2XNHA 2JH3A 3RU9A 3P26A 4D9HA 1JLKA 2R00A 2HNAA 3ONFA 2GTPA 2P2SA 3BXHA 3QMWA 5CYGA 1WBBA 1I9CA 1F0NA 4N7RA 1GPWB 1M34E 2I6TA 1FPQA 1IN4A 3C7DB 1M1XB 1V8OA 2A5JA 2ZSAA 3PDJA 3GJZA 1GZVA 1PJZA 3BIXA 4WNYA 2ECFA 2GZ3A 1YCFA 2AC7A 7MDHA 4KAAA 3SEQA 1T26A 4E6EA 3BDIA 4I5IA 1GNPA 2C2WA 5MN4A 1EJ0A 2Q7OE 3X0DA 2HYDA 2VEDA 1EFRA 1GD1O 2MINA 2QEQA 3I42A 5JCZA 5IUNC 2IZ5A 5ESWA 3W5JA 3GJ3A 1AQUA 5MF6A 1OZGA 1EFDN 2PZAA 1RPZA 4ZIRA 5IABA 4K2HA 2IVFA 3KLPX 1E1DA 2BUCA 3JAWA 1NI4B 4O4IB 3ZIUA 2ZJOA 4XQGA 4C0QC 1GQOA 3Q7QA 1RI4A 4RIIA 1QM5A 2PUVA 2BEUB 2VN8A 4FFOA 1VHDA 1R9MA 3BHJA 1YIAA 4R51A 3MWJA 3KJQA 3IAS6 2HLNA 1NXOA 1ULAA 1CUJA 1RPAA 3KEFA 4TL9A 2IY7A 3P4XA 1OYWA 1KJ8A 1YQTA 2AWOA 2ZI6A 3F8SA 3RUFA 3JYHA 4QXQA 2E9SA 3C74A 3CZQA 1PFKA 1VPTA 3RVMA 2HA3A 4YNBA 5TSDA 4JGGA 4EG1A 4RVUA 2A9KA 2VHWA 4GRAA 3GHYA 1ZRSA 4BZXA 1G19A 5ER6A 5I01A 1P4RA 2YVUA 2QMHA 4QFMA 5EUMA 3T06B 4IOJA 5BW4A 4JYBA 4EJ6A 1GAJA 1OGJA 4OFBA 3WZ2A 3KU1A 3W4KA 1F17A 4JUDX 4LF4B 1XGKA 1DQNA 1G2QA 1DJLA 4X1IB 2R85A 4IBOA 2HBRA 3VKGA 1TIKA 2XE7A 2E37A 3IP8A 4IIBA 5ALZA 5TJHA 4OQLA 1WETA 1W85B 2C54A 4QDOA 5CRIA 4UFOA 3OIGA 2CDAA 1UXKA 1MQSA 1NLUA 2D3TA 3D6VA 3S27A 1M83A 1G6HA 1YB1A 2AX4A 2JDIA 5IBPA 3TNDA 1WUIS 2CD7A 2CYAA 4ME6A 2ORWA 2GHRA 4U0JA 3ZWCA 4W6ZA 4D82A 2O8FA 1CUSA 4AICA 3ABIA 3OQOA 1VZ2A 5ITWA 1RD4A 4ZCQA 1XVIA 3R6TA 1BEEA 2R8OA 2H08A 4ZYXA 3G02A 2WHQA 3FF4A 1AKYA 2WWWA 2Y0EA 1E9SA 3RREA 3U7EB 3BGSA 4PS1A 1JHPA 2ZFUA 1VCMA 2ZQYA 4YMSA 5K1ZA 5C7YA 5LJLA 3LF2A 2P68A 1VE1A 4Q5IA 3F97A 3GLKA 4K88A 4KR7A 2EJBA 1IY2A 2NPOA 2WAOA 3CSDA 3DA8A 1E1KA 2SCUA 2XQVA 4U0KA 1VJTA 1OXBB 5D84A 5TQ2B 3VPXA 4LHZA 3SYNA 3WC4A 2V7UA 1E2GA 3VPSA 1JTVA 1SU7A 3LXUX 3AVYA 3MJSA 4V3CA 1ISSA 1E2LA 1RYMA 3D6TB 4D3XA 3UK7A 3UN1A 4WJLA 1NLFA 1K0UA 2WWXA 2DTDA 4I2VA 4L3OA 3NM5A 4JP5A 1K8XB 1WO8A 1TCVA 2LE0A 2LZ0A 4PSDA 2KBEA 1G6OA 2IHYA 4JLJA 1IXYA 2H29A 3R5SA 2O14A 2OWDA 4RNCA 1W4CA 1NULA 5DLEA 4AKSA 1EK6A 5AICA 5KJEA 5B6PA 3A1UA 4AMUA 1W36D 2P9JA 2W8BB 2G08A 4ENWA 2BDEA 3BA6A 4R1PA 5BR4A 1QJ4A 1T35A 1P74A 2XVYA 5BT8A 2JLZA 3C3WA 3CR3C 1PQPA 2WICA 2GOYA 3D6UA 4K3UA 3TFOA 1ZMRA 3TVTA 2H16A 1XAGA 2JGNA 4RD4A 3V4OA 1RAAA 2F7SA 1ZR4A 3DLBA 2FPSA 2QRJA 3OKPA 1Q0SA 1P19A 1KZYC 3SDBA 2H1OA 1JSRA 1TJ4A 4ARVA 3CUVA 2PLAA 3FIJA 2QSUA 2Z95A 5K0FA 1UXJA 3PQ5A 2HDWA 2C3YA 4BHTA 5CBPA 2Y3IA 1L4UA 5HIAA 3LT4A 4NOLA 5E2IA 4AF7A 2P2ZA 3Q7RA 4Z9FA 1ZLYA 1TKAA 4Y1RA 2E82A 1V39A 4IJMA 2H0RA 1JPUA 4LBYA 1OX6A 3FFWA 4TMTA 3TGPA 2YHAA 5HR5A 3I62A 5K0CA 3ZCSA 2V7GA 3RBZA 2NV6A 1IBCA 1DAKA 1E9FA 2HV8A 2I4IA 1NKSA 2OAEA 3B3GA 1OTYA 2JJMA 3FNBA 3QW4B 4RS3A 5D3QA 3IGFA 4QU5A 1GDTA 5F73A 3S2YA 3GZNA 5JXHA 2FPGB 1XJ5A 2MOKA 4IHJB 3UJDA 1FU7A 2TYSB 1IOVA 5EOVA 1XZEA 3NAGA 2QMYA 3AG6A 3S1LA 3INTA 2BI7A 2G6BA 4KUEA 2BF4A 3AEXA 4G1BA 4XDZA 1RWNA 1BHO1 3KQTA 1YUNA 1OI2A 2BMWA 1RTKA 3K5WA 4N03A 5D51S 1V47A 3SOPA 4BV3A 4IH9A 1UMBA 4MDEA 2QHXA 2QMUA 1UAYA 5ITVA 1LLFA 1Z4LA 1BW9B 1OA1A 4LEIA 3U2QA 4HUQA 1G2IA 5DHQA 5ICSA 4PGFA 5GY7A 4HLNA 3CF0A 3G7UA 2BFFA 1VA5A 2PZJA 4KAXA 1KK3A 4BTEA 5DRTA 2H00A 3P2KA 5C81A 4OX9B 3BGOS 2AXEA 2XITA 1DDGA 1I9GA 3HVHA 1E1LA 4DJTA 2DF8A 2GK6A 3CGGA 3PNQA 2DJ5A 5TQJA 1T9ZA 2O8CA 3WIOA 1A7AA 1IE3A 2PWPA 2H57A 1G5IA 3MQ4A 4GR4A 1XF9A 4F7WA 3IX7A 5JH7F 4ESVA 3WYBA 1GNSA 3KR2A 3D1VA 4UCFA 2ZT8A 3CA8A 4YVFA 2OBLA 1PV4A 1TJNA 3TRJA 3FBGA 5J23A 1X3SA 2FVXA 1BWQA 2SKEA 3H8VA 4J0JA 4B32A 4CBVA 5EJFA 1PW5A 1SU6A 1YIDA