5ABQA

Crystal structure analysis of fungal versatile peroxidase from pleurotus eryngii. mutant vpi-ss. mutated residues t2k, a49c, a61c, d69s, t70d, s86e, a131k, d146t, q202l, q219k, h232e, q239r, l288r, s301k, a308r,a309k and a314r.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
312
structure length
312
Chain Sequence
CDDGRTTANAACCILFPILDDIQENLFDGAQCGEEVHESLRLTFHDCIGFSPTLGGGGCDGSIIAFSDIETNFPANAGIDEIVEAQKPFVAKHNISAGDFIQFAGAVGVSNCPGGVRIPFFLGRPDAVKASPDHLVPEPFDSVTSILARMGDAGFSPVEVVWLLASHSIAAADKVDPSIPGTPFDSTPGVFDSQFFIETLLKGRLFPGTADNKGEAQSPLQGEIRLQSDELLARDPRTACEWQSMVNNQPKIQNRFAATMSKMALLGQDKTKLIDCSDVIPTPPALVGAAHLPAGFSLKDVEQACRKTPFPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Improving the Ph-Stability of Versatile Peroxidase by Comparative Structural Analysis with a Naturally-Stable Manganese Peroxidase.
pubmed doi rcsb
molecule keywords VERSATILE PEROXIDASE
molecule tags Oxidoreductase
source organism Pleurotus eryngii
total genus 90
structure length 312
sequence length 312
ec nomenclature ec 1.11.1.16: Versatile peroxidase.
pdb deposition date 2015-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00141 peroxidase Peroxidase
A PF11895 Peroxidase_ext Fungal peroxidase extension region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.420.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 2 Peroxidase, domain 2 5abqA02
1.10.520.10 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 5abqA01
1AEEA 5SW5A 1ZBYA 4NVJB 2RC1X 5FNBA 4A7MA 1H58A 1SBMA 1AETA 5FNEA 1HSRA 2EURA 2GHCX 4NVMB 1AEKA 3RRWA 3CCXA 5KSKA 4FCSA 4CVIA 1GWUA 1CCLA 5SYYA 4XV8A 5KQ6A 2CL4X 4CZRA 2XIFA 4JM9A 5KQ2A 1BEMA 2VCFX 2XJ5A 5SYVA 2CCDA 2EUTA 4NFGA 3FMUA 1OAGA 1LY9A 3M26A 1DS4A 5SXTA 5CIGA 4NVKB 2WD4A 2E3AA 4JPUA 5SX0A 3Q3UA 2EUUA 3M23A 1BEQA 4FCNA 6ATJA 2JTIA 1YYDA 5ALAA 5SYHA 2CCPA 5SYUA 1YZRA 1FHFA 1H5FA 1AEBA 2YCGA 4NVCA 4XV6A 1CCEA 4FEFA 5CIEA 1CMPA 3M2CA 2E3BA 2AS2A 4JMAA 1QO4A 5AMMA 5SW4A 4JQKA 1CCPA 2GHDX 3M2FA 3M2HA 1ATJA 4JMZA 5CIDA 1AEVA 3VLHA 1LLPA 2E39A 1H5GA 1GWTA 3M27A 1B80A 1H5DA 3M2EA 4JMSA 5CIFA 1AA4A 2V23A 4XV4A 4BM4A 1H3JA 5SYXA 4JQNA 1AEJA 1H55A 1CCCA 4JM8A 4A5GA 2AS3A 4A78A 1GW2A 3FM1A 1ARYA 1STQA 1YYGA 1U2KA 4JB4A 1S6VA 5L05A 4BLXA 2CYPA 4JQMA 4BLYA 1GZAA 4CZPA 4CZOA 2GHKX 1S73A 3E2NA 5KQIA 2B0ZA 4NVEA 5L02A 3FM6A 1CPDA 1AEDA 1H5CA 1KRJA 3UW8A 2RC0X 3X16A 4G05A 1U2JA 5SX7A 1ARXA 4NVBA 1AEUA 1YZPA 1CK6A 5D6MA 3RIVA 1H5EA 1SDQA 5CIBA 4BLLA 1BEPA 1DSGA 3M8MA 3ZCYA 4A6ZA 5AL9A 1V0HX 1SJ2A 4JMWA 3WNUA 1ARPA 2RBTX 2EUSA 4BLNA 2RBWX 1MKRA 2EUPA 4NVAA 1MK8A 4XVAA 5CCPA 1SCHA 5SYLA 1ARVA 4CZQA 3RIWA 5ABQA 4NVDA 6CCPA 4XV7A 1GZBA 2Y6BA 3VLJA 1W4WA 4JMTA 1KXMA 5SX6A 1BESA 2EUQA 4C50A 2RBXX 1A2FA 5KSFA 4CVJA 1RYCA 2N18A 1H5KA 4BLZA 2X07A 1ARWA 3WXOA 2RBUX 2GHHX 1B82A 2XIHA 5SXSA 1U75A 2RBZX 4NVIB 4C51A 2ICVA 2XJ6A 4NVNB 3HDLA 1H57A 3VLIA 5KQKA 1UB2A 5AOGA 5SXRA 3M2GA 2RBVX 4NVHB 1DJ1A 4OQ7A 3CCPA 5CJHA 3EXBA 2BOQA 1AEMA 3R99A 1ML2A 3M2IA 1APXA 1CPEA 5CIHA 1SOGA 1MN1A 2ANZA 2VKAA 1AC8A 4BM2A 4JMVA 7ATJA 3M28A 2VNXX 1OAFA 4P4QA 1A2GA 4JPTA 1CCJA 4BM1A 2VO2X 3ATJA 3FM4A 2CCAA 5EJXA 3UT2A 5JHZA 4NVOB 1AC4A 1DSEA 4JN0A 1AENA 2ATJA 1CMTA 4BM3A 4USCA 4JMBA 1LY8A 2V2EA 2GHEX 4NVLA 5SXQA 2Y5AA 2B11A 3E2OA 4NVGB 1H5MA 2B12A 3R98A 4CZNA 5KQ0A 5KQHA 5JHYA 1CPFA 5CICA 1CMUA 2AS4A 1W4YA 3M2BA 2EUNA 3ZCHA 4JM5A 1GX2A 5SXWA 1H5LA 4CCPA 4FDQA 3FKGA 1BVAA 4GEDA 1CPGA 1JCIA 2AS1A 2VCSA 1AEGA 1MN2A 1BJ9A 5SYKA 2GB8A 4XV5A 4BLKA 5SYJA 1CCKA 2GGNX 1C8IA 1IYNA 1CCGA 1U74A 1QPAA 1ZBZA 4JM6A 1EBEA 1ITKA 1MKQA 1KXNA 2EUOA 2YLJA 1U2LA 5KQ3A 1ARUA 3FJWA 1MNPA 5SXXA 5SX0B 2Y6AA 2XILA 5ABOA 4JPLA 3VLLA 5SX1A 4JQJA 2W23A 5L86A 1HCHA 3M5QA 3ZCGA 1DSPA 5JHXA 1JDRA 5JPRA 4PAEA 5ABNA 5SW6A 1LYKA 1H5JA 4A71A 2VNZX 3M29A 2XJ8A 3VLKA 5SYIA 2PCCA 1H5IA 2CEPA 1AESA 1AEHA 1AEFA 1BEJA 2VCNA 1PA2A 1KZMA 1CCBA 2RBYX 2X08A 2AQDA 5EJTA 1H5AA 1AEOA 5SYWA 1DCCA 4NVFA 1CCAA 1AEQA 1BGPA 1QGJA 1Z53A 2AS6A 7CCPA 3M25A 4ATJA 1GWOA 3VLMA 4CCXA 3M2AA 5SX3A 2XI6A 5SX2A 1DJ5A 4BM0A 1CCIA 4CUOA 1CYFA 1LGAA 1BEKA 3M2DA 2PCBA 5JQRA 1LYCA 1DSOA 2B10A 1B85A 1CMQA 2BCNA 2RC2X 2IA8A 1H5HA 1KOKA
chains in the Genus database with same CATH superfamily
1AEEA 5SW5A 1ZBYA 4NVJB 2RC1X 5FNBA 4A7MA 1H58A 1SBMA 1AETA 5FNEA 1HSRA 2EURA 2GHCX 4NVMB 1AEKA 3RRWA 3CCXA 5KSKA 4FCSA 4CVIA 1GWUA 1CCLA 5SYYA 4XV8A 5KQ6A 2CL4X 4CZRA 2XIFA 4JM9A 5KQ2A 1BEMA 2VCFX 2XJ5A 5SYVA 2CCDA 2EUTA 4NFGA 3FMUA 1OAGA 1LY9A 3M26A 1DS4A 5SXTA 5CIGA 4NVKB 2WD4A 2E3AA 4JPUA 5SX0A 3Q3UA 2EUUA 3M23A 1BEQA 4FCNA 6ATJA 2JTIA 1YYDA 5ALAA 5SYHA 2CCPA 5SYUA 1YZRA 1FHFA 1H5FA 1AEBA 2YCGA 4NVCA 4XV6A 1CCEA 4FEFA 5CIEA 1CMPA 3M2CA 2E3BA 2AS2A 4JMAA 1QO4A 4H79A 5AMMA 5SW4A 4JQKA 1CCPA 2GHDX 3M2FA 3M2HA 1ATJA 4JMZA 5CIDA 1AEVA 3VLHA 1LLPA 2E39A 1H5GA 1GWTA 3M27A 1B80A 1H5DA 3M2EA 4JMSA 5CIFA 1AA4A 2V23A 4XV4A 4BM4A 1H3JA 5SYXA 4JQNA 1AEJA 1H55A 1CCCA 4JM8A 4A5GA 2AS3A 4A78A 1GW2A 3FM1A 1ARYA 1STQA 1YYGA 1U2KA 4JB4A 1S6VA 5L05A 4BLXA 2CYPA 4JQMA 4BLYA 1GZAA 4CZPA 4CZOA 2GHKX 1S73A 3E2NA 5KQIA 2B0ZA 4NVEA 5L02A 3FM6A 1CPDA 1AEDA 1H5CA 1KRJA 3UW8A 2RC0X 2JMXA 3X16A 4G05A 1U2JA 5SX7A 1ARXA 4NVBA 1AEUA 1YZPA 1CK6A 5D6MA 3RIVA 1H5EA 1SDQA 5CIBA 4BLLA 1BEPA 1DSGA 3M8MA 3ZCYA 4A6ZA 5AL9A 1V0HX 1SJ2A 4JMWA 4U7UB 3WNUA 1ARPA 2RBTX 2EUSA 4BLNA 2RBWX 1MKRA 2EUPA 4NVAA 1MK8A 4XVAA 5CCPA 1SCHA 5SYLA 2ZCAA 1ARVA 2WSSS 4CZQA 3RIWA 5ABQA 4NVDA 6CCPA 4XV7A 1GZBA 2Y6BA 3VLJA 1W4WA 4JMTA 1KXMA 5SX6A 1BESA 2EUQA 4C50A 2RBXX 1A2FA 5KSFA 4CVJA 1RYCA 2N18A 1H5KA 4BLZA 2X07A 1ARWA 3WXOA 2RBUX 2GHHX 1B82A 2XIHA 5SXSA 1U75A 2RBZX 4NVIB 4C51A 2ICVA 2XJ6A 4NVNB 5H9EB 3HDLA 1H57A 3VLIA 5KQKA 1UB2A 5AOGA 5SXRA 3M2GA 2RBVX 4NVHB 1DJ1A 4OQ7A 3CCPA 5CJHA 3EXBA 2BOQA 1AEMA 3R99A 1ML2A 3M2IA 1APXA 1CPEA 5CIHA 1SOGA 1MN1A 2ANZA 2VKAA 2OEBA 1AC8A 4BM2A 4JMVA 7ATJA 3M28A 2VNXX 1OAFA 4P4QA 1A2GA 4JPTA 1CCJA 4BM1A 2VO2X 3ATJA 3FM4A 2CCAA 5EJXA 3UT2A 5JHZA 4NVOB 1AC4A 1DSEA 4JN0A 1AENA 2ATJA 1CMTA 4BM3A 4USCA 4JMBA 1LY8A 2V2EA 2GHEX 4NVLA 5SXQA 2Y5AA 5CD4J 2B11A 3E2OA 4NVGB 1H5MA 2B12A 3R98A 4CZNA 5KQ0A 5KQHA 5JHYA 1CPFA 5CICA 1CMUA 2AS4A 1W4YA 3M2BA 2EUNA 3ZCHA 4JM5A 1GX2A 5SXWA 1H5LA 4CCPA 4FDQA 3FKGA 1BVAA 4GEDA 1CPGA 1JCIA 2AS1A 2VCSA 1AEGA 1MN2A 1BJ9A 5SYKA 2GB8A 4XV5A 4BLKA 5SYJA 1CCKA 2GGNX 1C8IA 1IYNA 1CCGA 1U74A 1QPAA 1ZBZA 4JM6A 1EBEA 1ITKA 1MKQA 1KXNA 2EUOA 2A7UB 2YLJA 1U2LA 5KQ3A 1ARUA 3FJWA 1MNPA 5SXXA 5SX0B 2Y6AA 2XILA 5ABOA 4JPLA 3VLLA 5SX1A 4H7AA 4JQJA 2ZOPA 2W23A 5L86A 1HCHA 3M5QA 3ZCGA 1DSPA 5JHXA 1JDRA 5JPRA 4PAEA 5ABNA 5SW6A 1LYKA 1H5JA 4A71A 2VNZX 3M29A 2BO5A 2XJ8A 3VLKA 5SYIA 2PCCA 1H5IA 2CEPA 1AESA 1AEHA 1AEFA 4JZAA 1BEJA 2VCNA 1PA2A 1KZMA 1CCBA 2RBYX 2X08A 2AQDA 5EJTA 1H5AA 1AEOA 5SYWA 1DCCA 4NVFA 1CCAA 3X1LF 1AEQA 1BGPA 1QGJA 1Z53A 2AS6A 7CCPA 3M25A 4ATJA 1GWOA 3VLMA 4CCXA 3M2AA 5SX3A 4GKFA 2XI6A 4QYZB 5H9FB 5SX2A 1DJ5A 4BM0A 1CCIA 4CUOA 1CYFA 1LGAA 1BEKA 3M2DA 2PCBA 5JQRA 1LYCA 1DSOA 2B10A 1ABVA 1B85A 1CMQA 3WA8A 2BCNA 2RC2X 2IA8A 1H5HA 1KOKA
chains in the Genus database with same CATH topology
1AEEA 5SW5A 1ZBYA 4NVJB 2RC1X 5FNBA 4A7MA 1H58A 1SBMA 1AETA 5FNEA 1HSRA 2EURA 2GHCX 4NVMB 1AEKA 3RRWA 3CCXA 5KSKA 4FCSA 4CVIA 1GWUA 1CCLA 5SYYA 4XV8A 5KQ6A 2CL4X 4CZRA 2XIFA 4JM9A 5KQ2A 1BEMA 2VCFX 2XJ5A 5SYVA 2CCDA 2EUTA 4NFGA 3FMUA 1OAGA 1LY9A 3M26A 1DS4A 5SXTA 5CIGA 4NVKB 2WD4A 2E3AA 4JPUA 5SX0A 3Q3UA 2EUUA 3M23A 1BEQA 4FCNA 6ATJA 2JTIA 1YYDA 5ALAA 5SYHA 2CCPA 5SYUA 1YZRA 1FHFA 1H5FA 1AEBA 2YCGA 4NVCA 4XV6A 1CCEA 4FEFA 5CIEA 1CMPA 3M2CA 2E3BA 2AS2A 4JMAA 1QO4A 4H79A 5AMMA 5SW4A 4JQKA 1CCPA 2GHDX 3M2FA 3M2HA 1ATJA 4JMZA 5CIDA 1AEVA 3VLHA 1LLPA 2E39A 1H5GA 1GWTA 3M27A 1B80A 1H5DA 3M2EA 4JMSA 5CIFA 1AA4A 2V23A 4XV4A 4BM4A 1H3JA 5SYXA 4JQNA 1AEJA 1H55A 1CCCA 4JM8A 4A5GA 2AS3A 4A78A 1GW2A 3FM1A 1ARYA 1STQA 1YYGA 1U2KA 4JB4A 1S6VA 5L05A 4BLXA 2CYPA 4JQMA 4BLYA 1GZAA 4CZPA 4CZOA 2GHKX 1S73A 3E2NA 5KQIA 2B0ZA 4NVEA 5L02A 3FM6A 1CPDA 1AEDA 1H5CA 1KRJA 3UW8A 2RC0X 3X16A 4G05A 1U2JA 5SX7A 1ARXA 4NVBA 1AEUA 1YZPA 1CK6A 5D6MA 3RIVA 1H5EA 1SDQA 5CIBA 4BLLA 1BEPA 1DSGA 3M8MA 3ZCYA 4A6ZA 5AL9A 1V0HX 1SJ2A 4JMWA 4U7UB 3WNUA 1ARPA 2RBTX 2EUSA 4BLNA 2RBWX 1MKRA 2EUPA 4NVAA 1MK8A 4XVAA 5CCPA 1SCHA 5SYLA 2ZCAA 1ARVA 4CZQA 3RIWA 5ABQA 4NVDA 6CCPA 4XV7A 1GZBA 2Y6BA 3VLJA 1W4WA 4JMTA 1KXMA 5SX6A 1BESA 2EUQA 4C50A 2RBXX 1A2FA 5KSFA 4CVJA 1RYCA 2N18A 1H5KA 4BLZA 2X07A 1ARWA 3WXOA 2RBUX 2GHHX 1B82A 2XIHA 5SXSA 1U75A 2RBZX 4NVIB 4C51A 2ICVA 2XJ6A 4NVNB 5H9EB 3HDLA 1H57A 3VLIA 5KQKA 1UB2A 5AOGA 5SXRA 3M2GA 2RBVX 4NVHB 1DJ1A 4OQ7A 3CCPA 5CJHA 3EXBA 2BOQA 1AEMA 3R99A 1ML2A 3M2IA 1APXA 1CPEA 5CIHA 1SOGA 1MN1A 2ANZA 2VKAA 1AC8A 4BM2A 4JMVA 7ATJA 3M28A 2VNXX 1OAFA 4P4QA 1A2GA 4JPTA 1CCJA 4BM1A 2VO2X 3ATJA 3FM4A 2CCAA 5EJXA 3UT2A 5JHZA 4NVOB 1AC4A 1DSEA 4JN0A 1AENA 2ATJA 1CMTA 4BM3A 4USCA 4JMBA 1LY8A 2V2EA 2GHEX 4NVLA 5SXQA 2Y5AA 5CD4J 2B11A 3E2OA 4NVGB 1H5MA 2B12A 3R98A 4CZNA 5KQ0A 5KQHA 5JHYA 1CPFA 5CICA 1CMUA 2AS4A 1W4YA 3M2BA 2EUNA 3ZCHA 4JM5A 1GX2A 5SXWA 1H5LA 4CCPA 4FDQA 3FKGA 1BVAA 4GEDA 1CPGA 1JCIA 2AS1A 2VCSA 1AEGA 1MN2A 1BJ9A 5SYKA 2GB8A 4XV5A 4BLKA 5SYJA 1CCKA 2GGNX 1C8IA 1IYNA 1CCGA 1U74A 1QPAA 1ZBZA 4JM6A 1EBEA 1ITKA 1MKQA 1KXNA 2EUOA 2YLJA 1U2LA 5KQ3A 1ARUA 3FJWA 1MNPA 5SXXA 5SX0B 2Y6AA 2XILA 5ABOA 4JPLA 3VLLA 5SX1A 4H7AA 4JQJA 2W23A 5L86A 1HCHA 3M5QA 3ZCGA 1DSPA 5JHXA 1JDRA 5JPRA 4PAEA 5ABNA 5SW6A 1LYKA 1H5JA 4A71A 2VNZX 3M29A 2XJ8A 3VLKA 5SYIA 2PCCA 1H5IA 2CEPA 1AESA 1AEHA 1AEFA 4JZAA 1BEJA 2VCNA 1PA2A 1KZMA 1CCBA 2RBYX 2X08A 2AQDA 5EJTA 1H5AA 1AEOA 5SYWA 1DCCA 4NVFA 1CCAA 1AEQA 1BGPA 1QGJA 1Z53A 2AS6A 7CCPA 3M25A 4ATJA 1GWOA 3VLMA 4CCXA 3M2AA 5SX3A 2XI6A 4QYZB 5H9FB 5SX2A 1DJ5A 4BM0A 1CCIA 4CUOA 1CYFA 1LGAA 1BEKA 3M2DA 2PCBA 5JQRA 1LYCA 1DSOA 2B10A 1B85A 1CMQA 3WA8A 2BCNA 2RC2X 2IA8A 1H5HA 1KOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AEE A;  5SW5 A;  1ZBY A;  4NVJ B;  2RC1 X;  5FNB A;  4A7M A;  1H58 A;  1SBM A;  1AET A;  5FNE A;  1HSR A;  2EUR A;  2GHC X;  4NVM B;  1AEK A;  3RRW A;  3CCX A;  5KSK A;  4FCS A;  4CVI A;  1GWU A;  1CCL A;  5SYY A;  4XV8 A;  5KQ6 A;  2CL4 X;  4CZR A;  2XIF A;  4JM9 A;  5KQ2 A;  1BEM A;  2VCF X;  2XJ5 A;  5SYV A;  2CCD A;  2EUT A;  4NFG A;  3FMU A;  1OAG A;  1LY9 A;  3M26 A;  1DS4 A;  5SXT A;  5CIG A;  4NVK B;  2WD4 A;  2E3A A;  4JPU A;  5SX0 A;  3Q3U A;  2EUU A;  3M23 A;  1BEQ A;  4FCN A;  6ATJ A;  2JTI A;  1YYD A;  5ALA A;  5SYH A;  2CCP A;  5SYU A;  1YZR A;  1FHF A;  1H5F A;  1AEB A;  2YCG A;  4NVC A;  4XV6 A;  1CCE A;  4FEF A;  5CIE A;  1CMP A;  3M2C A;  2E3B A;  2AS2 A;  4JMA A;  1QO4 A;  5AMM A;  5SW4 A;  4JQK A;  1CCP A;  2GHD X;  3M2F A;  3M2H A;  1ATJ A;  4JMZ A;  5CID A;  1AEV A;  3VLH A;  1LLP A;  2E39 A;  1H5G A;  1GWT A;  3M27 A;  1B80 A;  1H5D A;  3M2E A;  4JMS A;  5CIF A;  1AA4 A;  2V23 A;  4XV4 A;  4BM4 A;  1H3J A;  5SYX A;  4JQN A;  1AEJ A;  1H55 A;  1CCC A;  4JM8 A;  4A5G A;  2AS3 A;  4A78 A;  1GW2 A;  3FM1 A;  1ARY A;  1STQ A;  1YYG A;  1U2K A;  4JB4 A;  1S6V A;  5L05 A;  4BLX A;  2CYP A;  4JQM A;  4BLY A;  1GZA A;  4CZP A;  4CZO A;  2GHK X;  1S73 A;  3E2N A;  5KQI A;  2B0Z A;  4NVE A;  5L02 A;  3FM6 A;  1CPD A;  1AED A;  1H5C A;  1KRJ A;  3UW8 A;  2RC0 X;  3X16 A;  4G05 A;  1U2J A;  5SX7 A;  1ARX A;  4NVB A;  1AEU A;  1YZP A;  1CK6 A;  5D6M A;  3RIV A;  1H5E A;  1SDQ A;  5CIB A;  4BLL A;  1BEP A;  1DSG A;  3M8M A;  3ZCY A;  4A6Z A;  5AL9 A;  1V0H X;  1SJ2 A;  4JMW A;  3WNU A;  1ARP A;  2RBT X;  2EUS A;  4BLN A;  2RBW X;  1MKR A;  2EUP A;  4NVA A;  1MK8 A;  4XVA A;  5CCP A;  1SCH A;  5SYL A;  1ARV A;  4CZQ A;  3RIW A;  5ABQ A;  4NVD A;  6CCP A;  4XV7 A;  1GZB A;  2Y6B A;  3VLJ A;  1W4W A;  4JMT A;  1KXM A;  5SX6 A;  1BES A;  2EUQ A;  4C50 A;  2RBX X;  1A2F A;  5KSF A;  4CVJ A;  1RYC A;  2N18 A;  1H5K A;  4BLZ A;  2X07 A;  1ARW A;  3WXO A;  2RBU X;  2GHH X;  1B82 A;  2XIH A;  5SXS A;  1U75 A;  2RBZ X;  4NVI B;  4C51 A;  2ICV A;  2XJ6 A;  4NVN B;  3HDL A;  1H57 A;  3VLI A;  5KQK A;  1UB2 A;  5AOG A;  5SXR A;  3M2G A;  2RBV X;  4NVH B;  1DJ1 A;  4OQ7 A;  3CCP A;  5CJH A;  3EXB A;  2BOQ A;  1AEM A;  3R99 A;  1ML2 A;  3M2I A;  1APX A;  1CPE A;  5CIH A;  1SOG A;  1MN1 A;  2ANZ A;  2VKA A;  1AC8 A;  4BM2 A;  4JMV A;  7ATJ A;  3M28 A;  2VNX X;  1OAF A;  4P4Q A;  1A2G A;  4JPT A;  1CCJ A;  4BM1 A;  2VO2 X;  3ATJ A;  3FM4 A;  2CCA A;  5EJX A;  3UT2 A;  5JHZ A;  4NVO B;  1AC4 A;  1DSE A;  4JN0 A;  1AEN A;  2ATJ A;  1CMT A;  4BM3 A;  4USC A;  4JMB A;  1LY8 A;  2V2E A;  2GHE X;  4NVL A;  5SXQ A;  2Y5A A;  2B11 A;  3E2O A;  4NVG B;  1H5M A;  2B12 A;  3R98 A;  4CZN A;  5KQ0 A;  5KQH A;  5JHY A;  1CPF A;  5CIC A;  1CMU A;  2AS4 A;  1W4Y A;  3M2B A;  2EUN A;  3ZCH A;  4JM5 A;  1GX2 A;  5SXW A;  1H5L A;  4CCP A;  4FDQ A;  3FKG A;  1BVA A;  4GED A;  1CPG A;  1JCI A;  2AS1 A;  2VCS A;  1AEG A;  1MN2 A;  1BJ9 A;  5SYK A;  2GB8 A;  4XV5 A;  4BLK A;  5SYJ A;  1CCK A;  2GGN X;  1C8I A;  1IYN A;  1CCG A;  1U74 A;  1QPA A;  1ZBZ A;  4JM6 A;  1EBE A;  1ITK A;  1MKQ A;  1KXN A;  2EUO A;  2YLJ A;  1U2L A;  5KQ3 A;  1ARU A;  3FJW A;  1MNP A;  5SXX A;  5SX0 B;  2Y6A A;  2XIL A;  5ABO A;  4JPL A;  3VLL A;  5SX1 A;  4JQJ A;  2W23 A;  5L86 A;  1HCH A;  3M5Q A;  3ZCG A;  1DSP A;  5JHX A;  1JDR A;  5JPR A;  4PAE A;  5ABN A;  5SW6 A;  1LYK A;  1H5J A;  4A71 A;  2VNZ X;  3M29 A;  2XJ8 A;  3VLK A;  5SYI A;  2PCC A;  1H5I A;  2CEP A;  1AES A;  1AEH A;  1AEF A;  1BEJ A;  2VCN A;  1PA2 A;  1KZM A;  1CCB A;  2RBY X;  2X08 A;  2AQD A;  5EJT A;  1H5A A;  1AEO A;  5SYW A;  1DCC A;  4NVF A;  1CCA A;  1AEQ A;  1BGP A;  1QGJ A;  1Z53 A;  2AS6 A;  7CCP A;  3M25 A;  4ATJ A;  1GWO A;  3VLM A;  4CCX A;  3M2A A;  5SX3 A;  2XI6 A;  5SX2 A;  1DJ5 A;  4BM0 A;  1CCI A;  4CUO A;  1CYF A;  1LGA A;  1BEK A;  3M2D A;  2PCB A;  5JQR A;  1LYC A;  1DSO A;  2B10 A;  1B85 A;  1CMQ A;  2BCN A;  2RC2 X;  2IA8 A;  1H5H A;  1KOK A; 
#chains in the Genus database with same CATH topology
 1AEE A;  5SW5 A;  1ZBY A;  4NVJ B;  2RC1 X;  5FNB A;  4A7M A;  1H58 A;  1SBM A;  1AET A;  5FNE A;  1HSR A;  2EUR A;  2GHC X;  4NVM B;  1AEK A;  3RRW A;  3CCX A;  5KSK A;  4FCS A;  4CVI A;  1GWU A;  1CCL A;  5SYY A;  4XV8 A;  5KQ6 A;  2CL4 X;  4CZR A;  2XIF A;  4JM9 A;  5KQ2 A;  1BEM A;  2VCF X;  2XJ5 A;  5SYV A;  2CCD A;  2EUT A;  4NFG A;  3FMU A;  1OAG A;  1LY9 A;  3M26 A;  1DS4 A;  5SXT A;  5CIG A;  4NVK B;  2WD4 A;  2E3A A;  4JPU A;  5SX0 A;  3Q3U A;  2EUU A;  3M23 A;  1BEQ A;  4FCN A;  6ATJ A;  2JTI A;  1YYD A;  5ALA A;  5SYH A;  2CCP A;  5SYU A;  1YZR A;  1FHF A;  1H5F A;  1AEB A;  2YCG A;  4NVC A;  4XV6 A;  1CCE A;  4FEF A;  5CIE A;  1CMP A;  3M2C A;  2E3B A;  2AS2 A;  4JMA A;  1QO4 A;  4H79 A;  5AMM A;  5SW4 A;  4JQK A;  1CCP A;  2GHD X;  3M2F A;  3M2H A;  1ATJ A;  4JMZ A;  5CID A;  1AEV A;  3VLH A;  1LLP A;  2E39 A;  1H5G A;  1GWT A;  3M27 A;  1B80 A;  1H5D A;  3M2E A;  4JMS A;  5CIF A;  1AA4 A;  2V23 A;  4XV4 A;  4BM4 A;  1H3J A;  5SYX A;  4JQN A;  1AEJ A;  1H55 A;  1CCC A;  4JM8 A;  4A5G A;  2AS3 A;  4A78 A;  1GW2 A;  3FM1 A;  1ARY A;  1STQ A;  1YYG A;  1U2K A;  4JB4 A;  1S6V A;  5L05 A;  4BLX A;  2CYP A;  4JQM A;  4BLY A;  1GZA A;  4CZP A;  4CZO A;  2GHK X;  1S73 A;  3E2N A;  5KQI A;  2B0Z A;  4NVE A;  5L02 A;  3FM6 A;  1CPD A;  1AED A;  1H5C A;  1KRJ A;  3UW8 A;  2RC0 X;  2JMX A;  3X16 A;  4G05 A;  1U2J A;  5SX7 A;  1ARX A;  4NVB A;  1AEU A;  1YZP A;  1CK6 A;  5D6M A;  3RIV A;  1H5E A;  1SDQ A;  5CIB A;  4BLL A;  1BEP A;  1DSG A;  3M8M A;  3ZCY A;  4A6Z A;  5AL9 A;  1V0H X;  1SJ2 A;  4JMW A;  4U7U B;  3WNU A;  1ARP A;  2RBT X;  2EUS A;  4BLN A;  2RBW X;  1MKR A;  2EUP A;  4NVA A;  1MK8 A;  4XVA A;  5CCP A;  1SCH A;  5SYL A;  2ZCA A;  1ARV A;  2WSS S;  4CZQ A;  3RIW A;  5ABQ A;  4NVD A;  6CCP A;  4XV7 A;  1GZB A;  2Y6B A;  3VLJ A;  1W4W A;  4JMT A;  1KXM A;  5SX6 A;  1BES A;  2EUQ A;  4C50 A;  2RBX X;  1A2F A;  5KSF A;  4CVJ A;  1RYC A;  2N18 A;  1H5K A;  4BLZ A;  2X07 A;  1ARW A;  3WXO A;  2RBU X;  2GHH X;  1B82 A;  2XIH A;  5SXS A;  1U75 A;  2RBZ X;  4NVI B;  4C51 A;  2ICV A;  2XJ6 A;  4NVN B;  5H9E B;  3HDL A;  1H57 A;  3VLI A;  5KQK A;  1UB2 A;  5AOG A;  5SXR A;  3M2G A;  2RBV X;  4NVH B;  1DJ1 A;  4OQ7 A;  3CCP A;  5CJH A;  3EXB A;  2BOQ A;  1AEM A;  3R99 A;  1ML2 A;  3M2I A;  1APX A;  1CPE A;  5CIH A;  1SOG A;  1MN1 A;  2ANZ A;  2VKA A;  2OEB A;  1AC8 A;  4BM2 A;  4JMV A;  7ATJ A;  3M28 A;  2VNX X;  1OAF A;  4P4Q A;  1A2G A;  4JPT A;  1CCJ A;  4BM1 A;  2VO2 X;  3ATJ A;  3FM4 A;  2CCA A;  5EJX A;  3UT2 A;  5JHZ A;  4NVO B;  1AC4 A;  1DSE A;  4JN0 A;  1AEN A;  2ATJ A;  1CMT A;  4BM3 A;  4USC A;  4JMB A;  1LY8 A;  2V2E A;  2GHE X;  4NVL A;  5SXQ A;  2Y5A A;  5CD4 J;  2B11 A;  3E2O A;  4NVG B;  1H5M A;  2B12 A;  3R98 A;  4CZN A;  5KQ0 A;  5KQH A;  5JHY A;  1CPF A;  5CIC A;  1CMU A;  2AS4 A;  1W4Y A;  3M2B A;  2EUN A;  3ZCH A;  4JM5 A;  1GX2 A;  5SXW A;  1H5L A;  4CCP A;  4FDQ A;  3FKG A;  1BVA A;  4GED A;  1CPG A;  1JCI A;  2AS1 A;  2VCS A;  1AEG A;  1MN2 A;  1BJ9 A;  5SYK A;  2GB8 A;  4XV5 A;  4BLK A;  5SYJ A;  1CCK A;  2GGN X;  1C8I A;  1IYN A;  1CCG A;  1U74 A;  1QPA A;  1ZBZ A;  4JM6 A;  1EBE A;  1ITK A;  1MKQ A;  1KXN A;  2EUO A;  2A7U B;  2YLJ A;  1U2L A;  5KQ3 A;  1ARU A;  3FJW A;  1MNP A;  5SXX A;  5SX0 B;  2Y6A A;  2XIL A;  5ABO A;  4JPL A;  3VLL A;  5SX1 A;  4H7A A;  4JQJ A;  2ZOP A;  2W23 A;  5L86 A;  1HCH A;  3M5Q A;  3ZCG A;  1DSP A;  5JHX A;  1JDR A;  5JPR A;  4PAE A;  5ABN A;  5SW6 A;  1LYK A;  1H5J A;  4A71 A;  2VNZ X;  3M29 A;  2BO5 A;  2XJ8 A;  3VLK A;  5SYI A;  2PCC A;  1H5I A;  2CEP A;  1AES A;  1AEH A;  1AEF A;  4JZA A;  1BEJ A;  2VCN A;  1PA2 A;  1KZM A;  1CCB A;  2RBY X;  2X08 A;  2AQD A;  5EJT A;  1H5A A;  1AEO A;  5SYW A;  1DCC A;  4NVF A;  1CCA A;  3X1L F;  1AEQ A;  1BGP A;  1QGJ A;  1Z53 A;  2AS6 A;  7CCP A;  3M25 A;  4ATJ A;  1GWO A;  3VLM A;  4CCX A;  3M2A A;  5SX3 A;  4GKF A;  2XI6 A;  4QYZ B;  5H9F B;  5SX2 A;  1DJ5 A;  4BM0 A;  1CCI A;  4CUO A;  1CYF A;  1LGA A;  1BEK A;  3M2D A;  2PCB A;  5JQR A;  1LYC A;  1DSO A;  2B10 A;  1ABV A;  1B85 A;  1CMQ A;  3WA8 A;  2BCN A;  2RC2 X;  2IA8 A;  1H5H A;  1KOK A; 
#chains in the Genus database with same CATH homology
 1AEE A;  5SW5 A;  1ZBY A;  4NVJ B;  2RC1 X;  5FNB A;  4A7M A;  1H58 A;  1SBM A;  1AET A;  5FNE A;  1HSR A;  2EUR A;  2GHC X;  4NVM B;  1AEK A;  3RRW A;  3CCX A;  5KSK A;  4FCS A;  4CVI A;  1GWU A;  1CCL A;  5SYY A;  4XV8 A;  5KQ6 A;  2CL4 X;  4CZR A;  2XIF A;  4JM9 A;  5KQ2 A;  1BEM A;  2VCF X;  2XJ5 A;  5SYV A;  2CCD A;  2EUT A;  4NFG A;  3FMU A;  1OAG A;  1LY9 A;  3M26 A;  1DS4 A;  5SXT A;  5CIG A;  4NVK B;  2WD4 A;  2E3A A;  4JPU A;  5SX0 A;  3Q3U A;  2EUU A;  3M23 A;  1BEQ A;  4FCN A;  6ATJ A;  2JTI A;  1YYD A;  5ALA A;  5SYH A;  2CCP A;  5SYU A;  1YZR A;  1FHF A;  1H5F A;  1AEB A;  2YCG A;  4NVC A;  4XV6 A;  1CCE A;  4FEF A;  5CIE A;  1CMP A;  3M2C A;  2E3B A;  2AS2 A;  4JMA A;  1QO4 A;  4H79 A;  5AMM A;  5SW4 A;  4JQK A;  1CCP A;  2GHD X;  3M2F A;  3M2H A;  1ATJ A;  4JMZ A;  5CID A;  1AEV A;  3VLH A;  1LLP A;  2E39 A;  1H5G A;  1GWT A;  3M27 A;  1B80 A;  1H5D A;  3M2E A;  4JMS A;  5CIF A;  1AA4 A;  2V23 A;  4XV4 A;  4BM4 A;  1H3J A;  5SYX A;  4JQN A;  1AEJ A;  1H55 A;  1CCC A;  4JM8 A;  4A5G A;  2AS3 A;  4A78 A;  1GW2 A;  3FM1 A;  1ARY A;  1STQ A;  1YYG A;  1U2K A;  4JB4 A;  1S6V A;  5L05 A;  4BLX A;  2CYP A;  4JQM A;  4BLY A;  1GZA A;  4CZP A;  4CZO A;  2GHK X;  1S73 A;  3E2N A;  5KQI A;  2B0Z A;  4NVE A;  5L02 A;  3FM6 A;  1CPD A;  1AED A;  1H5C A;  1KRJ A;  3UW8 A;  2RC0 X;  3X16 A;  4G05 A;  1U2J A;  5SX7 A;  1ARX A;  4NVB A;  1AEU A;  1YZP A;  1CK6 A;  5D6M A;  3RIV A;  1H5E A;  1SDQ A;  5CIB A;  4BLL A;  1BEP A;  1DSG A;  3M8M A;  3ZCY A;  4A6Z A;  5AL9 A;  1V0H X;  1SJ2 A;  4JMW A;  4U7U B;  3WNU A;  1ARP A;  2RBT X;  2EUS A;  4BLN A;  2RBW X;  1MKR A;  2EUP A;  4NVA A;  1MK8 A;  4XVA A;  5CCP A;  1SCH A;  5SYL A;  2ZCA A;  1ARV A;  4CZQ A;  3RIW A;  5ABQ A;  4NVD A;  6CCP A;  4XV7 A;  1GZB A;  2Y6B A;  3VLJ A;  1W4W A;  4JMT A;  1KXM A;  5SX6 A;  1BES A;  2EUQ A;  4C50 A;  2RBX X;  1A2F A;  5KSF A;  4CVJ A;  1RYC A;  2N18 A;  1H5K A;  4BLZ A;  2X07 A;  1ARW A;  3WXO A;  2RBU X;  2GHH X;  1B82 A;  2XIH A;  5SXS A;  1U75 A;  2RBZ X;  4NVI B;  4C51 A;  2ICV A;  2XJ6 A;  4NVN B;  5H9E B;  3HDL A;  1H57 A;  3VLI A;  5KQK A;  1UB2 A;  5AOG A;  5SXR A;  3M2G A;  2RBV X;  4NVH B;  1DJ1 A;  4OQ7 A;  3CCP A;  5CJH A;  3EXB A;  2BOQ A;  1AEM A;  3R99 A;  1ML2 A;  3M2I A;  1APX A;  1CPE A;  5CIH A;  1SOG A;  1MN1 A;  2ANZ A;  2VKA A;  1AC8 A;  4BM2 A;  4JMV A;  7ATJ A;  3M28 A;  2VNX X;  1OAF A;  4P4Q A;  1A2G A;  4JPT A;  1CCJ A;  4BM1 A;  2VO2 X;  3ATJ A;  3FM4 A;  2CCA A;  5EJX A;  3UT2 A;  5JHZ A;  4NVO B;  1AC4 A;  1DSE A;  4JN0 A;  1AEN A;  2ATJ A;  1CMT A;  4BM3 A;  4USC A;  4JMB A;  1LY8 A;  2V2E A;  2GHE X;  4NVL A;  5SXQ A;  2Y5A A;  5CD4 J;  2B11 A;  3E2O A;  4NVG B;  1H5M A;  2B12 A;  3R98 A;  4CZN A;  5KQ0 A;  5KQH A;  5JHY A;  1CPF A;  5CIC A;  1CMU A;  2AS4 A;  1W4Y A;  3M2B A;  2EUN A;  3ZCH A;  4JM5 A;  1GX2 A;  5SXW A;  1H5L A;  4CCP A;  4FDQ A;  3FKG A;  1BVA A;  4GED A;  1CPG A;  1JCI A;  2AS1 A;  2VCS A;  1AEG A;  1MN2 A;  1BJ9 A;  5SYK A;  2GB8 A;  4XV5 A;  4BLK A;  5SYJ A;  1CCK A;  2GGN X;  1C8I A;  1IYN A;  1CCG A;  1U74 A;  1QPA A;  1ZBZ A;  4JM6 A;  1EBE A;  1ITK A;  1MKQ A;  1KXN A;  2EUO A;  2YLJ A;  1U2L A;  5KQ3 A;  1ARU A;  3FJW A;  1MNP A;  5SXX A;  5SX0 B;  2Y6A A;  2XIL A;  5ABO A;  4JPL A;  3VLL A;  5SX1 A;  4H7A A;  4JQJ A;  2W23 A;  5L86 A;  1HCH A;  3M5Q A;  3ZCG A;  1DSP A;  5JHX A;  1JDR A;  5JPR A;  4PAE A;  5ABN A;  5SW6 A;  1LYK A;  1H5J A;  4A71 A;  2VNZ X;  3M29 A;  2XJ8 A;  3VLK A;  5SYI A;  2PCC A;  1H5I A;  2CEP A;  1AES A;  1AEH A;  1AEF A;  4JZA A;  1BEJ A;  2VCN A;  1PA2 A;  1KZM A;  1CCB A;  2RBY X;  2X08 A;  2AQD A;  5EJT A;  1H5A A;  1AEO A;  5SYW A;  1DCC A;  4NVF A;  1CCA A;  1AEQ A;  1BGP A;  1QGJ A;  1Z53 A;  2AS6 A;  7CCP A;  3M25 A;  4ATJ A;  1GWO A;  3VLM A;  4CCX A;  3M2A A;  5SX3 A;  2XI6 A;  4QYZ B;  5H9F B;  5SX2 A;  1DJ5 A;  4BM0 A;  1CCI A;  4CUO A;  1CYF A;  1LGA A;  1BEK A;  3M2D A;  2PCB A;  5JQR A;  1LYC A;  1DSO A;  2B10 A;  1B85 A;  1CMQ A;  3WA8 A;  2BCN A;  2RC2 X;  2IA8 A;  1H5H A;  1KOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...