5A5RA

Crystal structure of human atad2 bromodomain in complex with 5-5- methoxypyridin-3-yl-3-methyl-8-piperidin-4-ylamino-1,2-dihydro-1,7- naphthyridin-2-one
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Fragment-Based Discovery of Low-Micromolar Atad2 Bromodomain Inhibitors.
pubmed doi rcsb
molecule keywords ATPASE FAMILY AAA DOMAIN-CONTAINING PROTEIN 2
molecule tags Hydrolase
source organism Homo sapiens
total genus 55
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a5rA00
5CQAA 5FFWA 4QC3A 5IGMA 5ENIA 5IGNA 3Q2EA 5D3SA 4LYWA 3HMFA 4QSSA 5D3LA 5F62A 3GG3A 3D7CA 5ENBA 4BHWA 4A9FA 3S92A 5A5QA 4Z93A 2R10A 5EWHA 5EPRA 4CLBA 5A82A 5A5NA 4NRAA 5E74A 3LXJA 5FG5A 3O37A 5D3TA 4A9NA 4HXKA 2I7KA 4OGIA 5E7DA 2G4AA 5CUBA 5DKHA 4QSUA 2YEKA 5KTXA 5EISA 4NUDA 4J1PA 5FFYA 3Q2FA 4Y03A 5A5PA 5E9YA 2RO1A 5DLZA 4HBWA 5D3HA 5A83A 5FE4A 4A9HA 5CY9A 5D7XA 3JVMA 4TYLA 5EWDA 3U5MA 5L99A 4PY6A 4N4GA 5ETBA 4IOOA 5E0RA 5HQ7A 5E3GA 4ZC9A 5D3RA 4IR4A 5HRVA 2D9EA 5CQTA 5FG4A 4QSQA 4LZ2A 4CUSA 4IR6A 5ENEA 5F60A 4OGJA 4CFKA 5KTUA 3AQAA 5JWMA 4UITA 5FE7A 4LYSA 4QUUA 5AMEA 4BJXA 2DWWA 4LC2A 4UYFA 4A9LA 4QSTA 3MXFA 5F63A 4BW3A 2F6JA 4QR5A 5TCMA 3P1EA 5F61A 5CUAA 3IU6A 5D25A 3K2JA 5E9KA 4YC9A 5KTWA 4NRBA 5HEMA 3I3JA 5KHMA 4NQMA 4XY9A 4ALHA 4YYNA 5D0CA 4NRCA 4A9IA 5JI8A 4N4IA 4QR3A 3FKMX 5DFDA 4PCEA 4A9KA 5A5SA 4XUAA 4HXLA 5LUUA 3SVFA 3P5OA 5G4RA 4TU6A 3UVXA 2R0SA 4IR3A 4OUFA 4YY6A 5AD3A 3O36A 2R0VA 4MR6A 5FDZA 5DFBA 5EWCA 5ACYA 4YABA 5C7NA 3P1CA 5I7YA 3ZYUA 5IGKA 4XUBA 5I40A 4HXOA 4KV4A 5FH8A 5HLSA 4A9OA 5DKCA 4O7AA 4HBYA 2YW5A 3AADA 4NR4A 4QY4A 5DLXA 5I86A 5C4QA 5K29A 5EVAA 4N4HA 4NR9A 4PKLA 5FH7A 3LQJA 5HJCA 5ETDA 4O7EA 3U5NA 4UIXA 5CUEA 2D82A 5EPBA 5LJ2A 5HENA 5ENCA 1F68A 4Q0OA 2FSAA 4F3IA 5CP5A 4YY4A 2E3KA 1E6IA 2RNXA 5A5OA 5KO4A 2KTBB 4UIZA 2DKWA 5H1TA 4UYFB 3DWYA 2RNWA 5L98A 5LVQA 4C66A 5ENJA 4Z1SA 4HXSA 5H85A 4YYJA 2N9GA 4QBMA 5CPEA 1WUMA 2RFJA 4Z6HA 2RI7A 4NXJA 3UVDA 4TS8A 4C67A 5AD2A 3UV5A 4E96A 4YH3A 5F3AA 4NUEA 5CQ4A 2YDWA 4HXMA 4MEOA 2WP2A 4NQNA 4TT2A 2DVSA 5I29A 4LZRA 4QSVA 5LKZA 3DAIA 5II2A 3MQMA 5CQ8A 4UYEA 5HFQA 3QZTA 4J0SA 4LDFA 4KCXA 1EQFA 4N3WA 5ENHA 5DYAA 4NR5A 5BT3A 5BT4A 5CGPA 4YYHA 3JVJA 4HXNA 5FE2A 4QSRA 4O78A 1JM4B 5HFRA 2LSPB 4WHWA 5I83A 5FE1A 4RVRA 5DW2A 5E73A 5EU1A 2L85A 4QR4A 4QSXA 5FE3A 3G0JA 5A7CA 5EWVA 4NYXA 4ALGA 2H60A 4QEUA 5CZGA 4YBMA 2DVVA 4QSPA 5I7XA 3S91A 5CUCA 5FH6A 4YH4A 4YAXA 3JVLA 4WHUA 5F5ZA 3TLPA 5CRMA 5F36A 3UW9A 1ZS5A 4UYGA 5EM3A 4A9MA 2YEMA 4Q0NA 5E9MA 5FB1A 4Z6IA 5IBNA 4MEPA 5EPSA 3O35A 5FE5A 4NYVA 4PCIA 5TB6A 4O72A 4TTEA 5FB0A 4HBVA 4CUUA 4NYWA 5F1LA 5DFCA 4X2IA 5HM0A 5LJ0A 5FG6A 5HRWA 4IR5A 5FE0A 4QC1A 4YYKA 4UYDA 5EI4A 5LKUA 4MENA 4UYHA 4Z1QA 4A9EA 2DVRA 4ZW1A 5AMFA 5C87A 2OO1A 4UIYA 5A5RA 5ENGA 3LJWA 5DBMA 5DYXA 5H1UA 5LJ1A 4O7BA 2DVQA 4QZSA 2E7NA 5H1VA 5BT5A 3MB4A 4O77A 4NR7A 3U5OA 4O7CA 5KU3A 5EICA 4O7FA 4WIVA 4O70A 5A85A 5D3PA 5CQ3A 4QB3A 5HQ6A 5C85A 2RS9B 1JSPB 4QYLA 3U5LA 5I1QA 4BW2A 2DATA 4AKNA 4CUTA 5G4SA 4HBXA 2YELA 5E9VA 4QEVA 2OUOA 4CFLA 3LQIA 5IIDA 5EQ1A 4ZQLA 5CQ6A 5DX4A 5LKXA 4GPJA 5EGUA 5HQ5A 3QZVA 4CUPA 3QZSA 2L5EA 5D24A 3U5PA 3U5KA 4IOQA 4BW4A 5DKDA 5EP7A 4NR6A 5F1HA 4TU4A 5A81A 4TQNA 5II1A 4MR4A 5FE9A 2R0YA 4NUCA 5E3DA 5L8UA 5HCLA 4NR8A 4UIUA 3G0LA 4IORA 5I80A 4QSWA 2F6NA 5D3NA 5CS8A 5EK9A 4QEWA 5CTLA 3SVHA 5EWWA 2NXBA 4CUQA 5COIA 2MJVB 2OSSA 5F25A 1N72A 3MUKA 4QYDA 5E9LA 3P1FA 5ENFA 1WUGA 2GRCA 4YYIA 2I8NA 2E7OA 3HMHA 4YYDA 2YYNA 4PS5A 4O76A 5FBXA 4MR5A 5J0DA 4YYMA 5EA1A 4LRGA 4TT4A 4QUTA 4KV1A 3ONIA 5CU8A 4XYAA 3MULA 2WP1A 4HXPA 4NS5A 5IGLA 4UIWA 3LQHA 3UV2A 4MEQA 4O71A 5C8GA 2RNYA 3UV4A 3O34A 4A9JA 4O74A 3RCWA 5CUGA 5CQ7A 3JVKA 3HMEA 1X0JA 5FFVA 5LVRA 4O75A 4J0RA 5CFWA 2L84A 5D3JA 5LKTA 4LZSA 4BW1A 5D26A 5DY7A 3UVWA 5I89A 3O33A 4YADA 4YK0A 4LYIA 4TZ2A 3U5JA 4TT6A 4FLPA 4YATA 4QNSA 4MR3A 3NXBA 5DYCA 4J3IA 3MB3A 5L96A 4CURA 3UVYA 4XY8A 5I88A 4N4FA 5CRZA 4LR6A 4PTBA 3SVGA 4TZ8A 5FE6A 5EV9A 5FE8A 4HXRA 4UIVA 4YBSA 5F2PA 4YBTA 5DW1A 4YYGA 5DYUA 5L8TA 5IG6A 3P1DA 5E9IA 2YQDA 4DONA 4CL9A 5CQ5A 5L97A 5HELA 5C89A 5HRXA 5CUDA 3IU5A
chains in the Genus database with same CATH superfamily
5CQAA 5FFWA 4QC3A 5IGMA 5ENIA 5IGNA 3Q2EA 5D3SA 4LYWA 3HMFA 4QSSA 5D3LA 5F62A 3GG3A 3D7CA 5ENBA 4BHWA 4A9FA 3S92A 5A5QA 4Z93A 2R10A 5EWHA 5EPRA 4CLBA 5A82A 5A5NA 3ERRA 4NRAA 5E74A 3LXJA 5FG5A 3O37A 5D3TA 4A9NA 4HXKA 2I7KA 4OGIA 5E7DA 2G4AA 5CUBA 5DKHA 4QSUA 2YEKA 5KTXA 5EISA 4NUDA 4J1PA 5FFYA 3Q2FA 4Y03A 5A5PA 5E9YA 2RO1A 5DLZA 4HBWA 5D3HA 5A83A 5FE4A 4A9HA 5CY9A 5D7XA 3JVMA 4TYLA 5EWDA 3U5MA 5L99A 4PY6A 4N4GA 5ETBA 4IOOA 5E0RA 1PUOA 5HQ7A 5E3GA 3VKHA 4ZC9A 5D3RA 4IR4A 5HRVA 2D9EA 5CQTA 5FG4A 4QSQA 4LZ2A 4CUSA 4IR6A 5ENEA 5F60A 4OGJA 4CFKA 5KTUA 3AQAA 5JWMA 4UITA 5FE7A 4LYSA 4QUUA 5AMEA 4BJXA 2DWWA 4LC2A 4UYFA 4A9LA 4QSTA 3MXFA 5F63A 4BW3A 2F6JA 4QR5A 5TCMA 3P1EA 5F61A 5CUAA 3IU6A 5D25A 3K2JA 5E9KA 4YC9A 5KTWA 4NRBA 5HEMA 3I3JA 5KHMA 4NQMA 4XY9A 4ALHA 4YYNA 5D0CA 4NRCA 4A9IA 5JI8A 4N4IA 4QR3A 3FKMX 4AKIA 5DFDA 4PCEA 4A9KA 5A5SA 4XUAA 4HXLA 5LUUA 3SVFA 3P5OA 5G4RA 4TU6A 3UVXA 2R0SA 4IR3A 4OUFA 4YY6A 5AD3A 3O36A 2R0VA 4MR6A 5FDZA 5DFBA 5EWCA 5ACYA 4YABA 5C7NA 3P1CA 5I7YA 3ZYUA 5IGKA 4XUBA 5I40A 4HXOA 4KV4A 5FH8A 5HLSA 4A9OA 5DKCA 4O7AA 4HBYA 2YW5A 3AADA 4NR4A 4QY4A 5DLXA 5I86A 5C4QA 5K29A 5EVAA 4N4HA 4NR9A 4PKLA 5FH7A 3LQJA 5HJCA 5ETDA 4O7EA 3U5NA 4UIXA 5CUEA 2D82A 5EPBA 5LJ2A 5HENA 5ENCA 1F68A 4Q0OA 2FSAA 4F3IA 5CP5A 4YY4A 2E3KA 1E6IA 2RNXA 5A5OA 5KO4A 2KTBB 4UIZA 3VKGA 2DKWA 5H1TA 4UYFB 3DWYA 2RNWA 5L98A 5LVQA 4C66A 5ENJA 4Z1SA 4HXSA 5H85A 4YYJA 2N9GA 4QBMA 5CPEA 1WUMA 2RFJA 4Z6HA 2RI7A 4NXJA 3UVDA 4TS8A 4C67A 5AD2A 3UV5A 4E96A 4YH3A 5F3AA 4NUEA 5CQ4A 2YDWA 4HXMA 4MEOA 2WP2A 4NQNA 4TT2A 2DVSA 5I29A 4LZRA 4QSVA 5LKZA 3DAIA 5II2A 3MQMA 5CQ8A 4UYEA 5HFQA 3QZTA 4J0SA 4LDFA 4KCXA 1EQFA 4N3WA 5ENHA 5DYAA 4NR5A 5BT3A 5BT4A 5CGPA 4YYHA 3JVJA 4HXNA 5FE2A 4QSRA 4O78A 1JM4B 5HFRA 2LSPB 4WHWA 5I83A 5FE1A 4RVRA 5DW2A 5E73A 5EU1A 2L85A 4QR4A 4QSXA 3D1DA 5FE3A 3G0JA 5A7CA 5EWVA 4NYXA 4ALGA 2H60A 4QEUA 5CZGA 4YBMA 2DVVA 4QSPA 5I7XA 3S91A 5CUCA 5FH6A 4YH4A 4YAXA 4AI6A 3JVLA 4WHUA 5F5ZA 3TLPA 5CRMA 5F36A 3UW9A 1ZS5A 4UYGA 5EM3A 4A9MA 2YEMA 4Q0NA 5E9MA 4AKGA 5FB1A 4Z6IA 5IBNA 4MEPA 5EPSA 3O35A 5FE5A 4NYVA 4PCIA 5TB6A 4O72A 4TTEA 5FB0A 4HBVA 4CUUA 4NYWA 5F1LA 5DFCA 4X2IA 5HM0A 5LJ0A 5FG6A 5HRWA 4IR5A 5FE0A 4QC1A 4YYKA 4UYDA 5EI4A 5LKUA 4MENA 4UYHA 4Z1QA 4A9EA 2DVRA 4ZW1A 5AMFA 5C87A 2OO1A 4UIYA 5A5RA 5ENGA 3LJWA 5DBMA 5DYXA 5H1UA 5LJ1A 4O7BA 2DVQA 4QZSA 2E7NA 5H1VA 5BT5A 3MB4A 4O77A 4NR7A 3U5OA 4O7CA 5KU3A 5EICA 4O7FA 4WIVA 4O70A 5A85A 5D3PA 5CQ3A 4QB3A 5HQ6A 5C85A 2RS9B 1JSPB 4QYLA 3U5LA 5I1QA 4BW2A 2DATA 4AKNA 4CUTA 5G4SA 4HBXA 2YELA 5E9VA 4QEVA 2OUOA 1ZKRA 4CFLA 3LQIA 5IIDA 5EQ1A 4ZQLA 5CQ6A 5DX4A 5LKXA 4GPJA 5EGUA 5HQ5A 3QZVA 4CUPA 3QZSA 2L5EA 5D24A 3U5PA 3U5KA 2EJNA 4IOQA 4BW4A 4AKHA 5DKDA 5EP7A 4NR6A 5F1HA 4TU4A 5A81A 4TQNA 5II1A 4MR4A 3D1BA 5FE9A 2R0YA 4NUCA 5E3DA 5L8UA 5HCLA 4NR8A 4UIUA 3G0LA 4IORA 5I80A 4QSWA 2F6NA 5D3NA 5CS8A 5EK9A 4QEWA 5CTLA 3SVHA 5EWWA 2NXBA 4CUQA 5COIA 2MJVB 2OSSA 5F25A 1N72A 3MUKA 4QYDA 5E9LA 3P1FA 5ENFA 1WUGA 2GRCA 4YYIA 2I8NA 2E7OA 3HMHA 4YYDA 2YYNA 4PS5A 4O76A 5FBXA 4MR5A 5J0DA 4YYMA 5EA1A 4LRGA 4TT4A 4QUTA 4KV1A 3ONIA 5CU8A 4XYAA 3MULA 2WP1A 4HXPA 4NS5A 5IGLA 4UIWA 3LQHA 3UV2A 4MEQA 4O71A 5C8GA 2RNYA 3UV4A 3O34A 4A9JA 4O74A 3RCWA 5CUGA 5CQ7A 3JVKA 3HMEA 1X0JA 5FFVA 5LVRA 4O75A 4J0RA 5CFWA 2L84A 5D3JA 5LKTA 4LZSA 4BW1A 5D26A 5DY7A 3UVWA 5I89A 3O33A 4YADA 4YK0A 4LYIA 4TZ2A 3U5JA 4TT6A 4FLPA 4YATA 4QNSA 4MR3A 3NXBA 5DYCA 4J3IA 3MB3A 5L96A 4CURA 3UVYA 4XY8A 5I88A 4N4FA 5CRZA 4LR6A 4PTBA 3SVGA 4TZ8A 5FE6A 5EV9A 5FE8A 4HXRA 4UIVA 4YBSA 5F2PA 4YBTA 5DW1A 4YYGA 5DYUA 5L8TA 5IG6A 3P1DA 5E9IA 2YQDA 4DONA 4CL9A 5CQ5A 5L97A 5HELA 5C89A 5HRXA 5CUDA 3IU5A
chains in the Genus database with same CATH topology
5CQAA 5FFWA 4QC3A 5IGMA 5ENIA 5IGNA 3Q2EA 5D3SA 4LYWA 3HMFA 4QSSA 5D3LA 5F62A 3GG3A 3D7CA 5ENBA 4BHWA 4A9FA 3S92A 5A5QA 4Z93A 2R10A 5EWHA 5EPRA 4CLBA 5A82A 5A5NA 4NRAA 5E74A 3LXJA 5FG5A 3O37A 5D3TA 4A9NA 4HXKA 2I7KA 4OGIA 5E7DA 2G4AA 5CUBA 5DKHA 4QSUA 2YEKA 5KTXA 5EISA 4NUDA 4J1PA 5FFYA 3Q2FA 4Y03A 5A5PA 5E9YA 2RO1A 5DLZA 4HBWA 5D3HA 5A83A 5FE4A 4A9HA 5CY9A 5D7XA 3JVMA 4TYLA 5EWDA 3U5MA 5L99A 4PY6A 4N4GA 5ETBA 4IOOA 5E0RA 5HQ7A 5E3GA 4ZC9A 5D3RA 4IR4A 5HRVA 2D9EA 5CQTA 5FG4A 4QSQA 4LZ2A 4CUSA 4IR6A 5ENEA 5F60A 4OGJA 4CFKA 5KTUA 3AQAA 5JWMA 4UITA 5FE7A 4LYSA 4QUUA 5AMEA 4BJXA 2DWWA 4LC2A 4UYFA 4A9LA 4QSTA 3MXFA 5F63A 4BW3A 2F6JA 4QR5A 5TCMA 3P1EA 5F61A 5CUAA 3IU6A 5D25A 3K2JA 5E9KA 4YC9A 5KTWA 4NRBA 5HEMA 3I3JA 5KHMA 4NQMA 4XY9A 4ALHA 4YYNA 5D0CA 4NRCA 4A9IA 5JI8A 4N4IA 4QR3A 3FKMX 5DFDA 4PCEA 4A9KA 5A5SA 4XUAA 4HXLA 5LUUA 3SVFA 3P5OA 5G4RA 4TU6A 3UVXA 2R0SA 4IR3A 4OUFA 4YY6A 5AD3A 3O36A 2R0VA 4MR6A 5FDZA 5DFBA 5EWCA 5ACYA 4YABA 5C7NA 3P1CA 5I7YA 3ZYUA 5IGKA 4XUBA 5I40A 4HXOA 4KV4A 5FH8A 5HLSA 4A9OA 5DKCA 4O7AA 4HBYA 2YW5A 3AADA 4NR4A 4QY4A 5DLXA 5I86A 5C4QA 5K29A 5EVAA 4N4HA 4NR9A 4PKLA 5FH7A 3LQJA 5HJCA 5ETDA 4O7EA 3U5NA 4UIXA 5CUEA 2D82A 5EPBA 5LJ2A 5HENA 5ENCA 1F68A 4Q0OA 2FSAA 4F3IA 5CP5A 4YY4A 2E3KA 1E6IA 2RNXA 5A5OA 5KO4A 2KTBB 4UIZA 2DKWA 5H1TA 4UYFB 3DWYA 2RNWA 5L98A 5LVQA 4C66A 5ENJA 4Z1SA 4HXSA 5H85A 4YYJA 2N9GA 4QBMA 5CPEA 1WUMA 2RFJA 4Z6HA 2RI7A 4NXJA 3UVDA 4TS8A 4C67A 5AD2A 3UV5A 4E96A 4YH3A 5F3AA 4NUEA 5CQ4A 2YDWA 4HXMA 4MEOA 2WP2A 4NQNA 4TT2A 2DVSA 5I29A 4LZRA 4QSVA 5LKZA 3DAIA 5II2A 3MQMA 5CQ8A 4UYEA 5HFQA 3QZTA 4J0SA 4LDFA 4KCXA 1EQFA 4N3WA 5ENHA 5DYAA 4NR5A 5BT3A 5BT4A 5CGPA 4YYHA 3JVJA 4HXNA 5FE2A 4QSRA 4O78A 1JM4B 5HFRA 2LSPB 4WHWA 5I83A 5FE1A 4RVRA 5DW2A 5E73A 5EU1A 2L85A 4QR4A 4QSXA 5FE3A 3G0JA 5A7CA 5EWVA 4NYXA 4ALGA 2H60A 4QEUA 5CZGA 4YBMA 2DVVA 4QSPA 5I7XA 3S91A 5CUCA 5FH6A 4YH4A 4YAXA 3JVLA 4WHUA 5F5ZA 3TLPA 5CRMA 5F36A 3UW9A 1ZS5A 4UYGA 5EM3A 4A9MA 2YEMA 4Q0NA 5E9MA 5FB1A 4Z6IA 5IBNA 4MEPA 5EPSA 3O35A 5FE5A 4NYVA 4PCIA 5TB6A 4O72A 4TTEA 5FB0A 4HBVA 4CUUA 4NYWA 5F1LA 5DFCA 4X2IA 5HM0A 5LJ0A 5FG6A 5HRWA 4IR5A 5FE0A 4QC1A 4YYKA 4UYDA 5EI4A 5LKUA 4MENA 4UYHA 4Z1QA 4A9EA 2DVRA 4ZW1A 5AMFA 5C87A 2OO1A 4UIYA 5A5RA 5ENGA 3LJWA 5DBMA 5DYXA 5H1UA 5LJ1A 4O7BA 2DVQA 4QZSA 2E7NA 5H1VA 5BT5A 3MB4A 4O77A 4NR7A 3U5OA 4O7CA 5KU3A 5EICA 4O7FA 4WIVA 4O70A 5A85A 5D3PA 5CQ3A 4QB3A 5HQ6A 5C85A 2RS9B 1JSPB 4QYLA 3U5LA 5I1QA 4BW2A 2DATA 4AKNA 4CUTA 5G4SA 4HBXA 2YELA 5E9VA 4QEVA 2OUOA 4CFLA 3LQIA 5IIDA 5EQ1A 4ZQLA 5CQ6A 5DX4A 5LKXA 4GPJA 5EGUA 5HQ5A 3QZVA 4CUPA 3QZSA 2L5EA 5D24A 3U5PA 3U5KA 4IOQA 4BW4A 5DKDA 5EP7A 4NR6A 5F1HA 4TU4A 5A81A 4TQNA 5II1A 4MR4A 5FE9A 2R0YA 4NUCA 5E3DA 5L8UA 5HCLA 4NR8A 4UIUA 3G0LA 4IORA 5I80A 4QSWA 2F6NA 5D3NA 5CS8A 5EK9A 4QEWA 5CTLA 3SVHA 5EWWA 2NXBA 4CUQA 5COIA 2MJVB 2OSSA 5F25A 1N72A 3MUKA 4QYDA 5E9LA 3P1FA 5ENFA 1WUGA 2GRCA 4YYIA 2I8NA 2E7OA 3HMHA 4YYDA 2YYNA 4PS5A 4O76A 5FBXA 4MR5A 5J0DA 4YYMA 5EA1A 4LRGA 4TT4A 4QUTA 4KV1A 3ONIA 5CU8A 4XYAA 3MULA 2WP1A 4HXPA 4NS5A 5IGLA 4UIWA 3LQHA 3UV2A 4MEQA 4O71A 5C8GA 2RNYA 3UV4A 3O34A 4A9JA 4O74A 3RCWA 5CUGA 5CQ7A 3JVKA 3HMEA 1X0JA 5FFVA 5LVRA 4O75A 4J0RA 5CFWA 2L84A 5D3JA 5LKTA 4LZSA 4BW1A 5D26A 5DY7A 3UVWA 5I89A 3O33A 4YADA 4YK0A 4LYIA 4TZ2A 3U5JA 4TT6A 4FLPA 4YATA 4QNSA 4MR3A 3NXBA 5DYCA 4J3IA 3MB3A 5L96A 4CURA 3UVYA 4XY8A 5I88A 4N4FA 5CRZA 4LR6A 4PTBA 3SVGA 4TZ8A 5FE6A 5EV9A 5FE8A 4HXRA 4UIVA 4YBSA 5F2PA 4YBTA 5DW1A 4YYGA 5DYUA 5L8TA 5IG6A 3P1DA 5E9IA 2YQDA 4DONA 4CL9A 5CQ5A 5L97A 5HELA 5C89A 5HRXA 5CUDA 3IU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQA A;  5FFW A;  4QC3 A;  5IGM A;  5ENI A;  5IGN A;  3Q2E A;  5D3S A;  4LYW A;  3HMF A;  4QSS A;  5D3L A;  5F62 A;  3GG3 A;  3D7C A;  5ENB A;  4BHW A;  4A9F A;  3S92 A;  5A5Q A;  4Z93 A;  2R10 A;  5EWH A;  5EPR A;  4CLB A;  5A82 A;  5A5N A;  4NRA A;  5E74 A;  3LXJ A;  5FG5 A;  3O37 A;  5D3T A;  4A9N A;  4HXK A;  2I7K A;  4OGI A;  5E7D A;  2G4A A;  5CUB A;  5DKH A;  4QSU A;  2YEK A;  5KTX A;  5EIS A;  4NUD A;  4J1P A;  5FFY A;  3Q2F A;  4Y03 A;  5A5P A;  5E9Y A;  2RO1 A;  5DLZ A;  4HBW A;  5D3H A;  5A83 A;  5FE4 A;  4A9H A;  5CY9 A;  5D7X A;  3JVM A;  4TYL A;  5EWD A;  3U5M A;  5L99 A;  4PY6 A;  4N4G A;  5ETB A;  4IOO A;  5E0R A;  5HQ7 A;  5E3G A;  4ZC9 A;  5D3R A;  4IR4 A;  5HRV A;  2D9E A;  5CQT A;  5FG4 A;  4QSQ A;  4LZ2 A;  4CUS A;  4IR6 A;  5ENE A;  5F60 A;  4OGJ A;  4CFK A;  5KTU A;  3AQA A;  5JWM A;  4UIT A;  5FE7 A;  4LYS A;  4QUU A;  5AME A;  4BJX A;  2DWW A;  4LC2 A;  4UYF A;  4A9L A;  4QST A;  3MXF A;  5F63 A;  4BW3 A;  2F6J A;  4QR5 A;  5TCM A;  3P1E A;  5F61 A;  5CUA A;  3IU6 A;  5D25 A;  3K2J A;  5E9K A;  4YC9 A;  5KTW A;  4NRB A;  5HEM A;  3I3J A;  5KHM A;  4NQM A;  4XY9 A;  4ALH A;  4YYN A;  5D0C A;  4NRC A;  4A9I A;  5JI8 A;  4N4I A;  4QR3 A;  3FKM X;  5DFD A;  4PCE A;  4A9K A;  5A5S A;  4XUA A;  4HXL A;  5LUU A;  3SVF A;  3P5O A;  5G4R A;  4TU6 A;  3UVX A;  2R0S A;  4IR3 A;  4OUF A;  4YY6 A;  5AD3 A;  3O36 A;  2R0V A;  4MR6 A;  5FDZ A;  5DFB A;  5EWC A;  5ACY A;  4YAB A;  5C7N A;  3P1C A;  5I7Y A;  3ZYU A;  5IGK A;  4XUB A;  5I40 A;  4HXO A;  4KV4 A;  5FH8 A;  5HLS A;  4A9O A;  5DKC A;  4O7A A;  4HBY A;  2YW5 A;  3AAD A;  4NR4 A;  4QY4 A;  5DLX A;  5I86 A;  5C4Q A;  5K29 A;  5EVA A;  4N4H A;  4NR9 A;  4PKL A;  5FH7 A;  3LQJ A;  5HJC A;  5ETD A;  4O7E A;  3U5N A;  4UIX A;  5CUE A;  2D82 A;  5EPB A;  5LJ2 A;  5HEN A;  5ENC A;  1F68 A;  4Q0O A;  2FSA A;  4F3I A;  5CP5 A;  4YY4 A;  2E3K A;  1E6I A;  2RNX A;  5A5O A;  5KO4 A;  2KTB B;  4UIZ A;  2DKW A;  5H1T A;  4UYF B;  3DWY A;  2RNW A;  5L98 A;  5LVQ A;  4C66 A;  5ENJ A;  4Z1S A;  4HXS A;  5H85 A;  4YYJ A;  2N9G A;  4QBM A;  5CPE A;  1WUM A;  2RFJ A;  4Z6H A;  2RI7 A;  4NXJ A;  3UVD A;  4TS8 A;  4C67 A;  5AD2 A;  3UV5 A;  4E96 A;  4YH3 A;  5F3A A;  4NUE A;  5CQ4 A;  2YDW A;  4HXM A;  4MEO A;  2WP2 A;  4NQN A;  4TT2 A;  2DVS A;  5I29 A;  4LZR A;  4QSV A;  5LKZ A;  3DAI A;  5II2 A;  3MQM A;  5CQ8 A;  4UYE A;  5HFQ A;  3QZT A;  4J0S A;  4LDF A;  4KCX A;  1EQF A;  4N3W A;  5ENH A;  5DYA A;  4NR5 A;  5BT3 A;  5BT4 A;  5CGP A;  4YYH A;  3JVJ A;  4HXN A;  5FE2 A;  4QSR A;  4O78 A;  1JM4 B;  5HFR A;  2LSP B;  4WHW A;  5I83 A;  5FE1 A;  4RVR A;  5DW2 A;  5E73 A;  5EU1 A;  2L85 A;  4QR4 A;  4QSX A;  5FE3 A;  3G0J A;  5A7C A;  5EWV A;  4NYX A;  4ALG A;  2H60 A;  4QEU A;  5CZG A;  4YBM A;  2DVV A;  4QSP A;  5I7X A;  3S91 A;  5CUC A;  5FH6 A;  4YH4 A;  4YAX A;  3JVL A;  4WHU A;  5F5Z A;  3TLP A;  5CRM A;  5F36 A;  3UW9 A;  1ZS5 A;  4UYG A;  5EM3 A;  4A9M A;  2YEM A;  4Q0N A;  5E9M A;  5FB1 A;  4Z6I A;  5IBN A;  4MEP A;  5EPS A;  3O35 A;  5FE5 A;  4NYV A;  4PCI A;  5TB6 A;  4O72 A;  4TTE A;  5FB0 A;  4HBV A;  4CUU A;  4NYW A;  5F1L A;  5DFC A;  4X2I A;  5HM0 A;  5LJ0 A;  5FG6 A;  5HRW A;  4IR5 A;  5FE0 A;  4QC1 A;  4YYK A;  4UYD A;  5EI4 A;  5LKU A;  4MEN A;  4UYH A;  4Z1Q A;  4A9E A;  2DVR A;  4ZW1 A;  5AMF A;  5C87 A;  2OO1 A;  4UIY A;  5A5R A;  5ENG A;  3LJW A;  5DBM A;  5DYX A;  5H1U A;  5LJ1 A;  4O7B A;  2DVQ A;  4QZS A;  2E7N A;  5H1V A;  5BT5 A;  3MB4 A;  4O77 A;  4NR7 A;  3U5O A;  4O7C A;  5KU3 A;  5EIC A;  4O7F A;  4WIV A;  4O70 A;  5A85 A;  5D3P A;  5CQ3 A;  4QB3 A;  5HQ6 A;  5C85 A;  2RS9 B;  1JSP B;  4QYL A;  3U5L A;  5I1Q A;  4BW2 A;  2DAT A;  4AKN A;  4CUT A;  5G4S A;  4HBX A;  2YEL A;  5E9V A;  4QEV A;  2OUO A;  4CFL A;  3LQI A;  5IID A;  5EQ1 A;  4ZQL A;  5CQ6 A;  5DX4 A;  5LKX A;  4GPJ A;  5EGU A;  5HQ5 A;  3QZV A;  4CUP A;  3QZS A;  2L5E A;  5D24 A;  3U5P A;  3U5K A;  4IOQ A;  4BW4 A;  5DKD A;  5EP7 A;  4NR6 A;  5F1H A;  4TU4 A;  5A81 A;  4TQN A;  5II1 A;  4MR4 A;  5FE9 A;  2R0Y A;  4NUC A;  5E3D A;  5L8U A;  5HCL A;  4NR8 A;  4UIU A;  3G0L A;  4IOR A;  5I80 A;  4QSW A;  2F6N A;  5D3N A;  5CS8 A;  5EK9 A;  4QEW A;  5CTL A;  3SVH A;  5EWW A;  2NXB A;  4CUQ A;  5COI A;  2MJV B;  2OSS A;  5F25 A;  1N72 A;  3MUK A;  4QYD A;  5E9L A;  3P1F A;  5ENF A;  1WUG A;  2GRC A;  4YYI A;  2I8N A;  2E7O A;  3HMH A;  4YYD A;  2YYN A;  4PS5 A;  4O76 A;  5FBX A;  4MR5 A;  5J0D A;  4YYM A;  5EA1 A;  4LRG A;  4TT4 A;  4QUT A;  4KV1 A;  3ONI A;  5CU8 A;  4XYA A;  3MUL A;  2WP1 A;  4HXP A;  4NS5 A;  5IGL A;  4UIW A;  3LQH A;  3UV2 A;  4MEQ A;  4O71 A;  5C8G A;  2RNY A;  3UV4 A;  3O34 A;  4A9J A;  4O74 A;  3RCW A;  5CUG A;  5CQ7 A;  3JVK A;  3HME A;  1X0J A;  5FFV A;  5LVR A;  4O75 A;  4J0R A;  5CFW A;  2L84 A;  5D3J A;  5LKT A;  4LZS A;  4BW1 A;  5D26 A;  5DY7 A;  3UVW A;  5I89 A;  3O33 A;  4YAD A;  4YK0 A;  4LYI A;  4TZ2 A;  3U5J A;  4TT6 A;  4FLP A;  4YAT A;  4QNS A;  4MR3 A;  3NXB A;  5DYC A;  4J3I A;  3MB3 A;  5L96 A;  4CUR A;  3UVY A;  4XY8 A;  5I88 A;  4N4F A;  5CRZ A;  4LR6 A;  4PTB A;  3SVG A;  4TZ8 A;  5FE6 A;  5EV9 A;  5FE8 A;  4HXR A;  4UIV A;  4YBS A;  5F2P A;  4YBT A;  5DW1 A;  4YYG A;  5DYU A;  5L8T A;  5IG6 A;  3P1D A;  5E9I A;  2YQD A;  4DON A;  4CL9 A;  5CQ5 A;  5L97 A;  5HEL A;  5C89 A;  5HRX A;  5CUD A;  3IU5 A; 
#chains in the Genus database with same CATH topology
 5CQA A;  5FFW A;  4QC3 A;  5IGM A;  5ENI A;  5IGN A;  3Q2E A;  5D3S A;  4LYW A;  3HMF A;  4QSS A;  5D3L A;  5F62 A;  3GG3 A;  3D7C A;  5ENB A;  4BHW A;  4A9F A;  3S92 A;  5A5Q A;  4Z93 A;  2R10 A;  5EWH A;  5EPR A;  4CLB A;  5A82 A;  5A5N A;  3ERR A;  4NRA A;  5E74 A;  3LXJ A;  5FG5 A;  3O37 A;  5D3T A;  4A9N A;  4HXK A;  2I7K A;  4OGI A;  5E7D A;  2G4A A;  5CUB A;  5DKH A;  4QSU A;  2YEK A;  5KTX A;  5EIS A;  4NUD A;  4J1P A;  5FFY A;  3Q2F A;  4Y03 A;  5A5P A;  5E9Y A;  2RO1 A;  5DLZ A;  4HBW A;  5D3H A;  5A83 A;  5FE4 A;  4A9H A;  5CY9 A;  5D7X A;  3JVM A;  4TYL A;  5EWD A;  3U5M A;  5L99 A;  4PY6 A;  4N4G A;  5ETB A;  4IOO A;  5E0R A;  1PUO A;  5HQ7 A;  5E3G A;  3VKH A;  4ZC9 A;  5D3R A;  4IR4 A;  5HRV A;  2D9E A;  5CQT A;  5FG4 A;  4QSQ A;  4LZ2 A;  4CUS A;  4IR6 A;  5ENE A;  5F60 A;  4OGJ A;  4CFK A;  5KTU A;  3AQA A;  5JWM A;  4UIT A;  5FE7 A;  4LYS A;  4QUU A;  5AME A;  4BJX A;  2DWW A;  4LC2 A;  4UYF A;  4A9L A;  4QST A;  3MXF A;  5F63 A;  4BW3 A;  2F6J A;  4QR5 A;  5TCM A;  3P1E A;  5F61 A;  5CUA A;  3IU6 A;  5D25 A;  3K2J A;  5E9K A;  4YC9 A;  5KTW A;  4NRB A;  5HEM A;  3I3J A;  5KHM A;  4NQM A;  4XY9 A;  4ALH A;  4YYN A;  5D0C A;  4NRC A;  4A9I A;  5JI8 A;  4N4I A;  4QR3 A;  3FKM X;  4AKI A;  5DFD A;  4PCE A;  4A9K A;  5A5S A;  4XUA A;  4HXL A;  5LUU A;  3SVF A;  3P5O A;  5G4R A;  4TU6 A;  3UVX A;  2R0S A;  4IR3 A;  4OUF A;  4YY6 A;  5AD3 A;  3O36 A;  2R0V A;  4MR6 A;  5FDZ A;  5DFB A;  5EWC A;  5ACY A;  4YAB A;  5C7N A;  3P1C A;  5I7Y A;  3ZYU A;  5IGK A;  4XUB A;  5I40 A;  4HXO A;  4KV4 A;  5FH8 A;  5HLS A;  4A9O A;  5DKC A;  4O7A A;  4HBY A;  2YW5 A;  3AAD A;  4NR4 A;  4QY4 A;  5DLX A;  5I86 A;  5C4Q A;  5K29 A;  5EVA A;  4N4H A;  4NR9 A;  4PKL A;  5FH7 A;  3LQJ A;  5HJC A;  5ETD A;  4O7E A;  3U5N A;  4UIX A;  5CUE A;  2D82 A;  5EPB A;  5LJ2 A;  5HEN A;  5ENC A;  1F68 A;  4Q0O A;  2FSA A;  4F3I A;  5CP5 A;  4YY4 A;  2E3K A;  1E6I A;  2RNX A;  5A5O A;  5KO4 A;  2KTB B;  4UIZ A;  3VKG A;  2DKW A;  5H1T A;  4UYF B;  3DWY A;  2RNW A;  5L98 A;  5LVQ A;  4C66 A;  5ENJ A;  4Z1S A;  4HXS A;  5H85 A;  4YYJ A;  2N9G A;  4QBM A;  5CPE A;  1WUM A;  2RFJ A;  4Z6H A;  2RI7 A;  4NXJ A;  3UVD A;  4TS8 A;  4C67 A;  5AD2 A;  3UV5 A;  4E96 A;  4YH3 A;  5F3A A;  4NUE A;  5CQ4 A;  2YDW A;  4HXM A;  4MEO A;  2WP2 A;  4NQN A;  4TT2 A;  2DVS A;  5I29 A;  4LZR A;  4QSV A;  5LKZ A;  3DAI A;  5II2 A;  3MQM A;  5CQ8 A;  4UYE A;  5HFQ A;  3QZT A;  4J0S A;  4LDF A;  4KCX A;  1EQF A;  4N3W A;  5ENH A;  5DYA A;  4NR5 A;  5BT3 A;  5BT4 A;  5CGP A;  4YYH A;  3JVJ A;  4HXN A;  5FE2 A;  4QSR A;  4O78 A;  1JM4 B;  5HFR A;  2LSP B;  4WHW A;  5I83 A;  5FE1 A;  4RVR A;  5DW2 A;  5E73 A;  5EU1 A;  2L85 A;  4QR4 A;  4QSX A;  3D1D A;  5FE3 A;  3G0J A;  5A7C A;  5EWV A;  4NYX A;  4ALG A;  2H60 A;  4QEU A;  5CZG A;  4YBM A;  2DVV A;  4QSP A;  5I7X A;  3S91 A;  5CUC A;  5FH6 A;  4YH4 A;  4YAX A;  4AI6 A;  3JVL A;  4WHU A;  5F5Z A;  3TLP A;  5CRM A;  5F36 A;  3UW9 A;  1ZS5 A;  4UYG A;  5EM3 A;  4A9M A;  2YEM A;  4Q0N A;  5E9M A;  4AKG A;  5FB1 A;  4Z6I A;  5IBN A;  4MEP A;  5EPS A;  3O35 A;  5FE5 A;  4NYV A;  4PCI A;  5TB6 A;  4O72 A;  4TTE A;  5FB0 A;  4HBV A;  4CUU A;  4NYW A;  5F1L A;  5DFC A;  4X2I A;  5HM0 A;  5LJ0 A;  5FG6 A;  5HRW A;  4IR5 A;  5FE0 A;  4QC1 A;  4YYK A;  4UYD A;  5EI4 A;  5LKU A;  4MEN A;  4UYH A;  4Z1Q A;  4A9E A;  2DVR A;  4ZW1 A;  5AMF A;  5C87 A;  2OO1 A;  4UIY A;  5A5R A;  5ENG A;  3LJW A;  5DBM A;  5DYX A;  5H1U A;  5LJ1 A;  4O7B A;  2DVQ A;  4QZS A;  2E7N A;  5H1V A;  5BT5 A;  3MB4 A;  4O77 A;  4NR7 A;  3U5O A;  4O7C A;  5KU3 A;  5EIC A;  4O7F A;  4WIV A;  4O70 A;  5A85 A;  5D3P A;  5CQ3 A;  4QB3 A;  5HQ6 A;  5C85 A;  2RS9 B;  1JSP B;  4QYL A;  3U5L A;  5I1Q A;  4BW2 A;  2DAT A;  4AKN A;  4CUT A;  5G4S A;  4HBX A;  2YEL A;  5E9V A;  4QEV A;  2OUO A;  1ZKR A;  4CFL A;  3LQI A;  5IID A;  5EQ1 A;  4ZQL A;  5CQ6 A;  5DX4 A;  5LKX A;  4GPJ A;  5EGU A;  5HQ5 A;  3QZV A;  4CUP A;  3QZS A;  2L5E A;  5D24 A;  3U5P A;  3U5K A;  2EJN A;  4IOQ A;  4BW4 A;  4AKH A;  5DKD A;  5EP7 A;  4NR6 A;  5F1H A;  4TU4 A;  5A81 A;  4TQN A;  5II1 A;  4MR4 A;  3D1B A;  5FE9 A;  2R0Y A;  4NUC A;  5E3D A;  5L8U A;  5HCL A;  4NR8 A;  4UIU A;  3G0L A;  4IOR A;  5I80 A;  4QSW A;  2F6N A;  5D3N A;  5CS8 A;  5EK9 A;  4QEW A;  5CTL A;  3SVH A;  5EWW A;  2NXB A;  4CUQ A;  5COI A;  2MJV B;  2OSS A;  5F25 A;  1N72 A;  3MUK A;  4QYD A;  5E9L A;  3P1F A;  5ENF A;  1WUG A;  2GRC A;  4YYI A;  2I8N A;  2E7O A;  3HMH A;  4YYD A;  2YYN A;  4PS5 A;  4O76 A;  5FBX A;  4MR5 A;  5J0D A;  4YYM A;  5EA1 A;  4LRG A;  4TT4 A;  4QUT A;  4KV1 A;  3ONI A;  5CU8 A;  4XYA A;  3MUL A;  2WP1 A;  4HXP A;  4NS5 A;  5IGL A;  4UIW A;  3LQH A;  3UV2 A;  4MEQ A;  4O71 A;  5C8G A;  2RNY A;  3UV4 A;  3O34 A;  4A9J A;  4O74 A;  3RCW A;  5CUG A;  5CQ7 A;  3JVK A;  3HME A;  1X0J A;  5FFV A;  5LVR A;  4O75 A;  4J0R A;  5CFW A;  2L84 A;  5D3J A;  5LKT A;  4LZS A;  4BW1 A;  5D26 A;  5DY7 A;  3UVW A;  5I89 A;  3O33 A;  4YAD A;  4YK0 A;  4LYI A;  4TZ2 A;  3U5J A;  4TT6 A;  4FLP A;  4YAT A;  4QNS A;  4MR3 A;  3NXB A;  5DYC A;  4J3I A;  3MB3 A;  5L96 A;  4CUR A;  3UVY A;  4XY8 A;  5I88 A;  4N4F A;  5CRZ A;  4LR6 A;  4PTB A;  3SVG A;  4TZ8 A;  5FE6 A;  5EV9 A;  5FE8 A;  4HXR A;  4UIV A;  4YBS A;  5F2P A;  4YBT A;  5DW1 A;  4YYG A;  5DYU A;  5L8T A;  5IG6 A;  3P1D A;  5E9I A;  2YQD A;  4DON A;  4CL9 A;  5CQ5 A;  5L97 A;  5HEL A;  5C89 A;  5HRX A;  5CUD A;  3IU5 A; 
#chains in the Genus database with same CATH homology
 5CQA A;  5FFW A;  4QC3 A;  5IGM A;  5ENI A;  5IGN A;  3Q2E A;  5D3S A;  4LYW A;  3HMF A;  4QSS A;  5D3L A;  5F62 A;  3GG3 A;  3D7C A;  5ENB A;  4BHW A;  4A9F A;  3S92 A;  5A5Q A;  4Z93 A;  2R10 A;  5EWH A;  5EPR A;  4CLB A;  5A82 A;  5A5N A;  4NRA A;  5E74 A;  3LXJ A;  5FG5 A;  3O37 A;  5D3T A;  4A9N A;  4HXK A;  2I7K A;  4OGI A;  5E7D A;  2G4A A;  5CUB A;  5DKH A;  4QSU A;  2YEK A;  5KTX A;  5EIS A;  4NUD A;  4J1P A;  5FFY A;  3Q2F A;  4Y03 A;  5A5P A;  5E9Y A;  2RO1 A;  5DLZ A;  4HBW A;  5D3H A;  5A83 A;  5FE4 A;  4A9H A;  5CY9 A;  5D7X A;  3JVM A;  4TYL A;  5EWD A;  3U5M A;  5L99 A;  4PY6 A;  4N4G A;  5ETB A;  4IOO A;  5E0R A;  5HQ7 A;  5E3G A;  4ZC9 A;  5D3R A;  4IR4 A;  5HRV A;  2D9E A;  5CQT A;  5FG4 A;  4QSQ A;  4LZ2 A;  4CUS A;  4IR6 A;  5ENE A;  5F60 A;  4OGJ A;  4CFK A;  5KTU A;  3AQA A;  5JWM A;  4UIT A;  5FE7 A;  4LYS A;  4QUU A;  5AME A;  4BJX A;  2DWW A;  4LC2 A;  4UYF A;  4A9L A;  4QST A;  3MXF A;  5F63 A;  4BW3 A;  2F6J A;  4QR5 A;  5TCM A;  3P1E A;  5F61 A;  5CUA A;  3IU6 A;  5D25 A;  3K2J A;  5E9K A;  4YC9 A;  5KTW A;  4NRB A;  5HEM A;  3I3J A;  5KHM A;  4NQM A;  4XY9 A;  4ALH A;  4YYN A;  5D0C A;  4NRC A;  4A9I A;  5JI8 A;  4N4I A;  4QR3 A;  3FKM X;  5DFD A;  4PCE A;  4A9K A;  5A5S A;  4XUA A;  4HXL A;  5LUU A;  3SVF A;  3P5O A;  5G4R A;  4TU6 A;  3UVX A;  2R0S A;  4IR3 A;  4OUF A;  4YY6 A;  5AD3 A;  3O36 A;  2R0V A;  4MR6 A;  5FDZ A;  5DFB A;  5EWC A;  5ACY A;  4YAB A;  5C7N A;  3P1C A;  5I7Y A;  3ZYU A;  5IGK A;  4XUB A;  5I40 A;  4HXO A;  4KV4 A;  5FH8 A;  5HLS A;  4A9O A;  5DKC A;  4O7A A;  4HBY A;  2YW5 A;  3AAD A;  4NR4 A;  4QY4 A;  5DLX A;  5I86 A;  5C4Q A;  5K29 A;  5EVA A;  4N4H A;  4NR9 A;  4PKL A;  5FH7 A;  3LQJ A;  5HJC A;  5ETD A;  4O7E A;  3U5N A;  4UIX A;  5CUE A;  2D82 A;  5EPB A;  5LJ2 A;  5HEN A;  5ENC A;  1F68 A;  4Q0O A;  2FSA A;  4F3I A;  5CP5 A;  4YY4 A;  2E3K A;  1E6I A;  2RNX A;  5A5O A;  5KO4 A;  2KTB B;  4UIZ A;  2DKW A;  5H1T A;  4UYF B;  3DWY A;  2RNW A;  5L98 A;  5LVQ A;  4C66 A;  5ENJ A;  4Z1S A;  4HXS A;  5H85 A;  4YYJ A;  2N9G A;  4QBM A;  5CPE A;  1WUM A;  2RFJ A;  4Z6H A;  2RI7 A;  4NXJ A;  3UVD A;  4TS8 A;  4C67 A;  5AD2 A;  3UV5 A;  4E96 A;  4YH3 A;  5F3A A;  4NUE A;  5CQ4 A;  2YDW A;  4HXM A;  4MEO A;  2WP2 A;  4NQN A;  4TT2 A;  2DVS A;  5I29 A;  4LZR A;  4QSV A;  5LKZ A;  3DAI A;  5II2 A;  3MQM A;  5CQ8 A;  4UYE A;  5HFQ A;  3QZT A;  4J0S A;  4LDF A;  4KCX A;  1EQF A;  4N3W A;  5ENH A;  5DYA A;  4NR5 A;  5BT3 A;  5BT4 A;  5CGP A;  4YYH A;  3JVJ A;  4HXN A;  5FE2 A;  4QSR A;  4O78 A;  1JM4 B;  5HFR A;  2LSP B;  4WHW A;  5I83 A;  5FE1 A;  4RVR A;  5DW2 A;  5E73 A;  5EU1 A;  2L85 A;  4QR4 A;  4QSX A;  5FE3 A;  3G0J A;  5A7C A;  5EWV A;  4NYX A;  4ALG A;  2H60 A;  4QEU A;  5CZG A;  4YBM A;  2DVV A;  4QSP A;  5I7X A;  3S91 A;  5CUC A;  5FH6 A;  4YH4 A;  4YAX A;  3JVL A;  4WHU A;  5F5Z A;  3TLP A;  5CRM A;  5F36 A;  3UW9 A;  1ZS5 A;  4UYG A;  5EM3 A;  4A9M A;  2YEM A;  4Q0N A;  5E9M A;  5FB1 A;  4Z6I A;  5IBN A;  4MEP A;  5EPS A;  3O35 A;  5FE5 A;  4NYV A;  4PCI A;  5TB6 A;  4O72 A;  4TTE A;  5FB0 A;  4HBV A;  4CUU A;  4NYW A;  5F1L A;  5DFC A;  4X2I A;  5HM0 A;  5LJ0 A;  5FG6 A;  5HRW A;  4IR5 A;  5FE0 A;  4QC1 A;  4YYK A;  4UYD A;  5EI4 A;  5LKU A;  4MEN A;  4UYH A;  4Z1Q A;  4A9E A;  2DVR A;  4ZW1 A;  5AMF A;  5C87 A;  2OO1 A;  4UIY A;  5A5R A;  5ENG A;  3LJW A;  5DBM A;  5DYX A;  5H1U A;  5LJ1 A;  4O7B A;  2DVQ A;  4QZS A;  2E7N A;  5H1V A;  5BT5 A;  3MB4 A;  4O77 A;  4NR7 A;  3U5O A;  4O7C A;  5KU3 A;  5EIC A;  4O7F A;  4WIV A;  4O70 A;  5A85 A;  5D3P A;  5CQ3 A;  4QB3 A;  5HQ6 A;  5C85 A;  2RS9 B;  1JSP B;  4QYL A;  3U5L A;  5I1Q A;  4BW2 A;  2DAT A;  4AKN A;  4CUT A;  5G4S A;  4HBX A;  2YEL A;  5E9V A;  4QEV A;  2OUO A;  4CFL A;  3LQI A;  5IID A;  5EQ1 A;  4ZQL A;  5CQ6 A;  5DX4 A;  5LKX A;  4GPJ A;  5EGU A;  5HQ5 A;  3QZV A;  4CUP A;  3QZS A;  2L5E A;  5D24 A;  3U5P A;  3U5K A;  4IOQ A;  4BW4 A;  5DKD A;  5EP7 A;  4NR6 A;  5F1H A;  4TU4 A;  5A81 A;  4TQN A;  5II1 A;  4MR4 A;  5FE9 A;  2R0Y A;  4NUC A;  5E3D A;  5L8U A;  5HCL A;  4NR8 A;  4UIU A;  3G0L A;  4IOR A;  5I80 A;  4QSW A;  2F6N A;  5D3N A;  5CS8 A;  5EK9 A;  4QEW A;  5CTL A;  3SVH A;  5EWW A;  2NXB A;  4CUQ A;  5COI A;  2MJV B;  2OSS A;  5F25 A;  1N72 A;  3MUK A;  4QYD A;  5E9L A;  3P1F A;  5ENF A;  1WUG A;  2GRC A;  4YYI A;  2I8N A;  2E7O A;  3HMH A;  4YYD A;  2YYN A;  4PS5 A;  4O76 A;  5FBX A;  4MR5 A;  5J0D A;  4YYM A;  5EA1 A;  4LRG A;  4TT4 A;  4QUT A;  4KV1 A;  3ONI A;  5CU8 A;  4XYA A;  3MUL A;  2WP1 A;  4HXP A;  4NS5 A;  5IGL A;  4UIW A;  3LQH A;  3UV2 A;  4MEQ A;  4O71 A;  5C8G A;  2RNY A;  3UV4 A;  3O34 A;  4A9J A;  4O74 A;  3RCW A;  5CUG A;  5CQ7 A;  3JVK A;  3HME A;  1X0J A;  5FFV A;  5LVR A;  4O75 A;  4J0R A;  5CFW A;  2L84 A;  5D3J A;  5LKT A;  4LZS A;  4BW1 A;  5D26 A;  5DY7 A;  3UVW A;  5I89 A;  3O33 A;  4YAD A;  4YK0 A;  4LYI A;  4TZ2 A;  3U5J A;  4TT6 A;  4FLP A;  4YAT A;  4QNS A;  4MR3 A;  3NXB A;  5DYC A;  4J3I A;  3MB3 A;  5L96 A;  4CUR A;  3UVY A;  4XY8 A;  5I88 A;  4N4F A;  5CRZ A;  4LR6 A;  4PTB A;  3SVG A;  4TZ8 A;  5FE6 A;  5EV9 A;  5FE8 A;  4HXR A;  4UIV A;  4YBS A;  5F2P A;  4YBT A;  5DW1 A;  4YYG A;  5DYU A;  5L8T A;  5IG6 A;  3P1D A;  5E9I A;  2YQD A;  4DON A;  4CL9 A;  5CQ5 A;  5L97 A;  5HEL A;  5C89 A;  5HRX A;  5CUD A;  3IU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...