5A5PA

Crystal structure of human atad2 bromodomain in complex with 8-2-(dimethylamino)ethylamino-3-methyl-1,2-dihydroquinolin-2-one
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Fragment-Based Discovery of Low-Micromolar Atad2 Bromodomain Inhibitors.
pubmed doi rcsb
molecule keywords ATPASE FAMILY AAA DOMAIN-CONTAINING PROTEIN 2
molecule tags Hydrolase
source organism Homo sapiens
total genus 52
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a5pA00
2RNWA 5EQ1A 5EI4A 4GPJA 5I40A 5F1LA 5I80A 3QZVA 5DW1A 5EPRA 4TS8A 5HENA 5CUGA 2YELA 3U5MA 4NYXA 4QEUA 4QSSA 5ACYA 4J3IA 5IGKA 5CQ6A 5DKDA 4QZSA 5HRVA 2OSSA 3NXBA 2YQDA 2F6NA 5D25A 5D3RA 3MULA 4PTBA 3SVHA 3DWYA 4MR6A 5CUDA 3GG3A 4N4GA 2RNXA 5EWHA 5E9MA 5D3PA 4LZRA 5HQ5A 5FH7A 3DAIA 4Z1SA 4YBSA 3ONIA 3U5KA 2L84A 4XY9A 5CUEA 4NUDA 4TU6A 4CFKA 4A9KA 5F3AA 2NXBA 5FG6A 2RNYA 5CQ3A 3UVYA 2R0SA 5ENGA 4TT6A 4NQNA 2I7KA 2D9EA 4YH4A 3IU5A 4F3IA 4QR4A 4QEVA 5A5SA 4CURA 5FE6A 5EV9A 4YYDA 5AMEA 3RCWA 4NRCA 4BHWA 3SVGA 4HXRA 4NXJA 4O72A 3JVKA 5ETDA 3S91A 4N4HA 5BT3A 5L98A 5E7DA 5J0DA 4A9HA 3O33A 2L85A 5CQTA 5LUUA 5EWCA 3U5NA 5D3SA 4LZSA 4LYIA 5E9KA 5F61A 3UV2A 4A9EA 5AD3A 4QC1A 4QSTA 3U5LA 4QYDA 5FBXA 4A9FA 3O34A 5EVAA 5FFVA 2YEKA 5KTUA 4QSUA 5LKTA 3UVDA 2N9GA 4C66A 3G0JA 5EPBA 4OGIA 3UV4A 5CP5A 4QUTA 5ENBA 5IGMA 5C87A 4IOOA 5A5QA 4J0RA 5KTWA 4CUPA 4LC2A 4BW1A 4QY4A 2E7NA 5CTLA 4NYWA 4PKLA 4BW4A 4QSVA 4UIVA 4YC9A 5JI8A 5I1QA 5ENIA 5EK9A 4HXOA 4A9NA 5I89A 5EWDA 5I7XA 4O78A 5DY7A 4QSQA 2R0YA 5FH8A 5CU8A 4LYSA 5E9LA 4HXKA 5TB6A 4NR6A 4QSPA 4IORA 4NR5A 5ENCA 3U5JA 5EM3A 4O74A 3TLPA 5F36A 2OUOA 4N4IA 3U5PA 4IOQA 3Q2EA 4MR3A 5EPSA 5BT5A 4HXNA 2RO1A 4IR5A 4NS5A 4YABA 5FE4A 4Z93A 5JWMA 5CRMA 4PCEA 5F1HA 2R10A 5CS8A 3O37A 4O7BA 4ALGA 4NYVA 5G4RA 3P1CA 5FE5A 3K2JA 4YYKA 4O70A 4KV1A 5FFYA 5DYXA 5LVRA 5A5OA 4KV4A 5E74A 4LZ2A 5D3NA 5EICA 4AKNA 4QUUA 4DONA 5FE9A 5L99A 3MB4A 5C7NA 5EA1A 5IBNA 4HXMA 4QYLA 4J0SA 4HBXA 5E3DA 4YYJA 2YW5A 5D7XA 5A81A 5F63A 3P1FA 5A5NA 4NR9A 4UYFB 3UV5A 2OO1A 5L97A 3P1EA 4J1PA 4BJXA 5C8GA 3O36A 4MEOA 5AD2A 3HMHA 5DYAA 4TZ8A 4A9IA 5HFRA 4Q0NA 4QSRA 3IU6A 4XUAA 5HFQA 4HBVA 5CUCA 5II2A 5I7YA 3LQHA 5DW2A 3JVMA 4QR5A 4QC3A 5BT4A 1JM4B 5FB1A 3JVLA 5FE8A 4O76A 4N3WA 5F62A 5D24A 4QSXA 2F6JA 4CUSA 5C89A 5EGUA 5FE0A 2G4AA 4O77A 5DFDA 3P1DA 2KTBB 5CUBA 4X2IA 4UIYA 4UIWA 2L5EA 5D26A 2E3KA 5LVQA 5DX4A 5A85A 4CFLA 4O7EA 5K29A 4QSWA 4TTEA 4YYIA 5FG4A 5H1UA 3D7CA 4NR4A 5DLZA 3MQMA 4CLBA 4HXLA 4UYFA 5HCLA 5DYUA 5HRXA 5CRZA 1N72A 3AADA 2DVRA 3QZSA 4MENA 5HELA 5II1A 5A7CA 4LR6A 4UYEA 4IR3A 4A9OA 2DATA 3LJWA 3LXJA 4TZ2A 5IGNA 3G0LA 5FDZA 5CGPA 5F5ZA 5CZGA 4QEWA 5H85A 4LDFA 5ENEA 5FG5A 3LQJA 4CUUA 4IR6A 3LQIA 5C4QA 4QB3A 4QNSA 5A5PA 4LYWA 4A9MA 4CUQA 5FH6A 5COIA 5E3GA 5FFWA 2DKWA 5D3HA 3Q2FA 4A9JA 5TCMA 4TQNA 5E9IA 4PS5A 5H1TA 4IR4A 5CQAA 5CQ8A 4YBTA 5EU1A 5LKXA 2D82A 5CY9A 4UIZA 1X0JA 4O7CA 5DYCA 4Z6IA 5DFBA 5L96A 5A5RA 2R0VA 5HLSA 4ZQLA 5D0CA 2E7OA 5A83A 4KCXA 3QZTA 4WHUA 4HXSA 4NRAA 4MR4A 5I83A 2I8NA 3MXFA 4C67A 5IIDA 2DVVA 5G4SA 4YBMA 4CUTA 2DVQA 4Z1QA 5DLXA 5ENFA 5HRWA 4NUCA 4UYGA 5I86A 3UW9A 4NQMA 5EISA 2DVSA 4WIVA 4UITA 4YADA 5L8TA 5H1VA 4A9LA 4FLPA 1EQFA 2LSPB 2H60A 5FE1A 5ETBA 5KO4A 4TYLA 3HMFA 2DWWA 5ENJA 3AQAA 5HJCA 4UIXA 4WHWA 4O71A 4N4FA 5D3JA 5CQ5A 4UYHA 5EWWA 5FE3A 4YAXA 5DKHA 4MEQA 5E9VA 5HQ6A 4HBWA 4Q0OA 5L8UA 5I88A 5HQ7A 5D3LA 5CPEA 5D3TA 1E6IA 5F60A 2WP2A 3JVJA 5HM0A 4XY8A 4Y03A 4NRBA 4O7FA 4E96A 3MB3A 4YYMA 5LJ2A 4TT2A 4O75A 4PCIA 4YYHA 4RVRA 4O7AA 4OGJA 5HEMA 4NR7A 4XUBA 2YDWA 2MJVB 4YYNA 2RI7A 4ZW1A 5CQ7A 4Z6HA 5C85A 5ENHA 4MEPA 3S92A 5LKZA 2RS9B 4MR5A 4PY6A 5CUAA 3UVXA 1WUGA 5IGLA 5E0RA 3SVFA 2FSAA 2YYNA 5LJ1A 2GRCA 4BW2A 4TU4A 4NUEA 4YH3A 3HMEA 5CFWA 5DBMA 5KTXA 3P5OA 5FE7A 4HXPA 5E9YA 1JSPB 5DKCA 4ALHA 4XYAA 4TT4A 5FB0A 4QBMA 4YY6A 5F2PA 3U5OA 3FKMX 4YY4A 5A82A 3ZYUA 4YYGA 1WUMA 4CL9A 5KU3A 2RFJA 4OUFA 4YATA 5F25A 4LRGA 1ZS5A 4BW3A 4UIUA 5I29A 5CQ4A 5FE2A 5IG6A 3O35A 4NR8A 5LKUA 4YK0A 5LJ0A 5DFCA 3MUKA 4QR3A 4UYDA 5E73A 1F68A 2WP1A 5EP7A 4HBYA 3I3JA 5EWVA 4ZC9A 2YEMA 5KHMA 3UVWA 5AMFA
chains in the Genus database with same CATH superfamily
2RNWA 5EQ1A 5EI4A 4GPJA 5I40A 1PUOA 5F1LA 5I80A 3QZVA 5DW1A 5EPRA 4TS8A 5HENA 5CUGA 2YELA 3U5MA 4NYXA 4QEUA 4QSSA 5ACYA 4J3IA 4AKHA 5IGKA 5CQ6A 5DKDA 4QZSA 5HRVA 3VKGA 2OSSA 3NXBA 2YQDA 2F6NA 5D25A 5D3RA 3MULA 4PTBA 3SVHA 3DWYA 4MR6A 5CUDA 3GG3A 4N4GA 2RNXA 5EWHA 3D1BA 5E9MA 5D3PA 4LZRA 5HQ5A 2EJNA 5FH7A 3DAIA 3ERRA 4Z1SA 4YBSA 3ONIA 3U5KA 2L84A 4XY9A 5CUEA 4NUDA 4TU6A 4CFKA 4A9KA 5F3AA 2NXBA 5FG6A 2RNYA 5CQ3A 3UVYA 2R0SA 5ENGA 4TT6A 4NQNA 2I7KA 2D9EA 4YH4A 3IU5A 4F3IA 4QR4A 4QEVA 5A5SA 4AKGA 4CURA 5FE6A 5EV9A 4YYDA 5AMEA 3RCWA 4NRCA 4BHWA 3SVGA 4HXRA 4NXJA 4O72A 3JVKA 5ETDA 3S91A 4N4HA 5BT3A 5L98A 5E7DA 5J0DA 4A9HA 3O33A 2L85A 5CQTA 5LUUA 5EWCA 3U5NA 5D3SA 4LZSA 4LYIA 5E9KA 5F61A 3UV2A 4A9EA 5AD3A 4QC1A 4QSTA 3U5LA 4QYDA 5FBXA 4A9FA 3O34A 5EVAA 5FFVA 2YEKA 5KTUA 4QSUA 5LKTA 3UVDA 2N9GA 4C66A 3G0JA 5EPBA 4OGIA 4AKIA 3UV4A 5CP5A 4QUTA 5ENBA 5IGMA 5C87A 4IOOA 5A5QA 4J0RA 5KTWA 4CUPA 4LC2A 4BW1A 4QY4A 2E7NA 5CTLA 4NYWA 4PKLA 4BW4A 4QSVA 4UIVA 4YC9A 5JI8A 5I1QA 5ENIA 5EK9A 4HXOA 4A9NA 5I89A 5EWDA 5I7XA 4O78A 5DY7A 4QSQA 2R0YA 5FH8A 5CU8A 4LYSA 5E9LA 4HXKA 5TB6A 4NR6A 4QSPA 4IORA 4NR5A 5ENCA 3D1DA 5EM3A 4O74A 3U5JA 3TLPA 5F36A 2OUOA 4N4IA 3U5PA 4IOQA 3Q2EA 4MR3A 5EPSA 5BT5A 4HXNA 2RO1A 4IR5A 4NS5A 4YABA 5FE4A 4Z93A 5JWMA 5CRMA 4PCEA 5F1HA 2R10A 5CS8A 3O37A 4O7BA 4ALGA 4NYVA 5G4RA 3P1CA 5FE5A 3K2JA 4YYKA 4O70A 4KV1A 5FFYA 5DYXA 5LVRA 5A5OA 4KV4A 5E74A 4LZ2A 5D3NA 5EICA 4AKNA 4QUUA 4DONA 5FE9A 5L99A 3MB4A 5C7NA 5EA1A 3VKHA 5IBNA 4HXMA 4QYLA 4J0SA 4HBXA 5E3DA 4YYJA 2YW5A 5D7XA 5A81A 5F63A 3P1FA 5A5NA 4NR9A 4UYFB 3UV5A 2OO1A 5L97A 3P1EA 4J1PA 4BJXA 5C8GA 3O36A 4MEOA 5AD2A 3HMHA 5DYAA 4TZ8A 4A9IA 5HFRA 4Q0NA 4QSRA 3IU6A 4XUAA 5HFQA 4HBVA 5CUCA 5II2A 5I7YA 3LQHA 5DW2A 3JVMA 4QR5A 4AI6A 4QC3A 5BT4A 1JM4B 5FB1A 3JVLA 5FE8A 4O76A 1ZKRA 4N3WA 5F62A 5D24A 4QSXA 2F6JA 4CUSA 5C89A 5EGUA 5FE0A 2G4AA 4O77A 5DFDA 3P1DA 2KTBB 5CUBA 4X2IA 4UIYA 4UIWA 2L5EA 5D26A 2E3KA 5LVQA 5DX4A 5A85A 4CFLA 4O7EA 5K29A 4QSWA 4TTEA 4YYIA 5FG4A 5H1UA 3D7CA 4NR4A 5DLZA 3MQMA 4CLBA 4HXLA 4UYFA 5HCLA 5DYUA 5HRXA 5CRZA 1N72A 3AADA 2DVRA 3QZSA 4MENA 5HELA 5II1A 5A7CA 4LR6A 4UYEA 4IR3A 4A9OA 2DATA 3LJWA 3LXJA 4TZ2A 5IGNA 3G0LA 5FDZA 5CGPA 5F5ZA 5CZGA 4QEWA 5H85A 4LDFA 5ENEA 5FG5A 3LQJA 4CUUA 4IR6A 3LQIA 5C4QA 4QB3A 4QNSA 5A5PA 4LYWA 4A9MA 4CUQA 5FH6A 5COIA 5E3GA 5FFWA 2DKWA 5D3HA 3Q2FA 4A9JA 5TCMA 4TQNA 5E9IA 4PS5A 5H1TA 4IR4A 5CQAA 5CQ8A 4YBTA 5EU1A 5LKXA 2D82A 5CY9A 4UIZA 1X0JA 4O7CA 5DYCA 4Z6IA 5DFBA 5L96A 5A5RA 2R0VA 5HLSA 4ZQLA 5D0CA 2E7OA 5A83A 4KCXA 3QZTA 4WHUA 4HXSA 4NRAA 4MR4A 5I83A 2I8NA 3MXFA 4C67A 5IIDA 2DVVA 5G4SA 4YBMA 4CUTA 2DVQA 4Z1QA 5DLXA 5ENFA 5HRWA 4NUCA 4UYGA 5I86A 3UW9A 4NQMA 5EISA 2DVSA 4WIVA 4UITA 4YADA 5L8TA 5H1VA 4A9LA 4FLPA 1EQFA 2LSPB 2H60A 5FE1A 5ETBA 5KO4A 4TYLA 3HMFA 2DWWA 5ENJA 3AQAA 5HJCA 4UIXA 4WHWA 4O71A 4N4FA 5D3JA 5CQ5A 4UYHA 5EWWA 5FE3A 4YAXA 5DKHA 4MEQA 5E9VA 5HQ6A 4HBWA 4Q0OA 5L8UA 5I88A 5HQ7A 5D3LA 5CPEA 5D3TA 1E6IA 5F60A 2WP2A 3JVJA 5HM0A 4XY8A 4Y03A 4NRBA 4O7FA 4E96A 3MB3A 4YYMA 5LJ2A 4TT2A 4O75A 4PCIA 4YYHA 4RVRA 4O7AA 4OGJA 5HEMA 4NR7A 4XUBA 2YDWA 2MJVB 4YYNA 2RI7A 4ZW1A 5CQ7A 4Z6HA 5C85A 5ENHA 4MEPA 3S92A 5LKZA 2RS9B 4MR5A 4PY6A 5CUAA 3UVXA 1WUGA 5IGLA 5E0RA 3SVFA 2FSAA 2YYNA 5LJ1A 2GRCA 4BW2A 4TU4A 4NUEA 4YH3A 3HMEA 5CFWA 5DBMA 5KTXA 3P5OA 5FE7A 4HXPA 5E9YA 1JSPB 5DKCA 4ALHA 4XYAA 4TT4A 5FB0A 4QBMA 4YY6A 5F2PA 3U5OA 3FKMX 4YY4A 5A82A 3ZYUA 4YYGA 1WUMA 4CL9A 5KU3A 2RFJA 4OUFA 4YATA 5F25A 4LRGA 1ZS5A 4BW3A 4UIUA 5I29A 5CQ4A 5FE2A 5IG6A 3O35A 4NR8A 5LKUA 4YK0A 5LJ0A 5DFCA 3MUKA 4QR3A 4UYDA 5E73A 1F68A 2WP1A 5EP7A 4HBYA 3I3JA 5EWVA 4ZC9A 2YEMA 5KHMA 3UVWA 5AMFA
chains in the Genus database with same CATH topology
2RNWA 5EQ1A 5EI4A 4GPJA 5I40A 5F1LA 5I80A 3QZVA 5DW1A 5EPRA 4TS8A 5HENA 5CUGA 2YELA 3U5MA 4NYXA 4QEUA 4QSSA 5ACYA 4J3IA 5IGKA 5CQ6A 5DKDA 4QZSA 5HRVA 2OSSA 3NXBA 2YQDA 2F6NA 5D25A 5D3RA 3MULA 4PTBA 3SVHA 3DWYA 4MR6A 5CUDA 3GG3A 4N4GA 2RNXA 5EWHA 5E9MA 5D3PA 4LZRA 5HQ5A 5FH7A 3DAIA 4Z1SA 4YBSA 3ONIA 3U5KA 2L84A 4XY9A 5CUEA 4NUDA 4TU6A 4CFKA 4A9KA 5F3AA 2NXBA 5FG6A 2RNYA 5CQ3A 3UVYA 2R0SA 5ENGA 4TT6A 4NQNA 2I7KA 2D9EA 4YH4A 3IU5A 4F3IA 4QR4A 4QEVA 5A5SA 4CURA 5FE6A 5EV9A 4YYDA 5AMEA 3RCWA 4NRCA 4BHWA 3SVGA 4HXRA 4NXJA 4O72A 3JVKA 5ETDA 3S91A 4N4HA 5BT3A 5L98A 5E7DA 5J0DA 4A9HA 3O33A 2L85A 5CQTA 5LUUA 5EWCA 3U5NA 5D3SA 4LZSA 4LYIA 5E9KA 5F61A 3UV2A 4A9EA 5AD3A 4QC1A 4QSTA 3U5LA 4QYDA 5FBXA 4A9FA 3O34A 5EVAA 5FFVA 2YEKA 5KTUA 4QSUA 5LKTA 3UVDA 2N9GA 4C66A 3G0JA 5EPBA 4OGIA 3UV4A 5CP5A 4QUTA 5ENBA 5IGMA 5C87A 4IOOA 5A5QA 4J0RA 5KTWA 4CUPA 4LC2A 4BW1A 4QY4A 2E7NA 5CTLA 4NYWA 4PKLA 4BW4A 4QSVA 4UIVA 4YC9A 5JI8A 5I1QA 5ENIA 5EK9A 4HXOA 4A9NA 5I89A 5EWDA 5I7XA 4O78A 5DY7A 4QSQA 2R0YA 5FH8A 5CU8A 4LYSA 5E9LA 4HXKA 5TB6A 4NR6A 4QSPA 4IORA 4NR5A 5ENCA 3U5JA 5EM3A 4O74A 3TLPA 5F36A 2OUOA 4N4IA 3U5PA 4IOQA 3Q2EA 4MR3A 5EPSA 5BT5A 4HXNA 2RO1A 4IR5A 4NS5A 4YABA 5FE4A 4Z93A 5JWMA 5CRMA 4PCEA 5F1HA 2R10A 5CS8A 3O37A 4O7BA 4ALGA 4NYVA 5G4RA 3P1CA 5FE5A 3K2JA 4YYKA 4O70A 4KV1A 5FFYA 5DYXA 5LVRA 5A5OA 4KV4A 5E74A 4LZ2A 5D3NA 5EICA 4AKNA 4QUUA 4DONA 5FE9A 5L99A 3MB4A 5C7NA 5EA1A 5IBNA 4HXMA 4QYLA 4J0SA 4HBXA 5E3DA 4YYJA 2YW5A 5D7XA 5A81A 5F63A 3P1FA 5A5NA 4NR9A 4UYFB 3UV5A 2OO1A 5L97A 3P1EA 4J1PA 4BJXA 5C8GA 3O36A 4MEOA 5AD2A 3HMHA 5DYAA 4TZ8A 4A9IA 5HFRA 4Q0NA 4QSRA 3IU6A 4XUAA 5HFQA 4HBVA 5CUCA 5II2A 5I7YA 3LQHA 5DW2A 3JVMA 4QR5A 4QC3A 5BT4A 1JM4B 5FB1A 3JVLA 5FE8A 4O76A 4N3WA 5F62A 5D24A 4QSXA 2F6JA 4CUSA 5C89A 5EGUA 5FE0A 2G4AA 4O77A 5DFDA 3P1DA 2KTBB 5CUBA 4X2IA 4UIYA 4UIWA 2L5EA 5D26A 2E3KA 5LVQA 5DX4A 5A85A 4CFLA 4O7EA 5K29A 4QSWA 4TTEA 4YYIA 5FG4A 5H1UA 3D7CA 4NR4A 5DLZA 3MQMA 4CLBA 4HXLA 4UYFA 5HCLA 5DYUA 5HRXA 5CRZA 1N72A 3AADA 2DVRA 3QZSA 4MENA 5HELA 5II1A 5A7CA 4LR6A 4UYEA 4IR3A 4A9OA 2DATA 3LJWA 3LXJA 4TZ2A 5IGNA 3G0LA 5FDZA 5CGPA 5F5ZA 5CZGA 4QEWA 5H85A 4LDFA 5ENEA 5FG5A 3LQJA 4CUUA 4IR6A 3LQIA 5C4QA 4QB3A 4QNSA 5A5PA 4LYWA 4A9MA 4CUQA 5FH6A 5COIA 5E3GA 5FFWA 2DKWA 5D3HA 3Q2FA 4A9JA 5TCMA 4TQNA 5E9IA 4PS5A 5H1TA 4IR4A 5CQAA 5CQ8A 4YBTA 5EU1A 5LKXA 2D82A 5CY9A 4UIZA 1X0JA 4O7CA 5DYCA 4Z6IA 5DFBA 5L96A 5A5RA 2R0VA 5HLSA 4ZQLA 5D0CA 2E7OA 5A83A 4KCXA 3QZTA 4WHUA 4HXSA 4NRAA 4MR4A 5I83A 2I8NA 3MXFA 4C67A 5IIDA 2DVVA 5G4SA 4YBMA 4CUTA 2DVQA 4Z1QA 5DLXA 5ENFA 5HRWA 4NUCA 4UYGA 5I86A 3UW9A 4NQMA 5EISA 2DVSA 4WIVA 4UITA 4YADA 5L8TA 5H1VA 4A9LA 4FLPA 1EQFA 2LSPB 2H60A 5FE1A 5ETBA 5KO4A 4TYLA 3HMFA 2DWWA 5ENJA 3AQAA 5HJCA 4UIXA 4WHWA 4O71A 4N4FA 5D3JA 5CQ5A 4UYHA 5EWWA 5FE3A 4YAXA 5DKHA 4MEQA 5E9VA 5HQ6A 4HBWA 4Q0OA 5L8UA 5I88A 5HQ7A 5D3LA 5CPEA 5D3TA 1E6IA 5F60A 2WP2A 3JVJA 5HM0A 4XY8A 4Y03A 4NRBA 4O7FA 4E96A 3MB3A 4YYMA 5LJ2A 4TT2A 4O75A 4PCIA 4YYHA 4RVRA 4O7AA 4OGJA 5HEMA 4NR7A 4XUBA 2YDWA 2MJVB 4YYNA 2RI7A 4ZW1A 5CQ7A 4Z6HA 5C85A 5ENHA 4MEPA 3S92A 5LKZA 2RS9B 4MR5A 4PY6A 5CUAA 3UVXA 1WUGA 5IGLA 5E0RA 3SVFA 2FSAA 2YYNA 5LJ1A 2GRCA 4BW2A 4TU4A 4NUEA 4YH3A 3HMEA 5CFWA 5DBMA 5KTXA 3P5OA 5FE7A 4HXPA 5E9YA 1JSPB 5DKCA 4ALHA 4XYAA 4TT4A 5FB0A 4QBMA 4YY6A 5F2PA 3U5OA 3FKMX 4YY4A 5A82A 3ZYUA 4YYGA 1WUMA 4CL9A 5KU3A 2RFJA 4OUFA 4YATA 5F25A 4LRGA 1ZS5A 4BW3A 4UIUA 5I29A 5CQ4A 5FE2A 5IG6A 3O35A 4NR8A 5LKUA 4YK0A 5LJ0A 5DFCA 3MUKA 4QR3A 4UYDA 5E73A 1F68A 2WP1A 5EP7A 4HBYA 3I3JA 5EWVA 4ZC9A 2YEMA 5KHMA 3UVWA 5AMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RNW A;  5EQ1 A;  5EI4 A;  4GPJ A;  5I40 A;  5F1L A;  5I80 A;  3QZV A;  5DW1 A;  5EPR A;  4TS8 A;  5HEN A;  5CUG A;  2YEL A;  3U5M A;  4NYX A;  4QEU A;  4QSS A;  5ACY A;  4J3I A;  5IGK A;  5CQ6 A;  5DKD A;  4QZS A;  5HRV A;  2OSS A;  3NXB A;  2YQD A;  2F6N A;  5D25 A;  5D3R A;  3MUL A;  4PTB A;  3SVH A;  3DWY A;  4MR6 A;  5CUD A;  3GG3 A;  4N4G A;  2RNX A;  5EWH A;  5E9M A;  5D3P A;  4LZR A;  5HQ5 A;  5FH7 A;  3DAI A;  4Z1S A;  4YBS A;  3ONI A;  3U5K A;  2L84 A;  4XY9 A;  5CUE A;  4NUD A;  4TU6 A;  4CFK A;  4A9K A;  5F3A A;  2NXB A;  5FG6 A;  2RNY A;  5CQ3 A;  3UVY A;  2R0S A;  5ENG A;  4TT6 A;  4NQN A;  2I7K A;  2D9E A;  4YH4 A;  3IU5 A;  4F3I A;  4QR4 A;  4QEV A;  5A5S A;  4CUR A;  5FE6 A;  5EV9 A;  4YYD A;  5AME A;  3RCW A;  4NRC A;  4BHW A;  3SVG A;  4HXR A;  4NXJ A;  4O72 A;  3JVK A;  5ETD A;  3S91 A;  4N4H A;  5BT3 A;  5L98 A;  5E7D A;  5J0D A;  4A9H A;  3O33 A;  2L85 A;  5CQT A;  5LUU A;  5EWC A;  3U5N A;  5D3S A;  4LZS A;  4LYI A;  5E9K A;  5F61 A;  3UV2 A;  4A9E A;  5AD3 A;  4QC1 A;  4QST A;  3U5L A;  4QYD A;  5FBX A;  4A9F A;  3O34 A;  5EVA A;  5FFV A;  2YEK A;  5KTU A;  4QSU A;  5LKT A;  3UVD A;  2N9G A;  4C66 A;  3G0J A;  5EPB A;  4OGI A;  3UV4 A;  5CP5 A;  4QUT A;  5ENB A;  5IGM A;  5C87 A;  4IOO A;  5A5Q A;  4J0R A;  5KTW A;  4CUP A;  4LC2 A;  4BW1 A;  4QY4 A;  2E7N A;  5CTL A;  4NYW A;  4PKL A;  4BW4 A;  4QSV A;  4UIV A;  4YC9 A;  5JI8 A;  5I1Q A;  5ENI A;  5EK9 A;  4HXO A;  4A9N A;  5I89 A;  5EWD A;  5I7X A;  4O78 A;  5DY7 A;  4QSQ A;  2R0Y A;  5FH8 A;  5CU8 A;  4LYS A;  5E9L A;  4HXK A;  5TB6 A;  4NR6 A;  4QSP A;  4IOR A;  4NR5 A;  5ENC A;  3U5J A;  5EM3 A;  4O74 A;  3TLP A;  5F36 A;  2OUO A;  4N4I A;  3U5P A;  4IOQ A;  3Q2E A;  4MR3 A;  5EPS A;  5BT5 A;  4HXN A;  2RO1 A;  4IR5 A;  4NS5 A;  4YAB A;  5FE4 A;  4Z93 A;  5JWM A;  5CRM A;  4PCE A;  5F1H A;  2R10 A;  5CS8 A;  3O37 A;  4O7B A;  4ALG A;  4NYV A;  5G4R A;  3P1C A;  5FE5 A;  3K2J A;  4YYK A;  4O70 A;  4KV1 A;  5FFY A;  5DYX A;  5LVR A;  5A5O A;  4KV4 A;  5E74 A;  4LZ2 A;  5D3N A;  5EIC A;  4AKN A;  4QUU A;  4DON A;  5FE9 A;  5L99 A;  3MB4 A;  5C7N A;  5EA1 A;  5IBN A;  4HXM A;  4QYL A;  4J0S A;  4HBX A;  5E3D A;  4YYJ A;  2YW5 A;  5D7X A;  5A81 A;  5F63 A;  3P1F A;  5A5N A;  4NR9 A;  4UYF B;  3UV5 A;  2OO1 A;  5L97 A;  3P1E A;  4J1P A;  4BJX A;  5C8G A;  3O36 A;  4MEO A;  5AD2 A;  3HMH A;  5DYA A;  4TZ8 A;  4A9I A;  5HFR A;  4Q0N A;  4QSR A;  3IU6 A;  4XUA A;  5HFQ A;  4HBV A;  5CUC A;  5II2 A;  5I7Y A;  3LQH A;  5DW2 A;  3JVM A;  4QR5 A;  4QC3 A;  5BT4 A;  1JM4 B;  5FB1 A;  3JVL A;  5FE8 A;  4O76 A;  4N3W A;  5F62 A;  5D24 A;  4QSX A;  2F6J A;  4CUS A;  5C89 A;  5EGU A;  5FE0 A;  2G4A A;  4O77 A;  5DFD A;  3P1D A;  2KTB B;  5CUB A;  4X2I A;  4UIY A;  4UIW A;  2L5E A;  5D26 A;  2E3K A;  5LVQ A;  5DX4 A;  5A85 A;  4CFL A;  4O7E A;  5K29 A;  4QSW A;  4TTE A;  4YYI A;  5FG4 A;  5H1U A;  3D7C A;  4NR4 A;  5DLZ A;  3MQM A;  4CLB A;  4HXL A;  4UYF A;  5HCL A;  5DYU A;  5HRX A;  5CRZ A;  1N72 A;  3AAD A;  2DVR A;  3QZS A;  4MEN A;  5HEL A;  5II1 A;  5A7C A;  4LR6 A;  4UYE A;  4IR3 A;  4A9O A;  2DAT A;  3LJW A;  3LXJ A;  4TZ2 A;  5IGN A;  3G0L A;  5FDZ A;  5CGP A;  5F5Z A;  5CZG A;  4QEW A;  5H85 A;  4LDF A;  5ENE A;  5FG5 A;  3LQJ A;  4CUU A;  4IR6 A;  3LQI A;  5C4Q A;  4QB3 A;  4QNS A;  5A5P A;  4LYW A;  4A9M A;  4CUQ A;  5FH6 A;  5COI A;  5E3G A;  5FFW A;  2DKW A;  5D3H A;  3Q2F A;  4A9J A;  5TCM A;  4TQN A;  5E9I A;  4PS5 A;  5H1T A;  4IR4 A;  5CQA A;  5CQ8 A;  4YBT A;  5EU1 A;  5LKX A;  2D82 A;  5CY9 A;  4UIZ A;  1X0J A;  4O7C A;  5DYC A;  4Z6I A;  5DFB A;  5L96 A;  5A5R A;  2R0V A;  5HLS A;  4ZQL A;  5D0C A;  2E7O A;  5A83 A;  4KCX A;  3QZT A;  4WHU A;  4HXS A;  4NRA A;  4MR4 A;  5I83 A;  2I8N A;  3MXF A;  4C67 A;  5IID A;  2DVV A;  5G4S A;  4YBM A;  4CUT A;  2DVQ A;  4Z1Q A;  5DLX A;  5ENF A;  5HRW A;  4NUC A;  4UYG A;  5I86 A;  3UW9 A;  4NQM A;  5EIS A;  2DVS A;  4WIV A;  4UIT A;  4YAD A;  5L8T A;  5H1V A;  4A9L A;  4FLP A;  1EQF A;  2LSP B;  2H60 A;  5FE1 A;  5ETB A;  5KO4 A;  4TYL A;  3HMF A;  2DWW A;  5ENJ A;  3AQA A;  5HJC A;  4UIX A;  4WHW A;  4O71 A;  4N4F A;  5D3J A;  5CQ5 A;  4UYH A;  5EWW A;  5FE3 A;  4YAX A;  5DKH A;  4MEQ A;  5E9V A;  5HQ6 A;  4HBW A;  4Q0O A;  5L8U A;  5I88 A;  5HQ7 A;  5D3L A;  5CPE A;  5D3T A;  1E6I A;  5F60 A;  2WP2 A;  3JVJ A;  5HM0 A;  4XY8 A;  4Y03 A;  4NRB A;  4O7F A;  4E96 A;  3MB3 A;  4YYM A;  5LJ2 A;  4TT2 A;  4O75 A;  4PCI A;  4YYH A;  4RVR A;  4O7A A;  4OGJ A;  5HEM A;  4NR7 A;  4XUB A;  2YDW A;  2MJV B;  4YYN A;  2RI7 A;  4ZW1 A;  5CQ7 A;  4Z6H A;  5C85 A;  5ENH A;  4MEP A;  3S92 A;  5LKZ A;  2RS9 B;  4MR5 A;  4PY6 A;  5CUA A;  3UVX A;  1WUG A;  5IGL A;  5E0R A;  3SVF A;  2FSA A;  2YYN A;  5LJ1 A;  2GRC A;  4BW2 A;  4TU4 A;  4NUE A;  4YH3 A;  3HME A;  5CFW A;  5DBM A;  5KTX A;  3P5O A;  5FE7 A;  4HXP A;  5E9Y A;  1JSP B;  5DKC A;  4ALH A;  4XYA A;  4TT4 A;  5FB0 A;  4QBM A;  4YY6 A;  5F2P A;  3U5O A;  3FKM X;  4YY4 A;  5A82 A;  3ZYU A;  4YYG A;  1WUM A;  4CL9 A;  5KU3 A;  2RFJ A;  4OUF A;  4YAT A;  5F25 A;  4LRG A;  1ZS5 A;  4BW3 A;  4UIU A;  5I29 A;  5CQ4 A;  5FE2 A;  5IG6 A;  3O35 A;  4NR8 A;  5LKU A;  4YK0 A;  5LJ0 A;  5DFC A;  3MUK A;  4QR3 A;  4UYD A;  5E73 A;  1F68 A;  2WP1 A;  5EP7 A;  4HBY A;  3I3J A;  5EWV A;  4ZC9 A;  2YEM A;  5KHM A;  3UVW A;  5AMF A; 
#chains in the Genus database with same CATH topology
 2RNW A;  5EQ1 A;  5EI4 A;  4GPJ A;  5I40 A;  1PUO A;  5F1L A;  5I80 A;  3QZV A;  5DW1 A;  5EPR A;  4TS8 A;  5HEN A;  5CUG A;  2YEL A;  3U5M A;  4NYX A;  4QEU A;  4QSS A;  5ACY A;  4J3I A;  4AKH A;  5IGK A;  5CQ6 A;  5DKD A;  4QZS A;  5HRV A;  3VKG A;  2OSS A;  3NXB A;  2YQD A;  2F6N A;  5D25 A;  5D3R A;  3MUL A;  4PTB A;  3SVH A;  3DWY A;  4MR6 A;  5CUD A;  3GG3 A;  4N4G A;  2RNX A;  5EWH A;  3D1B A;  5E9M A;  5D3P A;  4LZR A;  5HQ5 A;  2EJN A;  5FH7 A;  3DAI A;  3ERR A;  4Z1S A;  4YBS A;  3ONI A;  3U5K A;  2L84 A;  4XY9 A;  5CUE A;  4NUD A;  4TU6 A;  4CFK A;  4A9K A;  5F3A A;  2NXB A;  5FG6 A;  2RNY A;  5CQ3 A;  3UVY A;  2R0S A;  5ENG A;  4TT6 A;  4NQN A;  2I7K A;  2D9E A;  4YH4 A;  3IU5 A;  4F3I A;  4QR4 A;  4QEV A;  5A5S A;  4AKG A;  4CUR A;  5FE6 A;  5EV9 A;  4YYD A;  5AME A;  3RCW A;  4NRC A;  4BHW A;  3SVG A;  4HXR A;  4NXJ A;  4O72 A;  3JVK A;  5ETD A;  3S91 A;  4N4H A;  5BT3 A;  5L98 A;  5E7D A;  5J0D A;  4A9H A;  3O33 A;  2L85 A;  5CQT A;  5LUU A;  5EWC A;  3U5N A;  5D3S A;  4LZS A;  4LYI A;  5E9K A;  5F61 A;  3UV2 A;  4A9E A;  5AD3 A;  4QC1 A;  4QST A;  3U5L A;  4QYD A;  5FBX A;  4A9F A;  3O34 A;  5EVA A;  5FFV A;  2YEK A;  5KTU A;  4QSU A;  5LKT A;  3UVD A;  2N9G A;  4C66 A;  3G0J A;  5EPB A;  4OGI A;  4AKI A;  3UV4 A;  5CP5 A;  4QUT A;  5ENB A;  5IGM A;  5C87 A;  4IOO A;  5A5Q A;  4J0R A;  5KTW A;  4CUP A;  4LC2 A;  4BW1 A;  4QY4 A;  2E7N A;  5CTL A;  4NYW A;  4PKL A;  4BW4 A;  4QSV A;  4UIV A;  4YC9 A;  5JI8 A;  5I1Q A;  5ENI A;  5EK9 A;  4HXO A;  4A9N A;  5I89 A;  5EWD A;  5I7X A;  4O78 A;  5DY7 A;  4QSQ A;  2R0Y A;  5FH8 A;  5CU8 A;  4LYS A;  5E9L A;  4HXK A;  5TB6 A;  4NR6 A;  4QSP A;  4IOR A;  4NR5 A;  5ENC A;  3D1D A;  5EM3 A;  4O74 A;  3U5J A;  3TLP A;  5F36 A;  2OUO A;  4N4I A;  3U5P A;  4IOQ A;  3Q2E A;  4MR3 A;  5EPS A;  5BT5 A;  4HXN A;  2RO1 A;  4IR5 A;  4NS5 A;  4YAB A;  5FE4 A;  4Z93 A;  5JWM A;  5CRM A;  4PCE A;  5F1H A;  2R10 A;  5CS8 A;  3O37 A;  4O7B A;  4ALG A;  4NYV A;  5G4R A;  3P1C A;  5FE5 A;  3K2J A;  4YYK A;  4O70 A;  4KV1 A;  5FFY A;  5DYX A;  5LVR A;  5A5O A;  4KV4 A;  5E74 A;  4LZ2 A;  5D3N A;  5EIC A;  4AKN A;  4QUU A;  4DON A;  5FE9 A;  5L99 A;  3MB4 A;  5C7N A;  5EA1 A;  3VKH A;  5IBN A;  4HXM A;  4QYL A;  4J0S A;  4HBX A;  5E3D A;  4YYJ A;  2YW5 A;  5D7X A;  5A81 A;  5F63 A;  3P1F A;  5A5N A;  4NR9 A;  4UYF B;  3UV5 A;  2OO1 A;  5L97 A;  3P1E A;  4J1P A;  4BJX A;  5C8G A;  3O36 A;  4MEO A;  5AD2 A;  3HMH A;  5DYA A;  4TZ8 A;  4A9I A;  5HFR A;  4Q0N A;  4QSR A;  3IU6 A;  4XUA A;  5HFQ A;  4HBV A;  5CUC A;  5II2 A;  5I7Y A;  3LQH A;  5DW2 A;  3JVM A;  4QR5 A;  4AI6 A;  4QC3 A;  5BT4 A;  1JM4 B;  5FB1 A;  3JVL A;  5FE8 A;  4O76 A;  1ZKR A;  4N3W A;  5F62 A;  5D24 A;  4QSX A;  2F6J A;  4CUS A;  5C89 A;  5EGU A;  5FE0 A;  2G4A A;  4O77 A;  5DFD A;  3P1D A;  2KTB B;  5CUB A;  4X2I A;  4UIY A;  4UIW A;  2L5E A;  5D26 A;  2E3K A;  5LVQ A;  5DX4 A;  5A85 A;  4CFL A;  4O7E A;  5K29 A;  4QSW A;  4TTE A;  4YYI A;  5FG4 A;  5H1U A;  3D7C A;  4NR4 A;  5DLZ A;  3MQM A;  4CLB A;  4HXL A;  4UYF A;  5HCL A;  5DYU A;  5HRX A;  5CRZ A;  1N72 A;  3AAD A;  2DVR A;  3QZS A;  4MEN A;  5HEL A;  5II1 A;  5A7C A;  4LR6 A;  4UYE A;  4IR3 A;  4A9O A;  2DAT A;  3LJW A;  3LXJ A;  4TZ2 A;  5IGN A;  3G0L A;  5FDZ A;  5CGP A;  5F5Z A;  5CZG A;  4QEW A;  5H85 A;  4LDF A;  5ENE A;  5FG5 A;  3LQJ A;  4CUU A;  4IR6 A;  3LQI A;  5C4Q A;  4QB3 A;  4QNS A;  5A5P A;  4LYW A;  4A9M A;  4CUQ A;  5FH6 A;  5COI A;  5E3G A;  5FFW A;  2DKW A;  5D3H A;  3Q2F A;  4A9J A;  5TCM A;  4TQN A;  5E9I A;  4PS5 A;  5H1T A;  4IR4 A;  5CQA A;  5CQ8 A;  4YBT A;  5EU1 A;  5LKX A;  2D82 A;  5CY9 A;  4UIZ A;  1X0J A;  4O7C A;  5DYC A;  4Z6I A;  5DFB A;  5L96 A;  5A5R A;  2R0V A;  5HLS A;  4ZQL A;  5D0C A;  2E7O A;  5A83 A;  4KCX A;  3QZT A;  4WHU A;  4HXS A;  4NRA A;  4MR4 A;  5I83 A;  2I8N A;  3MXF A;  4C67 A;  5IID A;  2DVV A;  5G4S A;  4YBM A;  4CUT A;  2DVQ A;  4Z1Q A;  5DLX A;  5ENF A;  5HRW A;  4NUC A;  4UYG A;  5I86 A;  3UW9 A;  4NQM A;  5EIS A;  2DVS A;  4WIV A;  4UIT A;  4YAD A;  5L8T A;  5H1V A;  4A9L A;  4FLP A;  1EQF A;  2LSP B;  2H60 A;  5FE1 A;  5ETB A;  5KO4 A;  4TYL A;  3HMF A;  2DWW A;  5ENJ A;  3AQA A;  5HJC A;  4UIX A;  4WHW A;  4O71 A;  4N4F A;  5D3J A;  5CQ5 A;  4UYH A;  5EWW A;  5FE3 A;  4YAX A;  5DKH A;  4MEQ A;  5E9V A;  5HQ6 A;  4HBW A;  4Q0O A;  5L8U A;  5I88 A;  5HQ7 A;  5D3L A;  5CPE A;  5D3T A;  1E6I A;  5F60 A;  2WP2 A;  3JVJ A;  5HM0 A;  4XY8 A;  4Y03 A;  4NRB A;  4O7F A;  4E96 A;  3MB3 A;  4YYM A;  5LJ2 A;  4TT2 A;  4O75 A;  4PCI A;  4YYH A;  4RVR A;  4O7A A;  4OGJ A;  5HEM A;  4NR7 A;  4XUB A;  2YDW A;  2MJV B;  4YYN A;  2RI7 A;  4ZW1 A;  5CQ7 A;  4Z6H A;  5C85 A;  5ENH A;  4MEP A;  3S92 A;  5LKZ A;  2RS9 B;  4MR5 A;  4PY6 A;  5CUA A;  3UVX A;  1WUG A;  5IGL A;  5E0R A;  3SVF A;  2FSA A;  2YYN A;  5LJ1 A;  2GRC A;  4BW2 A;  4TU4 A;  4NUE A;  4YH3 A;  3HME A;  5CFW A;  5DBM A;  5KTX A;  3P5O A;  5FE7 A;  4HXP A;  5E9Y A;  1JSP B;  5DKC A;  4ALH A;  4XYA A;  4TT4 A;  5FB0 A;  4QBM A;  4YY6 A;  5F2P A;  3U5O A;  3FKM X;  4YY4 A;  5A82 A;  3ZYU A;  4YYG A;  1WUM A;  4CL9 A;  5KU3 A;  2RFJ A;  4OUF A;  4YAT A;  5F25 A;  4LRG A;  1ZS5 A;  4BW3 A;  4UIU A;  5I29 A;  5CQ4 A;  5FE2 A;  5IG6 A;  3O35 A;  4NR8 A;  5LKU A;  4YK0 A;  5LJ0 A;  5DFC A;  3MUK A;  4QR3 A;  4UYD A;  5E73 A;  1F68 A;  2WP1 A;  5EP7 A;  4HBY A;  3I3J A;  5EWV A;  4ZC9 A;  2YEM A;  5KHM A;  3UVW A;  5AMF A; 
#chains in the Genus database with same CATH homology
 2RNW A;  5EQ1 A;  5EI4 A;  4GPJ A;  5I40 A;  5F1L A;  5I80 A;  3QZV A;  5DW1 A;  5EPR A;  4TS8 A;  5HEN A;  5CUG A;  2YEL A;  3U5M A;  4NYX A;  4QEU A;  4QSS A;  5ACY A;  4J3I A;  5IGK A;  5CQ6 A;  5DKD A;  4QZS A;  5HRV A;  2OSS A;  3NXB A;  2YQD A;  2F6N A;  5D25 A;  5D3R A;  3MUL A;  4PTB A;  3SVH A;  3DWY A;  4MR6 A;  5CUD A;  3GG3 A;  4N4G A;  2RNX A;  5EWH A;  5E9M A;  5D3P A;  4LZR A;  5HQ5 A;  5FH7 A;  3DAI A;  4Z1S A;  4YBS A;  3ONI A;  3U5K A;  2L84 A;  4XY9 A;  5CUE A;  4NUD A;  4TU6 A;  4CFK A;  4A9K A;  5F3A A;  2NXB A;  5FG6 A;  2RNY A;  5CQ3 A;  3UVY A;  2R0S A;  5ENG A;  4TT6 A;  4NQN A;  2I7K A;  2D9E A;  4YH4 A;  3IU5 A;  4F3I A;  4QR4 A;  4QEV A;  5A5S A;  4CUR A;  5FE6 A;  5EV9 A;  4YYD A;  5AME A;  3RCW A;  4NRC A;  4BHW A;  3SVG A;  4HXR A;  4NXJ A;  4O72 A;  3JVK A;  5ETD A;  3S91 A;  4N4H A;  5BT3 A;  5L98 A;  5E7D A;  5J0D A;  4A9H A;  3O33 A;  2L85 A;  5CQT A;  5LUU A;  5EWC A;  3U5N A;  5D3S A;  4LZS A;  4LYI A;  5E9K A;  5F61 A;  3UV2 A;  4A9E A;  5AD3 A;  4QC1 A;  4QST A;  3U5L A;  4QYD A;  5FBX A;  4A9F A;  3O34 A;  5EVA A;  5FFV A;  2YEK A;  5KTU A;  4QSU A;  5LKT A;  3UVD A;  2N9G A;  4C66 A;  3G0J A;  5EPB A;  4OGI A;  3UV4 A;  5CP5 A;  4QUT A;  5ENB A;  5IGM A;  5C87 A;  4IOO A;  5A5Q A;  4J0R A;  5KTW A;  4CUP A;  4LC2 A;  4BW1 A;  4QY4 A;  2E7N A;  5CTL A;  4NYW A;  4PKL A;  4BW4 A;  4QSV A;  4UIV A;  4YC9 A;  5JI8 A;  5I1Q A;  5ENI A;  5EK9 A;  4HXO A;  4A9N A;  5I89 A;  5EWD A;  5I7X A;  4O78 A;  5DY7 A;  4QSQ A;  2R0Y A;  5FH8 A;  5CU8 A;  4LYS A;  5E9L A;  4HXK A;  5TB6 A;  4NR6 A;  4QSP A;  4IOR A;  4NR5 A;  5ENC A;  3U5J A;  5EM3 A;  4O74 A;  3TLP A;  5F36 A;  2OUO A;  4N4I A;  3U5P A;  4IOQ A;  3Q2E A;  4MR3 A;  5EPS A;  5BT5 A;  4HXN A;  2RO1 A;  4IR5 A;  4NS5 A;  4YAB A;  5FE4 A;  4Z93 A;  5JWM A;  5CRM A;  4PCE A;  5F1H A;  2R10 A;  5CS8 A;  3O37 A;  4O7B A;  4ALG A;  4NYV A;  5G4R A;  3P1C A;  5FE5 A;  3K2J A;  4YYK A;  4O70 A;  4KV1 A;  5FFY A;  5DYX A;  5LVR A;  5A5O A;  4KV4 A;  5E74 A;  4LZ2 A;  5D3N A;  5EIC A;  4AKN A;  4QUU A;  4DON A;  5FE9 A;  5L99 A;  3MB4 A;  5C7N A;  5EA1 A;  5IBN A;  4HXM A;  4QYL A;  4J0S A;  4HBX A;  5E3D A;  4YYJ A;  2YW5 A;  5D7X A;  5A81 A;  5F63 A;  3P1F A;  5A5N A;  4NR9 A;  4UYF B;  3UV5 A;  2OO1 A;  5L97 A;  3P1E A;  4J1P A;  4BJX A;  5C8G A;  3O36 A;  4MEO A;  5AD2 A;  3HMH A;  5DYA A;  4TZ8 A;  4A9I A;  5HFR A;  4Q0N A;  4QSR A;  3IU6 A;  4XUA A;  5HFQ A;  4HBV A;  5CUC A;  5II2 A;  5I7Y A;  3LQH A;  5DW2 A;  3JVM A;  4QR5 A;  4QC3 A;  5BT4 A;  1JM4 B;  5FB1 A;  3JVL A;  5FE8 A;  4O76 A;  4N3W A;  5F62 A;  5D24 A;  4QSX A;  2F6J A;  4CUS A;  5C89 A;  5EGU A;  5FE0 A;  2G4A A;  4O77 A;  5DFD A;  3P1D A;  2KTB B;  5CUB A;  4X2I A;  4UIY A;  4UIW A;  2L5E A;  5D26 A;  2E3K A;  5LVQ A;  5DX4 A;  5A85 A;  4CFL A;  4O7E A;  5K29 A;  4QSW A;  4TTE A;  4YYI A;  5FG4 A;  5H1U A;  3D7C A;  4NR4 A;  5DLZ A;  3MQM A;  4CLB A;  4HXL A;  4UYF A;  5HCL A;  5DYU A;  5HRX A;  5CRZ A;  1N72 A;  3AAD A;  2DVR A;  3QZS A;  4MEN A;  5HEL A;  5II1 A;  5A7C A;  4LR6 A;  4UYE A;  4IR3 A;  4A9O A;  2DAT A;  3LJW A;  3LXJ A;  4TZ2 A;  5IGN A;  3G0L A;  5FDZ A;  5CGP A;  5F5Z A;  5CZG A;  4QEW A;  5H85 A;  4LDF A;  5ENE A;  5FG5 A;  3LQJ A;  4CUU A;  4IR6 A;  3LQI A;  5C4Q A;  4QB3 A;  4QNS A;  5A5P A;  4LYW A;  4A9M A;  4CUQ A;  5FH6 A;  5COI A;  5E3G A;  5FFW A;  2DKW A;  5D3H A;  3Q2F A;  4A9J A;  5TCM A;  4TQN A;  5E9I A;  4PS5 A;  5H1T A;  4IR4 A;  5CQA A;  5CQ8 A;  4YBT A;  5EU1 A;  5LKX A;  2D82 A;  5CY9 A;  4UIZ A;  1X0J A;  4O7C A;  5DYC A;  4Z6I A;  5DFB A;  5L96 A;  5A5R A;  2R0V A;  5HLS A;  4ZQL A;  5D0C A;  2E7O A;  5A83 A;  4KCX A;  3QZT A;  4WHU A;  4HXS A;  4NRA A;  4MR4 A;  5I83 A;  2I8N A;  3MXF A;  4C67 A;  5IID A;  2DVV A;  5G4S A;  4YBM A;  4CUT A;  2DVQ A;  4Z1Q A;  5DLX A;  5ENF A;  5HRW A;  4NUC A;  4UYG A;  5I86 A;  3UW9 A;  4NQM A;  5EIS A;  2DVS A;  4WIV A;  4UIT A;  4YAD A;  5L8T A;  5H1V A;  4A9L A;  4FLP A;  1EQF A;  2LSP B;  2H60 A;  5FE1 A;  5ETB A;  5KO4 A;  4TYL A;  3HMF A;  2DWW A;  5ENJ A;  3AQA A;  5HJC A;  4UIX A;  4WHW A;  4O71 A;  4N4F A;  5D3J A;  5CQ5 A;  4UYH A;  5EWW A;  5FE3 A;  4YAX A;  5DKH A;  4MEQ A;  5E9V A;  5HQ6 A;  4HBW A;  4Q0O A;  5L8U A;  5I88 A;  5HQ7 A;  5D3L A;  5CPE A;  5D3T A;  1E6I A;  5F60 A;  2WP2 A;  3JVJ A;  5HM0 A;  4XY8 A;  4Y03 A;  4NRB A;  4O7F A;  4E96 A;  3MB3 A;  4YYM A;  5LJ2 A;  4TT2 A;  4O75 A;  4PCI A;  4YYH A;  4RVR A;  4O7A A;  4OGJ A;  5HEM A;  4NR7 A;  4XUB A;  2YDW A;  2MJV B;  4YYN A;  2RI7 A;  4ZW1 A;  5CQ7 A;  4Z6H A;  5C85 A;  5ENH A;  4MEP A;  3S92 A;  5LKZ A;  2RS9 B;  4MR5 A;  4PY6 A;  5CUA A;  3UVX A;  1WUG A;  5IGL A;  5E0R A;  3SVF A;  2FSA A;  2YYN A;  5LJ1 A;  2GRC A;  4BW2 A;  4TU4 A;  4NUE A;  4YH3 A;  3HME A;  5CFW A;  5DBM A;  5KTX A;  3P5O A;  5FE7 A;  4HXP A;  5E9Y A;  1JSP B;  5DKC A;  4ALH A;  4XYA A;  4TT4 A;  5FB0 A;  4QBM A;  4YY6 A;  5F2P A;  3U5O A;  3FKM X;  4YY4 A;  5A82 A;  3ZYU A;  4YYG A;  1WUM A;  4CL9 A;  5KU3 A;  2RFJ A;  4OUF A;  4YAT A;  5F25 A;  4LRG A;  1ZS5 A;  4BW3 A;  4UIU A;  5I29 A;  5CQ4 A;  5FE2 A;  5IG6 A;  3O35 A;  4NR8 A;  5LKU A;  4YK0 A;  5LJ0 A;  5DFC A;  3MUK A;  4QR3 A;  4UYD A;  5E73 A;  1F68 A;  2WP1 A;  5EP7 A;  4HBY A;  3I3J A;  5EWV A;  4ZC9 A;  2YEM A;  5KHM A;  3UVW A;  5AMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...