5A5OA

Crystal structure of human atad2 bromodomain in complex with 3-methyl- 1,2-dihydroquinolin-2-one
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Fragment-Based Discovery of Low-Micromolar Atad2 Bromodomain Inhibitors.
pubmed doi rcsb
molecule keywords ATPASE FAMILY AAA DOMAIN-CONTAINING PROTEIN 2
molecule tags Hydrolase
source organism Homo sapiens
total genus 54
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a5oA00
4YBSA 5FFYA 4LYWA 5FG5A 4O7EA 4O77A 4N4IA 5DFDA 4CUTA 3IU6A 3U5OA 4LDFA 5DKHA 4YYMA 4KV1A 4QSWA 5D26A 4NQMA 5A85A 5E9LA 2L85A 5E3DA 4UYDA 5CQ4A 5D3PA 5I89A 5CQTA 2I7KA 4Z1SA 4Y03A 3JVLA 4C67A 5A82A 4Z93A 3QZSA 5IG6A 3P5OA 3QZVA 4QYLA 5EWVA 1N72A 4ALHA 5LKUA 4A9LA 5DKCA 4O7BA 4QSPA 4TZ8A 4LYSA 5F5ZA 4QYDA 4OUFA 5A5RA 4E96A 3MB4A 2GRCA 4Z6HA 4BW3A 4CUQA 5A83A 3U5LA 4A9KA 5LKZA 5FG6A 4IR6A 4QZSA 3JVJA 4TS8A 5DW2A 3S91A 4LR6A 5FE9A 5EWDA 4MR4A 5DKDA 2R0YA 5I29A 5TCMA 5I40A 4IOQA 4ALGA 3O36A 4UYGA 4UIUA 5E7DA 5DFCA 5COIA 5EK9A 5A5OA 2D9EA 3U5PA 2OUOA 4CFLA 2L84A 5CGPA 5IBNA 3QZTA 4QEWA 2YELA 4LYIA 4NUDA 4YY6A 5HRXA 5LVQA 4NYVA 3U5JA 3UVXA 4FLPA 5E0RA 5CZGA 4UITA 4QEUA 5ENIA 5EM3A 5A7CA 5DBMA 3O35A 4O76A 4QR3A 5L98A 3HMEA 5F25A 1X0JA 4YY4A 4TYLA 4CLBA 3MB3A 5L96A 4XYAA 4MR6A 4HXPA 4UIXA 5FB0A 4WHUA 5DFBA 5ETBA 5D3NA 4YADA 4NRBA 4QUTA 5ENEA 5IGMA 5KTWA 5FE4A 1ZS5A 4A9NA 5EU1A 4UIYA 1F68A 3NXBA 2OO1A 2DKWA 2RS9B 3AADA 2OSSA 2WP2A 4QC1A 5J0DA 4YAXA 5CQ7A 4UIVA 4QC3A 5EPRA 3GG3A 2E3KA 4QY4A 5D3JA 5KTUA 4NR9A 4IR5A 3P1DA 4CUUA 2R0VA 4A9OA 2I8NA 5ACYA 4A9HA 4QSQA 4MEQA 5F61A 5D0CA 5D25A 5FE5A 5D7XA 4CFKA 4J1PA 4C66A 5E73A 5CY9A 2D82A 5I88A 4O78A 5D3TA 5A5QA 4NYXA 3RCWA 5HLSA 4HXOA 5F63A 5FB1A 5DX4A 5C4QA 4WIVA 2F6NA 4QEVA 5JI8A 3K2JA 5CUGA 5CRMA 4MENA 4NUEA 4WHWA 4LZ2A 4TT4A 4YATA 4N4HA 5FFWA 4NQNA 4YYGA 4ZW1A 4QSVA 5DYAA 5F3AA 4UYEA 4QSRA 4YYIA 5E9KA 2DVSA 3P1EA 4NUCA 4IR3A 5CUAA 4RVRA 3P1CA 4UYFA 5ENFA 5H1VA 5A5NA 4HXLA 5DW1A 4UIZA 3UVDA 2H60A 4QR5A 4HXRA 5II2A 5CP5A 3FKMX 4BJXA 1JSPB 3MUKA 4MR5A 3U5MA 3O37A 5E9VA 5H1TA 5E3GA 4PCEA 4GPJA 5H85A 4KCXA 5DLZA 4PKLA 5FG4A 5AMEA 5CS8A 4LRGA 5D3RA 5DYXA 3LJWA 2RNYA 4LZSA 4NXJA 5F62A 4TT2A 3UVYA 5ENHA 5I7XA 4XY8A 3D7CA 1JM4B 5CQ3A 1E6IA 5FBXA 5CFWA 5LUUA 4TU4A 3LXJA 5LVRA 3MQMA 5G4SA 4YYHA 4CUSA 4O71A 4J0SA 2F6JA 4IORA 4PTBA 5KO4A 4HXSA 4HXMA 3ZYUA 4IOOA 4BW2A 3SVFA 5EV9A 5HRVA 5HRWA 5L8UA 2E7NA 2FSAA 4YBMA 4QSXA 5LKXA 5BT4A 4YBTA 4A9MA 4O74A 2L5EA 5BT5A 3JVKA 4NRAA 5HFRA 5CRZA 5EISA 4AKNA 4QSSA 4Z1QA 4TT6A 4YK0A 5A5SA 3UVWA 2YDWA 2RO1A 4PCIA 4UYFB 5EWCA 4HBXA 5I1QA 3UV4A 3LQIA 4DONA 5DYCA 5I83A 5II1A 5C87A 5CQAA 5EQ1A 4O7AA 5LJ1A 4A9FA 4BW4A 5EVAA 5E9MA 5LJ0A 5LJ2A 4OGJA 4KV4A 5F2PA 3IU5A 3I3JA 4PY6A 5FH7A 4N3WA 4CL9A 5C85A 1EQFA 5LKTA 5HQ7A 1WUGA 4NR8A 2R10A 4NR6A 4CURA 4HBYA 4O72A 5D24A 5FE0A 4QB3A 5E9YA 5DY7A 4Q0OA 4A9JA 3JVMA 2R0SA 4YYJA 5CUBA 2RNXA 4A9EA 5CQ8A 5L97A 3Q2EA 5F36A 5E74A 5FE7A 4NYWA 5CQ6A 4UYHA 5D3HA 2DWWA 4UIWA 4J3IA 5EI4A 5HEMA 3MULA 2YEKA 4O75A 4TZ2A 5IIDA 5C8GA 4NR5A 3AQAA 5FH6A 5EPSA 4OGIA 2YW5A 5A81A 4QBMA 5I7YA 5CUEA 5HELA 4TTEA 5FE8A 3UV5A 4XY9A 5FE6A 3Q2FA 5IGNA 4N4GA 5EICA 3HMFA 5FFVA 3ONIA 4QSTA 4ZQLA 5CU8A 2RNWA 1WUMA 4NRCA 4Q0NA 5CPEA 5I86A 4F3IA 5FE3A 4IR4A 4YH3A 4YC9A 4YABA 4ZC9A 5L8TA 3G0JA 2DVQA 3MXFA 5DLXA 4YH4A 3DAIA 5CUDA 5C89A 5F1HA 5EWWA 5C7NA 5EA1A 4XUBA 5ENGA 5ETDA 2DVRA 2NXBA 5F1LA 2G4AA 5I80A 5EPBA 3UV2A 3SVHA 4QUUA 3HMHA 4PS5A 4YYNA 5H1UA 4Z6IA 5E9IA 5HENA 5KHMA 3LQJA 5D3LA 2N9GA 3UW9A 2WP1A 5HFQA 5CTLA 5AD3A 4O7FA 2DVVA 5FH8A 5A5PA 5FDZA 3G0LA 4TQNA 5DYUA 4CUPA 2KTBB 5FE2A 5KU3A 4YYDA 5HQ6A 3O34A 4BHWA 3LQHA 3S92A 4YYKA 5EGUA 5HCLA 5FE1A 5CQ5A 2MJVB 4O7CA 2LSPB 5BT3A 4MR3A 5AMFA 2E7OA 4HXKA 4HBVA 2YQDA 4LC2A 3DWYA 4LZRA 4NR7A 4BW1A 5F60A 3P1FA 5EP7A 5EWHA 4HXNA 4O70A 5TB6A 2RFJA 5HJCA 3TLPA 5ENJA 2YEMA 3SVGA 5HQ5A 5D3SA 2YYNA 5G4RA 5K29A 5JWMA 2RI7A 5IGKA 4N4FA 4QR4A 4J0RA 4QNSA 4MEOA 5ENCA 3O33A 4MEPA 4HBWA 5AD2A 5L99A 4NR4A 5CUCA 5HM0A 4QSUA 3U5NA 4XUAA 2DATA 3U5KA 5IGLA 4X2IA 4TU6A 5ENBA 4NS5A 5KTXA 4A9IA
chains in the Genus database with same CATH superfamily
4YBSA 5FFYA 4LYWA 5FG5A 4O7EA 4O77A 4N4IA 5DFDA 4CUTA 3IU6A 3U5OA 4LDFA 5DKHA 4YYMA 4KV1A 4QSWA 5D26A 4NQMA 1PUOA 5A85A 5E9LA 2L85A 5E3DA 4UYDA 5CQ4A 5D3PA 5I89A 5CQTA 2I7KA 4Z1SA 4Y03A 3JVLA 4C67A 5A82A 4Z93A 3QZSA 5IG6A 3P5OA 3QZVA 4QYLA 5EWVA 1N72A 4ALHA 5LKUA 4A9LA 5DKCA 4O7BA 4QSPA 4TZ8A 4LYSA 5F5ZA 4QYDA 4OUFA 5A5RA 4E96A 3MB4A 2GRCA 4Z6HA 4BW3A 4CUQA 5A83A 3U5LA 4A9KA 5LKZA 5FG6A 4IR6A 4QZSA 3JVJA 4TS8A 5DW2A 3S91A 4LR6A 5FE9A 5EWDA 4MR4A 5DKDA 2R0YA 5I29A 5TCMA 5I40A 4IOQA 4ALGA 3O36A 4UYGA 4UIUA 5E7DA 3ERRA 5DFCA 5COIA 5EK9A 5A5OA 2D9EA 3U5PA 2OUOA 4CFLA 2L84A 5CGPA 5IBNA 3QZTA 4QEWA 2YELA 4LYIA 4NUDA 4YY6A 5HRXA 5LVQA 4NYVA 3U5JA 3UVXA 4FLPA 5E0RA 5CZGA 4UITA 4QEUA 5ENIA 5EM3A 5A7CA 5DBMA 3O35A 4O76A 4QR3A 5L98A 3HMEA 5F25A 3VKHA 1X0JA 4YY4A 4TYLA 4CLBA 3MB3A 5L96A 4XYAA 4MR6A 4HXPA 4UIXA 5FB0A 4WHUA 5DFBA 5ETBA 5D3NA 4YADA 4NRBA 4QUTA 5ENEA 5IGMA 5KTWA 5FE4A 1ZS5A 4A9NA 5EU1A 4UIYA 1F68A 3NXBA 2OO1A 2DKWA 2RS9B 4AKGA 3AADA 2OSSA 2WP2A 4QC1A 5J0DA 4YAXA 5CQ7A 4UIVA 4QC3A 5EPRA 3GG3A 2E3KA 4QY4A 5D3JA 5KTUA 4NR9A 4IR5A 3P1DA 4CUUA 2R0VA 4A9OA 2I8NA 5ACYA 4A9HA 4QSQA 4MEQA 5F61A 5D0CA 5D25A 5FE5A 5D7XA 4CFKA 4J1PA 4C66A 5E73A 5CY9A 2D82A 5I88A 4O78A 5D3TA 5A5QA 4NYXA 3RCWA 5HLSA 4HXOA 3VKGA 5F63A 1ZKRA 5FB1A 5DX4A 5C4QA 4WIVA 2F6NA 4QEVA 5JI8A 3K2JA 5CUGA 5CRMA 4MENA 4NUEA 4WHWA 3D1DA 4LZ2A 4TT4A 4YATA 4N4HA 5FFWA 4NQNA 4YYGA 4ZW1A 4QSVA 5DYAA 5F3AA 4AKIA 4UYEA 4QSRA 4YYIA 5E9KA 2DVSA 3P1EA 4NUCA 4IR3A 5CUAA 4RVRA 3P1CA 4UYFA 5ENFA 5H1VA 5A5NA 4HXLA 5DW1A 4UIZA 3UVDA 2H60A 4QR5A 4HXRA 5II2A 5CP5A 3FKMX 4BJXA 1JSPB 3MUKA 4MR5A 3U5MA 3O37A 5E9VA 5H1TA 5E3GA 4PCEA 4GPJA 5H85A 4KCXA 5DLZA 4PKLA 5FG4A 5AMEA 5CS8A 4LRGA 5D3RA 5DYXA 3LJWA 2RNYA 4LZSA 4NXJA 5F62A 4TT2A 3UVYA 5ENHA 5I7XA 4XY8A 3D7CA 1JM4B 5CQ3A 1E6IA 5FBXA 5CFWA 5LUUA 4TU4A 3LXJA 5LVRA 3MQMA 5G4SA 4YYHA 4CUSA 4O71A 4J0SA 2F6JA 4IORA 4PTBA 5KO4A 4HXSA 4HXMA 3ZYUA 4IOOA 4BW2A 3SVFA 5EV9A 5HRVA 5HRWA 5L8UA 2E7NA 2FSAA 4YBMA 4QSXA 5LKXA 5BT4A 4YBTA 4A9MA 4O74A 2L5EA 5BT5A 3JVKA 4NRAA 5HFRA 5CRZA 5EISA 4AKNA 4QSSA 4Z1QA 4TT6A 4YK0A 5A5SA 3UVWA 2YDWA 2RO1A 4PCIA 4UYFB 5EWCA 4HBXA 5I1QA 3UV4A 3LQIA 4DONA 5DYCA 5I83A 5II1A 5C87A 5CQAA 5EQ1A 4O7AA 5LJ1A 4A9FA 4BW4A 5EVAA 5E9MA 5LJ0A 5LJ2A 4OGJA 4KV4A 5F2PA 3IU5A 3I3JA 4PY6A 5FH7A 4N3WA 4CL9A 5C85A 1EQFA 5LKTA 5HQ7A 1WUGA 4NR8A 2R10A 4NR6A 4CURA 4HBYA 4O72A 5D24A 5FE0A 4QB3A 5E9YA 5DY7A 4Q0OA 4A9JA 3JVMA 2R0SA 4YYJA 5CUBA 2RNXA 4A9EA 5CQ8A 5L97A 2EJNA 3Q2EA 5F36A 5E74A 5FE7A 4NYWA 5CQ6A 4UYHA 5D3HA 2DWWA 4UIWA 4J3IA 5EI4A 5HEMA 3MULA 2YEKA 4O75A 4TZ2A 5IIDA 5C8GA 4NR5A 3AQAA 5FH6A 5EPSA 4OGIA 2YW5A 5A81A 4QBMA 5I7YA 5CUEA 5HELA 4TTEA 5FE8A 3UV5A 4XY9A 5FE6A 3Q2FA 5IGNA 4N4GA 5EICA 3HMFA 5FFVA 3ONIA 4QSTA 4ZQLA 5CU8A 2RNWA 1WUMA 4NRCA 4Q0NA 5CPEA 5I86A 4F3IA 5FE3A 4IR4A 4YH3A 4YC9A 4YABA 4ZC9A 5L8TA 3G0JA 2DVQA 3MXFA 5DLXA 4YH4A 3DAIA 5CUDA 5C89A 5F1HA 5EWWA 5C7NA 5EA1A 4XUBA 5ENGA 5ETDA 2DVRA 2NXBA 5F1LA 2G4AA 5I80A 5EPBA 3UV2A 3SVHA 4QUUA 3HMHA 4PS5A 4YYNA 5H1UA 4Z6IA 5E9IA 5HENA 5KHMA 3LQJA 5D3LA 2N9GA 3UW9A 2WP1A 5HFQA 5CTLA 5AD3A 4O7FA 2DVVA 5FH8A 5A5PA 5FDZA 3G0LA 4TQNA 5DYUA 4CUPA 2KTBB 5FE2A 5KU3A 4YYDA 5HQ6A 3O34A 4BHWA 3LQHA 3S92A 4YYKA 5EGUA 5HCLA 5FE1A 5CQ5A 2MJVB 4O7CA 2LSPB 5BT3A 4MR3A 5AMFA 2E7OA 3D1BA 4HXKA 4HBVA 2YQDA 4LC2A 3DWYA 4LZRA 4NR7A 4BW1A 5F60A 3P1FA 5EP7A 5EWHA 4HXNA 4O70A 5TB6A 2RFJA 5HJCA 3TLPA 5ENJA 2YEMA 3SVGA 5HQ5A 4AKHA 5D3SA 4AI6A 2YYNA 5G4RA 5K29A 5JWMA 2RI7A 5IGKA 4N4FA 4QR4A 4J0RA 4QNSA 4MEOA 5ENCA 3O33A 4MEPA 4HBWA 5AD2A 5L99A 4NR4A 5CUCA 5HM0A 4QSUA 3U5NA 4XUAA 2DATA 3U5KA 5IGLA 4X2IA 4TU6A 5ENBA 4NS5A 5KTXA 4A9IA
chains in the Genus database with same CATH topology
4YBSA 5FFYA 4LYWA 5FG5A 4O7EA 4O77A 4N4IA 5DFDA 4CUTA 3IU6A 3U5OA 4LDFA 5DKHA 4YYMA 4KV1A 4QSWA 5D26A 4NQMA 5A85A 5E9LA 2L85A 5E3DA 4UYDA 5CQ4A 5D3PA 5I89A 5CQTA 2I7KA 4Z1SA 4Y03A 3JVLA 4C67A 5A82A 4Z93A 3QZSA 5IG6A 3P5OA 3QZVA 4QYLA 5EWVA 1N72A 4ALHA 5LKUA 4A9LA 5DKCA 4O7BA 4QSPA 4TZ8A 4LYSA 5F5ZA 4QYDA 4OUFA 5A5RA 4E96A 3MB4A 2GRCA 4Z6HA 4BW3A 4CUQA 5A83A 3U5LA 4A9KA 5LKZA 5FG6A 4IR6A 4QZSA 3JVJA 4TS8A 5DW2A 3S91A 4LR6A 5FE9A 5EWDA 4MR4A 5DKDA 2R0YA 5I29A 5TCMA 5I40A 4IOQA 4ALGA 3O36A 4UYGA 4UIUA 5E7DA 5DFCA 5COIA 5EK9A 5A5OA 2D9EA 3U5PA 2OUOA 4CFLA 2L84A 5CGPA 5IBNA 3QZTA 4QEWA 2YELA 4LYIA 4NUDA 4YY6A 5HRXA 5LVQA 4NYVA 3U5JA 3UVXA 4FLPA 5E0RA 5CZGA 4UITA 4QEUA 5ENIA 5EM3A 5A7CA 5DBMA 3O35A 4O76A 4QR3A 5L98A 3HMEA 5F25A 1X0JA 4YY4A 4TYLA 4CLBA 3MB3A 5L96A 4XYAA 4MR6A 4HXPA 4UIXA 5FB0A 4WHUA 5DFBA 5ETBA 5D3NA 4YADA 4NRBA 4QUTA 5ENEA 5IGMA 5KTWA 5FE4A 1ZS5A 4A9NA 5EU1A 4UIYA 1F68A 3NXBA 2OO1A 2DKWA 2RS9B 3AADA 2OSSA 2WP2A 4QC1A 5J0DA 4YAXA 5CQ7A 4UIVA 4QC3A 5EPRA 3GG3A 2E3KA 4QY4A 5D3JA 5KTUA 4NR9A 4IR5A 3P1DA 4CUUA 2R0VA 4A9OA 2I8NA 5ACYA 4A9HA 4QSQA 4MEQA 5F61A 5D0CA 5D25A 5FE5A 5D7XA 4CFKA 4J1PA 4C66A 5E73A 5CY9A 2D82A 5I88A 4O78A 5D3TA 5A5QA 4NYXA 3RCWA 5HLSA 4HXOA 5F63A 5FB1A 5DX4A 5C4QA 4WIVA 2F6NA 4QEVA 5JI8A 3K2JA 5CUGA 5CRMA 4MENA 4NUEA 4WHWA 4LZ2A 4TT4A 4YATA 4N4HA 5FFWA 4NQNA 4YYGA 4ZW1A 4QSVA 5DYAA 5F3AA 4UYEA 4QSRA 4YYIA 5E9KA 2DVSA 3P1EA 4NUCA 4IR3A 5CUAA 4RVRA 3P1CA 4UYFA 5ENFA 5H1VA 5A5NA 4HXLA 5DW1A 4UIZA 3UVDA 2H60A 4QR5A 4HXRA 5II2A 5CP5A 3FKMX 4BJXA 1JSPB 3MUKA 4MR5A 3U5MA 3O37A 5E9VA 5H1TA 5E3GA 4PCEA 4GPJA 5H85A 4KCXA 5DLZA 4PKLA 5FG4A 5AMEA 5CS8A 4LRGA 5D3RA 5DYXA 3LJWA 2RNYA 4LZSA 4NXJA 5F62A 4TT2A 3UVYA 5ENHA 5I7XA 4XY8A 3D7CA 1JM4B 5CQ3A 1E6IA 5FBXA 5CFWA 5LUUA 4TU4A 3LXJA 5LVRA 3MQMA 5G4SA 4YYHA 4CUSA 4O71A 4J0SA 2F6JA 4IORA 4PTBA 5KO4A 4HXSA 4HXMA 3ZYUA 4IOOA 4BW2A 3SVFA 5EV9A 5HRVA 5HRWA 5L8UA 2E7NA 2FSAA 4YBMA 4QSXA 5LKXA 5BT4A 4YBTA 4A9MA 4O74A 2L5EA 5BT5A 3JVKA 4NRAA 5HFRA 5CRZA 5EISA 4AKNA 4QSSA 4Z1QA 4TT6A 4YK0A 5A5SA 3UVWA 2YDWA 2RO1A 4PCIA 4UYFB 5EWCA 4HBXA 5I1QA 3UV4A 3LQIA 4DONA 5DYCA 5I83A 5II1A 5C87A 5CQAA 5EQ1A 4O7AA 5LJ1A 4A9FA 4BW4A 5EVAA 5E9MA 5LJ0A 5LJ2A 4OGJA 4KV4A 5F2PA 3IU5A 3I3JA 4PY6A 5FH7A 4N3WA 4CL9A 5C85A 1EQFA 5LKTA 5HQ7A 1WUGA 4NR8A 2R10A 4NR6A 4CURA 4HBYA 4O72A 5D24A 5FE0A 4QB3A 5E9YA 5DY7A 4Q0OA 4A9JA 3JVMA 2R0SA 4YYJA 5CUBA 2RNXA 4A9EA 5CQ8A 5L97A 3Q2EA 5F36A 5E74A 5FE7A 4NYWA 5CQ6A 4UYHA 5D3HA 2DWWA 4UIWA 4J3IA 5EI4A 5HEMA 3MULA 2YEKA 4O75A 4TZ2A 5IIDA 5C8GA 4NR5A 3AQAA 5FH6A 5EPSA 4OGIA 2YW5A 5A81A 4QBMA 5I7YA 5CUEA 5HELA 4TTEA 5FE8A 3UV5A 4XY9A 5FE6A 3Q2FA 5IGNA 4N4GA 5EICA 3HMFA 5FFVA 3ONIA 4QSTA 4ZQLA 5CU8A 2RNWA 1WUMA 4NRCA 4Q0NA 5CPEA 5I86A 4F3IA 5FE3A 4IR4A 4YH3A 4YC9A 4YABA 4ZC9A 5L8TA 3G0JA 2DVQA 3MXFA 5DLXA 4YH4A 3DAIA 5CUDA 5C89A 5F1HA 5EWWA 5C7NA 5EA1A 4XUBA 5ENGA 5ETDA 2DVRA 2NXBA 5F1LA 2G4AA 5I80A 5EPBA 3UV2A 3SVHA 4QUUA 3HMHA 4PS5A 4YYNA 5H1UA 4Z6IA 5E9IA 5HENA 5KHMA 3LQJA 5D3LA 2N9GA 3UW9A 2WP1A 5HFQA 5CTLA 5AD3A 4O7FA 2DVVA 5FH8A 5A5PA 5FDZA 3G0LA 4TQNA 5DYUA 4CUPA 2KTBB 5FE2A 5KU3A 4YYDA 5HQ6A 3O34A 4BHWA 3LQHA 3S92A 4YYKA 5EGUA 5HCLA 5FE1A 5CQ5A 2MJVB 4O7CA 2LSPB 5BT3A 4MR3A 5AMFA 2E7OA 4HXKA 4HBVA 2YQDA 4LC2A 3DWYA 4LZRA 4NR7A 4BW1A 5F60A 3P1FA 5EP7A 5EWHA 4HXNA 4O70A 5TB6A 2RFJA 5HJCA 3TLPA 5ENJA 2YEMA 3SVGA 5HQ5A 5D3SA 2YYNA 5G4RA 5K29A 5JWMA 2RI7A 5IGKA 4N4FA 4QR4A 4J0RA 4QNSA 4MEOA 5ENCA 3O33A 4MEPA 4HBWA 5AD2A 5L99A 4NR4A 5CUCA 5HM0A 4QSUA 3U5NA 4XUAA 2DATA 3U5KA 5IGLA 4X2IA 4TU6A 5ENBA 4NS5A 5KTXA 4A9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YBS A;  5FFY A;  4LYW A;  5FG5 A;  4O7E A;  4O77 A;  4N4I A;  5DFD A;  4CUT A;  3IU6 A;  3U5O A;  4LDF A;  5DKH A;  4YYM A;  4KV1 A;  4QSW A;  5D26 A;  4NQM A;  5A85 A;  5E9L A;  2L85 A;  5E3D A;  4UYD A;  5CQ4 A;  5D3P A;  5I89 A;  5CQT A;  2I7K A;  4Z1S A;  4Y03 A;  3JVL A;  4C67 A;  5A82 A;  4Z93 A;  3QZS A;  5IG6 A;  3P5O A;  3QZV A;  4QYL A;  5EWV A;  1N72 A;  4ALH A;  5LKU A;  4A9L A;  5DKC A;  4O7B A;  4QSP A;  4TZ8 A;  4LYS A;  5F5Z A;  4QYD A;  4OUF A;  5A5R A;  4E96 A;  3MB4 A;  2GRC A;  4Z6H A;  4BW3 A;  4CUQ A;  5A83 A;  3U5L A;  4A9K A;  5LKZ A;  5FG6 A;  4IR6 A;  4QZS A;  3JVJ A;  4TS8 A;  5DW2 A;  3S91 A;  4LR6 A;  5FE9 A;  5EWD A;  4MR4 A;  5DKD A;  2R0Y A;  5I29 A;  5TCM A;  5I40 A;  4IOQ A;  4ALG A;  3O36 A;  4UYG A;  4UIU A;  5E7D A;  5DFC A;  5COI A;  5EK9 A;  5A5O A;  2D9E A;  3U5P A;  2OUO A;  4CFL A;  2L84 A;  5CGP A;  5IBN A;  3QZT A;  4QEW A;  2YEL A;  4LYI A;  4NUD A;  4YY6 A;  5HRX A;  5LVQ A;  4NYV A;  3U5J A;  3UVX A;  4FLP A;  5E0R A;  5CZG A;  4UIT A;  4QEU A;  5ENI A;  5EM3 A;  5A7C A;  5DBM A;  3O35 A;  4O76 A;  4QR3 A;  5L98 A;  3HME A;  5F25 A;  1X0J A;  4YY4 A;  4TYL A;  4CLB A;  3MB3 A;  5L96 A;  4XYA A;  4MR6 A;  4HXP A;  4UIX A;  5FB0 A;  4WHU A;  5DFB A;  5ETB A;  5D3N A;  4YAD A;  4NRB A;  4QUT A;  5ENE A;  5IGM A;  5KTW A;  5FE4 A;  1ZS5 A;  4A9N A;  5EU1 A;  4UIY A;  1F68 A;  3NXB A;  2OO1 A;  2DKW A;  2RS9 B;  3AAD A;  2OSS A;  2WP2 A;  4QC1 A;  5J0D A;  4YAX A;  5CQ7 A;  4UIV A;  4QC3 A;  5EPR A;  3GG3 A;  2E3K A;  4QY4 A;  5D3J A;  5KTU A;  4NR9 A;  4IR5 A;  3P1D A;  4CUU A;  2R0V A;  4A9O A;  2I8N A;  5ACY A;  4A9H A;  4QSQ A;  4MEQ A;  5F61 A;  5D0C A;  5D25 A;  5FE5 A;  5D7X A;  4CFK A;  4J1P A;  4C66 A;  5E73 A;  5CY9 A;  2D82 A;  5I88 A;  4O78 A;  5D3T A;  5A5Q A;  4NYX A;  3RCW A;  5HLS A;  4HXO A;  5F63 A;  5FB1 A;  5DX4 A;  5C4Q A;  4WIV A;  2F6N A;  4QEV A;  5JI8 A;  3K2J A;  5CUG A;  5CRM A;  4MEN A;  4NUE A;  4WHW A;  4LZ2 A;  4TT4 A;  4YAT A;  4N4H A;  5FFW A;  4NQN A;  4YYG A;  4ZW1 A;  4QSV A;  5DYA A;  5F3A A;  4UYE A;  4QSR A;  4YYI A;  5E9K A;  2DVS A;  3P1E A;  4NUC A;  4IR3 A;  5CUA A;  4RVR A;  3P1C A;  4UYF A;  5ENF A;  5H1V A;  5A5N A;  4HXL A;  5DW1 A;  4UIZ A;  3UVD A;  2H60 A;  4QR5 A;  4HXR A;  5II2 A;  5CP5 A;  3FKM X;  4BJX A;  1JSP B;  3MUK A;  4MR5 A;  3U5M A;  3O37 A;  5E9V A;  5H1T A;  5E3G A;  4PCE A;  4GPJ A;  5H85 A;  4KCX A;  5DLZ A;  4PKL A;  5FG4 A;  5AME A;  5CS8 A;  4LRG A;  5D3R A;  5DYX A;  3LJW A;  2RNY A;  4LZS A;  4NXJ A;  5F62 A;  4TT2 A;  3UVY A;  5ENH A;  5I7X A;  4XY8 A;  3D7C A;  1JM4 B;  5CQ3 A;  1E6I A;  5FBX A;  5CFW A;  5LUU A;  4TU4 A;  3LXJ A;  5LVR A;  3MQM A;  5G4S A;  4YYH A;  4CUS A;  4O71 A;  4J0S A;  2F6J A;  4IOR A;  4PTB A;  5KO4 A;  4HXS A;  4HXM A;  3ZYU A;  4IOO A;  4BW2 A;  3SVF A;  5EV9 A;  5HRV A;  5HRW A;  5L8U A;  2E7N A;  2FSA A;  4YBM A;  4QSX A;  5LKX A;  5BT4 A;  4YBT A;  4A9M A;  4O74 A;  2L5E A;  5BT5 A;  3JVK A;  4NRA A;  5HFR A;  5CRZ A;  5EIS A;  4AKN A;  4QSS A;  4Z1Q A;  4TT6 A;  4YK0 A;  5A5S A;  3UVW A;  2YDW A;  2RO1 A;  4PCI A;  4UYF B;  5EWC A;  4HBX A;  5I1Q A;  3UV4 A;  3LQI A;  4DON A;  5DYC A;  5I83 A;  5II1 A;  5C87 A;  5CQA A;  5EQ1 A;  4O7A A;  5LJ1 A;  4A9F A;  4BW4 A;  5EVA A;  5E9M A;  5LJ0 A;  5LJ2 A;  4OGJ A;  4KV4 A;  5F2P A;  3IU5 A;  3I3J A;  4PY6 A;  5FH7 A;  4N3W A;  4CL9 A;  5C85 A;  1EQF A;  5LKT A;  5HQ7 A;  1WUG A;  4NR8 A;  2R10 A;  4NR6 A;  4CUR A;  4HBY A;  4O72 A;  5D24 A;  5FE0 A;  4QB3 A;  5E9Y A;  5DY7 A;  4Q0O A;  4A9J A;  3JVM A;  2R0S A;  4YYJ A;  5CUB A;  2RNX A;  4A9E A;  5CQ8 A;  5L97 A;  3Q2E A;  5F36 A;  5E74 A;  5FE7 A;  4NYW A;  5CQ6 A;  4UYH A;  5D3H A;  2DWW A;  4UIW A;  4J3I A;  5EI4 A;  5HEM A;  3MUL A;  2YEK A;  4O75 A;  4TZ2 A;  5IID A;  5C8G A;  4NR5 A;  3AQA A;  5FH6 A;  5EPS A;  4OGI A;  2YW5 A;  5A81 A;  4QBM A;  5I7Y A;  5CUE A;  5HEL A;  4TTE A;  5FE8 A;  3UV5 A;  4XY9 A;  5FE6 A;  3Q2F A;  5IGN A;  4N4G A;  5EIC A;  3HMF A;  5FFV A;  3ONI A;  4QST A;  4ZQL A;  5CU8 A;  2RNW A;  1WUM A;  4NRC A;  4Q0N A;  5CPE A;  5I86 A;  4F3I A;  5FE3 A;  4IR4 A;  4YH3 A;  4YC9 A;  4YAB A;  4ZC9 A;  5L8T A;  3G0J A;  2DVQ A;  3MXF A;  5DLX A;  4YH4 A;  3DAI A;  5CUD A;  5C89 A;  5F1H A;  5EWW A;  5C7N A;  5EA1 A;  4XUB A;  5ENG A;  5ETD A;  2DVR A;  2NXB A;  5F1L A;  2G4A A;  5I80 A;  5EPB A;  3UV2 A;  3SVH A;  4QUU A;  3HMH A;  4PS5 A;  4YYN A;  5H1U A;  4Z6I A;  5E9I A;  5HEN A;  5KHM A;  3LQJ A;  5D3L A;  2N9G A;  3UW9 A;  2WP1 A;  5HFQ A;  5CTL A;  5AD3 A;  4O7F A;  2DVV A;  5FH8 A;  5A5P A;  5FDZ A;  3G0L A;  4TQN A;  5DYU A;  4CUP A;  2KTB B;  5FE2 A;  5KU3 A;  4YYD A;  5HQ6 A;  3O34 A;  4BHW A;  3LQH A;  3S92 A;  4YYK A;  5EGU A;  5HCL A;  5FE1 A;  5CQ5 A;  2MJV B;  4O7C A;  2LSP B;  5BT3 A;  4MR3 A;  5AMF A;  2E7O A;  4HXK A;  4HBV A;  2YQD A;  4LC2 A;  3DWY A;  4LZR A;  4NR7 A;  4BW1 A;  5F60 A;  3P1F A;  5EP7 A;  5EWH A;  4HXN A;  4O70 A;  5TB6 A;  2RFJ A;  5HJC A;  3TLP A;  5ENJ A;  2YEM A;  3SVG A;  5HQ5 A;  5D3S A;  2YYN A;  5G4R A;  5K29 A;  5JWM A;  2RI7 A;  5IGK A;  4N4F A;  4QR4 A;  4J0R A;  4QNS A;  4MEO A;  5ENC A;  3O33 A;  4MEP A;  4HBW A;  5AD2 A;  5L99 A;  4NR4 A;  5CUC A;  5HM0 A;  4QSU A;  3U5N A;  4XUA A;  2DAT A;  3U5K A;  5IGL A;  4X2I A;  4TU6 A;  5ENB A;  4NS5 A;  5KTX A;  4A9I A; 
#chains in the Genus database with same CATH topology
 4YBS A;  5FFY A;  4LYW A;  5FG5 A;  4O7E A;  4O77 A;  4N4I A;  5DFD A;  4CUT A;  3IU6 A;  3U5O A;  4LDF A;  5DKH A;  4YYM A;  4KV1 A;  4QSW A;  5D26 A;  4NQM A;  1PUO A;  5A85 A;  5E9L A;  2L85 A;  5E3D A;  4UYD A;  5CQ4 A;  5D3P A;  5I89 A;  5CQT A;  2I7K A;  4Z1S A;  4Y03 A;  3JVL A;  4C67 A;  5A82 A;  4Z93 A;  3QZS A;  5IG6 A;  3P5O A;  3QZV A;  4QYL A;  5EWV A;  1N72 A;  4ALH A;  5LKU A;  4A9L A;  5DKC A;  4O7B A;  4QSP A;  4TZ8 A;  4LYS A;  5F5Z A;  4QYD A;  4OUF A;  5A5R A;  4E96 A;  3MB4 A;  2GRC A;  4Z6H A;  4BW3 A;  4CUQ A;  5A83 A;  3U5L A;  4A9K A;  5LKZ A;  5FG6 A;  4IR6 A;  4QZS A;  3JVJ A;  4TS8 A;  5DW2 A;  3S91 A;  4LR6 A;  5FE9 A;  5EWD A;  4MR4 A;  5DKD A;  2R0Y A;  5I29 A;  5TCM A;  5I40 A;  4IOQ A;  4ALG A;  3O36 A;  4UYG A;  4UIU A;  5E7D A;  3ERR A;  5DFC A;  5COI A;  5EK9 A;  5A5O A;  2D9E A;  3U5P A;  2OUO A;  4CFL A;  2L84 A;  5CGP A;  5IBN A;  3QZT A;  4QEW A;  2YEL A;  4LYI A;  4NUD A;  4YY6 A;  5HRX A;  5LVQ A;  4NYV A;  3U5J A;  3UVX A;  4FLP A;  5E0R A;  5CZG A;  4UIT A;  4QEU A;  5ENI A;  5EM3 A;  5A7C A;  5DBM A;  3O35 A;  4O76 A;  4QR3 A;  5L98 A;  3HME A;  5F25 A;  3VKH A;  1X0J A;  4YY4 A;  4TYL A;  4CLB A;  3MB3 A;  5L96 A;  4XYA A;  4MR6 A;  4HXP A;  4UIX A;  5FB0 A;  4WHU A;  5DFB A;  5ETB A;  5D3N A;  4YAD A;  4NRB A;  4QUT A;  5ENE A;  5IGM A;  5KTW A;  5FE4 A;  1ZS5 A;  4A9N A;  5EU1 A;  4UIY A;  1F68 A;  3NXB A;  2OO1 A;  2DKW A;  2RS9 B;  4AKG A;  3AAD A;  2OSS A;  2WP2 A;  4QC1 A;  5J0D A;  4YAX A;  5CQ7 A;  4UIV A;  4QC3 A;  5EPR A;  3GG3 A;  2E3K A;  4QY4 A;  5D3J A;  5KTU A;  4NR9 A;  4IR5 A;  3P1D A;  4CUU A;  2R0V A;  4A9O A;  2I8N A;  5ACY A;  4A9H A;  4QSQ A;  4MEQ A;  5F61 A;  5D0C A;  5D25 A;  5FE5 A;  5D7X A;  4CFK A;  4J1P A;  4C66 A;  5E73 A;  5CY9 A;  2D82 A;  5I88 A;  4O78 A;  5D3T A;  5A5Q A;  4NYX A;  3RCW A;  5HLS A;  4HXO A;  3VKG A;  5F63 A;  1ZKR A;  5FB1 A;  5DX4 A;  5C4Q A;  4WIV A;  2F6N A;  4QEV A;  5JI8 A;  3K2J A;  5CUG A;  5CRM A;  4MEN A;  4NUE A;  4WHW A;  3D1D A;  4LZ2 A;  4TT4 A;  4YAT A;  4N4H A;  5FFW A;  4NQN A;  4YYG A;  4ZW1 A;  4QSV A;  5DYA A;  5F3A A;  4AKI A;  4UYE A;  4QSR A;  4YYI A;  5E9K A;  2DVS A;  3P1E A;  4NUC A;  4IR3 A;  5CUA A;  4RVR A;  3P1C A;  4UYF A;  5ENF A;  5H1V A;  5A5N A;  4HXL A;  5DW1 A;  4UIZ A;  3UVD A;  2H60 A;  4QR5 A;  4HXR A;  5II2 A;  5CP5 A;  3FKM X;  4BJX A;  1JSP B;  3MUK A;  4MR5 A;  3U5M A;  3O37 A;  5E9V A;  5H1T A;  5E3G A;  4PCE A;  4GPJ A;  5H85 A;  4KCX A;  5DLZ A;  4PKL A;  5FG4 A;  5AME A;  5CS8 A;  4LRG A;  5D3R A;  5DYX A;  3LJW A;  2RNY A;  4LZS A;  4NXJ A;  5F62 A;  4TT2 A;  3UVY A;  5ENH A;  5I7X A;  4XY8 A;  3D7C A;  1JM4 B;  5CQ3 A;  1E6I A;  5FBX A;  5CFW A;  5LUU A;  4TU4 A;  3LXJ A;  5LVR A;  3MQM A;  5G4S A;  4YYH A;  4CUS A;  4O71 A;  4J0S A;  2F6J A;  4IOR A;  4PTB A;  5KO4 A;  4HXS A;  4HXM A;  3ZYU A;  4IOO A;  4BW2 A;  3SVF A;  5EV9 A;  5HRV A;  5HRW A;  5L8U A;  2E7N A;  2FSA A;  4YBM A;  4QSX A;  5LKX A;  5BT4 A;  4YBT A;  4A9M A;  4O74 A;  2L5E A;  5BT5 A;  3JVK A;  4NRA A;  5HFR A;  5CRZ A;  5EIS A;  4AKN A;  4QSS A;  4Z1Q A;  4TT6 A;  4YK0 A;  5A5S A;  3UVW A;  2YDW A;  2RO1 A;  4PCI A;  4UYF B;  5EWC A;  4HBX A;  5I1Q A;  3UV4 A;  3LQI A;  4DON A;  5DYC A;  5I83 A;  5II1 A;  5C87 A;  5CQA A;  5EQ1 A;  4O7A A;  5LJ1 A;  4A9F A;  4BW4 A;  5EVA A;  5E9M A;  5LJ0 A;  5LJ2 A;  4OGJ A;  4KV4 A;  5F2P A;  3IU5 A;  3I3J A;  4PY6 A;  5FH7 A;  4N3W A;  4CL9 A;  5C85 A;  1EQF A;  5LKT A;  5HQ7 A;  1WUG A;  4NR8 A;  2R10 A;  4NR6 A;  4CUR A;  4HBY A;  4O72 A;  5D24 A;  5FE0 A;  4QB3 A;  5E9Y A;  5DY7 A;  4Q0O A;  4A9J A;  3JVM A;  2R0S A;  4YYJ A;  5CUB A;  2RNX A;  4A9E A;  5CQ8 A;  5L97 A;  2EJN A;  3Q2E A;  5F36 A;  5E74 A;  5FE7 A;  4NYW A;  5CQ6 A;  4UYH A;  5D3H A;  2DWW A;  4UIW A;  4J3I A;  5EI4 A;  5HEM A;  3MUL A;  2YEK A;  4O75 A;  4TZ2 A;  5IID A;  5C8G A;  4NR5 A;  3AQA A;  5FH6 A;  5EPS A;  4OGI A;  2YW5 A;  5A81 A;  4QBM A;  5I7Y A;  5CUE A;  5HEL A;  4TTE A;  5FE8 A;  3UV5 A;  4XY9 A;  5FE6 A;  3Q2F A;  5IGN A;  4N4G A;  5EIC A;  3HMF A;  5FFV A;  3ONI A;  4QST A;  4ZQL A;  5CU8 A;  2RNW A;  1WUM A;  4NRC A;  4Q0N A;  5CPE A;  5I86 A;  4F3I A;  5FE3 A;  4IR4 A;  4YH3 A;  4YC9 A;  4YAB A;  4ZC9 A;  5L8T A;  3G0J A;  2DVQ A;  3MXF A;  5DLX A;  4YH4 A;  3DAI A;  5CUD A;  5C89 A;  5F1H A;  5EWW A;  5C7N A;  5EA1 A;  4XUB A;  5ENG A;  5ETD A;  2DVR A;  2NXB A;  5F1L A;  2G4A A;  5I80 A;  5EPB A;  3UV2 A;  3SVH A;  4QUU A;  3HMH A;  4PS5 A;  4YYN A;  5H1U A;  4Z6I A;  5E9I A;  5HEN A;  5KHM A;  3LQJ A;  5D3L A;  2N9G A;  3UW9 A;  2WP1 A;  5HFQ A;  5CTL A;  5AD3 A;  4O7F A;  2DVV A;  5FH8 A;  5A5P A;  5FDZ A;  3G0L A;  4TQN A;  5DYU A;  4CUP A;  2KTB B;  5FE2 A;  5KU3 A;  4YYD A;  5HQ6 A;  3O34 A;  4BHW A;  3LQH A;  3S92 A;  4YYK A;  5EGU A;  5HCL A;  5FE1 A;  5CQ5 A;  2MJV B;  4O7C A;  2LSP B;  5BT3 A;  4MR3 A;  5AMF A;  2E7O A;  3D1B A;  4HXK A;  4HBV A;  2YQD A;  4LC2 A;  3DWY A;  4LZR A;  4NR7 A;  4BW1 A;  5F60 A;  3P1F A;  5EP7 A;  5EWH A;  4HXN A;  4O70 A;  5TB6 A;  2RFJ A;  5HJC A;  3TLP A;  5ENJ A;  2YEM A;  3SVG A;  5HQ5 A;  4AKH A;  5D3S A;  4AI6 A;  2YYN A;  5G4R A;  5K29 A;  5JWM A;  2RI7 A;  5IGK A;  4N4F A;  4QR4 A;  4J0R A;  4QNS A;  4MEO A;  5ENC A;  3O33 A;  4MEP A;  4HBW A;  5AD2 A;  5L99 A;  4NR4 A;  5CUC A;  5HM0 A;  4QSU A;  3U5N A;  4XUA A;  2DAT A;  3U5K A;  5IGL A;  4X2I A;  4TU6 A;  5ENB A;  4NS5 A;  5KTX A;  4A9I A; 
#chains in the Genus database with same CATH homology
 4YBS A;  5FFY A;  4LYW A;  5FG5 A;  4O7E A;  4O77 A;  4N4I A;  5DFD A;  4CUT A;  3IU6 A;  3U5O A;  4LDF A;  5DKH A;  4YYM A;  4KV1 A;  4QSW A;  5D26 A;  4NQM A;  5A85 A;  5E9L A;  2L85 A;  5E3D A;  4UYD A;  5CQ4 A;  5D3P A;  5I89 A;  5CQT A;  2I7K A;  4Z1S A;  4Y03 A;  3JVL A;  4C67 A;  5A82 A;  4Z93 A;  3QZS A;  5IG6 A;  3P5O A;  3QZV A;  4QYL A;  5EWV A;  1N72 A;  4ALH A;  5LKU A;  4A9L A;  5DKC A;  4O7B A;  4QSP A;  4TZ8 A;  4LYS A;  5F5Z A;  4QYD A;  4OUF A;  5A5R A;  4E96 A;  3MB4 A;  2GRC A;  4Z6H A;  4BW3 A;  4CUQ A;  5A83 A;  3U5L A;  4A9K A;  5LKZ A;  5FG6 A;  4IR6 A;  4QZS A;  3JVJ A;  4TS8 A;  5DW2 A;  3S91 A;  4LR6 A;  5FE9 A;  5EWD A;  4MR4 A;  5DKD A;  2R0Y A;  5I29 A;  5TCM A;  5I40 A;  4IOQ A;  4ALG A;  3O36 A;  4UYG A;  4UIU A;  5E7D A;  5DFC A;  5COI A;  5EK9 A;  5A5O A;  2D9E A;  3U5P A;  2OUO A;  4CFL A;  2L84 A;  5CGP A;  5IBN A;  3QZT A;  4QEW A;  2YEL A;  4LYI A;  4NUD A;  4YY6 A;  5HRX A;  5LVQ A;  4NYV A;  3U5J A;  3UVX A;  4FLP A;  5E0R A;  5CZG A;  4UIT A;  4QEU A;  5ENI A;  5EM3 A;  5A7C A;  5DBM A;  3O35 A;  4O76 A;  4QR3 A;  5L98 A;  3HME A;  5F25 A;  1X0J A;  4YY4 A;  4TYL A;  4CLB A;  3MB3 A;  5L96 A;  4XYA A;  4MR6 A;  4HXP A;  4UIX A;  5FB0 A;  4WHU A;  5DFB A;  5ETB A;  5D3N A;  4YAD A;  4NRB A;  4QUT A;  5ENE A;  5IGM A;  5KTW A;  5FE4 A;  1ZS5 A;  4A9N A;  5EU1 A;  4UIY A;  1F68 A;  3NXB A;  2OO1 A;  2DKW A;  2RS9 B;  3AAD A;  2OSS A;  2WP2 A;  4QC1 A;  5J0D A;  4YAX A;  5CQ7 A;  4UIV A;  4QC3 A;  5EPR A;  3GG3 A;  2E3K A;  4QY4 A;  5D3J A;  5KTU A;  4NR9 A;  4IR5 A;  3P1D A;  4CUU A;  2R0V A;  4A9O A;  2I8N A;  5ACY A;  4A9H A;  4QSQ A;  4MEQ A;  5F61 A;  5D0C A;  5D25 A;  5FE5 A;  5D7X A;  4CFK A;  4J1P A;  4C66 A;  5E73 A;  5CY9 A;  2D82 A;  5I88 A;  4O78 A;  5D3T A;  5A5Q A;  4NYX A;  3RCW A;  5HLS A;  4HXO A;  5F63 A;  5FB1 A;  5DX4 A;  5C4Q A;  4WIV A;  2F6N A;  4QEV A;  5JI8 A;  3K2J A;  5CUG A;  5CRM A;  4MEN A;  4NUE A;  4WHW A;  4LZ2 A;  4TT4 A;  4YAT A;  4N4H A;  5FFW A;  4NQN A;  4YYG A;  4ZW1 A;  4QSV A;  5DYA A;  5F3A A;  4UYE A;  4QSR A;  4YYI A;  5E9K A;  2DVS A;  3P1E A;  4NUC A;  4IR3 A;  5CUA A;  4RVR A;  3P1C A;  4UYF A;  5ENF A;  5H1V A;  5A5N A;  4HXL A;  5DW1 A;  4UIZ A;  3UVD A;  2H60 A;  4QR5 A;  4HXR A;  5II2 A;  5CP5 A;  3FKM X;  4BJX A;  1JSP B;  3MUK A;  4MR5 A;  3U5M A;  3O37 A;  5E9V A;  5H1T A;  5E3G A;  4PCE A;  4GPJ A;  5H85 A;  4KCX A;  5DLZ A;  4PKL A;  5FG4 A;  5AME A;  5CS8 A;  4LRG A;  5D3R A;  5DYX A;  3LJW A;  2RNY A;  4LZS A;  4NXJ A;  5F62 A;  4TT2 A;  3UVY A;  5ENH A;  5I7X A;  4XY8 A;  3D7C A;  1JM4 B;  5CQ3 A;  1E6I A;  5FBX A;  5CFW A;  5LUU A;  4TU4 A;  3LXJ A;  5LVR A;  3MQM A;  5G4S A;  4YYH A;  4CUS A;  4O71 A;  4J0S A;  2F6J A;  4IOR A;  4PTB A;  5KO4 A;  4HXS A;  4HXM A;  3ZYU A;  4IOO A;  4BW2 A;  3SVF A;  5EV9 A;  5HRV A;  5HRW A;  5L8U A;  2E7N A;  2FSA A;  4YBM A;  4QSX A;  5LKX A;  5BT4 A;  4YBT A;  4A9M A;  4O74 A;  2L5E A;  5BT5 A;  3JVK A;  4NRA A;  5HFR A;  5CRZ A;  5EIS A;  4AKN A;  4QSS A;  4Z1Q A;  4TT6 A;  4YK0 A;  5A5S A;  3UVW A;  2YDW A;  2RO1 A;  4PCI A;  4UYF B;  5EWC A;  4HBX A;  5I1Q A;  3UV4 A;  3LQI A;  4DON A;  5DYC A;  5I83 A;  5II1 A;  5C87 A;  5CQA A;  5EQ1 A;  4O7A A;  5LJ1 A;  4A9F A;  4BW4 A;  5EVA A;  5E9M A;  5LJ0 A;  5LJ2 A;  4OGJ A;  4KV4 A;  5F2P A;  3IU5 A;  3I3J A;  4PY6 A;  5FH7 A;  4N3W A;  4CL9 A;  5C85 A;  1EQF A;  5LKT A;  5HQ7 A;  1WUG A;  4NR8 A;  2R10 A;  4NR6 A;  4CUR A;  4HBY A;  4O72 A;  5D24 A;  5FE0 A;  4QB3 A;  5E9Y A;  5DY7 A;  4Q0O A;  4A9J A;  3JVM A;  2R0S A;  4YYJ A;  5CUB A;  2RNX A;  4A9E A;  5CQ8 A;  5L97 A;  3Q2E A;  5F36 A;  5E74 A;  5FE7 A;  4NYW A;  5CQ6 A;  4UYH A;  5D3H A;  2DWW A;  4UIW A;  4J3I A;  5EI4 A;  5HEM A;  3MUL A;  2YEK A;  4O75 A;  4TZ2 A;  5IID A;  5C8G A;  4NR5 A;  3AQA A;  5FH6 A;  5EPS A;  4OGI A;  2YW5 A;  5A81 A;  4QBM A;  5I7Y A;  5CUE A;  5HEL A;  4TTE A;  5FE8 A;  3UV5 A;  4XY9 A;  5FE6 A;  3Q2F A;  5IGN A;  4N4G A;  5EIC A;  3HMF A;  5FFV A;  3ONI A;  4QST A;  4ZQL A;  5CU8 A;  2RNW A;  1WUM A;  4NRC A;  4Q0N A;  5CPE A;  5I86 A;  4F3I A;  5FE3 A;  4IR4 A;  4YH3 A;  4YC9 A;  4YAB A;  4ZC9 A;  5L8T A;  3G0J A;  2DVQ A;  3MXF A;  5DLX A;  4YH4 A;  3DAI A;  5CUD A;  5C89 A;  5F1H A;  5EWW A;  5C7N A;  5EA1 A;  4XUB A;  5ENG A;  5ETD A;  2DVR A;  2NXB A;  5F1L A;  2G4A A;  5I80 A;  5EPB A;  3UV2 A;  3SVH A;  4QUU A;  3HMH A;  4PS5 A;  4YYN A;  5H1U A;  4Z6I A;  5E9I A;  5HEN A;  5KHM A;  3LQJ A;  5D3L A;  2N9G A;  3UW9 A;  2WP1 A;  5HFQ A;  5CTL A;  5AD3 A;  4O7F A;  2DVV A;  5FH8 A;  5A5P A;  5FDZ A;  3G0L A;  4TQN A;  5DYU A;  4CUP A;  2KTB B;  5FE2 A;  5KU3 A;  4YYD A;  5HQ6 A;  3O34 A;  4BHW A;  3LQH A;  3S92 A;  4YYK A;  5EGU A;  5HCL A;  5FE1 A;  5CQ5 A;  2MJV B;  4O7C A;  2LSP B;  5BT3 A;  4MR3 A;  5AMF A;  2E7O A;  4HXK A;  4HBV A;  2YQD A;  4LC2 A;  3DWY A;  4LZR A;  4NR7 A;  4BW1 A;  5F60 A;  3P1F A;  5EP7 A;  5EWH A;  4HXN A;  4O70 A;  5TB6 A;  2RFJ A;  5HJC A;  3TLP A;  5ENJ A;  2YEM A;  3SVG A;  5HQ5 A;  5D3S A;  2YYN A;  5G4R A;  5K29 A;  5JWM A;  2RI7 A;  5IGK A;  4N4F A;  4QR4 A;  4J0R A;  4QNS A;  4MEO A;  5ENC A;  3O33 A;  4MEP A;  4HBW A;  5AD2 A;  5L99 A;  4NR4 A;  5CUC A;  5HM0 A;  4QSU A;  3U5N A;  4XUA A;  2DAT A;  3U5K A;  5IGL A;  4X2I A;  4TU6 A;  5ENB A;  4NS5 A;  5KTX A;  4A9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...